1RLGA

Molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
VPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of Box C/D RNA-Protein Interactions; Cocrystal Structure of Archaeal L7Ae and a Box C/D RNA.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural protein/rna
molecule keywords 25-MER
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1rlgA00
3JCMM 3LWPC 2ALEA 2CZWA 4BW0B 1SDSA 3WXMB 3VI6A 1ZWZA 2AIFA 3CCJF 1VQPF 3OW2F 2OTLF 3CCUF 1W42A 4LCKA 3AGKA 3MCAB 1W41A 3LWVC 1VQ8F 2WALA 3NMUC 1VQMF 3PAFA 3E20B 1CN7A 3RA6A 1NMUB 3IR9A 1GZ0A 3LWQC 3GYQA 1KD1H 1KQSF 5IT9M 1CK2A 4C4WC 1VQOF 1YI2F 1PXWA 4NUTA 1VQ6F 3CCSF 1YJWF 1K73H 3N4YA 1Q86H 1Q82H 3LFOA 1QVFF 2VGMA 5GANK 1XBIA 4BY9D 3NK7A 4TZZA 1JJ2F 2QI2A 1DT9A 1W2BF 1IPAA 2KTUA 3RA5A 3NVIB 2OTJF 5A2QM 1W3EX 2QA4F 5G4VC 3J80M 3CCMF 1YJNF 5EWRA 1VQKF 1X52A 1KC8H 4X3MA 3CXCF 3E1YA 3HAXD 1YIJF 3OBWA 3ON1A 1RA4A 3CCRF 1W40A 2KG4A 1VQ5F 1VQ9F 5EO3A 3N4ZA 3CG6A 3J81M 1GO1A 3I56F 2LBXA 1QVGF 1H7MA 1Q7YH 2OZBA 3SIUA 1K8AH 3JAMM 2VGNA 3OBYA 1YJ9F 3HJWC 4X3LA 2OHWA 5G4UC 1T0KB 1YITF 2FC3A 3CCEF 3NVKE 5GIPC 3CMEF 1X7PA 3G6EF 3CC2F 3CPWF 1Q81H 3CMAF 5GIOC 3O85A 5DCVA 2HVYD 2QEXF 3CC4F 3CC7F 3V7EA 3I55F 1VQLF 2I6DA 3G4SF 1S72F 3CCLF 3LWOC 1K9MH 2LBWA 3NK6A 1VQNF 1YHQF 3CPQA 3J7AR 3FFMA 2JNBA 1M1KH 1RLGA 1GO0A 5FJ4C 5GINC 1VQ4F 1M90H 1VQ7F 3PLAC 1E7KA 3CD6F 5FLXM 2BO1A 3CCVF 1NJIH 3CCQF 2KTVA 3SIVA 3G71F 3LWRC 3VMFB 1N8RH 1X7OA 3V7QA 5GAPK
chains in the Genus database with same CATH superfamily
3ZP7A 3S0YA 2F9ZC 3VI6A 4ZK7A 1VH8A 4TV9B 1VQPF 3OW2F 2OTLF 1TUBA 3AGKA 1W41A 5LP6C 2BTUA 1VQ8F 2IG8A 3IEQA 1SA0B 3NMUC 4I4TA 2HRYA 4O4LA 2CVLA 1VHAA 5IT9M 2BTOA 3VIUA 1CK2A 4BVRA 1J7HA 4IHJB 1PXWA 3HKDB 3E22A 4FFBB 4U3JA 2YYEA 4BT7A 1Q82H 4DRXB 2VGMA 3GHZA 2LCAA 2RHOA 2ZODA 1KNKA 2QA4F 3D54A 1U40A 5JVDB 5EWRA 4YJ2A 2Z1UA 1KC8H 2H8CA 3CXCF 3HAXD 1YIJF 1W59A 3JAWB 3S0WA 3JVHA 4U39A 5EYPA 3TD4A 3JASB 4X20B 1W40A 3B6NA 4EI9A 4O4JB 3RYCB 1VQ9F 4YJ3A 3CG6A 2HX0A 5ITZB 2OZBA 3M84A 4B45A 5BMVA 3HJWC 2OHWA 3C9UA 1T0KB 1YITF 4I55B 3I7TA 3FPIA 3HTNA 3RE3A 4I55A 3V4DA 1CLIA 4X1KA 1Q81H 3K0TA 5DCVA 3D00A 3HKBB 3F0EA 3WGLA 4TUYA 5IYZB 4ZHQB 3CC4F 1VQLF 4C82A 4HNAB 5KMGA 2I6DA 2H8EA 1S72F 4X1YA 2LBWA 5EIBC 1SA0A 4EI8A 1M1KH 1RLGA 2VAPA 2W8BC 3M1XA 4O4LB 2R6R1 1RQ2A 5EIBD 3ZOPA 1VQ7F 2CHTA 1TVKA 5J2UB 5HP8A 3HKEB 1E7KA 3ERNA 2L26A 5FLXM 5HXUA 3RYIA 4DXDA 3KE1A 4B62A 4NWOB 3IKEA 3HKCB 5LOVB 5CA1A 2ALEA 4FFBA 4BW0B 3RYHA 1SDSA 5B8FA 3WJQA 3JARB 4EB6A 3TD3A 4ZOLA 5IJ9A 3LDTA 3CCUF 1W42A 5MN6A 2PHNA 4BVTA 4BT5A 5CA0B 3LWVC 4XCQA 3P10A 5C8YA 5JVDA 1VQMF 4F6RB 1IV2A 1KNJA 3VCZA 4R40B 3E20B 1W57A 4X1KB 4BVQA 4O4HA 3C9SA 3LWQC 5IJ0B 1FSZA 3JALA 3CCSF 2AMTA 5J2TB 3F6MA 1SZQA 5MN4A 1ONIA 4TZZA 4ZHYB 1JJ2F 2OTMA 5JQGA 5KX5A 2RHJA 3T80A 1QAHA 1IPAA 5JCOA 3RA5A 3C9RA 2UYJA 3K2XA 3DC2A 1W3EX 2ZOVA 5G4VC 4ZI7B 3CYQA 3JAWA 1YJNF 1VQKF 3TD5A 4X3MA 2RB9A 3ON1A 2KGWA 3HKCA 3KHNA 1VQ5F 3RYIB 2B33A 5EO3A 5IJ0A 1GO1A 1H7MA 1JN1A 1K8AH 3HKEA 2HP0A 2GZLA 2UYNB 3JAMM 3N2KA 2VGNA 2VAWA 3Q8HA 3HKDA 5G4UC 3VOBA 2RHLA 2PMPA 2IQQA 3QHDA 3OONA 1DBFA 4G88A 1X7PA 4I50B 1U43A 5EB1B 3CMAF 3WGJA 2CSLA 5C8YB 3ZP4A 3WJPA 2N48A 4LNUA 3CC7F 4TUYB 3G4SF 1VK3A 1TUBB 3MCQA 3CCLF 3LWOC 4EB6B 4E6EA 4BT6A 5LA6A 3P4EA 1VQNF 3CPQA 4RQOA 3J7AR 4B46A 2JNBA 4ZHQA 5FJ4C 1T0AA 4WBNB 1Z5WA 5BMVB 1M90H 5LOVA 2Z01A 3VTIC 3N2GA 5HWEA 2ZVZA 2BO1A 4BT4A 5FNVA 5LXTB 4O4IB 4B5CA 2ZF8A 3JATB 2HS4A 1IV1A 3JCMM 2CZWA 1X25A 3U0OA 4HNAA 4LNUB 3S0HA 2UZHA 1ZWZA 3VYUC 2AIFA 2R751 2NMUA 2GVIA 1FFXB 4KWEA 3ESJA 4G4YA 4LCKA 2UYPA 4IIJB 3MCAB 3CYPB 3DDNA 2P6YA 1W55A 1CN7A 3RA6A 4WBNA 2HP0B 3JALB 1NMUB 3IR9A 1VQVA 1KD1H 4X1IA 1KQSF 3JAKB 4C4WC 4YJ3B 1YI2F 5JH7A 1VQ6F 1K73H 3JATA 5HP7A 5HXZA 4F6RA 4IHJA 1Q86H 1COMA 3V3TA 4O4IA 3LFOA 1W5FA 2CHSA 5HY2A 1QVFF 5GANK 1XBIA 4BY9D 2QI2A 3M4SA 4ZI7A 2UYKA 3VYSC 4X20A 2KTUA 3NVIB 4I50A 2OTJF 5A2QM 3BYQA 3J80M 3CCMF 4O2AA 4BVSA 1GX1A 3E1YA 3WGNA 3F0DA 3OBWA 5HY4A 3ZO8A 5LA6B 3KJKA 2VXYA 2UYNA 4TV8B 5EZYB 3CCRF 2KG4A 3D01A 3UT5A 3S03A 3J81M 3I56F 2LBXA 1QVGF 4O2AB 3SIUA 4C8EA 3K14A 4O4HB 4G4ZA 4X3LA 3QUWA 5LYJA 2FC3A 3CCEF 2Z1EA 3NVKE 3CMEF 1W5BA 3CPWF 5GONA 3O85A 3C9TA 2HVYD 2QEXF 2K1SA 4TV9A 4RHAA 1XRGA 4X1IB 5LP6B 3V7EA 5IYZA 4BT2A 5CB4A 2HS0A 5JH7B 2V9YA 5CB4B 1XV2A 3R0PA 1YHQF 1QD9A 5AVMA 1GO0A 1YGYA 4O4JA 3GTZA 3WJRA 1YQNA 3FD6A 3MBMA 2LBTA 2YXZA 3S06A 3RYFB 3WPXA 2Q1YA 3CD6F 2RHHA 1NJIH 3CCQF 2KTVA 3C8LA 1ODEA 3F0GA 3K12A 3P0ZA 2GLZA 1N8RH 4ZOLB 5IJ9B 5HY0A 3FD5A 1X7OA 5GAPK 3LWPC 3F0FA 5KMGB 1H48A 3WXMB 5FNVB 2DT4A 1IV4A 2FGYA 2Q1XA 3CCJF 2Z1FA 3VYTC 1NQ3A 1IV3A 4PWTA 4O2BA 5CA0A 2CWJA 2WALA 3LMEA 3N2GB 4IIJA 2HP3A 1OAPA 5J2UA 3PAFA 2MQEA 5GONB 3JARA 1JFFA 1GZ0A 1W581 5ITZA 5LP6A 3GYQA 2EWCA 2ZVYA 4C8GA 1VQOF 1U3LA 3RYCA 1XHOA 3QTYA 2VAMA 4NUTA 1JD1A 2HRUA 4X1YB 3S02A 1YJWF 1UFYA 3N4YA 1RQ7A 2ZAUA 3L7QA 5LXTA 2HS3A 3NK7A 2I6RA 3LYBA 1JFFB 5LYJB 3RYHB 1DT9A 1UI9A 4C8IA 3IMPA 1W2BF 2QTPA 4TV8A 5EZYA 1TVKB 3VO8A 2CW4A 4ZHWA 1FNKA 1PF5A 1X52A 3UT5B 3MQWA 1RA4A 3IEWA 3N2KB 5EAZA 4M8IA 3VOAA 3WPWA 3KJJA 3N4ZA 1W5EA 1Q7YH 3WGKA 3RYFA 4C81A 5EB0A 4NQ3A 3OBYA 1YJ9F 1RLUA 2Z1TA 3IKFA 4ZHVA 4G4XA 5KX5B 1W5AA 3MDOA 5GIPC 3CC2F 3HKBA 3G6EF 3CB2A 4EI7A 1JY8A 3WGMA 5GIOC 3HWUA 3EORA 4O2BB 3JAKA 4G4VA 3I55F 5MN5A 5J2TA 2H6LA 1K9MH 3E22B 3ELCA 4U3JB 5JCOC 5HY1A 1FFXA 2BTQB 3NK6A 5EYPB 3FFMA 1Z5VA 1Q8RA 5GINC 1VQ4F 3FBAA 1U3PA 1OFUA 2G9IA 2HQSC 1QU9A 4BT3A 4I4TB 2DYYA 1H47A 3JASA 3PLAC 3I3FA 1R1MA 2IAFA 3KIZA 1FNJA 5JQGB 3CCVF 2AIZP 3SIVA 4YJ2B 4G4WA 3G71F 5CA1B 3LWRC 4DRXA 3VMFB 3V7QA 4ERHA
chains in the Genus database with same CATH topology
3JCMM 3LWPC 2ALEA 2CZWA 4BW0B 1SDSA 2F9ZC 3VI6A 3WXMB 1ZWZA 2FGYA 2AIFA 3CCJF 1VQPF 3OW2F 2OTLF 3CCUF 1W42A 4BVTA 4LCKA 3AGKA 3MCAB 1W41A 3LWVC 4XCQA 1VQ8F 2WALA 3NMUC 1VQMF 3PAFA 3E20B 1CN7A 3RA6A 4BVQA 1NMUB 3IR9A 1GZ0A 3LWQC 3GYQA 1KD1H 1KQSF 5IT9M 4BVRA 1CK2A 4C4WC 1VQOF 1YI2F 1PXWA 4NUTA 1VQ6F 3CCSF 1YJWF 1K73H 5HXZA 3N4YA 1Q86H 3V3TA 1Q82H 3LFOA 5HY2A 1QVFF 2VGMA 5GANK 1XBIA 4BY9D 3NK7A 4TZZA 1JJ2F 2QI2A 1DT9A 1W2BF 1IPAA 2KTUA 3RA5A 3NVIB 2OTJF 5A2QM 1W3EX 2QA4F 5G4VC 3J80M 3CCMF 1YJNF 5EWRA 4BVSA 1VQKF 1X52A 1KC8H 4X3MA 3CXCF 3E1YA 3HAXD 1YIJF 3OBWA 3ON1A 5HY4A 1RA4A 3CCRF 1W40A 2KG4A 4EI9A 1VQ5F 1VQ9F 5EO3A 3N4ZA 3CG6A 3J81M 1GO1A 3I56F 2LBXA 1QVGF 1H7MA 1Q7YH 2OZBA 3SIUA 1K8AH 3JAMM 2VGNA 4NQ3A 3OBYA 1YJ9F 3HJWC 4X3LA 2OHWA 5G4UC 1T0KB 1YITF 2FC3A 3CCEF 3NVKE 5GIPC 3CMEF 1X7PA 3G6EF 3CC2F 3CPWF 4EI7A 1Q81H 3CMAF 5GIOC 3O85A 5DCVA 3D00A 2HVYD 2QEXF 3CC4F 3CC7F 3V7EA 3I55F 1VQLF 2I6DA 3G4SF 1S72F 3CCLF 3LWOC 1K9MH 2LBWA 5HY1A 3NK6A 1VQNF 1YHQF 3CPQA 3J7AR 3FFMA 4EI8A 2JNBA 1M1KH 1RLGA 1GO0A 5FJ4C 5GINC 1VQ4F 1M90H 1VQ7F 3PLAC 1E7KA 5HWEA 3CD6F 5FLXM 2BO1A 3CCVF 1NJIH 5HXUA 3CCQF 2KTVA 3SIVA 3G71F 3LWRC 2GLZA 3VMFB 1N8RH 5HY0A 1X7OA 3V7QA 5GAPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM M;  3LWP C;  2ALE A;  2CZW A;  4BW0 B;  1SDS A;  3WXM B;  3VI6 A;  1ZWZ A;  2AIF A;  3CCJ F;  1VQP F;  3OW2 F;  2OTL F;  3CCU F;  1W42 A;  4LCK A;  3AGK A;  3MCA B;  1W41 A;  3LWV C;  1VQ8 F;  2WAL A;  3NMU C;  1VQM F;  3PAF A;  3E20 B;  1CN7 A;  3RA6 A;  1NMU B;  3IR9 A;  1GZ0 A;  3LWQ C;  3GYQ A;  1KD1 H;  1KQS F;  5IT9 M;  1CK2 A;  4C4W C;  1VQO F;  1YI2 F;  1PXW A;  4NUT A;  1VQ6 F;  3CCS F;  1YJW F;  1K73 H;  3N4Y A;  1Q86 H;  1Q82 H;  3LFO A;  1QVF F;  2VGM A;  5GAN K;  1XBI A;  4BY9 D;  3NK7 A;  4TZZ A;  1JJ2 F;  2QI2 A;  1DT9 A;  1W2B F;  1IPA A;  2KTU A;  3RA5 A;  3NVI B;  2OTJ F;  5A2Q M;  1W3E X;  2QA4 F;  5G4V C;  3J80 M;  3CCM F;  1YJN F;  5EWR A;  1VQK F;  1X52 A;  1KC8 H;  4X3M A;  3CXC F;  3E1Y A;  3HAX D;  1YIJ F;  3OBW A;  3ON1 A;  1RA4 A;  3CCR F;  1W40 A;  2KG4 A;  1VQ5 F;  1VQ9 F;  5EO3 A;  3N4Z A;  3CG6 A;  3J81 M;  1GO1 A;  3I56 F;  2LBX A;  1QVG F;  1H7M A;  1Q7Y H;  2OZB A;  3SIU A;  1K8A H;  3JAM M;  2VGN A;  3OBY A;  1YJ9 F;  3HJW C;  4X3L A;  2OHW A;  5G4U C;  1T0K B;  1YIT F;  2FC3 A;  3CCE F;  3NVK E;  5GIP C;  3CME F;  1X7P A;  3G6E F;  3CC2 F;  3CPW F;  1Q81 H;  3CMA F;  5GIO C;  3O85 A;  5DCV A;  2HVY D;  2QEX F;  3CC4 F;  3CC7 F;  3V7E A;  3I55 F;  1VQL F;  2I6D A;  3G4S F;  1S72 F;  3CCL F;  3LWO C;  1K9M H;  2LBW A;  3NK6 A;  1VQN F;  1YHQ F;  3CPQ A;  3J7A R;  3FFM A;  2JNB A;  1M1K H;  1RLG A;  1GO0 A;  5FJ4 C;  5GIN C;  1VQ4 F;  1M90 H;  1VQ7 F;  3PLA C;  1E7K A;  3CD6 F;  5FLX M;  2BO1 A;  3CCV F;  1NJI H;  3CCQ F;  2KTV A;  3SIV A;  3G71 F;  3LWR C;  3VMF B;  1N8R H;  1X7O A;  3V7Q A;  5GAP K; 
#chains in the Genus database with same CATH topology
 3ZP7 A;  3S0Y A;  2F9Z C;  3VI6 A;  4ZK7 A;  1VH8 A;  4TV9 B;  1VQP F;  3OW2 F;  2OTL F;  1TUB A;  3AGK A;  1W41 A;  5LP6 C;  2BTU A;  1VQ8 F;  2IG8 A;  3IEQ A;  1SA0 B;  3NMU C;  4I4T A;  2HRY A;  4O4L A;  2CVL A;  1VHA A;  5IT9 M;  2BTO A;  3VIU A;  1CK2 A;  4BVR A;  1J7H A;  4IHJ B;  1PXW A;  3HKD B;  3E22 A;  4FFB B;  4U3J A;  2YYE A;  4BT7 A;  1Q82 H;  4DRX B;  2VGM A;  3GHZ A;  2LCA A;  2RHO A;  2ZOD A;  1KNK A;  2QA4 F;  3D54 A;  1U40 A;  5JVD B;  5EWR A;  4YJ2 A;  2Z1U A;  1KC8 H;  2H8C A;  3CXC F;  3HAX D;  1YIJ F;  1W59 A;  3JAW B;  3S0W A;  3JVH A;  4U39 A;  5EYP A;  3TD4 A;  3JAS B;  4X20 B;  1W40 A;  3B6N A;  4EI9 A;  4O4J B;  3RYC B;  1VQ9 F;  4YJ3 A;  3CG6 A;  2HX0 A;  5ITZ B;  2OZB A;  3M84 A;  4B45 A;  5BMV A;  3HJW C;  2OHW A;  3C9U A;  1T0K B;  1YIT F;  4I55 B;  3I7T A;  3FPI A;  3HTN A;  3RE3 A;  4I55 A;  3V4D A;  1CLI A;  4X1K A;  1Q81 H;  3K0T A;  5DCV A;  3D00 A;  3HKB B;  3F0E A;  3WGL A;  4TUY A;  5IYZ B;  4ZHQ B;  3CC4 F;  1VQL F;  4C82 A;  4HNA B;  5KMG A;  2I6D A;  2H8E A;  1S72 F;  4X1Y A;  2LBW A;  5EIB C;  1SA0 A;  4EI8 A;  1M1K H;  1RLG A;  2VAP A;  2W8B C;  3M1X A;  4O4L B;  2R6R 1;  1RQ2 A;  5EIB D;  3ZOP A;  1VQ7 F;  2CHT A;  1TVK A;  5J2U B;  5HP8 A;  3HKE B;  1E7K A;  3ERN A;  2L26 A;  5FLX M;  5HXU A;  3RYI A;  4DXD A;  3KE1 A;  4B62 A;  4NWO B;  3IKE A;  3HKC B;  5LOV B;  5CA1 A;  2ALE A;  4FFB A;  4BW0 B;  3RYH A;  1SDS A;  5B8F A;  3WJQ A;  3JAR B;  4EB6 A;  3TD3 A;  4ZOL A;  5IJ9 A;  3LDT A;  3CCU F;  1W42 A;  5MN6 A;  2PHN A;  4BVT A;  4BT5 A;  5CA0 B;  3LWV C;  4XCQ A;  3P10 A;  5C8Y A;  5JVD A;  1VQM F;  4F6R B;  1IV2 A;  1KNJ A;  3VCZ A;  4R40 B;  3E20 B;  1W57 A;  4X1K B;  4BVQ A;  4O4H A;  3C9S A;  3LWQ C;  5IJ0 B;  1FSZ A;  3JAL A;  3CCS F;  2AMT A;  5J2T B;  3F6M A;  1SZQ A;  5MN4 A;  1ONI A;  4TZZ A;  4ZHY B;  1JJ2 F;  2OTM A;  5JQG A;  5KX5 A;  2RHJ A;  3T80 A;  1QAH A;  1IPA A;  5JCO A;  3RA5 A;  3C9R A;  2UYJ A;  3K2X A;  3DC2 A;  1W3E X;  2ZOV A;  5G4V C;  4ZI7 B;  3CYQ A;  3JAW A;  1YJN F;  1VQK F;  3TD5 A;  4X3M A;  2RB9 A;  3ON1 A;  2KGW A;  3HKC A;  3KHN A;  1VQ5 F;  3RYI B;  2B33 A;  5EO3 A;  5IJ0 A;  1GO1 A;  1H7M A;  1JN1 A;  1K8A H;  3HKE A;  2HP0 A;  2GZL A;  2UYN B;  3JAM M;  3N2K A;  2VGN A;  2VAW A;  3Q8H A;  3HKD A;  5G4U C;  3VOB A;  2RHL A;  2PMP A;  2IQQ A;  3QHD A;  3OON A;  1DBF A;  4G88 A;  1X7P A;  4I50 B;  1U43 A;  5EB1 B;  3CMA F;  3WGJ A;  2CSL A;  5C8Y B;  3ZP4 A;  3WJP A;  2N48 A;  4LNU A;  3CC7 F;  4TUY B;  3G4S F;  1VK3 A;  1TUB B;  3MCQ A;  3CCL F;  3LWO C;  4EB6 B;  4E6E A;  4BT6 A;  5LA6 A;  3P4E A;  1VQN F;  3CPQ A;  4RQO A;  3J7A R;  4B46 A;  2JNB A;  4ZHQ A;  5FJ4 C;  1T0A A;  4WBN B;  1Z5W A;  5BMV B;  1M90 H;  5LOV A;  2Z01 A;  3VTI C;  3N2G A;  5HWE A;  2ZVZ A;  2BO1 A;  4BT4 A;  5FNV A;  5LXT B;  4O4I B;  4B5C A;  2ZF8 A;  3JAT B;  2HS4 A;  1IV1 A;  3JCM M;  2CZW A;  1X25 A;  3U0O A;  4HNA A;  4LNU B;  3S0H A;  2UZH A;  1ZWZ A;  3VYU C;  2AIF A;  2R75 1;  2NMU A;  2GVI A;  1FFX B;  4KWE A;  3ESJ A;  4G4Y A;  4LCK A;  2UYP A;  4IIJ B;  3MCA B;  3CYP B;  3DDN A;  2P6Y A;  1W55 A;  1CN7 A;  3RA6 A;  4WBN A;  2HP0 B;  3JAL B;  1NMU B;  3IR9 A;  1VQV A;  1KD1 H;  4X1I A;  1KQS F;  3JAK B;  4C4W C;  4YJ3 B;  1YI2 F;  5JH7 A;  1VQ6 F;  1K73 H;  3JAT A;  5HP7 A;  5HXZ A;  4F6R A;  4IHJ A;  1Q86 H;  1COM A;  3V3T A;  4O4I A;  3LFO A;  1W5F A;  2CHS A;  5HY2 A;  1QVF F;  5GAN K;  1XBI A;  4BY9 D;  2QI2 A;  3M4S A;  4ZI7 A;  2UYK A;  3VYS C;  4X20 A;  2KTU A;  3NVI B;  4I50 A;  2OTJ F;  5A2Q M;  3BYQ A;  3J80 M;  3CCM F;  4O2A A;  4BVS A;  1GX1 A;  3E1Y A;  3WGN A;  3F0D A;  3OBW A;  5HY4 A;  3ZO8 A;  5LA6 B;  3KJK A;  2VXY A;  2UYN A;  4TV8 B;  5EZY B;  3CCR F;  2KG4 A;  3D01 A;  3UT5 A;  3S03 A;  3J81 M;  3I56 F;  2LBX A;  1QVG F;  4O2A B;  3SIU A;  4C8E A;  3K14 A;  4O4H B;  4G4Z A;  4X3L A;  3QUW A;  5LYJ A;  2FC3 A;  3CCE F;  2Z1E A;  3NVK E;  3CME F;  1W5B A;  3CPW F;  5GON A;  3O85 A;  3C9T A;  2HVY D;  2QEX F;  2K1S A;  4TV9 A;  4RHA A;  1XRG A;  4X1I B;  5LP6 B;  3V7E A;  5IYZ A;  4BT2 A;  5CB4 A;  2HS0 A;  5JH7 B;  2V9Y A;  5CB4 B;  1XV2 A;  3R0P A;  1YHQ F;  1QD9 A;  5AVM A;  1GO0 A;  1YGY A;  4O4J A;  3GTZ A;  3WJR A;  1YQN A;  3FD6 A;  3MBM A;  2LBT A;  2YXZ A;  3S06 A;  3RYF B;  3WPX A;  2Q1Y A;  3CD6 F;  2RHH A;  1NJI H;  3CCQ F;  2KTV A;  3C8L A;  1ODE A;  3F0G A;  3K12 A;  3P0Z A;  2GLZ A;  1N8R H;  4ZOL B;  5IJ9 B;  5HY0 A;  3FD5 A;  1X7O A;  5GAP K;  3LWP C;  3F0F A;  5KMG B;  1H48 A;  3WXM B;  5FNV B;  2DT4 A;  1IV4 A;  2FGY A;  2Q1X A;  3CCJ F;  2Z1F A;  3VYT C;  1NQ3 A;  1IV3 A;  4PWT A;  4O2B A;  5CA0 A;  2CWJ A;  2WAL A;  3LME A;  3N2G B;  4IIJ A;  2HP3 A;  1OAP A;  5J2U A;  3PAF A;  2MQE A;  5GON B;  3JAR A;  1JFF A;  1GZ0 A;  1W58 1;  5ITZ A;  5LP6 A;  3GYQ A;  2EWC A;  2ZVY A;  4C8G A;  1VQO F;  1U3L A;  3RYC A;  1XHO A;  3QTY A;  2VAM A;  4NUT A;  1JD1 A;  2HRU A;  4X1Y B;  3S02 A;  1YJW F;  1UFY A;  3N4Y A;  1RQ7 A;  2ZAU A;  3L7Q A;  5LXT A;  2HS3 A;  3NK7 A;  2I6R A;  3LYB A;  1JFF B;  5LYJ B;  3RYH B;  1DT9 A;  1UI9 A;  4C8I A;  3IMP A;  1W2B F;  2QTP A;  4TV8 A;  5EZY A;  1TVK B;  3VO8 A;  2CW4 A;  4ZHW A;  1FNK A;  1PF5 A;  1X52 A;  3UT5 B;  3MQW A;  1RA4 A;  3IEW A;  3N2K B;  5EAZ A;  4M8I A;  3VOA A;  3WPW A;  3KJJ A;  3N4Z A;  1W5E A;  1Q7Y H;  3WGK A;  3RYF A;  4C81 A;  5EB0 A;  4NQ3 A;  3OBY A;  1YJ9 F;  1RLU A;  2Z1T A;  3IKF A;  4ZHV A;  4G4X A;  5KX5 B;  1W5A A;  3MDO A;  5GIP C;  3CC2 F;  3HKB A;  3G6E F;  3CB2 A;  4EI7 A;  1JY8 A;  3WGM A;  5GIO C;  3HWU A;  3EOR A;  4O2B B;  3JAK A;  4G4V A;  3I55 F;  5MN5 A;  5J2T A;  2H6L A;  1K9M H;  3E22 B;  3ELC A;  4U3J B;  5JCO C;  5HY1 A;  1FFX A;  2BTQ B;  3NK6 A;  5EYP B;  3FFM A;  1Z5V A;  1Q8R A;  5GIN C;  1VQ4 F;  3FBA A;  1U3P A;  1OFU A;  2G9I A;  2HQS C;  1QU9 A;  4BT3 A;  4I4T B;  2DYY A;  1H47 A;  3JAS A;  3PLA C;  3I3F A;  1R1M A;  2IAF A;  3KIZ A;  1FNJ A;  5JQG B;  3CCV F;  2AIZ P;  3SIV A;  4YJ2 B;  4G4W A;  3G71 F;  5CA1 B;  3LWR C;  4DRX A;  3VMF B;  3V7Q A;  4ERH A; 
#chains in the Genus database with same CATH homology
 3JCM M;  3LWP C;  2ALE A;  2CZW A;  4BW0 B;  1SDS A;  2F9Z C;  3VI6 A;  3WXM B;  1ZWZ A;  2FGY A;  2AIF A;  3CCJ F;  1VQP F;  3OW2 F;  2OTL F;  3CCU F;  1W42 A;  4BVT A;  4LCK A;  3AGK A;  3MCA B;  1W41 A;  3LWV C;  4XCQ A;  1VQ8 F;  2WAL A;  3NMU C;  1VQM F;  3PAF A;  3E20 B;  1CN7 A;  3RA6 A;  4BVQ A;  1NMU B;  3IR9 A;  1GZ0 A;  3LWQ C;  3GYQ A;  1KD1 H;  1KQS F;  5IT9 M;  4BVR A;  1CK2 A;  4C4W C;  1VQO F;  1YI2 F;  1PXW A;  4NUT A;  1VQ6 F;  3CCS F;  1YJW F;  1K73 H;  5HXZ A;  3N4Y A;  1Q86 H;  3V3T A;  1Q82 H;  3LFO A;  5HY2 A;  1QVF F;  2VGM A;  5GAN K;  1XBI A;  4BY9 D;  3NK7 A;  4TZZ A;  1JJ2 F;  2QI2 A;  1DT9 A;  1W2B F;  1IPA A;  2KTU A;  3RA5 A;  3NVI B;  2OTJ F;  5A2Q M;  1W3E X;  2QA4 F;  5G4V C;  3J80 M;  3CCM F;  1YJN F;  5EWR A;  4BVS A;  1VQK F;  1X52 A;  1KC8 H;  4X3M A;  3CXC F;  3E1Y A;  3HAX D;  1YIJ F;  3OBW A;  3ON1 A;  5HY4 A;  1RA4 A;  3CCR F;  1W40 A;  2KG4 A;  4EI9 A;  1VQ5 F;  1VQ9 F;  5EO3 A;  3N4Z A;  3CG6 A;  3J81 M;  1GO1 A;  3I56 F;  2LBX A;  1QVG F;  1H7M A;  1Q7Y H;  2OZB A;  3SIU A;  1K8A H;  3JAM M;  2VGN A;  4NQ3 A;  3OBY A;  1YJ9 F;  3HJW C;  4X3L A;  2OHW A;  5G4U C;  1T0K B;  1YIT F;  2FC3 A;  3CCE F;  3NVK E;  5GIP C;  3CME F;  1X7P A;  3G6E F;  3CC2 F;  3CPW F;  4EI7 A;  1Q81 H;  3CMA F;  5GIO C;  3O85 A;  5DCV A;  3D00 A;  2HVY D;  2QEX F;  3CC4 F;  3CC7 F;  3V7E A;  3I55 F;  1VQL F;  2I6D A;  3G4S F;  1S72 F;  3CCL F;  3LWO C;  1K9M H;  2LBW A;  5HY1 A;  3NK6 A;  1VQN F;  1YHQ F;  3CPQ A;  3J7A R;  3FFM A;  4EI8 A;  2JNB A;  1M1K H;  1RLG A;  1GO0 A;  5FJ4 C;  5GIN C;  1VQ4 F;  1M90 H;  1VQ7 F;  3PLA C;  1E7K A;  5HWE A;  3CD6 F;  5FLX M;  2BO1 A;  3CCV F;  1NJI H;  5HXU A;  3CCQ F;  2KTV A;  3SIV A;  3G71 F;  3LWR C;  2GLZ A;  3VMF B;  1N8R H;  5HY0 A;  1X7O A;  3V7Q A;  5GAP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...