1RLGA

Molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
VPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/rna
molecule keywords 25-MER
publication title Molecular Basis of Box C/D RNA-Protein Interactions; Cocrystal Structure of Archaeal L7Ae and a Box C/D RNA.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1rlgA00
3J80M 2KTUA 4X3MA 1GO1A 1YJWF 1N8RH 1Q86H 1VQNF 3CCEF 3CCVF 1E7KA 3CCRF 3AGKA 3CPQA 1VQPF 1VQLF 3G71F 1VQOF 1ZWZA 1VQ4F 3I55F 3J81M 1JJ2F 3HAXD 5GIOC 1M90H 2OHWA 1PXWA 3OBWA 2KTVA 1Q82H 1QVFF 3HJWC 1X7OA 2QI2A 4NUTA 5G4VC 1VQKF 3CCUF 1K8AH 2OTLF 1RLGA 1GZ0A 1DT9A 2JNBA 3J7AR 2FC3A 1Q81H 1KC8H 3LWOC 3LWPC 1VQ7F 3V7QA 2ALEA 3V7EA 3SIUA 2OTJF 1QVGF 1W41A 3CC7F 5GIPC 3JAMM 5EO3A 3RA5A 3WXMB 3OBYA 1W3EX 1SDSA 3NMUC 1VQ6F 5A2QM 3PLAC 2CZWA 3MCAB 5GINC 2QEXF 1VQ8F 3NVIB 1M1KH 1W2BF 1VQ5F 3CMAF 4X3LA 3N4ZA 2QA4F 5DCVA 3CC2F 3CC4F 4TZZA 1YIJF 3CCJF 3NVKE 3VI6A 1X52A 3G6EF 3LWVC 3LFOA 2OZBA 2KG4A 5G4UC 5IT9M 1VQ9F 1K73H 3N4YA 2VGNA 3ON1A 5GANK 2VGMA 3PAFA 2LBXA 3CCMF 3SIVA 3LWQC 2WALA 3CXCF 3CG6A 1YHQF 3FFMA 1K9MH 3LWRC 3E20B 3CMEF 1NMUB 2AIFA 1XBIA 3NK7A 3NK6A 3RA6A 5EWRA 1W42A 1VQMF 3JCMM 2I6DA 3O85A 3OW2F 1Q7YH 1RA4A 3G4SF 1YITF 4C4WC 1IPAA 1X7PA 3IR9A 3GYQA 1NJIH 4BW0B 1T0KB 1H7MA 3CD6F 5FLXM 1S72F 3CCLF 1GO0A 1KQSF 2HVYD 4LCKA 3CCQF 1YJNF 3CCSF 1YI2F 3E1YA 4BY9D 1W40A 1CK2A 3CPWF 2BO1A 1KD1H 3VMFB 2LBWA 1YJ9F 5FJ4C 1CN7A 3I56F 5GAPK
chains in the Genus database with same CATH superfamily
2ZVYA 3DDNA 3KJJA 4HNAA 2HQSC 3UT5A 1GX1A 3F0EA 3ZO8A 3JAWA 1OFUA 1Q86H 1VQNF 3CCVF 3CCRF 4BT4A 1VQLF 3RYIA 3WPWA 1VQVA 1W5BA 3J81M 2OHWA 1PXWA 1Q82H 2YXZA 3IKFA 2RHOA 5JH7B 4ZOLA 2OTLF 2MQEA 4FFBA 5JVDB 1GZ0A 1DT9A 3J7AR 3D00A 4C82A 5JH7A 3WGKA 1VQ7F 2ALEA 3K12A 4LNUA 3RYHA 1W41A 1U3PA 3WXMB 3Q8HA 5J2TB 4B46A 1VQ6F 5MN5A 3PLAC 2CZWA 4YJ2B 3NVIB 4O4HB 2ZODA 2BTQB 4I50A 4ZHYB 2QA4F 4ZI7B 2UYPA 1JN1A 3I3FA 4YJ2A 4YJ3B 3BYQA 3CCJF 3C9RA 3LFOA 3S03A 2Z1FA 4ZI7A 2OZBA 4B45A 3RYFB 4G4WA 4YJ3A 3N4YA 5LXTA 5EIBC 2VGMA 2HRUA 3P0ZA 3HKDB 4O4JB 5C8YB 3S02A 1K9MH 3B6NA 3MCQA 2I6RA 3HKBB 4I55A 4TV9A 4U3JA 1NMUB 1W59A 3S06A 3HKDA 4O4JA 2GVIA 3FD5A 3FPIA 5B8FA 4BT3A 2RHHA 1IV3A 5BMVA 3D54A 3F0FA 3JALB 4C8IA 5J2UA 1RA4A 2GLZA 4RQOA 1YITF 1RQ7A 1IPAA 1TVKB 3EORA 3VYSC 1VHAA 3LMEA 2KGWA 2VAMA 3M84A 4O4IA 1W5EA 1FFXB 1TVKA 3RE3A 1NJIH 4G4VA 1T0KB 3TD3A 5FLXM 3CCLF 5LOVA 3WJRA 5JQGB 5LP6B 2V9YA 3WPXA 2HVYD 3CCSF 1YI2F 3E1YA 5JQGA 1CK2A 3CPWF 3RYCA 2HS3A 2N48A 4G88A 4BVSA 2HP0B 3ERNA 2LBWA 3HKCB 3U0OA 5FJ4C 2CHSA 5LYJB 1SA0B 2Z01A 4TUYB 4O2AA 4X3MA 3HKCA 1N8RH 5LYJA 4X20B 5CA1B 1SA0A 4G4YA 2CSLA 5CA0B 3CCEF 1VQPF 5JCOC 5CA1A 4ZHWA 1TUBB 3C9SA 3WJQA 5CB4A 3I55F 5CA0A 5HP7A 1JJ2F 2IQQA 2GZLA 1XHOA 4C8GA 2RHJA 3S0WA 1QVFF 3HJWC 5HWEA 1XRGA 1RLGA 2IAFA 3R0PA 3IEWA 2JNBA 3ELCA 3UT5B 1KC8H 3LWOC 3JAWB 4B62A 3LWPC 4NWOB 3V7QA 2OTJF 1QVGF 5EO3A 3RYIB 3RA5A 3OBYA 1W3EX 1SDSA 1JY8A 1RQ2A 2QTPA 2Z1EA 2QEXF 3K2XA 1M1KH 4BVTA 3HKEB 3QTYA 1FNKA 4TV8B 5HY2A 4O2BB 4ZOLB 4G4ZA 3FD6A 2CW4A 4FFBB 4TZZA 1YGYA 1YIJF 3NVKE 3HKEA 3G6EF 4TV8A 3LWVC 4O2BA 2KG4A 4KWEA 3IEQA 4LNUB 3RYHB 2W8BC 3ON1A 5GANK 3GHZA 2LBXA 3DC2A 3VOBA 3LWQC 2WALA 3OONA 3P4EA 2L26A 1T0AA 3E20B 3MBMA 4I50B 2DYYA 1U43A 5ITZB 2PMPA 3RA6A 2CVLA 2H8EA 5EWRA 3VTIC 3S0HA 4G4XA 5HP8A 3WGJA 5ITZA 5LXTB 1Q7YH 2UYKA 5EZYB 3S0YA 1COMA 1OAPA 3MQWA 3WGLA 3WJPA 2NMUA 1ODEA 3P10A 5EZYA 3C9TA 1H47A 4I4TB 4I55B 4TV9B 4U3JB 4BT6A 2EWCA 4R40B 5LP6C 4I4TA 4BT5A 3FBAA 5BMVB 1VH8A 1H48A 3T80A 5KX5B 1GO0A 3JATA 1KQSF 5J2UB 3C8LA 4LCKA 3VYTC 5KX5A 4XCQA 2BO1A 3KJKA 4IIJA 1FSZA 4O4IB 3E22B 5HY4A 3VO8A 1W55A 3ZP4A 3J80M 2KTUA 1Q8RA 3F6MA 5IYZA 1JD1A 4BVRA 3E22A 2B33A 3M1XA 5LOVB 1E7KA 5IJ9B 3WGMA 3AGKA 3G71F 1VQOF 1QD9A 5LA6B 4F6RB 4C81A 1R1MA 1U3LA 5IJ9A 1M90H 2H6LA 2IG8A 3KHNA 2KTVA 3RYCB 5LA6A 4F6RA 4ZHVA 1J7HA 1X7OA 2QI2A 4NUTA 1VQKF 1K8AH 2BTUA 4O2AB 3LYBA 3K14A 1Q81H 2PHNA 1QAHA 2BTOA 3K0TA 3CC7F 3JAMM 3NMUC 5CB4B 5A2QM 1ONIA 1VQ8F 1VQ5F 4BT7A 4X3LA 5DCVA 4IHJA 3CC4F 3VIUA 3VYUC 3N2GB 1CLIA 5G4UC 5IT9M 2YYEA 3WGNA 2VGNA 1NQ3A 3JAKA 2CWJA 3JASB 2Q1YA 3N2GA 4O4LB 3CCMF 3V3TA 3SIVA 1W581 3I7TA 3CXCF 3LDTA 2K1SA 3HTNA 2ZVZA 5EYPA 3JASA 3F0GA 4O4LA 2RB9A 3LWRC 3CMEF 2AIFA 2CHTA 3KE1A 1Z5VA 4X1IB 1W42A 4EB6B 3JCMM 2I6DA 3O85A 5KMGB 3OW2F 2G9IA 4X1IA 1IV1A 4EB6A 4WBNB 5KMGA 3IMPA 2H8CA 1X7PA 5MN4A 3IR9A 3HWUA 4WBNA 4BW0B 2LCAA 3ESJA 3JVHA 1Z5WA 2VAWA 1IV2A 4EI8A 3CCQF 2LBTA 4BT2A 3ZOPA 1W40A 1KD1H 4C8EA 5JCOA 3VMFB 2UYNB 1W5FA 2AMTA 2HS4A 5GONB 1IV4A 1CN7A 1SZQA 3I56F 1X52A 1VK3A 5JVDA 1X25A 2UYNA 2ZF8A 5GONA 1GO1A 1KNJA 5EAZA 3TD4A 1YJWF 3C9UA 2VXYA 3CPQA 5EIBD 3JATB 4U39A 5IJ0B 1W5AA 1ZWZA 1VQ4F 5J2TA 3HAXD 1YQNA 5EB0A 5GIOC 3OBWA 4O4HA 1PF5A 4DXDA 5IJ0A 4IIJB 5G4VC 4EI9A 3CCUF 3V4DA 5IYZB 2FC3A 2FGYA 2UZHA 2HX0A 3RYFA 5EB1B 5HXUA 3V7EA 3SIUA 2Z1UA 4RHAA 5GIPC 4NQ3A 4ZHQB 4ERHA 3CYPB 1XV2A 5C8YA 5HY0A 3MCAB 5GINC 4ZHQA 1W2BF 4E6EA 2UYJA 2DT4A 3HKBA 3CMAF 3N4ZA 3MDOA 2ZAUA 3CC2F 5AVMA 5FNVB 4EI7A 5MN6A 4PWTA 3VI6A 1UFYA 4X1YB 5FNVA 3JALA 1VQ9F 1K73H 2HRYA 3PAFA 1KNKA 2OTMA 4X1YA 1W57A 4X1KB 4B5CA 3ZP7A 3CG6A 2ZOVA 5HY1A 1YHQF 3FFMA 3M4SA 5HXZA 1FFXA 4X1KA 3VCZA 4IHJB 1QU9A 1RLUA 2Z1TA 1XBIA 2AIZP 2VAPA 3NK7A 1U40A 1DBFA 3N2KB 3NK6A 1VQMF 5LP6A 3N2KA 3JAKB 2Q1XA 3GTZA 2R751 4DRXB 3G4SF 4C4WC 2P6YA 3CB2A 1FNJA 2HP0A 3GYQA 5EYPB 3VOAA 4DRXA 3L7QA 4M8IA 4TUYA 3QHDA 1H7MA 3CD6F 4BVQA 2HP3A 4X20A 1S72F 3D01A 2R6R1 1UI9A 2HS0A 3JARB 3TD5A 3CYQA 3IKEA 1TUBA 4ZK7A 1JFFB 1YJNF 3F0DA 2F9ZC 4BY9D 3JARA 3QUWA 3KIZA 2RHLA 4HNAB 1JFFA 1YJ9F 5GAPK
chains in the Genus database with same CATH topology
3J80M 2KTUA 4X3MA 1GO1A 1YJWF 4BVRA 1N8RH 1Q86H 1VQNF 3CCEF 3CCVF 1E7KA 3CCRF 3AGKA 3CPQA 1VQPF 1VQLF 3G71F 1VQOF 1ZWZA 1VQ4F 3I55F 3J81M 1JJ2F 3HAXD 5GIOC 1M90H 2OHWA 1PXWA 3OBWA 2KTVA 1Q82H 1QVFF 3HJWC 1X7OA 5HWEA 2QI2A 4NUTA 5G4VC 4EI9A 1VQKF 3CCUF 1K8AH 2OTLF 1RLGA 1GZ0A 1DT9A 2JNBA 3J7AR 3D00A 2FC3A 1Q81H 1KC8H 3LWOC 3LWPC 1VQ7F 3V7QA 2ALEA 2FGYA 3V7EA 5HXUA 3SIUA 2OTJF 1QVGF 1W41A 3CC7F 5GIPC 3JAMM 4NQ3A 5EO3A 3RA5A 3WXMB 3OBYA 1W3EX 1SDSA 3NMUC 1VQ6F 5A2QM 5HY0A 3PLAC 2CZWA 3MCAB 5GINC 2QEXF 1VQ8F 3NVIB 1M1KH 1W2BF 1VQ5F 4BVTA 3CMAF 4X3LA 3N4ZA 5HY2A 2QA4F 5DCVA 3CC2F 4EI7A 3CC4F 4TZZA 1YIJF 3CCJF 3NVKE 3VI6A 3G6EF 3LWVC 3LFOA 2OZBA 2KG4A 5G4UC 5IT9M 1VQ9F 1K73H 3N4YA 2VGNA 3ON1A 2VGMA 5GANK 3PAFA 2LBXA 3CCMF 3V3TA 3LWQC 3SIVA 2WALA 3CXCF 3CG6A 5HY1A 1YHQF 3FFMA 1K9MH 5HXZA 3LWRC 3E20B 3CMEF 1NMUB 2AIFA 1XBIA 3NK7A 3NK6A 3RA6A 5EWRA 1W42A 1VQMF 3JCMM 2I6DA 3O85A 3OW2F 1Q7YH 1RA4A 2GLZA 5GAPK 3G4SF 1YITF 4C4WC 1IPAA 1X7PA 3IR9A 3GYQA 1NJIH 4BW0B 1T0KB 1H7MA 3CD6F 4BVQA 5FLXM 1S72F 3CCLF 1GO0A 1KQSF 4EI8A 2HVYD 4LCKA 3CCQF 1YJNF 3CCSF 1YI2F 2F9ZC 3E1YA 4BY9D 1W40A 1CK2A 4XCQA 2BO1A 3CPWF 1KD1H 3VMFB 4BVSA 2LBWA 1YJ9F 5FJ4C 1CN7A 5HY4A 3I56F 1X52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 M;  2KTU A;  4X3M A;  1GO1 A;  1YJW F;  1N8R H;  1Q86 H;  1VQN F;  3CCE F;  3CCV F;  1E7K A;  3CCR F;  3AGK A;  3CPQ A;  1VQP F;  1VQL F;  3G71 F;  1VQO F;  1ZWZ A;  1VQ4 F;  3I55 F;  3J81 M;  1JJ2 F;  3HAX D;  5GIO C;  1M90 H;  2OHW A;  1PXW A;  3OBW A;  2KTV A;  1Q82 H;  1QVF F;  3HJW C;  1X7O A;  2QI2 A;  4NUT A;  5G4V C;  1VQK F;  3CCU F;  1K8A H;  2OTL F;  1RLG A;  1GZ0 A;  1DT9 A;  2JNB A;  3J7A R;  2FC3 A;  1Q81 H;  1KC8 H;  3LWO C;  3LWP C;  1VQ7 F;  3V7Q A;  2ALE A;  3V7E A;  3SIU A;  2OTJ F;  1QVG F;  1W41 A;  3CC7 F;  5GIP C;  3JAM M;  5EO3 A;  3RA5 A;  3WXM B;  3OBY A;  1W3E X;  1SDS A;  3NMU C;  1VQ6 F;  5A2Q M;  3PLA C;  2CZW A;  3MCA B;  5GIN C;  2QEX F;  1VQ8 F;  3NVI B;  1M1K H;  1W2B F;  1VQ5 F;  3CMA F;  4X3L A;  3N4Z A;  2QA4 F;  5DCV A;  3CC2 F;  3CC4 F;  4TZZ A;  1YIJ F;  3CCJ F;  3NVK E;  3VI6 A;  1X52 A;  3G6E F;  3LWV C;  3LFO A;  2OZB A;  2KG4 A;  5G4U C;  5IT9 M;  1VQ9 F;  1K73 H;  3N4Y A;  2VGN A;  3ON1 A;  5GAN K;  2VGM A;  3PAF A;  2LBX A;  3CCM F;  3SIV A;  3LWQ C;  2WAL A;  3CXC F;  3CG6 A;  1YHQ F;  3FFM A;  1K9M H;  3LWR C;  3E20 B;  3CME F;  1NMU B;  2AIF A;  1XBI A;  3NK7 A;  3NK6 A;  3RA6 A;  5EWR A;  1W42 A;  1VQM F;  3JCM M;  2I6D A;  3O85 A;  3OW2 F;  1Q7Y H;  1RA4 A;  3G4S F;  1YIT F;  4C4W C;  1IPA A;  1X7P A;  3IR9 A;  3GYQ A;  1NJI H;  4BW0 B;  1T0K B;  1H7M A;  3CD6 F;  5FLX M;  1S72 F;  3CCL F;  1GO0 A;  1KQS F;  2HVY D;  4LCK A;  3CCQ F;  1YJN F;  3CCS F;  1YI2 F;  3E1Y A;  4BY9 D;  1W40 A;  1CK2 A;  3CPW F;  2BO1 A;  1KD1 H;  3VMF B;  2LBW A;  1YJ9 F;  5FJ4 C;  1CN7 A;  3I56 F;  5GAP K; 
#chains in the Genus database with same CATH topology
 2ZVY A;  3DDN A;  3KJJ A;  4HNA A;  2HQS C;  3UT5 A;  1GX1 A;  3F0E A;  3ZO8 A;  3JAW A;  1OFU A;  1Q86 H;  1VQN F;  3CCV F;  3CCR F;  4BT4 A;  1VQL F;  3RYI A;  3WPW A;  1VQV A;  1W5B A;  3J81 M;  2OHW A;  1PXW A;  1Q82 H;  2YXZ A;  3IKF A;  2RHO A;  5JH7 B;  4ZOL A;  2OTL F;  2MQE A;  4FFB A;  5JVD B;  1GZ0 A;  1DT9 A;  3J7A R;  3D00 A;  4C82 A;  5JH7 A;  3WGK A;  1VQ7 F;  2ALE A;  3K12 A;  4LNU A;  3RYH A;  1W41 A;  1U3P A;  3WXM B;  3Q8H A;  5J2T B;  4B46 A;  1VQ6 F;  5MN5 A;  3PLA C;  2CZW A;  4YJ2 B;  3NVI B;  4O4H B;  2ZOD A;  2BTQ B;  4I50 A;  4ZHY B;  2QA4 F;  4ZI7 B;  2UYP A;  1JN1 A;  3I3F A;  4YJ2 A;  4YJ3 B;  3BYQ A;  3CCJ F;  3C9R A;  3LFO A;  3S03 A;  2Z1F A;  4ZI7 A;  2OZB A;  4B45 A;  3RYF B;  4G4W A;  4YJ3 A;  3N4Y A;  5LXT A;  5EIB C;  2VGM A;  2HRU A;  3P0Z A;  3HKD B;  4O4J B;  5C8Y B;  3S02 A;  1K9M H;  3B6N A;  3MCQ A;  2I6R A;  3HKB B;  4I55 A;  4TV9 A;  4U3J A;  1NMU B;  1W59 A;  3S06 A;  3HKD A;  4O4J A;  2GVI A;  3FD5 A;  3FPI A;  5B8F A;  4BT3 A;  2RHH A;  1IV3 A;  5BMV A;  3D54 A;  3F0F A;  3JAL B;  4C8I A;  5J2U A;  1RA4 A;  2GLZ A;  4RQO A;  1YIT F;  1RQ7 A;  1IPA A;  1TVK B;  3EOR A;  3VYS C;  1VHA A;  3LME A;  2KGW A;  2VAM A;  3M84 A;  4O4I A;  1W5E A;  1FFX B;  1TVK A;  3RE3 A;  1NJI H;  4G4V A;  1T0K B;  3TD3 A;  5FLX M;  3CCL F;  5LOV A;  3WJR A;  5JQG B;  5LP6 B;  2V9Y A;  3WPX A;  2HVY D;  3CCS F;  1YI2 F;  3E1Y A;  5JQG A;  1CK2 A;  3CPW F;  3RYC A;  2HS3 A;  2N48 A;  4G88 A;  4BVS A;  2HP0 B;  3ERN A;  2LBW A;  3HKC B;  3U0O A;  5FJ4 C;  2CHS A;  5LYJ B;  1SA0 B;  2Z01 A;  4TUY B;  4O2A A;  4X3M A;  3HKC A;  1N8R H;  5LYJ A;  4X20 B;  5CA1 B;  1SA0 A;  4G4Y A;  2CSL A;  5CA0 B;  3CCE F;  1VQP F;  5JCO C;  5CA1 A;  4ZHW A;  1TUB B;  3C9S A;  3WJQ A;  5CB4 A;  3I55 F;  5CA0 A;  5HP7 A;  1JJ2 F;  2IQQ A;  2GZL A;  1XHO A;  4C8G A;  2RHJ A;  3S0W A;  1QVF F;  3HJW C;  5HWE A;  1XRG A;  1RLG A;  2IAF A;  3R0P A;  3IEW A;  2JNB A;  3ELC A;  3UT5 B;  1KC8 H;  3LWO C;  3JAW B;  4B62 A;  3LWP C;  4NWO B;  3V7Q A;  2OTJ F;  1QVG F;  5EO3 A;  3RYI B;  3RA5 A;  3OBY A;  1W3E X;  1SDS A;  1JY8 A;  1RQ2 A;  2QTP A;  2Z1E A;  2QEX F;  3K2X A;  1M1K H;  4BVT A;  3HKE B;  3QTY A;  1FNK A;  4TV8 B;  5HY2 A;  4O2B B;  4ZOL B;  4G4Z A;  3FD6 A;  2CW4 A;  4FFB B;  4TZZ A;  1YGY A;  1YIJ F;  3NVK E;  3HKE A;  3G6E F;  4TV8 A;  3LWV C;  4O2B A;  2KG4 A;  4KWE A;  3IEQ A;  4LNU B;  3RYH B;  2W8B C;  3ON1 A;  5GAN K;  3GHZ A;  2LBX A;  3DC2 A;  3VOB A;  3LWQ C;  2WAL A;  3OON A;  3P4E A;  2L26 A;  1T0A A;  3E20 B;  3MBM A;  4I50 B;  2DYY A;  1U43 A;  5ITZ B;  2PMP A;  3RA6 A;  2CVL A;  2H8E A;  5EWR A;  3VTI C;  3S0H A;  4G4X A;  5HP8 A;  3WGJ A;  5ITZ A;  5LXT B;  1Q7Y H;  2UYK A;  5EZY B;  3S0Y A;  1COM A;  1OAP A;  3MQW A;  3WGL A;  3WJP A;  2NMU A;  1ODE A;  3P10 A;  5EZY A;  3C9T A;  1H47 A;  4I4T B;  4I55 B;  4TV9 B;  4U3J B;  4BT6 A;  2EWC A;  4R40 B;  5LP6 C;  4I4T A;  4BT5 A;  3FBA A;  5BMV B;  1VH8 A;  1H48 A;  3T80 A;  5KX5 B;  1GO0 A;  3JAT A;  1KQS F;  5J2U B;  3C8L A;  4LCK A;  3VYT C;  5KX5 A;  4XCQ A;  2BO1 A;  3KJK A;  4IIJ A;  1FSZ A;  4O4I B;  3E22 B;  5HY4 A;  3VO8 A;  1W55 A;  3ZP4 A;  3J80 M;  2KTU A;  1Q8R A;  3F6M A;  5IYZ A;  1JD1 A;  4BVR A;  3E22 A;  2B33 A;  3M1X A;  5LOV B;  1E7K A;  5IJ9 B;  3WGM A;  3AGK A;  3G71 F;  1VQO F;  1QD9 A;  5LA6 B;  4F6R B;  4C81 A;  1R1M A;  1U3L A;  5IJ9 A;  1M90 H;  2H6L A;  2IG8 A;  3KHN A;  2KTV A;  3RYC B;  5LA6 A;  4F6R A;  4ZHV A;  1J7H A;  1X7O A;  2QI2 A;  4NUT A;  1VQK F;  1K8A H;  2BTU A;  4O2A B;  3LYB A;  3K14 A;  1Q81 H;  2PHN A;  1QAH A;  2BTO A;  3K0T A;  3CC7 F;  3JAM M;  3NMU C;  5CB4 B;  5A2Q M;  1ONI A;  1VQ8 F;  1VQ5 F;  4BT7 A;  4X3L A;  5DCV A;  4IHJ A;  3CC4 F;  3VIU A;  3VYU C;  3N2G B;  1CLI A;  5G4U C;  5IT9 M;  2YYE A;  3WGN A;  2VGN A;  1NQ3 A;  3JAK A;  2CWJ A;  3JAS B;  2Q1Y A;  3N2G A;  4O4L B;  3CCM F;  3V3T A;  3SIV A;  1W58 1;  3I7T A;  3CXC F;  3LDT A;  2K1S A;  3HTN A;  2ZVZ A;  5EYP A;  3JAS A;  3F0G A;  4O4L A;  2RB9 A;  3LWR C;  3CME F;  2AIF A;  2CHT A;  3KE1 A;  1Z5V A;  4X1I B;  1W42 A;  4EB6 B;  3JCM M;  2I6D A;  3O85 A;  5KMG B;  3OW2 F;  2G9I A;  4X1I A;  1IV1 A;  4EB6 A;  4WBN B;  5KMG A;  3IMP A;  2H8C A;  1X7P A;  5MN4 A;  3IR9 A;  3HWU A;  4WBN A;  4BW0 B;  2LCA A;  3ESJ A;  3JVH A;  1Z5W A;  2VAW A;  1IV2 A;  4EI8 A;  3CCQ F;  2LBT A;  4BT2 A;  3ZOP A;  1W40 A;  1KD1 H;  4C8E A;  5JCO A;  3VMF B;  2UYN B;  1W5F A;  2AMT A;  2HS4 A;  5GON B;  1IV4 A;  1CN7 A;  1SZQ A;  3I56 F;  1X52 A;  1VK3 A;  5JVD A;  1X25 A;  2UYN A;  2ZF8 A;  5GON A;  1GO1 A;  1KNJ A;  5EAZ A;  3TD4 A;  1YJW F;  3C9U A;  2VXY A;  3CPQ A;  5EIB D;  3JAT B;  4U39 A;  5IJ0 B;  1W5A A;  1ZWZ A;  1VQ4 F;  5J2T A;  3HAX D;  1YQN A;  5EB0 A;  5GIO C;  3OBW A;  4O4H A;  1PF5 A;  4DXD A;  5IJ0 A;  4IIJ B;  5G4V C;  4EI9 A;  3CCU F;  3V4D A;  5IYZ B;  2FC3 A;  2FGY A;  2UZH A;  2HX0 A;  3RYF A;  5EB1 B;  5HXU A;  3V7E A;  3SIU A;  2Z1U A;  4RHA A;  5GIP C;  4NQ3 A;  4ZHQ B;  4ERH A;  3CYP B;  1XV2 A;  5C8Y A;  5HY0 A;  3MCA B;  5GIN C;  4ZHQ A;  1W2B F;  4E6E A;  2UYJ A;  2DT4 A;  3HKB A;  3CMA F;  3N4Z A;  3MDO A;  2ZAU A;  3CC2 F;  5AVM A;  5FNV B;  4EI7 A;  5MN6 A;  4PWT A;  3VI6 A;  1UFY A;  4X1Y B;  5FNV A;  3JAL A;  1VQ9 F;  1K73 H;  2HRY A;  3PAF A;  1KNK A;  2OTM A;  4X1Y A;  1W57 A;  4X1K B;  4B5C A;  3ZP7 A;  3CG6 A;  2ZOV A;  5HY1 A;  1YHQ F;  3FFM A;  3M4S A;  5HXZ A;  1FFX A;  4X1K A;  3VCZ A;  4IHJ B;  1QU9 A;  1RLU A;  2Z1T A;  1XBI A;  2AIZ P;  2VAP A;  3NK7 A;  1U40 A;  1DBF A;  3N2K B;  3NK6 A;  1VQM F;  5LP6 A;  3N2K A;  3JAK B;  2Q1X A;  3GTZ A;  2R75 1;  4DRX B;  3G4S F;  4C4W C;  2P6Y A;  3CB2 A;  1FNJ A;  2HP0 A;  3GYQ A;  5EYP B;  3VOA A;  4DRX A;  3L7Q A;  4M8I A;  4TUY A;  3QHD A;  1H7M A;  3CD6 F;  4BVQ A;  2HP3 A;  4X20 A;  1S72 F;  3D01 A;  2R6R 1;  1UI9 A;  2HS0 A;  3JAR B;  3TD5 A;  3CYQ A;  3IKE A;  1TUB A;  4ZK7 A;  1JFF B;  1YJN F;  3F0D A;  2F9Z C;  4BY9 D;  3JAR A;  3QUW A;  3KIZ A;  2RHL A;  4HNA B;  1JFF A;  1YJ9 F;  5GAP K; 
#chains in the Genus database with same CATH homology
 3J80 M;  2KTU A;  4X3M A;  1GO1 A;  1YJW F;  4BVR A;  1N8R H;  1Q86 H;  1VQN F;  3CCE F;  3CCV F;  1E7K A;  3CCR F;  3AGK A;  3CPQ A;  1VQP F;  1VQL F;  3G71 F;  1VQO F;  1ZWZ A;  1VQ4 F;  3I55 F;  3J81 M;  1JJ2 F;  3HAX D;  5GIO C;  1M90 H;  2OHW A;  1PXW A;  3OBW A;  2KTV A;  1Q82 H;  1QVF F;  3HJW C;  1X7O A;  5HWE A;  2QI2 A;  4NUT A;  5G4V C;  4EI9 A;  1VQK F;  3CCU F;  1K8A H;  2OTL F;  1RLG A;  1GZ0 A;  1DT9 A;  2JNB A;  3J7A R;  3D00 A;  2FC3 A;  1Q81 H;  1KC8 H;  3LWO C;  3LWP C;  1VQ7 F;  3V7Q A;  2ALE A;  2FGY A;  3V7E A;  5HXU A;  3SIU A;  2OTJ F;  1QVG F;  1W41 A;  3CC7 F;  5GIP C;  3JAM M;  4NQ3 A;  5EO3 A;  3RA5 A;  3WXM B;  3OBY A;  1W3E X;  1SDS A;  3NMU C;  1VQ6 F;  5A2Q M;  5HY0 A;  3PLA C;  2CZW A;  3MCA B;  5GIN C;  2QEX F;  1VQ8 F;  3NVI B;  1M1K H;  1W2B F;  1VQ5 F;  4BVT A;  3CMA F;  4X3L A;  3N4Z A;  5HY2 A;  2QA4 F;  5DCV A;  3CC2 F;  4EI7 A;  3CC4 F;  4TZZ A;  1YIJ F;  3CCJ F;  3NVK E;  3VI6 A;  3G6E F;  3LWV C;  3LFO A;  2OZB A;  2KG4 A;  5G4U C;  5IT9 M;  1VQ9 F;  1K73 H;  3N4Y A;  2VGN A;  3ON1 A;  2VGM A;  5GAN K;  3PAF A;  2LBX A;  3CCM F;  3V3T A;  3LWQ C;  3SIV A;  2WAL A;  3CXC F;  3CG6 A;  5HY1 A;  1YHQ F;  3FFM A;  1K9M H;  5HXZ A;  3LWR C;  3E20 B;  3CME F;  1NMU B;  2AIF A;  1XBI A;  3NK7 A;  3NK6 A;  3RA6 A;  5EWR A;  1W42 A;  1VQM F;  3JCM M;  2I6D A;  3O85 A;  3OW2 F;  1Q7Y H;  1RA4 A;  2GLZ A;  5GAP K;  3G4S F;  1YIT F;  4C4W C;  1IPA A;  1X7P A;  3IR9 A;  3GYQ A;  1NJI H;  4BW0 B;  1T0K B;  1H7M A;  3CD6 F;  4BVQ A;  5FLX M;  1S72 F;  3CCL F;  1GO0 A;  1KQS F;  4EI8 A;  2HVY D;  4LCK A;  3CCQ F;  1YJN F;  3CCS F;  1YI2 F;  2F9Z C;  3E1Y A;  4BY9 D;  1W40 A;  1CK2 A;  4XCQ A;  2BO1 A;  3CPW F;  1KD1 H;  3VMF B;  4BVS A;  2LBW A;  1YJ9 F;  5FJ4 C;  1CN7 A;  5HY4 A;  3I56 F;  1X52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...