1RLGA

Molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
VPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 25-MER
publication title Molecular Basis of Box C/D RNA-Protein Interactions; Cocrystal Structure of Archaeal L7Ae and a Box C/D RNA.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural protein/rna
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1rlgA00
3CC7F 2QA4F 1Q82H 1W40A 5FLXM 1YI2F 1H7MA 2VGNA 1NMUB 3CCMF 1X7OA 1CN7A 3HJWC 1GO1A 1ZWZA 3IR9A 3NK7A 3V7EA 1YIJF 3JCMM 2CZWA 4TZZA 1Q86H 2FC3A 2KTUA 3CCRF 3VMFB 3I56F 5EWRA 5GAPK 3SIUA 5GINC 2LBWA 1IPAA 1YJWF 1W2BF 1M1KH 3J80M 3PAFA 1M90H 1KD1H 3RA5A 1VQ7F 2KTVA 3LWQC 1VQ9F 3SIVA 1X52A 5FJ4C 1VQMF 3RA6A 1RLGA 3CG6A 2KG4A 5IT9M 1PXWA 1VQ5F 3LWVC 3CPQA 5G4VC 3JAMM 1K9MH 3J7AR 2VGMA 4X3MA 3CXCF 3CCEF 4BY9D 2OHWA 1SDSA 4BW0B 3CC4F 2JNBA 3CCLF 1GO0A 1T0KB 1YHQF 3N4YA 3OW2F 1VQNF 3FFMA 4X3LA 1K8AH 3NMUC 3PLAC 2OTJF 2ALEA 2I6DA 3CC2F 2WALA 3AGKA 3CCQF 3G6EF 3E1YA 1YJNF 3GYQA 1VQ6F 3LWPC 3G71F 1VQ4F 3MCAB 1W42A 3CD6F 1RA4A 3LWRC 5DCVA 5A2QM 1DT9A 3WXMB 3CPWF 3HAXD 5GANK 3CCSF 3V7QA 5GIPC 3CCJF 3I55F 2BO1A 3J81M 3N4ZA 1XBIA 1E7KA 3E20B 3ON1A 1VQPF 2AIFA 3CCVF 2LBXA 1Q81H 1S72F 4LCKA 3CMEF 3VI6A 3CCUF 1W3EX 1VQKF 3CMAF 1QVGF 1QVFF 3OBYA 1X7PA 5GIOC 1CK2A 1KC8H 3O85A 3G4SF 5G4UC 4C4WC 1Q7YH 1NJIH 1JJ2F 1YITF 2QEXF 2QI2A 1K73H 3OBWA 1VQLF 4NUTA 2OTLF 3NVKE 3NK6A 1YJ9F 1VQOF 3LWOC 1VQ8F 2HVYD 3LFOA 1KQSF 1GZ0A 1W41A 5EO3A 2OZBA 3NVIB 1N8RH
chains in the Genus database with same CATH superfamily
3IKEA 5HY0A 1W40A 1IV3A 4I50B 4O4IA 5LXTB 4C81A 1W5BA 5LP6B 3CCMF 1X7OA 1CN7A 3P0ZA 1GO1A 5HP8A 3ESJA 5LOVA 4IHJB 3JAWB 3UT5B 3V7EA 1OFUA 3BYQA 1Q86H 1UFYA 4I50A 5LXTA 3CCRF 2UYNB 2CHSA 5EWRA 5GAPK 3E22B 4XCQA 5LP6A 3HKCB 1IPAA 4IHJA 1M1KH 3ELCA 3RYFB 3JAWA 3UT5A 1ODEA 3CYQA 4RQOA 5EB0A 3SIVA 1X52A 1W55A 2UYPA 5MN5A 2UYNA 4O2BA 2KG4A 3E22A 3CB2A 2DT4A 4G4ZA 4LNUB 1K9MH 3S0WA 3Q8HA 3P4EA 3RYFA 2HX0A 2OHWA 2OTMA 2RHOA 2Z1UA 3MBMA 4ERHA 2W8BC 3OW2F 3FFMA 4X3LA 5FNVB 1K8AH 2ALEA 1W581 4LNUA 3RE3A 3CC2F 1J7HA 1GX1A 3ZO8A 3E1YA 3L7QA 4G4WA 3GYQA 5CB4B 2CW4A 3MCAB 2R6R1 3GTZA 1XV2A 3TD3A 2EWCA 3CD6F 1RA4A 4EB6B 1DT9A 5A2QM 3CPWF 4C8EA 2GZLA 3CCSF 5FNVA 5KX5B 3V7QA 3CCJF 3I55F 3J81M 3D01A 4HNAA 3WGJA 1JD1A 5CB4A 4C8IA 2AIFA 1Q81H 1Z5VA 2GVIA 3M1XA 5LYJB 4NWOB 3CCUF 1VQKF 2HRUA 4ZHYB 3CMAF 4EB6A 5MN4A 3OBYA 1KNJA 5KX5A 1UI9A 1KC8H 3O85A 2CVLA 3WPXA 4C4WC 3K0TA 1JJ2F 3I3FA 5B8FA 3HKBB 4NUTA 5J2TB 2OTLF 3NK6A 3P10A 5LYJA 1VQOF 3LWOC 4ZHWA 2NMUA 3HKDB 1CLIA 1FNJA 1QU9A 3FD5A 2LCAA 4U3JB 4X1YB 1W41A 3R0PA 2CWJA 4BT3A 5FLXM 3D00A 1YI2F 3S03A 5J2TA 3WGLA 1NMUB 4B62A 2YXZA 4BVTA 3U0OA 2B33A 3HKDA 1ZWZA 3MQWA 4U3JA 5HXUA 5HY1A 1RQ2A 1TVKB 3HKEB 2H8CA 3NK7A 2RHJA 3QHDA 4X20A 3KE1A 2H8EA 4ZOLB 3JCMM 2CSLA 2CZWA 1VHAA 3FPIA 5EB1B 2KTUA 3I56F 3SIUA 1JFFA 2LBWA 5GINC 4TV8B 1YJWF 1W2BF 5JVDB 3J80M 1TVKA 2HP0B 3F0EA 1VQ9F 1FSZA 4ZOLA 1VK3A 4BT6A 3RA6A 3CG6A 3KIZA 2AMTA 4NQ3A 2VAMA 1VQ5F 3LWVC 3CPQA 4TUYB 4TV8A 5JVDA 3FD6A 4BT5A 3CXCF 3CCEF 2HP0A 4BY9D 3KJJA 3CCLF 1GO0A 1ONIA 1T0AA 2HS0A 2VAWA 5KMGB 2HQSC 1KNKA 1VQNF 2V9YA 3VCZA 1XRGA 3PLAC 4ZHQB 5BMVB 2BTUA 3F0FA 3TD4A 2WALA 3LDTA 3JATB 3LWPC 2Z1EA 3JASB 1YGYA 4C8GA 1VQ4F 5HP7A 3I7TA 3HKCA 5HY4A 5KMGA 3LWRC 3HAXD 3WXMB 4BT2A 5GANK 5C8YB 1Z5WA 4G4YA 3S0HA 4ZHQA 5BMVA 2BO1A 3WJQA 3N4ZA 3VTIC 3ERNA 1IV1A 1FFXB 3ON1A 1IV4A 1VQPF 1U3PA 2LBXA 1SZQA 5AVMA 3CMEF 3V3TA 1VH8A 3IMPA 5GIOC 5C8YA 3IEQA 1CK2A 1NQ3A 3N2GB 3GHZA 2ZVZA 1Q7YH 1XHOA 4BVQA 1FFXA 2ZVYA 5HY2A 2Z1TA 3IKFA 2ZAUA 1U3LA 2UYJA 3OBWA 4I55B 3VYUC 4IIJB 1KQSF 2OZBA 3ZOPA 3HWUA 3NVIB 3N2GA 3OONA 3CC7F 5IYZB 3VYTC 5JQGB 4C82A 2HS4A 3ZP4A 4TV9B 1TUBB 2HS3A 5EAZA 2VGNA 5MN6A 4I55A 2DYYA 4IIJA 4B5CA 5EZYB 3MDOA 2YYEA 2Z1FA 2QTPA 3KJKA 3JAKB 5IYZA 3VIUA 4O2AB 5CA0B 4TZZA 5JQGA 4ZK7A 4YJ2B 1SA0B 4TV9A 1TUBA 1U40A 1W57A 1RLUA 3V4DA 5EZYA 3VO8A 3PAFA 1M90H 2RHLA 3JAKA 2KTVA 2RB9A 3LWQC 5GONB 1VQ7F 3VOBA 3HKBA 4O2AA 2AIZP 4I4TB 5CA0A 5EIBC 4EI8A 4YJ2A 3JARB 3B6NA 3KHNA 4WBNB 4O4LB 1W59A 2CHTA 3JVHA 4X1YA 2VXYA 3D54A 3CYPB 4BVSA 5IJ0B 3C9UA 5LA6B 3VOAA 5GONA 4I4TA 1YHQF 1VQVA 1X25A 2H6LA 3S0YA 3N4YA 4DXDA 1H47A 2GLZA 4WBNA 4O4LA 2L26A 3HKEA 3T80A 3MCQA 3AGKA 3CCQF 4FFBB 3G6EF 3QTYA 1VQ6F 5LA6A 3G71F 3F0DA 1W5AA 5CA1B 1W42A 1Q8RA 5JCOC 2VAPA 3LYBA 5LOVB 2UYKA 3LMEA 4EI7A 3HTNA 1XBIA 4FFBA 1E7KA 4RHAA 3K2XA 1W5FA 3F6MA 5HWEA 4LCKA 2HP3A 3VI6A 5CA1A 3FBAA 4M8IA 3S02A 4DRXB 4TUYA 2PMPA 1DBFA 4G4VA 3JALB 4B45A 4E6EA 3K14A 4ZHVA 1H48A 2QEXF 1OAPA 2ZODA 1W5EA 3EORA 1K73H 4BT4A 4O2BB 2IG8A 4DRXA 4F6RB 4O4JB 1COMA 3JALA 4YJ3B 3C9RA 3JATA 1N8RH 2ZF8A 3DDNA 3M84A 2UZHA 3JASA 2QA4F 3IEWA 1Q82H 1H7MA 3HJWC 3TD5A 4F6RA 3IR9A 4O4JA 5HXZA 4YJ3A 3S06A 1YIJF 2MQEA 5LP6C 2G9IA 2FC3A 2BTQB 3VMFB 1PF5A 3N2KB 3WJPA 1RQ7A 3DC2A 3WPWA 2K1SA 3RYIB 2KGWA 1KD1H 3RA5A 4HNAB 1JN1A 2BTOA 1U43A 5FJ4C 1VQMF 4PWTA 1RLGA 4O4HB 5IT9M 3K12A 1PXWA 3N2KA 3C8LA 5G4VC 1QAHA 1FNKA 3QUWA 2P6YA 2VGMA 4X3MA 3WJRA 5ITZB 3RYIA 3J7AR 1SDSA 4BW0B 3CC4F 2JNBA 1R1MA 1T0KB 3JAMM 2IQQA 2I6RA 4O4HA 3ZP7A 5EYPB 2RHHA 3NMUC 2OTJF 2I6DA 2Q1XA 3M4SA 4G4XA 1JY8A 5IJ9B 5ITZA 1YJNF 4EI9A 1SA0A 5JH7B 2LBTA 3RYHB 5DCVA 1QD9A 3C9SA 1IV2A 5EYPA 4B46A 5GIPC 2HRYA 5JCOA 5IJ9A 2N48A 1YQNA 3E20B 4X20B 3RYCB 5J2UB 3WGMA 4ZI7B 3JARA 4BVRA 3CCVF 5JH7A 1S72F 4X1IB 4X1KB 2IAFA 3WGNA 1W3EX 5EIBD 3RYHA 1JFFB 1QVGF 4KWEA 2F9ZC 1QVFF 4R40B 1X7PA 2Z01A 5IJ0A 2ZOVA 3G4SF 3VYSC 5G4UC 1NJIH 2FGYA 1YITF 3WGKA 3RYCA 5J2UA 2QI2A 4O4IB 3F0GA 2R751 4ZI7A 1VQLF 2Q1YA 3C9TA 3NVKE 4X1IA 4X1KA 1YJ9F 4BT7A 1VQ8F 2HVYD 3LFOA 4G88A 1GZ0A 5EO3A 2PHNA 4U39A
chains in the Genus database with same CATH topology
3CC7F 2QA4F 1Q82H 5HY0A 1W40A 3D00A 5FLXM 1YI2F 1H7MA 2VGNA 1NMUB 3CCMF 1X7OA 1CN7A 3HJWC 1GO1A 4BVTA 1ZWZA 5HXUA 5HY1A 3IR9A 5HXZA 3NK7A 3V7EA 1YIJF 3JCMM 2CZWA 4TZZA 1Q86H 2FC3A 2KTUA 3CCRF 3VMFB 3I56F 5EWRA 5GAPK 3SIUA 4XCQA 2LBWA 5GINC 1IPAA 1YJWF 1W2BF 1M1KH 3J80M 3PAFA 1M90H 1KD1H 3RA5A 1VQ7F 2KTVA 3LWQC 1VQ9F 3SIVA 1X52A 5FJ4C 1VQMF 3RA6A 4EI8A 3CG6A 1RLGA 2KG4A 5IT9M 1PXWA 4NQ3A 1VQ5F 3LWVC 3CPQA 5G4VC 3JAMM 4BVSA 1K9MH 2VGMA 4X3MA 3J7AR 3CXCF 3CCEF 4BY9D 2OHWA 1SDSA 4BW0B 3CC4F 2JNBA 3CCLF 1GO0A 1T0KB 1YHQF 3N4YA 3OW2F 1VQNF 2GLZA 3FFMA 4X3LA 1K8AH 3NMUC 3PLAC 2OTJF 2ALEA 2I6DA 3CC2F 2WALA 3AGKA 3CCQF 3G6EF 3E1YA 1YJNF 3GYQA 1VQ6F 3LWPC 4EI9A 3G71F 1VQ4F 3MCAB 1W42A 3CD6F 1RA4A 5HY4A 3LWRC 5DCVA 5A2QM 1DT9A 3WXMB 3CPWF 3HAXD 5GANK 3CCSF 3V7QA 5GIPC 3CCJF 3I55F 4EI7A 2BO1A 3J81M 3N4ZA 1XBIA 1E7KA 3E20B 3ON1A 4BVRA 2AIFA 5HWEA 2LBXA 3CCVF 1VQPF 1S72F 3CMEF 3VI6A 1Q81H 4LCKA 3V3TA 3CCUF 1W3EX 1VQKF 3CMAF 1QVGF 2F9ZC 1QVFF 3OBYA 1X7PA 5GIOC 1CK2A 1KC8H 3O85A 3G4SF 5G4UC 4C4WC 1Q7YH 4BVQA 1NJIH 2FGYA 1JJ2F 1YITF 2QEXF 5HY2A 2QI2A 1K73H 3OBWA 1VQLF 4NUTA 2OTLF 3NVKE 3NK6A 1YJ9F 1VQOF 3LWOC 1VQ8F 2HVYD 3LFOA 1KQSF 1GZ0A 1W41A 5EO3A 2OZBA 3NVIB 1N8RH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 F;  2QA4 F;  1Q82 H;  1W40 A;  5FLX M;  1YI2 F;  1H7M A;  2VGN A;  1NMU B;  3CCM F;  1X7O A;  1CN7 A;  3HJW C;  1GO1 A;  1ZWZ A;  3IR9 A;  3NK7 A;  3V7E A;  1YIJ F;  3JCM M;  2CZW A;  4TZZ A;  1Q86 H;  2FC3 A;  2KTU A;  3CCR F;  3VMF B;  3I56 F;  5EWR A;  5GAP K;  3SIU A;  5GIN C;  2LBW A;  1IPA A;  1YJW F;  1W2B F;  1M1K H;  3J80 M;  3PAF A;  1M90 H;  1KD1 H;  3RA5 A;  1VQ7 F;  2KTV A;  3LWQ C;  1VQ9 F;  3SIV A;  1X52 A;  5FJ4 C;  1VQM F;  3RA6 A;  1RLG A;  3CG6 A;  2KG4 A;  5IT9 M;  1PXW A;  1VQ5 F;  3LWV C;  3CPQ A;  5G4V C;  3JAM M;  1K9M H;  3J7A R;  2VGM A;  4X3M A;  3CXC F;  3CCE F;  4BY9 D;  2OHW A;  1SDS A;  4BW0 B;  3CC4 F;  2JNB A;  3CCL F;  1GO0 A;  1T0K B;  1YHQ F;  3N4Y A;  3OW2 F;  1VQN F;  3FFM A;  4X3L A;  1K8A H;  3NMU C;  3PLA C;  2OTJ F;  2ALE A;  2I6D A;  3CC2 F;  2WAL A;  3AGK A;  3CCQ F;  3G6E F;  3E1Y A;  1YJN F;  3GYQ A;  1VQ6 F;  3LWP C;  3G71 F;  1VQ4 F;  3MCA B;  1W42 A;  3CD6 F;  1RA4 A;  3LWR C;  5DCV A;  5A2Q M;  1DT9 A;  3WXM B;  3CPW F;  3HAX D;  5GAN K;  3CCS F;  3V7Q A;  5GIP C;  3CCJ F;  3I55 F;  2BO1 A;  3J81 M;  3N4Z A;  1XBI A;  1E7K A;  3E20 B;  3ON1 A;  1VQP F;  2AIF A;  3CCV F;  2LBX A;  1Q81 H;  1S72 F;  4LCK A;  3CME F;  3VI6 A;  3CCU F;  1W3E X;  1VQK F;  3CMA F;  1QVG F;  1QVF F;  3OBY A;  1X7P A;  5GIO C;  1CK2 A;  1KC8 H;  3O85 A;  3G4S F;  5G4U C;  4C4W C;  1Q7Y H;  1NJI H;  1JJ2 F;  1YIT F;  2QEX F;  2QI2 A;  1K73 H;  3OBW A;  1VQL F;  4NUT A;  2OTL F;  3NVK E;  3NK6 A;  1YJ9 F;  1VQO F;  3LWO C;  1VQ8 F;  2HVY D;  3LFO A;  1KQS F;  1GZ0 A;  1W41 A;  5EO3 A;  2OZB A;  3NVI B;  1N8R H; 
#chains in the Genus database with same CATH topology
 3IKE A;  5HY0 A;  1W40 A;  1IV3 A;  4I50 B;  4O4I A;  5LXT B;  4C81 A;  1W5B A;  5LP6 B;  3CCM F;  1X7O A;  1CN7 A;  3P0Z A;  1GO1 A;  5HP8 A;  3ESJ A;  5LOV A;  4IHJ B;  3JAW B;  3UT5 B;  3V7E A;  1OFU A;  3BYQ A;  1Q86 H;  1UFY A;  4I50 A;  5LXT A;  3CCR F;  2UYN B;  2CHS A;  5EWR A;  5GAP K;  3E22 B;  4XCQ A;  5LP6 A;  3HKC B;  1IPA A;  4IHJ A;  1M1K H;  3ELC A;  3RYF B;  3JAW A;  3UT5 A;  1ODE A;  3CYQ A;  4RQO A;  5EB0 A;  3SIV A;  1X52 A;  1W55 A;  2UYP A;  5MN5 A;  2UYN A;  4O2B A;  2KG4 A;  3E22 A;  3CB2 A;  2DT4 A;  4G4Z A;  4LNU B;  1K9M H;  3S0W A;  3Q8H A;  3P4E A;  3RYF A;  2HX0 A;  2OHW A;  2OTM A;  2RHO A;  2Z1U A;  3MBM A;  4ERH A;  2W8B C;  3OW2 F;  3FFM A;  4X3L A;  5FNV B;  1K8A H;  2ALE A;  1W58 1;  4LNU A;  3RE3 A;  3CC2 F;  1J7H A;  1GX1 A;  3ZO8 A;  3E1Y A;  3L7Q A;  4G4W A;  3GYQ A;  5CB4 B;  2CW4 A;  3MCA B;  2R6R 1;  3GTZ A;  1XV2 A;  3TD3 A;  2EWC A;  3CD6 F;  1RA4 A;  4EB6 B;  1DT9 A;  5A2Q M;  3CPW F;  4C8E A;  2GZL A;  3CCS F;  5FNV A;  5KX5 B;  3V7Q A;  3CCJ F;  3I55 F;  3J81 M;  3D01 A;  4HNA A;  3WGJ A;  1JD1 A;  5CB4 A;  4C8I A;  2AIF A;  1Q81 H;  1Z5V A;  2GVI A;  3M1X A;  5LYJ B;  4NWO B;  3CCU F;  1VQK F;  2HRU A;  4ZHY B;  3CMA F;  4EB6 A;  5MN4 A;  3OBY A;  1KNJ A;  5KX5 A;  1UI9 A;  1KC8 H;  3O85 A;  2CVL A;  3WPX A;  4C4W C;  3K0T A;  1JJ2 F;  3I3F A;  5B8F A;  3HKB B;  4NUT A;  5J2T B;  2OTL F;  3NK6 A;  3P10 A;  5LYJ A;  1VQO F;  3LWO C;  4ZHW A;  2NMU A;  3HKD B;  1CLI A;  1FNJ A;  1QU9 A;  3FD5 A;  2LCA A;  4U3J B;  4X1Y B;  1W41 A;  3R0P A;  2CWJ A;  4BT3 A;  5FLX M;  3D00 A;  1YI2 F;  3S03 A;  5J2T A;  3WGL A;  1NMU B;  4B62 A;  2YXZ A;  4BVT A;  3U0O A;  2B33 A;  3HKD A;  1ZWZ A;  3MQW A;  4U3J A;  5HXU A;  5HY1 A;  1RQ2 A;  1TVK B;  3HKE B;  2H8C A;  3NK7 A;  2RHJ A;  3QHD A;  4X20 A;  3KE1 A;  2H8E A;  4ZOL B;  3JCM M;  2CSL A;  2CZW A;  1VHA A;  3FPI A;  5EB1 B;  2KTU A;  3I56 F;  3SIU A;  1JFF A;  2LBW A;  5GIN C;  4TV8 B;  1YJW F;  1W2B F;  5JVD B;  3J80 M;  1TVK A;  2HP0 B;  3F0E A;  1VQ9 F;  1FSZ A;  4ZOL A;  1VK3 A;  4BT6 A;  3RA6 A;  3CG6 A;  3KIZ A;  2AMT A;  4NQ3 A;  2VAM A;  1VQ5 F;  3LWV C;  3CPQ A;  4TUY B;  4TV8 A;  5JVD A;  3FD6 A;  4BT5 A;  3CXC F;  3CCE F;  2HP0 A;  4BY9 D;  3KJJ A;  3CCL F;  1GO0 A;  1ONI A;  1T0A A;  2HS0 A;  2VAW A;  5KMG B;  2HQS C;  1KNK A;  1VQN F;  2V9Y A;  3VCZ A;  1XRG A;  3PLA C;  4ZHQ B;  5BMV B;  2BTU A;  3F0F A;  3TD4 A;  2WAL A;  3LDT A;  3JAT B;  3LWP C;  2Z1E A;  3JAS B;  1YGY A;  4C8G A;  1VQ4 F;  5HP7 A;  3I7T A;  3HKC A;  5HY4 A;  5KMG A;  3LWR C;  3HAX D;  3WXM B;  4BT2 A;  5GAN K;  5C8Y B;  1Z5W A;  4G4Y A;  3S0H A;  4ZHQ A;  5BMV A;  2BO1 A;  3WJQ A;  3N4Z A;  3VTI C;  3ERN A;  1IV1 A;  1FFX B;  3ON1 A;  1IV4 A;  1VQP F;  1U3P A;  2LBX A;  1SZQ A;  5AVM A;  3CME F;  3V3T A;  1VH8 A;  3IMP A;  5GIO C;  5C8Y A;  3IEQ A;  1CK2 A;  1NQ3 A;  3N2G B;  3GHZ A;  2ZVZ A;  1Q7Y H;  1XHO A;  4BVQ A;  1FFX A;  2ZVY A;  5HY2 A;  2Z1T A;  3IKF A;  2ZAU A;  1U3L A;  2UYJ A;  3OBW A;  4I55 B;  3VYU C;  4IIJ B;  1KQS F;  2OZB A;  3ZOP A;  3HWU A;  3NVI B;  3N2G A;  3OON A;  3CC7 F;  5IYZ B;  3VYT C;  5JQG B;  4C82 A;  2HS4 A;  3ZP4 A;  4TV9 B;  1TUB B;  2HS3 A;  5EAZ A;  2VGN A;  5MN6 A;  4I55 A;  2DYY A;  4IIJ A;  4B5C A;  5EZY B;  3MDO A;  2YYE A;  2Z1F A;  2QTP A;  3KJK A;  3JAK B;  5IYZ A;  3VIU A;  4O2A B;  5CA0 B;  4TZZ A;  5JQG A;  4ZK7 A;  4YJ2 B;  1SA0 B;  4TV9 A;  1TUB A;  1U40 A;  1W57 A;  1RLU A;  3V4D A;  5EZY A;  3VO8 A;  3PAF A;  1M90 H;  2RHL A;  3JAK A;  2KTV A;  2RB9 A;  3LWQ C;  5GON B;  1VQ7 F;  3VOB A;  3HKB A;  4O2A A;  2AIZ P;  4I4T B;  5CA0 A;  5EIB C;  4EI8 A;  4YJ2 A;  3JAR B;  3B6N A;  3KHN A;  4WBN B;  4O4L B;  1W59 A;  2CHT A;  3JVH A;  4X1Y A;  2VXY A;  3D54 A;  3CYP B;  4BVS A;  5IJ0 B;  3C9U A;  5LA6 B;  3VOA A;  5GON A;  4I4T A;  1YHQ F;  1VQV A;  1X25 A;  2H6L A;  3S0Y A;  3N4Y A;  4DXD A;  1H47 A;  2GLZ A;  4WBN A;  4O4L A;  2L26 A;  3HKE A;  3T80 A;  3MCQ A;  3AGK A;  3CCQ F;  4FFB B;  3G6E F;  3QTY A;  1VQ6 F;  5LA6 A;  3G71 F;  3F0D A;  1W5A A;  5CA1 B;  1W42 A;  1Q8R A;  5JCO C;  2VAP A;  3LYB A;  5LOV B;  2UYK A;  3LME A;  4EI7 A;  3HTN A;  1XBI A;  4FFB A;  1E7K A;  4RHA A;  3K2X A;  1W5F A;  3F6M A;  5HWE A;  4LCK A;  2HP3 A;  3VI6 A;  5CA1 A;  3FBA A;  4M8I A;  3S02 A;  4DRX B;  4TUY A;  2PMP A;  1DBF A;  4G4V A;  3JAL B;  4B45 A;  4E6E A;  3K14 A;  4ZHV A;  1H48 A;  2QEX F;  1OAP A;  2ZOD A;  1W5E A;  3EOR A;  1K73 H;  4BT4 A;  4O2B B;  2IG8 A;  4DRX A;  4F6R B;  4O4J B;  1COM A;  3JAL A;  4YJ3 B;  3C9R A;  3JAT A;  1N8R H;  2ZF8 A;  3DDN A;  3M84 A;  2UZH A;  3JAS A;  2QA4 F;  3IEW A;  1Q82 H;  1H7M A;  3HJW C;  3TD5 A;  4F6R A;  3IR9 A;  4O4J A;  5HXZ A;  4YJ3 A;  3S06 A;  1YIJ F;  2MQE A;  5LP6 C;  2G9I A;  2FC3 A;  2BTQ B;  3VMF B;  1PF5 A;  3N2K B;  3WJP A;  1RQ7 A;  3DC2 A;  3WPW A;  2K1S A;  3RYI B;  2KGW A;  1KD1 H;  3RA5 A;  4HNA B;  1JN1 A;  2BTO A;  1U43 A;  5FJ4 C;  1VQM F;  4PWT A;  1RLG A;  4O4H B;  5IT9 M;  3K12 A;  1PXW A;  3N2K A;  3C8L A;  5G4V C;  1QAH A;  1FNK A;  3QUW A;  2P6Y A;  2VGM A;  4X3M A;  3WJR A;  5ITZ B;  3RYI A;  3J7A R;  1SDS A;  4BW0 B;  3CC4 F;  2JNB A;  1R1M A;  1T0K B;  3JAM M;  2IQQ A;  2I6R A;  4O4H A;  3ZP7 A;  5EYP B;  2RHH A;  3NMU C;  2OTJ F;  2I6D A;  2Q1X A;  3M4S A;  4G4X A;  1JY8 A;  5IJ9 B;  5ITZ A;  1YJN F;  4EI9 A;  1SA0 A;  5JH7 B;  2LBT A;  3RYH B;  5DCV A;  1QD9 A;  3C9S A;  1IV2 A;  5EYP A;  4B46 A;  5GIP C;  2HRY A;  5JCO A;  5IJ9 A;  2N48 A;  1YQN A;  3E20 B;  4X20 B;  3RYC B;  5J2U B;  3WGM A;  4ZI7 B;  3JAR A;  4BVR A;  3CCV F;  5JH7 A;  1S72 F;  4X1I B;  4X1K B;  2IAF A;  3WGN A;  1W3E X;  5EIB D;  3RYH A;  1JFF B;  1QVG F;  4KWE A;  2F9Z C;  1QVF F;  4R40 B;  1X7P A;  2Z01 A;  5IJ0 A;  2ZOV A;  3G4S F;  3VYS C;  5G4U C;  1NJI H;  2FGY A;  1YIT F;  3WGK A;  3RYC A;  5J2U A;  2QI2 A;  4O4I B;  3F0G A;  2R75 1;  4ZI7 A;  1VQL F;  2Q1Y A;  3C9T A;  3NVK E;  4X1I A;  4X1K A;  1YJ9 F;  4BT7 A;  1VQ8 F;  2HVY D;  3LFO A;  4G88 A;  1GZ0 A;  5EO3 A;  2PHN A;  4U39 A; 
#chains in the Genus database with same CATH homology
 3CC7 F;  2QA4 F;  1Q82 H;  5HY0 A;  1W40 A;  3D00 A;  5FLX M;  1YI2 F;  1H7M A;  2VGN A;  1NMU B;  3CCM F;  1X7O A;  1CN7 A;  3HJW C;  1GO1 A;  4BVT A;  1ZWZ A;  5HXU A;  5HY1 A;  3IR9 A;  5HXZ A;  3NK7 A;  3V7E A;  1YIJ F;  3JCM M;  2CZW A;  4TZZ A;  1Q86 H;  2FC3 A;  2KTU A;  3CCR F;  3VMF B;  3I56 F;  5EWR A;  5GAP K;  3SIU A;  4XCQ A;  2LBW A;  5GIN C;  1IPA A;  1YJW F;  1W2B F;  1M1K H;  3J80 M;  3PAF A;  1M90 H;  1KD1 H;  3RA5 A;  1VQ7 F;  2KTV A;  3LWQ C;  1VQ9 F;  3SIV A;  1X52 A;  5FJ4 C;  1VQM F;  3RA6 A;  4EI8 A;  3CG6 A;  1RLG A;  2KG4 A;  5IT9 M;  1PXW A;  4NQ3 A;  1VQ5 F;  3LWV C;  3CPQ A;  5G4V C;  3JAM M;  4BVS A;  1K9M H;  2VGM A;  4X3M A;  3J7A R;  3CXC F;  3CCE F;  4BY9 D;  2OHW A;  1SDS A;  4BW0 B;  3CC4 F;  2JNB A;  3CCL F;  1GO0 A;  1T0K B;  1YHQ F;  3N4Y A;  3OW2 F;  1VQN F;  2GLZ A;  3FFM A;  4X3L A;  1K8A H;  3NMU C;  3PLA C;  2OTJ F;  2ALE A;  2I6D A;  3CC2 F;  2WAL A;  3AGK A;  3CCQ F;  3G6E F;  3E1Y A;  1YJN F;  3GYQ A;  1VQ6 F;  3LWP C;  4EI9 A;  3G71 F;  1VQ4 F;  3MCA B;  1W42 A;  3CD6 F;  1RA4 A;  5HY4 A;  3LWR C;  5DCV A;  5A2Q M;  1DT9 A;  3WXM B;  3CPW F;  3HAX D;  5GAN K;  3CCS F;  3V7Q A;  5GIP C;  3CCJ F;  3I55 F;  4EI7 A;  2BO1 A;  3J81 M;  3N4Z A;  1XBI A;  1E7K A;  3E20 B;  3ON1 A;  4BVR A;  2AIF A;  5HWE A;  2LBX A;  3CCV F;  1VQP F;  1S72 F;  3CME F;  3VI6 A;  1Q81 H;  4LCK A;  3V3T A;  3CCU F;  1W3E X;  1VQK F;  3CMA F;  1QVG F;  2F9Z C;  1QVF F;  3OBY A;  1X7P A;  5GIO C;  1CK2 A;  1KC8 H;  3O85 A;  3G4S F;  5G4U C;  4C4W C;  1Q7Y H;  4BVQ A;  1NJI H;  2FGY A;  1JJ2 F;  1YIT F;  2QEX F;  5HY2 A;  2QI2 A;  1K73 H;  3OBW A;  1VQL F;  4NUT A;  2OTL F;  3NVK E;  3NK6 A;  1YJ9 F;  1VQO F;  3LWO C;  1VQ8 F;  2HVY D;  3LFO A;  1KQS F;  1GZ0 A;  1W41 A;  5EO3 A;  2OZB A;  3NVI B;  1N8R H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...