5G4UC

Association of three two-k-turn units based on kt-7 3bu,3nu, forming a triangular-shaped structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
EASYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMKT-7
publication title A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna/protein
total genus 36
structure length 120
sequence length 120
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5g4uC00
4X3LA 1VQMF 3O85A 3HAXD 3CCJF 2KG4A 1PXWA 2KTVA 3HJWC 2QI2A 1VQNF 4LCKA 3N4ZA 1K73H 1S72F 1Q86H 3CCVF 4BW0B 1CN7A 5G4VC 3JCMM 1VQ6F 2QEXF 3VMFB 2OZBA 3CCUF 2I6DA 3CC7F 1GO0A 3LWPC 2VGMA 1NMUB 3OBYA 3ON1A 5GIOC 1Q82H 1ZWZA 3NVIB 3NK6A 1YIJF 5A2QM 5GIPC 5IT9M 3LWRC 1W2BF 2KTUA 1NJIH 1JJ2F 1YJNF 1KQSF 1VQKF 2OTJF 1VQ9F 3SIVA 1VQLF 1W40A 3G6EF 3CCQF 3JAMM 3CPWF 3CCMF 5EWRA 1H7MA 1RLGA 4C4WC 1W3EX 1KD1H 3J80M 1VQ4F 1DT9A 1VQ8F 2QA4F 1IPAA 1YJ9F 4NUTA 2WALA 3NMUC 1X7OA 3NVKE 3LWQC 1VQOF 3CG6A 1GO1A 1W41A 2VGNA 1W42A 3CXCF 1T0KB 3J81M 3WXMB 2OHWA 5DCVA 1YHQF 3G4SF 5GINC 3CCEF 3IR9A 1Q81H 3E1YA 5EO3A 4TZZA 2HVYD 3RA5A 4BY9D 3V7EA 1QVFF 2ALEA 3PLAC 5GANK 3CCLF 1N8RH 3CC4F 2JNBA 1X7PA 3VI6A 3MCAB 1VQPF 5FLXM 1YI2F 1YJWF 5FJ4C 2CZWA 1KC8H 3NK7A 3N4YA 3OW2F 1E7KA 2BO1A 3AGKA 3E20B 3CC2F 2AIFA 3J7AR 1M90H 1K9MH 1XBIA 3I55F 3CCRF 3LFOA 3PAFA 1Q7YH 3CCSF 3CMEF 3FFMA 1VQ5F 1K8AH 1VQ7F 3RA6A 3I56F 3GYQA 2OTLF 1M1KH 3OBWA 1GZ0A 3CD6F 5G4UC 1X52A 3LWOC 2LBXA 3CMAF 1CK2A 3CPQA 2FC3A 1RA4A 3V7QA 1SDSA 2LBWA 4X3MA 1QVGF 3G71F 3SIUA 3LWVC 1YITF 5GAPK
chains in the Genus database with same CATH superfamily
1VQMF 2KGWA 5JCOC 3IKEA 4G88A 2KG4A 4M8IA 1PXWA 2KTVA 2Z1EA 2FGYA 2QI2A 3JARB 3N4ZA 5EZYB 1S72F 4X1KB 1Q86H 3QHDA 3CCVF 3JAWA 2QTPA 1T0AA 5CB4B 4C81A 2Z01A 4O4HA 4F6RB 3VMFB 3FD6A 5JVDA 3RYHA 2N48A 2CHSA 1W5EA 3M1XA 1ZWZA 3C9TA 4O4HB 3Q8HA 4BVSA 3CYQA 3LYBA 4ZHWA 2ZODA 4G4ZA 1YIJF 4DXDA 3LWRC 2HS0A 2RHLA 4U3JB 1NJIH 1FFXA 4I4TB 2OTJF 4BVQA 1JD1A 1VQ9F 4C82A 5KX5B 3VCZA 3CCQF 3VYTC 3CCMF 3VOAA 1H7MA 4YJ2A 2QA4F 4FFBA 1U3LA 4NUTA 3WJPA 5IJ9B 4B45A 5IYZA 2CWJA 4O4IA 3LWQC 3R0PA 1UFYA 1GO1A 2VGNA 3HTNA 1H47A 2UYJA 1U43A 3RYCB 3J81M 1T0KB 3JATA 1Z5WA 5EYPA 2G9IA 2ZF8A 3S06A 3WGLA 4G4XA 1YHQF 3VO8A 3KE1A 4TV8A 3CCEF 2K1SA 3K0TA 4WBNA 5JH7A 5EYPB 2R6R1 1QVFF 3PLAC 3ZP7A 4IHJB 3M84A 3CC4F 1X7PA 3HWUA 3MQWA 1YI2F 5FJ4C 2CZWA 3S0WA 3ESJA 3JVHA 2UYNB 5EAZA 3OW2F 3HKDA 2DYYA 3RYFB 4B46A 3CB2A 3D01A 3I55F 3PAFA 1FNJA 3M4SA 4ZHVA 3CMEF 1RQ7A 2I6RA 4O2BB 3WJRA 3CYPB 3GYQA 1JN1A 1X52A 5EIBC 1UI9A 2BTOA 3IEWA 1SZQA 1TVKA 5FNVA 4I55A 4PWTA 5LYJB 3G71F 3V3TA 1TUBB 3DC2A 5CA1A 1Q8RA 1VQNF 4I55B 5LP6A 4BW0B 5CA0B 3JAKA 5CA1B 5G4VC 3K12A 1VQ6F 4X20A 2OZBA 3FBAA 3C8LA 3TD5A 1VK3A 2VGMA 5LA6A 3IEQA 2B33A 3JAKB 3WGKA 1Q82H 2R751 2HP0A 5AVMA 5J2UB 2L26A 1H48A 4RHAA 1J7HA 5A2QM 3RYIA 4EB6B 4I50A 1W2BF 2KTUA 2HP0B 3JALB 3RYIB 2DT4A 3I7TA 3KJJA 1NQ3A 2MQEA 3CPWF 5EWRA 1QAHA 5BMVA 1VQ8F 3ELCA 1SA0A 3KHNA 1IPAA 3NMUC 3JAWB 2HRYA 2NMUA 3S0HA 1VQOF 3NVKE 2AMTA 2CSLA 1W41A 5JVDB 3RYHB 3MBMA 1COMA 3N2GA 1IV3A 4O4LA 3HKBA 2IAFA 3WXMB 5DCVA 2Z1TA 3WPWA 2AIZP 2VAPA 3KJKA 4O4LB 3E1YA 5B8FA 4BY9D 2ALEA 1FFXB 4E6EA 3K2XA 2LBTA 3VI6A 3MCAB 3D00A 3JASA 2Z1UA 5LXTA 1YJWF 3OONA 2H8EA 5MN6A 3NK7A 4YJ2B 1RLUA 3E20B 4R40B 4FFBB 5LXTB 5EB0A 4U39A 1QU9A 5IYZB 4O4IB 3J7AR 1M90H 4HNAA 3CCRF 5MN5A 1Q7YH 3CCSF 3UT5A 5J2TA 1JFFA 4ZHQA 4RQOA 4ZI7A 3HKEA 4C8EA 3JATB 2UYPA 3S03A 1VQ7F 4X1YA 4LNUA 1W59A 2OTLF 4TV8B 3VOBA 1XHOA 3CD6F 4ZI7B 5G4UC 2LBXA 3HKEB 1U40A 4WBNB 5HXUA 5JH7B 3QUWA 2FC3A 1RA4A 3V7QA 3ZP4A 3T80A 1SDSA 4BT3A 2GZLA 1YITF 1KNKA 2CVLA 3HAXD 3CCJF 5HXZA 2H6LA 3HKDB 5ITZA 5HY0A 3JCMM 4EI8A 3HKCA 2QEXF 3CCUF 2VXYA 2I6DA 3CC7F 1GO0A 2IQQA 3LMEA 3N2KA 1NMUB 1YQNA 3C9UA 3F6MA 1OAPA 2UZHA 5IT9M 3E22A 4DRXA 1X25A 5GONA 1YJNF 1KQSF 1VQKF 1TVKB 5HWEA 5FNVB 2Z1FA 1W57A 3G6EF 3JAMM 5GONB 2Q1XA 5HP8A 4TUYA 1RLGA 4C4WC 1W3EX 5LOVA 5HY2A 2VAWA 3J80M 1KD1H 5JQGA 1VQ4F 5EB1B 2YXZA 2PMPA 1YJ9F 5LP6B 3MDOA 1X7OA 5LOVB 4X20B 3P10A 1R1MA 1W42A 2H8CA 4ZOLA 3CXCF 5LA6B 3VTIC 3KIZA 1W5BA 2HS4A 5LP6C 1W5FA 2HP3A 3S02A 3WPXA 4BT2A 4TV9A 3VYUC 4BVTA 5GINC 3B6NA 3IR9A 1W5AA 1Q81H 4I50B 3ZOPA 5EO3A 5JCOA 4O4JA 4C8GA 3F0DA 4NWOB 4TZZA 5KMGA 3RA5A 2HVYD 3V7EA 4O2AA 3F0EA 2BTUA 2JNBA 5FLXM 2GVIA 3JARA 1W55A 3ERNA 3GTZA 5EZYA 3N4YA 4X1KA 3AGKA 3ZO8A 5BMVB 2HQSC 1SA0B 4YJ3A 5CB4A 3CC2F 2AIFA 2GLZA 4BT5A 4F6RA 4EI7A 1K9MH 1QD9A 3N2GB 4YJ3B 3HKBB 2VAMA 4G4WA 2RHHA 4BT4A 1KNJA 3OBWA 1GZ0A 3LWOC 1CK2A 1ODEA 4U3JA 2UYKA 3CPQA 4I4TA 2HX0A 3S0YA 5HY4A 4X3MA 1QVGF 3IMPA 5KX5A 3BYQA 3LWVC 1W581 2IG8A 1ONIA 5GAPK 4X3LA 3O85A 1VHAA 2F9ZC 2HRUA 2W8BC 1JY8A 3JASB 2RHOA 3HJWC 4LCKA 3DDNA 1K73H 4ERHA 1CN7A 5IJ9A 3WGMA 1XRGA 4XCQA 1GX1A 1U3PA 4HNAB 1IV4A 3LWPC 3OBYA 3RYCA 1IV1A 3WGJA 3ON1A 3UT5B 1JFFB 2EWCA 4ZHQB 5J2TB 5GIOC 3NVIB 5IJ0A 3EORA 4X1YB 3NK6A 4LNUB 4X1IA 4EI9A 5GIPC 5MN4A 2YYEA 3P0ZA 4KWEA 1PF5A 3WJQA 1VQVA 1VH8A 3F0FA 2ZVZA 5IJ0B 1JJ2F 3P4EA 3I3FA 4IHJA 3TD4A 4X1IB 2RHJA 3SIVA 1VQLF 3U0OA 1OFUA 1W40A 3VIUA 2UYNA 4B62A 5HY1A 3IKFA 1DT9A 3RYFA 2OTMA 2WALA 5ITZB 3WGNA 3HKCB 3CG6A 4ZK7A 2CHTA 3N2KB 4G4YA 4G4VA 4O2BA 2BTQB 2LCAA 2OHWA 1RQ2A 3G4SF 3FPIA 4BVRA 3K14A 1XV2A 3E22B 4DRXB 1Z5VA 4C8IA 5HP7A 2PHNA 4IIJA 4B5CA 5LYJA 3TD3A 5GANK 3F0GA 3CCLF 1N8RH 2ZOVA 1TUBA 1VQPF 4BT6A 3GHZA 1FNKA 5C8YA 4IIJB 4TUYB 1YGYA 1KC8H 1E7KA 2BO1A 3D54A 3RE3A 2ZAUA 5JQGB 5CA0A 4NQ3A 5C8YB 3QTYA 2HS3A 3C9RA 1XBIA 3MCQA 3LFOA 2Q1YA 1FSZA 3VYSC 5EIBD 4ZOLB 3V4DA 3FFMA 1CLIA 1VQ5F 5J2UA 1K8AH 2V9YA 3RA6A 4BT7A 4TV9B 3I56F 4EB6A 1M1KH 3CMAF 4ZHYB 3JALA 1IV2A 2CW4A 3C9SA 2RB9A 4O4JB 5KMGB 1DBFA 2LBWA 4O2AB 2ZVYA 3SIUA 2P6YA 3L7QA 3FD5A 3LDTA
chains in the Genus database with same CATH topology
4X3LA 1VQMF 3O85A 3HAXD 2F9ZC 3CCJF 2KG4A 5HXZA 1PXWA 2KTVA 3HJWC 2FGYA 2QI2A 1VQNF 3N4ZA 4LCKA 1K73H 1S72F 1Q86H 3CCVF 4BW0B 1CN7A 5HY0A 5G4VC 3JCMM 4EI8A 4XCQA 1VQ6F 2QEXF 3VMFB 2OZBA 3CCUF 2I6DA 3CC7F 1GO0A 3LWPC 2VGMA 3OBYA 1NMUB 3ON1A 5GIOC 1Q82H 1ZWZA 3NVIB 4BVSA 3NK6A 1YIJF 4EI9A 5A2QM 5GIPC 5IT9M 3LWRC 1W2BF 2KTUA 1NJIH 1JJ2F 1YJNF 1KQSF 1VQKF 2OTJF 5HWEA 4BVQA 1VQ9F 3SIVA 1VQLF 1W40A 3G6EF 3CCQF 3JAMM 3CPWF 3CCMF 5EWRA 1H7MA 1RLGA 4C4WC 1W3EX 5HY2A 1KD1H 3J80M 5HY1A 3LWVC 1VQ4F 1DT9A 1VQ8F 2QA4F 1IPAA 1YJ9F 4NUTA 2WALA 3NMUC 1X7OA 3NVKE 3LWQC 1VQOF 3CG6A 1GO1A 1W41A 2VGNA 1W42A 3CXCF 1T0KB 3J81M 3WXMB 2OHWA 5DCVA 1YHQF 3G4SF 4BVTA 5GINC 4BVRA 3CCEF 3IR9A 1Q81H 3E1YA 5EO3A 4TZZA 2HVYD 3RA5A 4BY9D 3V7EA 1QVFF 2ALEA 3PLAC 5GANK 3CCLF 1N8RH 3CC4F 2JNBA 1X7PA 3VI6A 3MCAB 1VQPF 3D00A 5FLXM 1YI2F 1YJWF 5FJ4C 2CZWA 1KC8H 3NK7A 3N4YA 3OW2F 1E7KA 2BO1A 3AGKA 3E20B 4NQ3A 3CC2F 2AIFA 2GLZA 3J7AR 1M90H 4EI7A 1K9MH 1XBIA 3I55F 3CCRF 3LFOA 3PAFA 1Q7YH 3CCSF 3CMEF 3FFMA 1VQ5F 1K8AH 1VQ7F 3RA6A 3I56F 3GYQA 2OTLF 1M1KH 3OBWA 1GZ0A 3CD6F 5G4UC 1X52A 3LWOC 2LBXA 3CMAF 5HXUA 1CK2A 3CPQA 2FC3A 1RA4A 3V7QA 1SDSA 5HY4A 2LBWA 4X3MA 1QVGF 3G71F 3SIUA 3V3TA 1YITF 5GAPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3L A;  1VQM F;  3O85 A;  3HAX D;  3CCJ F;  2KG4 A;  1PXW A;  2KTV A;  3HJW C;  2QI2 A;  1VQN F;  4LCK A;  3N4Z A;  1K73 H;  1S72 F;  1Q86 H;  3CCV F;  4BW0 B;  1CN7 A;  5G4V C;  3JCM M;  1VQ6 F;  2QEX F;  3VMF B;  2OZB A;  3CCU F;  2I6D A;  3CC7 F;  1GO0 A;  3LWP C;  2VGM A;  1NMU B;  3OBY A;  3ON1 A;  5GIO C;  1Q82 H;  1ZWZ A;  3NVI B;  3NK6 A;  1YIJ F;  5A2Q M;  5GIP C;  5IT9 M;  3LWR C;  1W2B F;  2KTU A;  1NJI H;  1JJ2 F;  1YJN F;  1KQS F;  1VQK F;  2OTJ F;  1VQ9 F;  3SIV A;  1VQL F;  1W40 A;  3G6E F;  3CCQ F;  3JAM M;  3CPW F;  3CCM F;  5EWR A;  1H7M A;  1RLG A;  4C4W C;  1W3E X;  1KD1 H;  3J80 M;  1VQ4 F;  1DT9 A;  1VQ8 F;  2QA4 F;  1IPA A;  1YJ9 F;  4NUT A;  2WAL A;  3NMU C;  1X7O A;  3NVK E;  3LWQ C;  1VQO F;  3CG6 A;  1GO1 A;  1W41 A;  2VGN A;  1W42 A;  3CXC F;  1T0K B;  3J81 M;  3WXM B;  2OHW A;  5DCV A;  1YHQ F;  3G4S F;  5GIN C;  3CCE F;  3IR9 A;  1Q81 H;  3E1Y A;  5EO3 A;  4TZZ A;  2HVY D;  3RA5 A;  4BY9 D;  3V7E A;  1QVF F;  2ALE A;  3PLA C;  5GAN K;  3CCL F;  1N8R H;  3CC4 F;  2JNB A;  1X7P A;  3VI6 A;  3MCA B;  1VQP F;  5FLX M;  1YI2 F;  1YJW F;  5FJ4 C;  2CZW A;  1KC8 H;  3NK7 A;  3N4Y A;  3OW2 F;  1E7K A;  2BO1 A;  3AGK A;  3E20 B;  3CC2 F;  2AIF A;  3J7A R;  1M90 H;  1K9M H;  1XBI A;  3I55 F;  3CCR F;  3LFO A;  3PAF A;  1Q7Y H;  3CCS F;  3CME F;  3FFM A;  1VQ5 F;  1K8A H;  1VQ7 F;  3RA6 A;  3I56 F;  3GYQ A;  2OTL F;  1M1K H;  3OBW A;  1GZ0 A;  3CD6 F;  5G4U C;  1X52 A;  3LWO C;  2LBX A;  3CMA F;  1CK2 A;  3CPQ A;  2FC3 A;  1RA4 A;  3V7Q A;  1SDS A;  2LBW A;  4X3M A;  1QVG F;  3G71 F;  3SIU A;  3LWV C;  1YIT F;  5GAP K; 
#chains in the Genus database with same CATH topology
 1VQM F;  2KGW A;  5JCO C;  3IKE A;  4G88 A;  2KG4 A;  4M8I A;  1PXW A;  2KTV A;  2Z1E A;  2FGY A;  2QI2 A;  3JAR B;  3N4Z A;  5EZY B;  1S72 F;  4X1K B;  1Q86 H;  3QHD A;  3CCV F;  3JAW A;  2QTP A;  1T0A A;  5CB4 B;  4C81 A;  2Z01 A;  4O4H A;  4F6R B;  3VMF B;  3FD6 A;  5JVD A;  3RYH A;  2N48 A;  2CHS A;  1W5E A;  3M1X A;  1ZWZ A;  3C9T A;  4O4H B;  3Q8H A;  4BVS A;  3CYQ A;  3LYB A;  4ZHW A;  2ZOD A;  4G4Z A;  1YIJ F;  4DXD A;  3LWR C;  2HS0 A;  2RHL A;  4U3J B;  1NJI H;  1FFX A;  4I4T B;  2OTJ F;  4BVQ A;  1JD1 A;  1VQ9 F;  4C82 A;  5KX5 B;  3VCZ A;  3CCQ F;  3VYT C;  3CCM F;  3VOA A;  1H7M A;  4YJ2 A;  2QA4 F;  4FFB A;  1U3L A;  4NUT A;  3WJP A;  5IJ9 B;  4B45 A;  5IYZ A;  2CWJ A;  4O4I A;  3LWQ C;  3R0P A;  1UFY A;  1GO1 A;  2VGN A;  3HTN A;  1H47 A;  2UYJ A;  1U43 A;  3RYC B;  3J81 M;  1T0K B;  3JAT A;  1Z5W A;  5EYP A;  2G9I A;  2ZF8 A;  3S06 A;  3WGL A;  4G4X A;  1YHQ F;  3VO8 A;  3KE1 A;  4TV8 A;  3CCE F;  2K1S A;  3K0T A;  4WBN A;  5JH7 A;  5EYP B;  2R6R 1;  1QVF F;  3PLA C;  3ZP7 A;  4IHJ B;  3M84 A;  3CC4 F;  1X7P A;  3HWU A;  3MQW A;  1YI2 F;  5FJ4 C;  2CZW A;  3S0W A;  3ESJ A;  3JVH A;  2UYN B;  5EAZ A;  3OW2 F;  3HKD A;  2DYY A;  3RYF B;  4B46 A;  3CB2 A;  3D01 A;  3I55 F;  3PAF A;  1FNJ A;  3M4S A;  4ZHV A;  3CME F;  1RQ7 A;  2I6R A;  4O2B B;  3WJR A;  3CYP B;  3GYQ A;  1JN1 A;  1X52 A;  5EIB C;  1UI9 A;  2BTO A;  3IEW A;  1SZQ A;  1TVK A;  5FNV A;  4I55 A;  4PWT A;  5LYJ B;  3G71 F;  3V3T A;  1TUB B;  3DC2 A;  5CA1 A;  1Q8R A;  1VQN F;  4I55 B;  5LP6 A;  4BW0 B;  5CA0 B;  3JAK A;  5CA1 B;  5G4V C;  3K12 A;  1VQ6 F;  4X20 A;  2OZB A;  3FBA A;  3C8L A;  3TD5 A;  1VK3 A;  2VGM A;  5LA6 A;  3IEQ A;  2B33 A;  3JAK B;  3WGK A;  1Q82 H;  2R75 1;  2HP0 A;  5AVM A;  5J2U B;  2L26 A;  1H48 A;  4RHA A;  1J7H A;  5A2Q M;  3RYI A;  4EB6 B;  4I50 A;  1W2B F;  2KTU A;  2HP0 B;  3JAL B;  3RYI B;  2DT4 A;  3I7T A;  3KJJ A;  1NQ3 A;  2MQE A;  3CPW F;  5EWR A;  1QAH A;  5BMV A;  1VQ8 F;  3ELC A;  1SA0 A;  3KHN A;  1IPA A;  3NMU C;  3JAW B;  2HRY A;  2NMU A;  3S0H A;  1VQO F;  3NVK E;  2AMT A;  2CSL A;  1W41 A;  5JVD B;  3RYH B;  3MBM A;  1COM A;  3N2G A;  1IV3 A;  4O4L A;  3HKB A;  2IAF A;  3WXM B;  5DCV A;  2Z1T A;  3WPW A;  2AIZ P;  2VAP A;  3KJK A;  4O4L B;  3E1Y A;  5B8F A;  4BY9 D;  2ALE A;  1FFX B;  4E6E A;  3K2X A;  2LBT A;  3VI6 A;  3MCA B;  3D00 A;  3JAS A;  2Z1U A;  5LXT A;  1YJW F;  3OON A;  2H8E A;  5MN6 A;  3NK7 A;  4YJ2 B;  1RLU A;  3E20 B;  4R40 B;  4FFB B;  5LXT B;  5EB0 A;  4U39 A;  1QU9 A;  5IYZ B;  4O4I B;  3J7A R;  1M90 H;  4HNA A;  3CCR F;  5MN5 A;  1Q7Y H;  3CCS F;  3UT5 A;  5J2T A;  1JFF A;  4ZHQ A;  4RQO A;  4ZI7 A;  3HKE A;  4C8E A;  3JAT B;  2UYP A;  3S03 A;  1VQ7 F;  4X1Y A;  4LNU A;  1W59 A;  2OTL F;  4TV8 B;  3VOB A;  1XHO A;  3CD6 F;  4ZI7 B;  5G4U C;  2LBX A;  3HKE B;  1U40 A;  4WBN B;  5HXU A;  5JH7 B;  3QUW A;  2FC3 A;  1RA4 A;  3V7Q A;  3ZP4 A;  3T80 A;  1SDS A;  4BT3 A;  2GZL A;  1YIT F;  1KNK A;  2CVL A;  3HAX D;  3CCJ F;  5HXZ A;  2H6L A;  3HKD B;  5ITZ A;  5HY0 A;  3JCM M;  4EI8 A;  3HKC A;  2QEX F;  3CCU F;  2VXY A;  2I6D A;  3CC7 F;  1GO0 A;  2IQQ A;  3LME A;  3N2K A;  1NMU B;  1YQN A;  3C9U A;  3F6M A;  1OAP A;  2UZH A;  5IT9 M;  3E22 A;  4DRX A;  1X25 A;  5GON A;  1YJN F;  1KQS F;  1VQK F;  1TVK B;  5HWE A;  5FNV B;  2Z1F A;  1W57 A;  3G6E F;  3JAM M;  5GON B;  2Q1X A;  5HP8 A;  4TUY A;  1RLG A;  4C4W C;  1W3E X;  5LOV A;  5HY2 A;  2VAW A;  3J80 M;  1KD1 H;  5JQG A;  1VQ4 F;  5EB1 B;  2YXZ A;  2PMP A;  1YJ9 F;  5LP6 B;  3MDO A;  1X7O A;  5LOV B;  4X20 B;  3P10 A;  1R1M A;  1W42 A;  2H8C A;  4ZOL A;  3CXC F;  5LA6 B;  3VTI C;  3KIZ A;  1W5B A;  2HS4 A;  5LP6 C;  1W5F A;  2HP3 A;  3S02 A;  3WPX A;  4BT2 A;  4TV9 A;  3VYU C;  4BVT A;  5GIN C;  3B6N A;  3IR9 A;  1W5A A;  1Q81 H;  4I50 B;  3ZOP A;  5EO3 A;  5JCO A;  4O4J A;  4C8G A;  3F0D A;  4NWO B;  4TZZ A;  5KMG A;  3RA5 A;  2HVY D;  3V7E A;  4O2A A;  3F0E A;  2BTU A;  2JNB A;  5FLX M;  2GVI A;  3JAR A;  1W55 A;  3ERN A;  3GTZ A;  5EZY A;  3N4Y A;  4X1K A;  3AGK A;  3ZO8 A;  5BMV B;  2HQS C;  1SA0 B;  4YJ3 A;  5CB4 A;  3CC2 F;  2AIF A;  2GLZ A;  4BT5 A;  4F6R A;  4EI7 A;  1K9M H;  1QD9 A;  3N2G B;  4YJ3 B;  3HKB B;  2VAM A;  4G4W A;  2RHH A;  4BT4 A;  1KNJ A;  3OBW A;  1GZ0 A;  3LWO C;  1CK2 A;  1ODE A;  4U3J A;  2UYK A;  3CPQ A;  4I4T A;  2HX0 A;  3S0Y A;  5HY4 A;  4X3M A;  1QVG F;  3IMP A;  5KX5 A;  3BYQ A;  3LWV C;  1W58 1;  2IG8 A;  1ONI A;  5GAP K;  4X3L A;  3O85 A;  1VHA A;  2F9Z C;  2HRU A;  2W8B C;  1JY8 A;  3JAS B;  2RHO A;  3HJW C;  4LCK A;  3DDN A;  1K73 H;  4ERH A;  1CN7 A;  5IJ9 A;  3WGM A;  1XRG A;  4XCQ A;  1GX1 A;  1U3P A;  4HNA B;  1IV4 A;  3LWP C;  3OBY A;  3RYC A;  1IV1 A;  3WGJ A;  3ON1 A;  3UT5 B;  1JFF B;  2EWC A;  4ZHQ B;  5J2T B;  5GIO C;  3NVI B;  5IJ0 A;  3EOR A;  4X1Y B;  3NK6 A;  4LNU B;  4X1I A;  4EI9 A;  5GIP C;  5MN4 A;  2YYE A;  3P0Z A;  4KWE A;  1PF5 A;  3WJQ A;  1VQV A;  1VH8 A;  3F0F A;  2ZVZ A;  5IJ0 B;  1JJ2 F;  3P4E A;  3I3F A;  4IHJ A;  3TD4 A;  4X1I B;  2RHJ A;  3SIV A;  1VQL F;  3U0O A;  1OFU A;  1W40 A;  3VIU A;  2UYN A;  4B62 A;  5HY1 A;  3IKF A;  1DT9 A;  3RYF A;  2OTM A;  2WAL A;  5ITZ B;  3WGN A;  3HKC B;  3CG6 A;  4ZK7 A;  2CHT A;  3N2K B;  4G4Y A;  4G4V A;  4O2B A;  2BTQ B;  2LCA A;  2OHW A;  1RQ2 A;  3G4S F;  3FPI A;  4BVR A;  3K14 A;  1XV2 A;  3E22 B;  4DRX B;  1Z5V A;  4C8I A;  5HP7 A;  2PHN A;  4IIJ A;  4B5C A;  5LYJ A;  3TD3 A;  5GAN K;  3F0G A;  3CCL F;  1N8R H;  2ZOV A;  1TUB A;  1VQP F;  4BT6 A;  3GHZ A;  1FNK A;  5C8Y A;  4IIJ B;  4TUY B;  1YGY A;  1KC8 H;  1E7K A;  2BO1 A;  3D54 A;  3RE3 A;  2ZAU A;  5JQG B;  5CA0 A;  4NQ3 A;  5C8Y B;  3QTY A;  2HS3 A;  3C9R A;  1XBI A;  3MCQ A;  3LFO A;  2Q1Y A;  1FSZ A;  3VYS C;  5EIB D;  4ZOL B;  3V4D A;  3FFM A;  1CLI A;  1VQ5 F;  5J2U A;  1K8A H;  2V9Y A;  3RA6 A;  4BT7 A;  4TV9 B;  3I56 F;  4EB6 A;  1M1K H;  3CMA F;  4ZHY B;  3JAL A;  1IV2 A;  2CW4 A;  3C9S A;  2RB9 A;  4O4J B;  5KMG B;  1DBF A;  2LBW A;  4O2A B;  2ZVY A;  3SIU A;  2P6Y A;  3L7Q A;  3FD5 A;  3LDT A; 
#chains in the Genus database with same CATH homology
 4X3L A;  1VQM F;  3O85 A;  3HAX D;  2F9Z C;  3CCJ F;  2KG4 A;  5HXZ A;  1PXW A;  2KTV A;  3HJW C;  2FGY A;  2QI2 A;  1VQN F;  3N4Z A;  4LCK A;  1K73 H;  1S72 F;  1Q86 H;  3CCV F;  4BW0 B;  1CN7 A;  5HY0 A;  5G4V C;  3JCM M;  4EI8 A;  4XCQ A;  1VQ6 F;  2QEX F;  3VMF B;  2OZB A;  3CCU F;  2I6D A;  3CC7 F;  1GO0 A;  3LWP C;  2VGM A;  3OBY A;  1NMU B;  3ON1 A;  5GIO C;  1Q82 H;  1ZWZ A;  3NVI B;  4BVS A;  3NK6 A;  1YIJ F;  4EI9 A;  5A2Q M;  5GIP C;  5IT9 M;  3LWR C;  1W2B F;  2KTU A;  1NJI H;  1JJ2 F;  1YJN F;  1KQS F;  1VQK F;  2OTJ F;  5HWE A;  4BVQ A;  1VQ9 F;  3SIV A;  1VQL F;  1W40 A;  3G6E F;  3CCQ F;  3JAM M;  3CPW F;  3CCM F;  5EWR A;  1H7M A;  1RLG A;  4C4W C;  1W3E X;  5HY2 A;  1KD1 H;  3J80 M;  5HY1 A;  3LWV C;  1VQ4 F;  1DT9 A;  1VQ8 F;  2QA4 F;  1IPA A;  1YJ9 F;  4NUT A;  2WAL A;  3NMU C;  1X7O A;  3NVK E;  3LWQ C;  1VQO F;  3CG6 A;  1GO1 A;  1W41 A;  2VGN A;  1W42 A;  3CXC F;  1T0K B;  3J81 M;  3WXM B;  2OHW A;  5DCV A;  1YHQ F;  3G4S F;  4BVT A;  5GIN C;  4BVR A;  3CCE F;  3IR9 A;  1Q81 H;  3E1Y A;  5EO3 A;  4TZZ A;  2HVY D;  3RA5 A;  4BY9 D;  3V7E A;  1QVF F;  2ALE A;  3PLA C;  5GAN K;  3CCL F;  1N8R H;  3CC4 F;  2JNB A;  1X7P A;  3VI6 A;  3MCA B;  1VQP F;  3D00 A;  5FLX M;  1YI2 F;  1YJW F;  5FJ4 C;  2CZW A;  1KC8 H;  3NK7 A;  3N4Y A;  3OW2 F;  1E7K A;  2BO1 A;  3AGK A;  3E20 B;  4NQ3 A;  3CC2 F;  2AIF A;  2GLZ A;  3J7A R;  1M90 H;  4EI7 A;  1K9M H;  1XBI A;  3I55 F;  3CCR F;  3LFO A;  3PAF A;  1Q7Y H;  3CCS F;  3CME F;  3FFM A;  1VQ5 F;  1K8A H;  1VQ7 F;  3RA6 A;  3I56 F;  3GYQ A;  2OTL F;  1M1K H;  3OBW A;  1GZ0 A;  3CD6 F;  5G4U C;  1X52 A;  3LWO C;  2LBX A;  3CMA F;  5HXU A;  1CK2 A;  3CPQ A;  2FC3 A;  1RA4 A;  3V7Q A;  1SDS A;  5HY4 A;  2LBW A;  4X3M A;  1QVG F;  3G71 F;  3SIU A;  3V3T A;  1YIT F;  5GAP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...