5G4UC

Association of three two-k-turn units based on kt-7 3bu,3nu, forming a triangular-shaped structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
EASYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna/protein
molecule keywords HMKT-7
publication title A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 36
structure length 120
sequence length 120
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5g4uC00
3LFOA 1H7MA 3OBYA 2QA4F 2HVYD 1GZ0A 1RLGA 5IT9M 3CCVF 3CC7F 2KTVA 1KC8H 3CCQF 3HAXD 3NVIB 5FJ4C 3NVKE 1W42A 3SIVA 1YJNF 3NMUC 3IR9A 1W2BF 5DCVA 3V7QA 3CD6F 2KG4A 3HJWC 2WALA 3N4YA 3CCLF 1YHQF 1VQPF 1YJ9F 5G4VC 4BW0B 3CCUF 1W41A 1X7PA 1VQ6F 3AGKA 3LWOC 1VQKF 3V7EA 1M1KH 3VMFB 1VQ9F 3OW2F 5GIPC 3I56F 1QVFF 1K8AH 3CG6A 3I55F 3J81M 3E1YA 1JJ2F 3SIUA 5EWRA 3LWQC 5GAPK 5A2QM 1VQNF 1Q81H 2FC3A 3CXCF 1YIJF 3CMEF 1SDSA 2ALEA 2QEXF 1Q86H 1DT9A 1YJWF 3CCSF 3ON1A 3JAMM 4C4WC 2OTLF 2BO1A 3CMAF 3CCEF 1VQ5F 1NMUB 1W40A 3NK6A 4TZZA 3J80M 1X52A 2OHWA 2QI2A 1VQ7F 1VQLF 1CK2A 1GO1A 4NUTA 1IPAA 2OTJF 4X3MA 2JNBA 1W3EX 3O85A 3RA6A 3MCAB 3CCMF 2VGNA 1XBIA 5EO3A 3NK7A 1GO0A 5GINC 5GANK 3E20B 1E7KA 1YI2F 3N4ZA 4BY9D 3CC4F 3G71F 1K9MH 1M90H 2CZWA 3VI6A 3LWRC 5G4UC 4X3LA 1S72F 1YITF 3PLAC 1CN7A 1NJIH 3LWVC 3PAFA 3CCRF 3FFMA 1KQSF 1RA4A 3OBWA 2LBWA 3GYQA 1N8RH 5GIOC 1VQ4F 2KTUA 3G4SF 3LWPC 3CPQA 4LCKA 2AIFA 2I6DA 1ZWZA 1QVGF 1K73H 1VQOF 3CC2F 1PXWA 1KD1H 2OZBA 1T0KB 3J7AR 1VQ8F 3CCJF 3RA5A 1VQMF 1Q82H 2LBXA 3JCMM 3CPWF 5FLXM 2VGMA 3G6EF 3WXMB 1Q7YH 1X7OA
chains in the Genus database with same CATH superfamily
5MN6A 1H47A 4B62A 2ZF8A 5BMVB 1KC8H 3WGLA 3NVIB 4BVTA 2H8CA 3K2XA 3QTYA 3IR9A 3EORA 3HKBA 3DDNA 5DCVA 2HS0A 1XV2A 2KG4A 4ZHYB 3HJWC 4B46A 2CW4A 1YHQF 1YJ9F 5LOVA 5G4VC 4BW0B 3CCUF 3RYHA 3M84A 3LWOC 1VQKF 3V7EA 4TV8B 1M1KH 5MN4A 5FNVA 1TVKA 3I3FA 3HKCB 3I55F 3J81M 3C8LA 3V3TA 1ODEA 5EWRA 2HS4A 1W59A 2Z1TA 1VQNF 1YIJF 1SDSA 3CMEF 1FNKA 3F0DA 4ZOLA 1UI9A 4I50B 2MQEA 4R40B 4ZHQB 3RYIB 4C4WC 2OTMA 2UZHA 2ZVZA 3U0OA 3CMAF 4YJ2B 4ZI7B 2H8EA 1W40A 4TZZA 2Q1YA 2QI2A 1CK2A 1JFFB 5ITZB 1IPAA 4BT7A 3K14A 1W3EX 3CCMF 1W5EA 4O2AA 3L7QA 5C8YB 3JARB 2HP3A 3ZP4A 2AMTA 1GO0A 2GZLA 5BMVA 5GANK 3LMEA 3S0HA 3G71F 2AIZP 4M8IA 5HXZA 4RQOA 1U3LA 4RHAA 3E22B 1YITF 3QUWA 1W5AA 3FPIA 2ZAUA 3LWVC 2UYJA 3HKBB 3PAFA 2UYNB 3GTZA 1PF5A 4TV8A 4EI9A 1QD9A 3B6NA 4LNUB 2Z1EA 2AIFA 4C8GA 3HKCA 2I6DA 5CA0B 1T0AA 2K1SA 4BVSA 1VQOF 1PXWA 2CVLA 3FD5A 3N2KB 3WJPA 4BVRA 5FNVB 1DBFA 2OZBA 1VQ8F 5EYPB 1Q82H 1UFYA 2LBXA 4I50A 3T80A 4G4ZA 1RLUA 4ZHQA 3RYIA 5LYJB 5IJ0B 2IQQA 4KWEA 3LFOA 3OBYA 4YJ2A 2HVYD 3C9UA 3IEWA 4ZI7A 5HXUA 3CC7F 2PMPA 5FJ4C 2LCAA 3HKDB 3NMUC 1RQ2A 3C9RA 1JFFA 5ITZA 4TUYB 3WPWA 1W2BF 3FD6A 3CD6F 2HRUA 3KHNA 1OFUA 4DRXB 4FFBB 3C9SA 5C8YA 3JARA 5J2TB 1VQ6F 3TD5A 3VMFB 1VQ9F 3OW2F 1IV1A 1Z5WA 3UT5B 5J2UA 3I56F 1QVFF 2L26A 4I4TB 2Z1UA 3F6MA 3IKFA 5JCOA 3E22A 2HRYA 3S0WA 3BYQA 3KE1A 5CA1B 5JH7A 2ALEA 2UYNA 3ON1A 3VYSC 1NQ3A 2OTLF 2GLZA 2W8BC 2VAWA 4LNUA 3NK6A 2R751 3ESJA 5KMGB 3ZO8A 1VQLF 5CA0A 3V4DA 4G4WA 3N2KA 2RHLA 3KIZA 3MDOA 5EYPA 3O85A 5JVDB 2UYPA 3MBMA 3MCAB 2DYYA 5JCOC 4HNAB 5KX5B 5LXTB 5LYJA 3JAWB 4C81A 4U39A 5IJ0A 5HWEA 4ZHWA 5EIBD 3F0FA 2EWCA 1VHAA 2R6R1 1U43A 3F0GA 3E20B 3MCQA 2ZODA 1E7KA 3P4EA 3HKDA 1YI2F 3HKEB 2CZWA 4TUYA 5G4UC 3VO8A 3PLAC 4ZHVA 5EB0A 4BT3A 4DRXA 1NJIH 4FFBA 3CB2A 2ZVYA 5J2TA 1RQ7A 3CCRF 2H6LA 1U40A 2LBWA 3GYQA 1VQ4F 3LWPC 3UT5A 3JALB 2IG8A 5HP7A 4I4TA 1K73H 3CC2F 3M4SA 1GX1A 3S03A 3D54A 4O4IB 5J2UB 3RA5A 1VQMF 5CA1A 3LYBA 5FLXM 2VGMA 2LBTA 1W5BA 1X7OA 2QA4F 1GZ0A 1RLGA 5JH7B 5CB4B 3CCVF 3VYTC 3CCQF 2HX0A 4X20B 5KMGA 1SA0B 1W42A 3NVKE 3S0YA 1YJNF 4X1IB 2V9YA 4EI7A 3IMPA 5JVDA 3RYCB 2WALA 2VAMA 1VQVA 2FGYA 3N4YA 3CCLF 2PHNA 2VAPA 5IYZA 4HNAA 3KJKA 5KX5A 3ZOPA 5LXTA 3M1XA 3JAWA 5EB1B 4IHJB 3N2GB 3RYFA 2HS3A 4TV9B 1ONIA 4F6RB 4ZK7A 3P10A 3HKEA 3CYQA 5JQGB 3CG6A 4G4XA 5EIBC 3E1YA 1JJ2F 3D00A 2B33A 5GAPK 2YXZA 3KJJA 5A2QM 1QU9A 1Q81H 3CXCF 4I55B 3I7TA 3WGMA 5B8FA 1Q86H 1DT9A 1YJWF 3K12A 4NQ3A 2BO1A 5IJ9B 3HTNA 4BT6A 1FNJA 1JN1A 5MN5A 1NMUB 3JALA 2N48A 1U3PA 1W5FA 2HQSC 3VTIC 2OHWA 3J80M 1VQ7F 4NUTA 1IV4A 2OTJF 3VOAA 4X3MA 3WGNA 4O4IA 3RA6A 3TD3A 2YYEA 2CSLA 2HP0B 4O4HB 2RHOA 3RE3A 2RHJA 4YJ3A 3S02A 3WGJA 5CB4A 1VK3A 5LA6B 1KNJA 1SZQA 4X20A 1SA0A 4X1KB 3K0TA 3CC4F 4BVQA 4X1IA 3GHZA 3JATB 4G4VA 5HP8A 4BT2A 4XCQA 5GONB 4IIJB 1Q8RA 3RYCA 4U3JB 3VCZA 2BTOA 1VH8A 2DT4A 3OONA 3F0EA 1XHOA 4IHJA 3FFMA 1KQSF 3N2GA 4G4YA 1RA4A 4O4LB 4WBNB 1CLIA 3OBWA 3MQWA 4TV9A 4F6RA 5IYZB 5GIOC 4EI8A 3CPQA 3ELCA 3R0PA 3JAKB 5JQGA 4BT5A 1FSZA 3CYPB 3RYFB 1KD1H 4NWOB 1IV2A 2VXYA 3J7AR 1W57A 4B45A 1TUBB 4I55A 3CPWF 2Z1FA 1YQNA 2IAFA 4X1YA 5EZYB 3G6EF 4O2BB 3WXMB 4G88A 5IJ9A 1H7MA 5IT9M 4EB6B 2KTVA 3HAXD 2G9IA 1QAHA 4PWTA 2Z01A 2RB9A 3SIVA 3QHDA 5HY0A 2UYKA 5LP6B 3V7QA 3WGKA 3FBAA 3ZP7A 1VQPF 2CHSA 1KNKA 1W41A 1X7PA 2HP0A 4O4HA 3AGKA 5LA6A 1FFXB 5GIPC 4X1KA 3WJQA 1K8AH 3JATA 4YJ3B 3SIUA 5GONA 3S06A 5HY2A 4C8IA 4IIJA 3LWQC 4U3JA 3C9TA 2GVIA 2FC3A 4O4JB 2QEXF 1J7HA 3CCSF 3JAMM 2ZOVA 3JASB 1OAPA 4O4LA 4WBNA 3CCEF 1VQ5F 1IV3A 3DC2A 1H48A 2QTPA 3JAKA 1X52A 3HWUA 1JD1A 1GO1A 3WPXA 2JNBA 3JVHA 5EAZA 2CHTA 1TUBA 4B5CA 4C82A 2F9ZC 2KGWA 5LOVB 5EZYA 5AVMA 4O2BA 3RYHB 1X25A 2VGNA 1XBIA 5EO3A 3IEQA 1R1MA 3NK7A 4EB6A 1YGYA 5HY1A 5GINC 4X1YB 1COMA 3LDTA 3N4ZA 1TVKB 1W581 3ERNA 1K9MH 1M90H 4BY9D 3VI6A 5LP6A 3LWRC 4X3LA 1S72F 1Z5VA 1CN7A 3VYUC 4ZOLB 1JY8A 5HY4A 2I6RA 3Q8HA 4DXDA 1N8RH 1FFXA 3P0ZA 2KTUA 3G4SF 4E6EA 4LCKA 4C8EA 4ERHA 3WJRA 1ZWZA 1QVGF 2CWJA 3IKEA 2BTUA 2Q1XA 3TD4A 3VOBA 2BTQB 1T0KB 3VIUA 3D01A 3CCJF 2NMUA 2RHHA 3JCMM 4BT4A 4O4JA 1W55A 5LP6C 1XRGA 4O2AB 1Q7YH 2P6YA 3JASA
chains in the Genus database with same CATH topology
3LFOA 1H7MA 3OBYA 2QA4F 2HVYD 1GZ0A 1RLGA 5IT9M 5HXUA 3CCVF 3CC7F 2KTVA 1KC8H 3CCQF 3HAXD 3NVIB 4BVTA 5FJ4C 3NVKE 1W42A 3SIVA 1YJNF 5HY0A 3NMUC 3IR9A 4EI7A 1W2BF 5DCVA 3V7QA 3CD6F 2KG4A 3HJWC 2WALA 3N4YA 2FGYA 3CCLF 1YHQF 1VQPF 1YJ9F 5G4VC 4BW0B 3CCUF 1W41A 1X7PA 1VQ6F 3AGKA 3LWOC 1VQKF 3V7EA 1M1KH 3VMFB 1VQ9F 3OW2F 5GIPC 3I56F 1QVFF 1K8AH 3CG6A 3I55F 3J81M 3E1YA 3V3TA 1JJ2F 3SIUA 3D00A 5EWRA 5HY2A 3LWQC 5GAPK 5A2QM 1VQNF 1Q81H 2FC3A 3CXCF 1YIJF 3CMEF 1SDSA 2ALEA 2QEXF 1Q86H 1DT9A 1YJWF 3CCSF 3ON1A 3JAMM 4C4WC 4NQ3A 2BO1A 2OTLF 3CMAF 3CCEF 1VQ5F 2GLZA 1NMUB 1W40A 3NK6A 4TZZA 3J80M 1X52A 2OHWA 2QI2A 1VQ7F 1VQLF 1CK2A 1GO1A 4NUTA 1IPAA 2OTJF 4X3MA 2JNBA 1W3EX 3O85A 3RA6A 3MCAB 2F9ZC 3CCMF 2VGNA 1XBIA 5EO3A 5HWEA 3NK7A 1GO0A 5HY1A 5GINC 5GANK 3E20B 1E7KA 1YI2F 3N4ZA 4BY9D 3CC4F 4BVQA 3G71F 1K9MH 2CZWA 1M90H 3VI6A 5HXZA 3LWRC 5G4UC 4XCQA 4X3LA 1S72F 1YITF 3PLAC 1CN7A 1NJIH 3LWVC 3PAFA 3CCRF 3FFMA 1KQSF 1RA4A 5HY4A 3OBWA 2LBWA 3GYQA 4EI9A 1N8RH 5GIOC 4EI8A 2KTUA 3G4SF 1VQ4F 3LWPC 3CPQA 4LCKA 2AIFA 2I6DA 1ZWZA 1QVGF 4BVSA 1VQOF 1K73H 3CC2F 1PXWA 4BVRA 1KD1H 2OZBA 1T0KB 3J7AR 1VQ8F 3CCJF 3RA5A 1VQMF 1Q82H 2LBXA 3JCMM 3CPWF 5FLXM 2VGMA 3G6EF 3WXMB 1Q7YH 1X7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFO A;  1H7M A;  3OBY A;  2QA4 F;  2HVY D;  1GZ0 A;  1RLG A;  5IT9 M;  3CCV F;  3CC7 F;  2KTV A;  1KC8 H;  3CCQ F;  3HAX D;  3NVI B;  5FJ4 C;  3NVK E;  1W42 A;  3SIV A;  1YJN F;  3NMU C;  3IR9 A;  1W2B F;  5DCV A;  3V7Q A;  3CD6 F;  2KG4 A;  3HJW C;  2WAL A;  3N4Y A;  3CCL F;  1YHQ F;  1VQP F;  1YJ9 F;  5G4V C;  4BW0 B;  3CCU F;  1W41 A;  1X7P A;  1VQ6 F;  3AGK A;  3LWO C;  1VQK F;  3V7E A;  1M1K H;  3VMF B;  1VQ9 F;  3OW2 F;  5GIP C;  3I56 F;  1QVF F;  1K8A H;  3CG6 A;  3I55 F;  3J81 M;  3E1Y A;  1JJ2 F;  3SIU A;  5EWR A;  3LWQ C;  5GAP K;  5A2Q M;  1VQN F;  1Q81 H;  2FC3 A;  3CXC F;  1YIJ F;  3CME F;  1SDS A;  2ALE A;  2QEX F;  1Q86 H;  1DT9 A;  1YJW F;  3CCS F;  3ON1 A;  3JAM M;  4C4W C;  2OTL F;  2BO1 A;  3CMA F;  3CCE F;  1VQ5 F;  1NMU B;  1W40 A;  3NK6 A;  4TZZ A;  3J80 M;  1X52 A;  2OHW A;  2QI2 A;  1VQ7 F;  1VQL F;  1CK2 A;  1GO1 A;  4NUT A;  1IPA A;  2OTJ F;  4X3M A;  2JNB A;  1W3E X;  3O85 A;  3RA6 A;  3MCA B;  3CCM F;  2VGN A;  1XBI A;  5EO3 A;  3NK7 A;  1GO0 A;  5GIN C;  5GAN K;  3E20 B;  1E7K A;  1YI2 F;  3N4Z A;  4BY9 D;  3CC4 F;  3G71 F;  1K9M H;  1M90 H;  2CZW A;  3VI6 A;  3LWR C;  5G4U C;  4X3L A;  1S72 F;  1YIT F;  3PLA C;  1CN7 A;  1NJI H;  3LWV C;  3PAF A;  3CCR F;  3FFM A;  1KQS F;  1RA4 A;  3OBW A;  2LBW A;  3GYQ A;  1N8R H;  5GIO C;  1VQ4 F;  2KTU A;  3G4S F;  3LWP C;  3CPQ A;  4LCK A;  2AIF A;  2I6D A;  1ZWZ A;  1QVG F;  1K73 H;  1VQO F;  3CC2 F;  1PXW A;  1KD1 H;  2OZB A;  1T0K B;  3J7A R;  1VQ8 F;  3CCJ F;  3RA5 A;  1VQM F;  1Q82 H;  2LBX A;  3JCM M;  3CPW F;  5FLX M;  2VGM A;  3G6E F;  3WXM B;  1Q7Y H;  1X7O A; 
#chains in the Genus database with same CATH topology
 5MN6 A;  1H47 A;  4B62 A;  2ZF8 A;  5BMV B;  1KC8 H;  3WGL A;  3NVI B;  4BVT A;  2H8C A;  3K2X A;  3QTY A;  3IR9 A;  3EOR A;  3HKB A;  3DDN A;  5DCV A;  2HS0 A;  1XV2 A;  2KG4 A;  4ZHY B;  3HJW C;  4B46 A;  2CW4 A;  1YHQ F;  1YJ9 F;  5LOV A;  5G4V C;  4BW0 B;  3CCU F;  3RYH A;  3M84 A;  3LWO C;  1VQK F;  3V7E A;  4TV8 B;  1M1K H;  5MN4 A;  5FNV A;  1TVK A;  3I3F A;  3HKC B;  3I55 F;  3J81 M;  3C8L A;  3V3T A;  1ODE A;  5EWR A;  2HS4 A;  1W59 A;  2Z1T A;  1VQN F;  1YIJ F;  1SDS A;  3CME F;  1FNK A;  3F0D A;  4ZOL A;  1UI9 A;  4I50 B;  2MQE A;  4R40 B;  4ZHQ B;  3RYI B;  4C4W C;  2OTM A;  2UZH A;  2ZVZ A;  3U0O A;  3CMA F;  4YJ2 B;  4ZI7 B;  2H8E A;  1W40 A;  4TZZ A;  2Q1Y A;  2QI2 A;  1CK2 A;  1JFF B;  5ITZ B;  1IPA A;  4BT7 A;  3K14 A;  1W3E X;  3CCM F;  1W5E A;  4O2A A;  3L7Q A;  5C8Y B;  3JAR B;  2HP3 A;  3ZP4 A;  2AMT A;  1GO0 A;  2GZL A;  5BMV A;  5GAN K;  3LME A;  3S0H A;  3G71 F;  2AIZ P;  4M8I A;  5HXZ A;  4RQO A;  1U3L A;  4RHA A;  3E22 B;  1YIT F;  3QUW A;  1W5A A;  3FPI A;  2ZAU A;  3LWV C;  2UYJ A;  3HKB B;  3PAF A;  2UYN B;  3GTZ A;  1PF5 A;  4TV8 A;  4EI9 A;  1QD9 A;  3B6N A;  4LNU B;  2Z1E A;  2AIF A;  4C8G A;  3HKC A;  2I6D A;  5CA0 B;  1T0A A;  2K1S A;  4BVS A;  1VQO F;  1PXW A;  2CVL A;  3FD5 A;  3N2K B;  3WJP A;  4BVR A;  5FNV B;  1DBF A;  2OZB A;  1VQ8 F;  5EYP B;  1Q82 H;  1UFY A;  2LBX A;  4I50 A;  3T80 A;  4G4Z A;  1RLU A;  4ZHQ A;  3RYI A;  5LYJ B;  5IJ0 B;  2IQQ A;  4KWE A;  3LFO A;  3OBY A;  4YJ2 A;  2HVY D;  3C9U A;  3IEW A;  4ZI7 A;  5HXU A;  3CC7 F;  2PMP A;  5FJ4 C;  2LCA A;  3HKD B;  3NMU C;  1RQ2 A;  3C9R A;  1JFF A;  5ITZ A;  4TUY B;  3WPW A;  1W2B F;  3FD6 A;  3CD6 F;  2HRU A;  3KHN A;  1OFU A;  4DRX B;  4FFB B;  3C9S A;  5C8Y A;  3JAR A;  5J2T B;  1VQ6 F;  3TD5 A;  3VMF B;  1VQ9 F;  3OW2 F;  1IV1 A;  1Z5W A;  3UT5 B;  5J2U A;  3I56 F;  1QVF F;  2L26 A;  4I4T B;  2Z1U A;  3F6M A;  3IKF A;  5JCO A;  3E22 A;  2HRY A;  3S0W A;  3BYQ A;  3KE1 A;  5CA1 B;  5JH7 A;  2ALE A;  2UYN A;  3ON1 A;  3VYS C;  1NQ3 A;  2OTL F;  2GLZ A;  2W8B C;  2VAW A;  4LNU A;  3NK6 A;  2R75 1;  3ESJ A;  5KMG B;  3ZO8 A;  1VQL F;  5CA0 A;  3V4D A;  4G4W A;  3N2K A;  2RHL A;  3KIZ A;  3MDO A;  5EYP A;  3O85 A;  5JVD B;  2UYP A;  3MBM A;  3MCA B;  2DYY A;  5JCO C;  4HNA B;  5KX5 B;  5LXT B;  5LYJ A;  3JAW B;  4C81 A;  4U39 A;  5IJ0 A;  5HWE A;  4ZHW A;  5EIB D;  3F0F A;  2EWC A;  1VHA A;  2R6R 1;  1U43 A;  3F0G A;  3E20 B;  3MCQ A;  2ZOD A;  1E7K A;  3P4E A;  3HKD A;  1YI2 F;  3HKE B;  2CZW A;  4TUY A;  5G4U C;  3VO8 A;  3PLA C;  4ZHV A;  5EB0 A;  4BT3 A;  4DRX A;  1NJI H;  4FFB A;  3CB2 A;  2ZVY A;  5J2T A;  1RQ7 A;  3CCR F;  2H6L A;  1U40 A;  2LBW A;  3GYQ A;  1VQ4 F;  3LWP C;  3UT5 A;  3JAL B;  2IG8 A;  5HP7 A;  4I4T A;  1K73 H;  3CC2 F;  3M4S A;  1GX1 A;  3S03 A;  3D54 A;  4O4I B;  5J2U B;  3RA5 A;  1VQM F;  5CA1 A;  3LYB A;  5FLX M;  2VGM A;  2LBT A;  1W5B A;  1X7O A;  2QA4 F;  1GZ0 A;  1RLG A;  5JH7 B;  5CB4 B;  3CCV F;  3VYT C;  3CCQ F;  2HX0 A;  4X20 B;  5KMG A;  1SA0 B;  1W42 A;  3NVK E;  3S0Y A;  1YJN F;  4X1I B;  2V9Y A;  4EI7 A;  3IMP A;  5JVD A;  3RYC B;  2WAL A;  2VAM A;  1VQV A;  2FGY A;  3N4Y A;  3CCL F;  2PHN A;  2VAP A;  5IYZ A;  4HNA A;  3KJK A;  5KX5 A;  3ZOP A;  5LXT A;  3M1X A;  3JAW A;  5EB1 B;  4IHJ B;  3N2G B;  3RYF A;  2HS3 A;  4TV9 B;  1ONI A;  4F6R B;  4ZK7 A;  3P10 A;  3HKE A;  3CYQ A;  5JQG B;  3CG6 A;  4G4X A;  5EIB C;  3E1Y A;  1JJ2 F;  3D00 A;  2B33 A;  5GAP K;  2YXZ A;  3KJJ A;  5A2Q M;  1QU9 A;  1Q81 H;  3CXC F;  4I55 B;  3I7T A;  3WGM A;  5B8F A;  1Q86 H;  1DT9 A;  1YJW F;  3K12 A;  4NQ3 A;  2BO1 A;  5IJ9 B;  3HTN A;  4BT6 A;  1FNJ A;  1JN1 A;  5MN5 A;  1NMU B;  3JAL A;  2N48 A;  1U3P A;  1W5F A;  2HQS C;  3VTI C;  2OHW A;  3J80 M;  1VQ7 F;  4NUT A;  1IV4 A;  2OTJ F;  3VOA A;  4X3M A;  3WGN A;  4O4I A;  3RA6 A;  3TD3 A;  2YYE A;  2CSL A;  2HP0 B;  4O4H B;  2RHO A;  3RE3 A;  2RHJ A;  4YJ3 A;  3S02 A;  3WGJ A;  5CB4 A;  1VK3 A;  5LA6 B;  1KNJ A;  1SZQ A;  4X20 A;  1SA0 A;  4X1K B;  3K0T A;  3CC4 F;  4BVQ A;  4X1I A;  3GHZ A;  3JAT B;  4G4V A;  5HP8 A;  4BT2 A;  4XCQ A;  5GON B;  4IIJ B;  1Q8R A;  3RYC A;  4U3J B;  3VCZ A;  2BTO A;  1VH8 A;  2DT4 A;  3OON A;  3F0E A;  1XHO A;  4IHJ A;  3FFM A;  1KQS F;  3N2G A;  4G4Y A;  1RA4 A;  4O4L B;  4WBN B;  1CLI A;  3OBW A;  3MQW A;  4TV9 A;  4F6R A;  5IYZ B;  5GIO C;  4EI8 A;  3CPQ A;  3ELC A;  3R0P A;  3JAK B;  5JQG A;  4BT5 A;  1FSZ A;  3CYP B;  3RYF B;  1KD1 H;  4NWO B;  1IV2 A;  2VXY A;  3J7A R;  1W57 A;  4B45 A;  1TUB B;  4I55 A;  3CPW F;  2Z1F A;  1YQN A;  2IAF A;  4X1Y A;  5EZY B;  3G6E F;  4O2B B;  3WXM B;  4G88 A;  5IJ9 A;  1H7M A;  5IT9 M;  4EB6 B;  2KTV A;  3HAX D;  2G9I A;  1QAH A;  4PWT A;  2Z01 A;  2RB9 A;  3SIV A;  3QHD A;  5HY0 A;  2UYK A;  5LP6 B;  3V7Q A;  3WGK A;  3FBA A;  3ZP7 A;  1VQP F;  2CHS A;  1KNK A;  1W41 A;  1X7P A;  2HP0 A;  4O4H A;  3AGK A;  5LA6 A;  1FFX B;  5GIP C;  4X1K A;  3WJQ A;  1K8A H;  3JAT A;  4YJ3 B;  3SIU A;  5GON A;  3S06 A;  5HY2 A;  4C8I A;  4IIJ A;  3LWQ C;  4U3J A;  3C9T A;  2GVI A;  2FC3 A;  4O4J B;  2QEX F;  1J7H A;  3CCS F;  3JAM M;  2ZOV A;  3JAS B;  1OAP A;  4O4L A;  4WBN A;  3CCE F;  1VQ5 F;  1IV3 A;  3DC2 A;  1H48 A;  2QTP A;  3JAK A;  1X52 A;  3HWU A;  1JD1 A;  1GO1 A;  3WPX A;  2JNB A;  3JVH A;  5EAZ A;  2CHT A;  1TUB A;  4B5C A;  4C82 A;  2F9Z C;  2KGW A;  5LOV B;  5EZY A;  5AVM A;  4O2B A;  3RYH B;  1X25 A;  2VGN A;  1XBI A;  5EO3 A;  3IEQ A;  1R1M A;  3NK7 A;  4EB6 A;  1YGY A;  5HY1 A;  5GIN C;  4X1Y B;  1COM A;  3LDT A;  3N4Z A;  1TVK B;  1W58 1;  3ERN A;  1K9M H;  1M90 H;  4BY9 D;  3VI6 A;  5LP6 A;  3LWR C;  4X3L A;  1S72 F;  1Z5V A;  1CN7 A;  3VYU C;  4ZOL B;  1JY8 A;  5HY4 A;  2I6R A;  3Q8H A;  4DXD A;  1N8R H;  1FFX A;  3P0Z A;  2KTU A;  3G4S F;  4E6E A;  4LCK A;  4C8E A;  4ERH A;  3WJR A;  1ZWZ A;  1QVG F;  2CWJ A;  3IKE A;  2BTU A;  2Q1X A;  3TD4 A;  3VOB A;  2BTQ B;  1T0K B;  3VIU A;  3D01 A;  3CCJ F;  2NMU A;  2RHH A;  3JCM M;  4BT4 A;  4O4J A;  1W55 A;  5LP6 C;  1XRG A;  4O2A B;  1Q7Y H;  2P6Y A;  3JAS A; 
#chains in the Genus database with same CATH homology
 3LFO A;  1H7M A;  3OBY A;  2QA4 F;  2HVY D;  1GZ0 A;  1RLG A;  5IT9 M;  5HXU A;  3CCV F;  3CC7 F;  2KTV A;  1KC8 H;  3CCQ F;  3HAX D;  3NVI B;  4BVT A;  5FJ4 C;  3NVK E;  1W42 A;  3SIV A;  1YJN F;  5HY0 A;  3NMU C;  3IR9 A;  4EI7 A;  1W2B F;  5DCV A;  3V7Q A;  3CD6 F;  2KG4 A;  3HJW C;  2WAL A;  3N4Y A;  2FGY A;  3CCL F;  1YHQ F;  1VQP F;  1YJ9 F;  5G4V C;  4BW0 B;  3CCU F;  1W41 A;  1X7P A;  1VQ6 F;  3AGK A;  3LWO C;  1VQK F;  3V7E A;  1M1K H;  3VMF B;  1VQ9 F;  3OW2 F;  5GIP C;  3I56 F;  1QVF F;  1K8A H;  3CG6 A;  3I55 F;  3J81 M;  3E1Y A;  3V3T A;  1JJ2 F;  3SIU A;  3D00 A;  5EWR A;  5HY2 A;  3LWQ C;  5GAP K;  5A2Q M;  1VQN F;  1Q81 H;  2FC3 A;  3CXC F;  1YIJ F;  3CME F;  1SDS A;  2ALE A;  2QEX F;  1Q86 H;  1DT9 A;  1YJW F;  3CCS F;  3ON1 A;  3JAM M;  4C4W C;  4NQ3 A;  2BO1 A;  2OTL F;  3CMA F;  3CCE F;  1VQ5 F;  2GLZ A;  1NMU B;  1W40 A;  3NK6 A;  4TZZ A;  3J80 M;  1X52 A;  2OHW A;  2QI2 A;  1VQ7 F;  1VQL F;  1CK2 A;  1GO1 A;  4NUT A;  1IPA A;  2OTJ F;  4X3M A;  2JNB A;  1W3E X;  3O85 A;  3RA6 A;  3MCA B;  2F9Z C;  3CCM F;  2VGN A;  1XBI A;  5EO3 A;  5HWE A;  3NK7 A;  1GO0 A;  5HY1 A;  5GIN C;  5GAN K;  3E20 B;  1E7K A;  1YI2 F;  3N4Z A;  4BY9 D;  3CC4 F;  4BVQ A;  3G71 F;  1K9M H;  2CZW A;  1M90 H;  3VI6 A;  5HXZ A;  3LWR C;  5G4U C;  4XCQ A;  4X3L A;  1S72 F;  1YIT F;  3PLA C;  1CN7 A;  1NJI H;  3LWV C;  3PAF A;  3CCR F;  3FFM A;  1KQS F;  1RA4 A;  5HY4 A;  3OBW A;  2LBW A;  3GYQ A;  4EI9 A;  1N8R H;  5GIO C;  4EI8 A;  2KTU A;  3G4S F;  1VQ4 F;  3LWP C;  3CPQ A;  4LCK A;  2AIF A;  2I6D A;  1ZWZ A;  1QVG F;  4BVS A;  1VQO F;  1K73 H;  3CC2 F;  1PXW A;  4BVR A;  1KD1 H;  2OZB A;  1T0K B;  3J7A R;  1VQ8 F;  3CCJ F;  3RA5 A;  1VQM F;  1Q82 H;  2LBX A;  3JCM M;  3CPW F;  5FLX M;  2VGM A;  3G6E F;  3WXM B;  1Q7Y H;  1X7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...