1RLGA

Molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
VPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of Box C/D RNA-Protein Interactions; Cocrystal Structure of Archaeal L7Ae and a Box C/D RNA.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural protein/rna
molecule keywords 25-MER
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1rlgA00
1Q86H 3AGKA 1VQ6F 1SDSA 1YJWF 1YIJF 3WXMB 2OTJF 5GAPK 1K9MH 5GIOC 3G6EF 2HVYD 3NVIB 1VQKF 5G4VC 4LCKA 2LBXA 1CK2A 1XBIA 1X7OA 2WALA 1VQ5F 3CXCF 5EWRA 1VQ8F 3LFOA 3CCQF 1K8AH 3LWVC 4X3LA 3CCEF 3MCAB 3J81M 1VQ7F 2AIFA 3E20B 2VGNA 3J80M 3CMEF 1VQ4F 1YJ9F 3HJWC 1W42A 1QVGF 2LBWA 1VQLF 1VQOF 3RA5A 3I55F 1VQ9F 1W40A 5A2QM 1E7KA 1N8RH 1T0KB 3V7QA 1NMUB 1DT9A 3CCUF 3HAXD 4NUTA 3NK7A 2QEXF 3PLAC 1W41A 3CC2F 1X52A 3SIUA 1KD1H 1YI2F 3SIVA 2FC3A 2QI2A 3CCVF 2OZBA 3ON1A 1GZ0A 3LWRC 3LWPC 3OW2F 3CCSF 3CCMF 2VGMA 1Q82H 1X7PA 1QVFF 1RLGA 3VMFB 1CN7A 3CPWF 2ALEA 3CMAF 3CPQA 1GO1A 1Q81H 3RA6A 3G71F 3N4YA 1IPAA 4BW0B 1KQSF 3CCLF 3LWOC 3JCMM 3I56F 3NVKE 2QA4F 3CC7F 5GINC 4TZZA 1VQMF 3CD6F 5GIPC 2JNBA 1NJIH 2BO1A 3V7EA 1ZWZA 1KC8H 1H7MA 1VQPF 3OBWA 3LWQC 2OTLF 1K73H 2KG4A 1RA4A 3E1YA 3N4ZA 1M90H 2CZWA 3FFMA 2KTVA 3JAMM 2I6DA 1YJNF 3OBYA 3IR9A 1YITF 1W2BF 1S72F 1YHQF 1M1KH 5DCVA 5G4UC 3VI6A 5FLXM 3J7AR 1Q7YH 4C4WC 1PXWA 1GO0A 3CCJF 2KTUA 4BY9D 3NMUC 3NK6A 5IT9M 5FJ4C 1W3EX 3PAFA 1VQNF 2OHWA 3GYQA 1JJ2F 5GANK 3CG6A 5EO3A 3CCRF 3O85A 3G4SF 4X3MA 3CC4F
chains in the Genus database with same CATH superfamily
1Q86H 2ZVZA 3AGKA 4ZI7B 4EB6A 1U40A 5CB4A 2Z1TA 4TV8A 2OTJF 1JFFB 5GIOC 1RQ2A 2HVYD 4ZHWA 1RQ7A 3KHNA 4I50A 3S03A 5G4VC 1VQKF 3TD4A 4LCKA 4X20A 5ITZB 2BTQB 2WALA 5J2UA 3IKFA 5FNVA 3F0DA 5EIBC 3MDOA 4X3LA 5JH7B 3CCEF 3J81M 5LYJB 3J80M 4O2AA 3M4SA 4B45A 1UI9A 5BMVB 4KWEA 1PF5A 2LBWA 4O2BB 5IYZA 1N8RH 4O4IA 1T0KB 4ZK7A 2H6LA 4BT2A 4TUYA 3DDNA 5LP6C 1TUBA 3C9RA 1KD1H 3EORA 5AVMA 3D00A 2K1SA 5LXTB 2AIZP 3HKCA 1OFUA 3LDTA 4G4VA 5EZYB 5LP6B 1RLGA 5EZYA 2IQQA 3WGMA 1SA0B 1GO1A 4BT3A 3G71F 3N4YA 3WGKA 4BW0B 3C9TA 3CCLF 5KX5A 3NVKE 3UT5B 3VYUC 4R40B 4BVRA 3QTYA 1VQMF 3HWUA 5CA0A 2JNBA 4X1YB 3IEQA 2RHLA 4O4IB 4IHJA 3VYTC 3V7EA 1ZWZA 1VK3A 3DC2A 3ZOPA 5CA0B 3LWQC 3N2GB 2KG4A 2CVLA 2GLZA 3E1YA 3N4ZA 2G9IA 1M90H 4BVSA 2CZWA 1KNKA 1DBFA 3FFMA 5JH7A 4ZOLA 3JARB 1SA0A 3OBYA 3VOBA 1COMA 3LYBA 2HS3A 3IR9A 4O4HB 2EWCA 1S72F 5FLXM 4X20B 3D01A 4NWOB 4G4XA 2ZVYA 4I50B 4BT7A 1GO0A 1JFFA 4ERHA 1W3EX 3PAFA 5CB4B 3JAWB 1Z5WA 2Q1YA 4BVQA 2B33A 5EO3A 5CA1B 1RLUA 5C8YA 3HKEA 4YJ3B 5IJ9A 1H48A 1VQ6F 3F0GA 3VTIC 1YJWF 1YIJF 4F6RA 3FD5A 5IJ0A 2HS0A 1IV2A 1VQVA 4DXDA 1XHOA 3QUWA 5MN6A 3JAKB 4I4TB 3LMEA 5MN4A 1U43A 2Z1FA 4O2AB 2DYYA 2OTMA 3CXCF 4O4JA 3K0TA 2UYJA 2CHSA 2VAMA 3MCAB 3JASB 1VQ4F 4G88A 1JN1A 5MN5A 2KGWA 5HXZA 3V3TA 1QVGF 1U3PA 1VQOF 4TV9A 4X1KB 5A2QM 1YGYA 2BTOA 2W8BC 3P4EA 2RHOA 5HY2A 3GHZA 3ZP7A 4EB6B 3GTZA 3U0OA 3HAXD 4I4TA 3NK7A 3CC2F 1GX1A 2ZODA 1YI2F 2BTUA 3C9SA 1QAHA 3CCVF 2OZBA 4F6RB 5IJ0B 3ON1A 3IKEA 4YJ2B 3RYFB 3ERNA 3OW2F 4ZHQB 1FSZA 1YQNA 2UYNA 4G4YA 5LOVA 2VGMA 1Q82H 1X7PA 4RQOA 3HKBB 3WPWA 2PHNA 4WBNB 3CMAF 4DRXB 5CA1A 3I3FA 4ZHYB 2Z01A 3F0EA 1QU9A 3MBMA 1KQSF 5JQGA 1H47A 3BYQA 4I55B 4ZHVA 4TV9B 4X1KA 4TZZA 2H8CA 3CD6F 5GIPC 1XV2A 5EIBD 2F9ZC 2YXZA 3QHDA 4ZOLB 3IMPA 1KC8H 2UYPA 3OBWA 3RYHB 5HP8A 3D54A 5EYPA 1UFYA 2IG8A 3JAKA 4BT5A 2Q1XA 1W5AA 1FFXB 5EB0A 2KTVA 2I6DA 1VH8A 3WGJA 3F6MA 4C81A 5G4UC 4LNUB 3J7AR 5C8YB 2HP3A 4C4WC 3E22B 4BVTA 4YJ3A 5IJ9B 3CCJF 4BY9D 2R751 3NK6A 3JAWA 5J2TA 5KX5B 3OONA 2VAWA 3GYQA 1JJ2F 5GANK 1IV4A 3O85A 5LP6A 3G4SF 4X3MA 5EAZA 3CC4F 3HKCB 1SDSA 3R0PA 2P6YA 3K12A 4RHAA 2LBTA 5GAPK 1K9MH 4C82A 4B5CA 3G6EF 2HRYA 2YYEA 5J2TB 1X7OA 3KIZA 3ESJA 2HQSC 3F0FA 1TUBB 3RYIB 5EWRA 3LFOA 2HX0A 3N2GA 3CCQF 3K2XA 3LWVC 2AIFA 2I6RA 2VGNA 1OAPA 3CMEF 1YJ9F 1FFXA 4IHJB 3RYIA 3HJWC 4O2BA 3JALB 5LYJA 3RA5A 1VQ9F 1W40A 3ZO8A 3RYCB 5HP7A 3RYHA 3V7QA 1NMUB 3CCUF 3VIUA 4NUTA 2QEXF 3PLAC 1X52A 2ZF8A 3KJKA 3SIVA 3C9UA 2QI2A 3RE3A 1X25A 4I55A 1GZ0A 3CCSF 4C8IA 2RHJA 5HXUA 2H8EA 1J7HA 2ZOVA 3CPQA 4U3JB 1Q81H 3RA6A 4TUYB 3WJPA 1IPAA 5IYZB 3VYSC 4ZHQA 2FGYA 1IV3A 1ODEA 3KJJA 2CW4A 3JCMM 3I56F 3L7QA 4O4LA 5BMVA 2QTPA 2QA4F 3CC7F 5GINC 4BT6A 4BT4A 1NJIH 2HP0A 2HRUA 2Z1UA 5JVDB 4EI8A 1H7MA 3JALA 5FNVB 2OTLF 5J2UB 5ITZA 1K73H 3P0ZA 3S02A 1JY8A 3WGNA 4IIJB 5JQGB 1U3LA 1YITF 4ZI7A 1ONIA 1KNJA 4TV8B 3P10A 4O4JB 3VI6A 1Q7YH 4WBNA 1PXWA 4B62A 2N48A 3C8LA 3HKBA 3NMUC 5IT9M 5HY4A 2Z1EA 4X1IA 4HNAA 2RHHA 2VAPA 3VCZA 3CYPB 4PWTA 4G4WA 1TVKB 1SZQA 5HY1A 2ZAUA 2CWJA 1VHAA 4C8GA 5EB1B 3S06A 5KMGA 1Q8RA 2HS4A 3RYCA 2PMPA 3WXMB 2GVIA 3NVIB 3M84A 1NQ3A 2LBXA 1CK2A 3N2KB 1XBIA 3WJRA 4LNUA 3T80A 4M8IA 1VQ5F 3I7TA 4U39A 1VQ8F 2AMTA 1K8AH 3S0WA 4C8EA 2LCAA 4FFBA 1VQ7F 1W57A 3E20B 3JARA 1FNKA 2CHTA 3HKDA 3TD5A 1W42A 5HY0A 1VQLF 3B6NA 3FPIA 3I55F 1E7KA 3WGLA 3HTNA 2DT4A 3MQWA 3VO8A 5LA6B 1IV1A 1DT9A 3JVHA 1JD1A 1W41A 3JATA 3N2KA 5GONB 3SIUA 2IAFA 2FC3A 1W581 3HKEB 5JCOC 2UYKA 3LWRC 3ELCA 3WPXA 3LWPC 1W55A 3CCMF 5KMGB 3Q8HA 3E22A 1XRGA 5GONA 1QVFF 3VMFB 5LOVB 1CN7A 3CPWF 2ALEA 3CYQA 5JCOA 4EI9A 4HNAB 3JATB 1TVKA 4O4HA 4EI7A 5LA6A 3LWOC 2CSLA 5LXTA 2GZLA 1Z5VA 3K14A 3HKDB 5EYPB 3FD6A 3IEWA 2L26A 2UZHA 2BO1A 2NMUA 3M1XA 3V4DA 1QD9A 2R6R1 4XCQA 4FFBB 5B8FA 4IIJA 1VQPF 2MQEA 1R1MA 2V9YA 3S0YA 1RA4A 2VXYA 1T0AA 3JASA 2RB9A 4X1YA 3S0HA 3KE1A 3MCQA 1W5FA 3UT5A 3JAMM 1YJNF 4DRXA 1CLIA 2HP0B 1W2BF 4B46A 5JVDA 1YHQF 1M1KH 5DCVA 1FNJA 4NQ3A 3WJQA 4O4LB 3CB2A 2UYNB 4E6EA 2KTUA 1W5EA 1W5BA 4X1IB 5FJ4C 3RYFA 4YJ2A 1VQNF 4U3JA 3ZP4A 3FBAA 2OHWA 1W59A 4G4ZA 3TD3A 3CG6A 3CCRF 5HWEA 3VOAA
chains in the Genus database with same CATH topology
1Q86H 3AGKA 1VQ6F 1SDSA 1YJWF 1YIJF 3WXMB 2OTJF 5GAPK 1K9MH 5GIOC 3G6EF 2HVYD 3NVIB 1VQKF 5G4VC 4LCKA 2LBXA 1CK2A 1XBIA 1X7OA 2WALA 1VQ5F 3CXCF 5EWRA 1VQ8F 3LFOA 3CCQF 1K8AH 3LWVC 4X3LA 3CCEF 3MCAB 3J81M 1VQ7F 2AIFA 3E20B 2VGNA 3J80M 3CMEF 1VQ4F 1YJ9F 5HXZA 3HJWC 3V3TA 1W42A 1QVGF 5HY0A 2LBWA 1VQLF 1VQOF 3RA5A 3I55F 1VQ9F 1W40A 5A2QM 5HWEA 1E7KA 1N8RH 1T0KB 3V7QA 5HY2A 1NMUB 1DT9A 3CCUF 3HAXD 4NUTA 3NK7A 2QEXF 3PLAC 1W41A 3CC2F 1X52A 3SIUA 1KD1H 1YI2F 3SIVA 2FC3A 2QI2A 3CCVF 2OZBA 3ON1A 1GZ0A 3D00A 3LWRC 3LWPC 3OW2F 3CCSF 3CCMF 5HXUA 2VGMA 1Q82H 1X7PA 1QVFF 1RLGA 3VMFB 1CN7A 3CPWF 2ALEA 3CMAF 4EI9A 3CPQA 1GO1A 1Q81H 3RA6A 3G71F 3N4YA 1IPAA 4BW0B 1KQSF 4EI7A 2FGYA 3LWOC 3CCLF 3JCMM 3I56F 3NVKE 4BVRA 2QA4F 3CC7F 5GINC 4TZZA 1VQMF 3CD6F 5GIPC 2JNBA 1NJIH 2F9ZC 2BO1A 3V7EA 1ZWZA 4XCQA 4EI8A 1KC8H 1H7MA 1VQPF 3OBWA 3LWQC 2OTLF 1K73H 2KG4A 1RA4A 2GLZA 3E1YA 3N4ZA 1M90H 4BVSA 2CZWA 3FFMA 2KTVA 3JAMM 2I6DA 1YJNF 3OBYA 3IR9A 1YITF 1W2BF 1S72F 1YHQF 1M1KH 5DCVA 5G4UC 3VI6A 4NQ3A 5FLXM 3J7AR 1Q7YH 4C4WC 1PXWA 4BVTA 1GO0A 3CCJF 2KTUA 4BY9D 3NMUC 3NK6A 5IT9M 5FJ4C 5HY4A 1W3EX 3PAFA 1VQNF 2OHWA 3GYQA 1JJ2F 5GANK 3CG6A 4BVQA 5EO3A 5HY1A 3CCRF 3O85A 3G4SF 4X3MA 3CC4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 H;  3AGK A;  1VQ6 F;  1SDS A;  1YJW F;  1YIJ F;  3WXM B;  2OTJ F;  5GAP K;  1K9M H;  5GIO C;  3G6E F;  2HVY D;  3NVI B;  1VQK F;  5G4V C;  4LCK A;  2LBX A;  1CK2 A;  1XBI A;  1X7O A;  2WAL A;  1VQ5 F;  3CXC F;  5EWR A;  1VQ8 F;  3LFO A;  3CCQ F;  1K8A H;  3LWV C;  4X3L A;  3CCE F;  3MCA B;  3J81 M;  1VQ7 F;  2AIF A;  3E20 B;  2VGN A;  3J80 M;  3CME F;  1VQ4 F;  1YJ9 F;  3HJW C;  1W42 A;  1QVG F;  2LBW A;  1VQL F;  1VQO F;  3RA5 A;  3I55 F;  1VQ9 F;  1W40 A;  5A2Q M;  1E7K A;  1N8R H;  1T0K B;  3V7Q A;  1NMU B;  1DT9 A;  3CCU F;  3HAX D;  4NUT A;  3NK7 A;  2QEX F;  3PLA C;  1W41 A;  3CC2 F;  1X52 A;  3SIU A;  1KD1 H;  1YI2 F;  3SIV A;  2FC3 A;  2QI2 A;  3CCV F;  2OZB A;  3ON1 A;  1GZ0 A;  3LWR C;  3LWP C;  3OW2 F;  3CCS F;  3CCM F;  2VGM A;  1Q82 H;  1X7P A;  1QVF F;  1RLG A;  3VMF B;  1CN7 A;  3CPW F;  2ALE A;  3CMA F;  3CPQ A;  1GO1 A;  1Q81 H;  3RA6 A;  3G71 F;  3N4Y A;  1IPA A;  4BW0 B;  1KQS F;  3CCL F;  3LWO C;  3JCM M;  3I56 F;  3NVK E;  2QA4 F;  3CC7 F;  5GIN C;  4TZZ A;  1VQM F;  3CD6 F;  5GIP C;  2JNB A;  1NJI H;  2BO1 A;  3V7E A;  1ZWZ A;  1KC8 H;  1H7M A;  1VQP F;  3OBW A;  3LWQ C;  2OTL F;  1K73 H;  2KG4 A;  1RA4 A;  3E1Y A;  3N4Z A;  1M90 H;  2CZW A;  3FFM A;  2KTV A;  3JAM M;  2I6D A;  1YJN F;  3OBY A;  3IR9 A;  1YIT F;  1W2B F;  1S72 F;  1YHQ F;  1M1K H;  5DCV A;  5G4U C;  3VI6 A;  5FLX M;  3J7A R;  1Q7Y H;  4C4W C;  1PXW A;  1GO0 A;  3CCJ F;  2KTU A;  4BY9 D;  3NMU C;  3NK6 A;  5IT9 M;  5FJ4 C;  1W3E X;  3PAF A;  1VQN F;  2OHW A;  3GYQ A;  1JJ2 F;  5GAN K;  3CG6 A;  5EO3 A;  3CCR F;  3O85 A;  3G4S F;  4X3M A;  3CC4 F; 
#chains in the Genus database with same CATH topology
 1Q86 H;  2ZVZ A;  3AGK A;  4ZI7 B;  4EB6 A;  1U40 A;  5CB4 A;  2Z1T A;  4TV8 A;  2OTJ F;  1JFF B;  5GIO C;  1RQ2 A;  2HVY D;  4ZHW A;  1RQ7 A;  3KHN A;  4I50 A;  3S03 A;  5G4V C;  1VQK F;  3TD4 A;  4LCK A;  4X20 A;  5ITZ B;  2BTQ B;  2WAL A;  5J2U A;  3IKF A;  5FNV A;  3F0D A;  5EIB C;  3MDO A;  4X3L A;  5JH7 B;  3CCE F;  3J81 M;  5LYJ B;  3J80 M;  4O2A A;  3M4S A;  4B45 A;  1UI9 A;  5BMV B;  4KWE A;  1PF5 A;  2LBW A;  4O2B B;  5IYZ A;  1N8R H;  4O4I A;  1T0K B;  4ZK7 A;  2H6L A;  4BT2 A;  4TUY A;  3DDN A;  5LP6 C;  1TUB A;  3C9R A;  1KD1 H;  3EOR A;  5AVM A;  3D00 A;  2K1S A;  5LXT B;  2AIZ P;  3HKC A;  1OFU A;  3LDT A;  4G4V A;  5EZY B;  5LP6 B;  1RLG A;  5EZY A;  2IQQ A;  3WGM A;  1SA0 B;  1GO1 A;  4BT3 A;  3G71 F;  3N4Y A;  3WGK A;  4BW0 B;  3C9T A;  3CCL F;  5KX5 A;  3NVK E;  3UT5 B;  3VYU C;  4R40 B;  4BVR A;  3QTY A;  1VQM F;  3HWU A;  5CA0 A;  2JNB A;  4X1Y B;  3IEQ A;  2RHL A;  4O4I B;  4IHJ A;  3VYT C;  3V7E A;  1ZWZ A;  1VK3 A;  3DC2 A;  3ZOP A;  5CA0 B;  3LWQ C;  3N2G B;  2KG4 A;  2CVL A;  2GLZ A;  3E1Y A;  3N4Z A;  2G9I A;  1M90 H;  4BVS A;  2CZW A;  1KNK A;  1DBF A;  3FFM A;  5JH7 A;  4ZOL A;  3JAR B;  1SA0 A;  3OBY A;  3VOB A;  1COM A;  3LYB A;  2HS3 A;  3IR9 A;  4O4H B;  2EWC A;  1S72 F;  5FLX M;  4X20 B;  3D01 A;  4NWO B;  4G4X A;  2ZVY A;  4I50 B;  4BT7 A;  1GO0 A;  1JFF A;  4ERH A;  1W3E X;  3PAF A;  5CB4 B;  3JAW B;  1Z5W A;  2Q1Y A;  4BVQ A;  2B33 A;  5EO3 A;  5CA1 B;  1RLU A;  5C8Y A;  3HKE A;  4YJ3 B;  5IJ9 A;  1H48 A;  1VQ6 F;  3F0G A;  3VTI C;  1YJW F;  1YIJ F;  4F6R A;  3FD5 A;  5IJ0 A;  2HS0 A;  1IV2 A;  1VQV A;  4DXD A;  1XHO A;  3QUW A;  5MN6 A;  3JAK B;  4I4T B;  3LME A;  5MN4 A;  1U43 A;  2Z1F A;  4O2A B;  2DYY A;  2OTM A;  3CXC F;  4O4J A;  3K0T A;  2UYJ A;  2CHS A;  2VAM A;  3MCA B;  3JAS B;  1VQ4 F;  4G88 A;  1JN1 A;  5MN5 A;  2KGW A;  5HXZ A;  3V3T A;  1QVG F;  1U3P A;  1VQO F;  4TV9 A;  4X1K B;  5A2Q M;  1YGY A;  2BTO A;  2W8B C;  3P4E A;  2RHO A;  5HY2 A;  3GHZ A;  3ZP7 A;  4EB6 B;  3GTZ A;  3U0O A;  3HAX D;  4I4T A;  3NK7 A;  3CC2 F;  1GX1 A;  2ZOD A;  1YI2 F;  2BTU A;  3C9S A;  1QAH A;  3CCV F;  2OZB A;  4F6R B;  5IJ0 B;  3ON1 A;  3IKE A;  4YJ2 B;  3RYF B;  3ERN A;  3OW2 F;  4ZHQ B;  1FSZ A;  1YQN A;  2UYN A;  4G4Y A;  5LOV A;  2VGM A;  1Q82 H;  1X7P A;  4RQO A;  3HKB B;  3WPW A;  2PHN A;  4WBN B;  3CMA F;  4DRX B;  5CA1 A;  3I3F A;  4ZHY B;  2Z01 A;  3F0E A;  1QU9 A;  3MBM A;  1KQS F;  5JQG A;  1H47 A;  3BYQ A;  4I55 B;  4ZHV A;  4TV9 B;  4X1K A;  4TZZ A;  2H8C A;  3CD6 F;  5GIP C;  1XV2 A;  5EIB D;  2F9Z C;  2YXZ A;  3QHD A;  4ZOL B;  3IMP A;  1KC8 H;  2UYP A;  3OBW A;  3RYH B;  5HP8 A;  3D54 A;  5EYP A;  1UFY A;  2IG8 A;  3JAK A;  4BT5 A;  2Q1X A;  1W5A A;  1FFX B;  5EB0 A;  2KTV A;  2I6D A;  1VH8 A;  3WGJ A;  3F6M A;  4C81 A;  5G4U C;  4LNU B;  3J7A R;  5C8Y B;  2HP3 A;  4C4W C;  3E22 B;  4BVT A;  4YJ3 A;  5IJ9 B;  3CCJ F;  4BY9 D;  2R75 1;  3NK6 A;  3JAW A;  5J2T A;  5KX5 B;  3OON A;  2VAW A;  3GYQ A;  1JJ2 F;  5GAN K;  1IV4 A;  3O85 A;  5LP6 A;  3G4S F;  4X3M A;  5EAZ A;  3CC4 F;  3HKC B;  1SDS A;  3R0P A;  2P6Y A;  3K12 A;  4RHA A;  2LBT A;  5GAP K;  1K9M H;  4C82 A;  4B5C A;  3G6E F;  2HRY A;  2YYE A;  5J2T B;  1X7O A;  3KIZ A;  3ESJ A;  2HQS C;  3F0F A;  1TUB B;  3RYI B;  5EWR A;  3LFO A;  2HX0 A;  3N2G A;  3CCQ F;  3K2X A;  3LWV C;  2AIF A;  2I6R A;  2VGN A;  1OAP A;  3CME F;  1YJ9 F;  1FFX A;  4IHJ B;  3RYI A;  3HJW C;  4O2B A;  3JAL B;  5LYJ A;  3RA5 A;  1VQ9 F;  1W40 A;  3ZO8 A;  3RYC B;  5HP7 A;  3RYH A;  3V7Q A;  1NMU B;  3CCU F;  3VIU A;  4NUT A;  2QEX F;  3PLA C;  1X52 A;  2ZF8 A;  3KJK A;  3SIV A;  3C9U A;  2QI2 A;  3RE3 A;  1X25 A;  4I55 A;  1GZ0 A;  3CCS F;  4C8I A;  2RHJ A;  5HXU A;  2H8E A;  1J7H A;  2ZOV A;  3CPQ A;  4U3J B;  1Q81 H;  3RA6 A;  4TUY B;  3WJP A;  1IPA A;  5IYZ B;  3VYS C;  4ZHQ A;  2FGY A;  1IV3 A;  1ODE A;  3KJJ A;  2CW4 A;  3JCM M;  3I56 F;  3L7Q A;  4O4L A;  5BMV A;  2QTP A;  2QA4 F;  3CC7 F;  5GIN C;  4BT6 A;  4BT4 A;  1NJI H;  2HP0 A;  2HRU A;  2Z1U A;  5JVD B;  4EI8 A;  1H7M A;  3JAL A;  5FNV B;  2OTL F;  5J2U B;  5ITZ A;  1K73 H;  3P0Z A;  3S02 A;  1JY8 A;  3WGN A;  4IIJ B;  5JQG B;  1U3L A;  1YIT F;  4ZI7 A;  1ONI A;  1KNJ A;  4TV8 B;  3P10 A;  4O4J B;  3VI6 A;  1Q7Y H;  4WBN A;  1PXW A;  4B62 A;  2N48 A;  3C8L A;  3HKB A;  3NMU C;  5IT9 M;  5HY4 A;  2Z1E A;  4X1I A;  4HNA A;  2RHH A;  2VAP A;  3VCZ A;  3CYP B;  4PWT A;  4G4W A;  1TVK B;  1SZQ A;  5HY1 A;  2ZAU A;  2CWJ A;  1VHA A;  4C8G A;  5EB1 B;  3S06 A;  5KMG A;  1Q8R A;  2HS4 A;  3RYC A;  2PMP A;  3WXM B;  2GVI A;  3NVI B;  3M84 A;  1NQ3 A;  2LBX A;  1CK2 A;  3N2K B;  1XBI A;  3WJR A;  4LNU A;  3T80 A;  4M8I A;  1VQ5 F;  3I7T A;  4U39 A;  1VQ8 F;  2AMT A;  1K8A H;  3S0W A;  4C8E A;  2LCA A;  4FFB A;  1VQ7 F;  1W57 A;  3E20 B;  3JAR A;  1FNK A;  2CHT A;  3HKD A;  3TD5 A;  1W42 A;  5HY0 A;  1VQL F;  3B6N A;  3FPI A;  3I55 F;  1E7K A;  3WGL A;  3HTN A;  2DT4 A;  3MQW A;  3VO8 A;  5LA6 B;  1IV1 A;  1DT9 A;  3JVH A;  1JD1 A;  1W41 A;  3JAT A;  3N2K A;  5GON B;  3SIU A;  2IAF A;  2FC3 A;  1W58 1;  3HKE B;  5JCO C;  2UYK A;  3LWR C;  3ELC A;  3WPX A;  3LWP C;  1W55 A;  3CCM F;  5KMG B;  3Q8H A;  3E22 A;  1XRG A;  5GON A;  1QVF F;  3VMF B;  5LOV B;  1CN7 A;  3CPW F;  2ALE A;  3CYQ A;  5JCO A;  4EI9 A;  4HNA B;  3JAT B;  1TVK A;  4O4H A;  4EI7 A;  5LA6 A;  3LWO C;  2CSL A;  5LXT A;  2GZL A;  1Z5V A;  3K14 A;  3HKD B;  5EYP B;  3FD6 A;  3IEW A;  2L26 A;  2UZH A;  2BO1 A;  2NMU A;  3M1X A;  3V4D A;  1QD9 A;  2R6R 1;  4XCQ A;  4FFB B;  5B8F A;  4IIJ A;  1VQP F;  2MQE A;  1R1M A;  2V9Y A;  3S0Y A;  1RA4 A;  2VXY A;  1T0A A;  3JAS A;  2RB9 A;  4X1Y A;  3S0H A;  3KE1 A;  3MCQ A;  1W5F A;  3UT5 A;  3JAM M;  1YJN F;  4DRX A;  1CLI A;  2HP0 B;  1W2B F;  4B46 A;  5JVD A;  1YHQ F;  1M1K H;  5DCV A;  1FNJ A;  4NQ3 A;  3WJQ A;  4O4L B;  3CB2 A;  2UYN B;  4E6E A;  2KTU A;  1W5E A;  1W5B A;  4X1I B;  5FJ4 C;  3RYF A;  4YJ2 A;  1VQN F;  4U3J A;  3ZP4 A;  3FBA A;  2OHW A;  1W59 A;  4G4Z A;  3TD3 A;  3CG6 A;  3CCR F;  5HWE A;  3VOA A; 
#chains in the Genus database with same CATH homology
 1Q86 H;  3AGK A;  1VQ6 F;  1SDS A;  1YJW F;  1YIJ F;  3WXM B;  2OTJ F;  5GAP K;  1K9M H;  5GIO C;  3G6E F;  2HVY D;  3NVI B;  1VQK F;  5G4V C;  4LCK A;  2LBX A;  1CK2 A;  1XBI A;  1X7O A;  2WAL A;  1VQ5 F;  3CXC F;  5EWR A;  1VQ8 F;  3LFO A;  3CCQ F;  1K8A H;  3LWV C;  4X3L A;  3CCE F;  3MCA B;  3J81 M;  1VQ7 F;  2AIF A;  3E20 B;  2VGN A;  3J80 M;  3CME F;  1VQ4 F;  1YJ9 F;  5HXZ A;  3HJW C;  3V3T A;  1W42 A;  1QVG F;  5HY0 A;  2LBW A;  1VQL F;  1VQO F;  3RA5 A;  3I55 F;  1VQ9 F;  1W40 A;  5A2Q M;  5HWE A;  1E7K A;  1N8R H;  1T0K B;  3V7Q A;  5HY2 A;  1NMU B;  1DT9 A;  3CCU F;  3HAX D;  4NUT A;  3NK7 A;  2QEX F;  3PLA C;  1W41 A;  3CC2 F;  1X52 A;  3SIU A;  1KD1 H;  1YI2 F;  3SIV A;  2FC3 A;  2QI2 A;  3CCV F;  2OZB A;  3ON1 A;  1GZ0 A;  3D00 A;  3LWR C;  3LWP C;  3OW2 F;  3CCS F;  3CCM F;  5HXU A;  2VGM A;  1Q82 H;  1X7P A;  1QVF F;  1RLG A;  3VMF B;  1CN7 A;  3CPW F;  2ALE A;  3CMA F;  4EI9 A;  3CPQ A;  1GO1 A;  1Q81 H;  3RA6 A;  3G71 F;  3N4Y A;  1IPA A;  4BW0 B;  1KQS F;  4EI7 A;  2FGY A;  3LWO C;  3CCL F;  3JCM M;  3I56 F;  3NVK E;  4BVR A;  2QA4 F;  3CC7 F;  5GIN C;  4TZZ A;  1VQM F;  3CD6 F;  5GIP C;  2JNB A;  1NJI H;  2F9Z C;  2BO1 A;  3V7E A;  1ZWZ A;  4XCQ A;  4EI8 A;  1KC8 H;  1H7M A;  1VQP F;  3OBW A;  3LWQ C;  2OTL F;  1K73 H;  2KG4 A;  1RA4 A;  2GLZ A;  3E1Y A;  3N4Z A;  1M90 H;  4BVS A;  2CZW A;  3FFM A;  2KTV A;  3JAM M;  2I6D A;  1YJN F;  3OBY A;  3IR9 A;  1YIT F;  1W2B F;  1S72 F;  1YHQ F;  1M1K H;  5DCV A;  5G4U C;  3VI6 A;  4NQ3 A;  5FLX M;  3J7A R;  1Q7Y H;  4C4W C;  1PXW A;  4BVT A;  1GO0 A;  3CCJ F;  2KTU A;  4BY9 D;  3NMU C;  3NK6 A;  5IT9 M;  5FJ4 C;  5HY4 A;  1W3E X;  3PAF A;  1VQN F;  2OHW A;  3GYQ A;  1JJ2 F;  5GAN K;  3CG6 A;  4BVQ A;  5EO3 A;  5HY1 A;  3CCR F;  3O85 A;  3G4S F;  4X3M A;  3CC4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...