1QVFF

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1qvfF00
1VQMF 2WALA 1X52A 3CC7F 1ZWZA 1W42A 4TZZA 1VQ8F 5GAPK 3VI6A 4LCKA 3CD6F 1PXWA 3MCAB 3N4ZA 2AIFA 2BO1A 1W3EX 1VQ9F 1CK2A 4X3MA 3N4YA 5G4VC 1N8RH 2I6DA 1VQ5F 3HJWC 3NMUC 1Q82H 3CC4F 2LBXA 1IPAA 1DT9A 1W41A 1JJ2F 1GO0A 3IR9A 1E7KA 3OBWA 3CCRF 3LWQC 1Q81H 1KQSF 1GO1A 1XBIA 5EWRA 3I55F 3JAMM 4X3LA 3CCJF 3OBYA 1X7PA 1YITF 3LFOA 1VQOF 1W2BF 1QVGF 3CXCF 1NMUB 1NJIH 1YJNF 3GYQA 1SDSA 3CCVF 4BY9D 1QVFF 3NK7A 2JNBA 3G71F 3CC2F 3CCLF 1H7MA 4BW0B 1Q86H 2ALEA 5GIOC 1KD1H 5DCVA 3SIUA 1S72F 2KTVA 3CMAF 1VQ6F 1YJWF 3E20B 4C4WC 3O85A 2VGMA 2HVYD 3CPWF 3CCMF 2OTJF 3CPQA 3ON1A 3VMFB 1VQNF 3LWRC 5FLXM 5EO3A 3CCSF 1KC8H 1YJ9F 2QA4F 1RA4A 1M1KH 3J80M 3SIVA 5GINC 3WXMB 3OW2F 2OTLF 3RA5A 3J7AR 3I56F 1X7OA 3LWPC 2LBWA 1VQPF 2CZWA 3CCQF 3HAXD 2QI2A 3CG6A 5GIPC 3G6EF 3NVIB 3V7QA 3RA6A 3FFMA 1CN7A 1VQKF 3JCMM 1VQ4F 5A2QM 3J81M 3PLAC 3E1YA 3V7EA 1W40A 2OZBA 1M90H 1VQ7F 3PAFA 1YHQF 1YI2F 2KG4A 3AGKA 1T0KB 1GZ0A 5G4UC 3NVKE 3CCUF 2FC3A 3LWOC 3LWVC 1K9MH 1YIJF 2KTUA 1VQLF 1RLGA 5FJ4C 1K73H 2QEXF 3CMEF 5GANK 5IT9M 1K8AH 2OHWA 3CCEF 1Q7YH 3G4SF 3NK6A 2VGNA 4NUTA
chains in the Genus database with same CATH superfamily
1W42A 4XCQA 4TZZA 1VQ8F 5BMVA 3VYSC 1XHOA 5KX5B 3VYUC 1QD9A 1R1MA 1VQ9F 5EAZA 4C8IA 3JAWA 1U40A 2UYPA 1N8RH 1W57A 2HP0B 4YJ3A 2CHTA 3CC4F 2LBXA 4R40B 3L7QA 4BT4A 4O2AB 4B45A 3OBWA 1Q81H 2ZOVA 5LYJB 1RQ2A 3VOAA 3I55F 3WGNA 1JD1A 3OBYA 1YITF 3RYFA 5HY0A 2UYNB 2NMUA 2KGWA 3HWUA 3HKDA 1NJIH 3GYQA 3S0YA 3NK7A 3G71F 1FFXB 3CC2F 4FFBA 1UFYA 5JQGB 5CB4B 4G88A 2ALEA 4O4IA 4O4JB 5GIOC 3S02A 5DCVA 1S72F 2GZLA 3M1XA 1JFFB 4ZHQA 3F0EA 3B6NA 3JATB 3CPWF 5KMGA 2GVIA 3MCQA 2VAWA 2R6R1 4X1IB 3VMFB 1VQNF 4DRXA 2UZHA 4ZHVA 2H6LA 5FLXM 3BYQA 3E22A 3F0FA 1YJ9F 2QA4F 2HRUA 4BT5A 3RA5A 4NWOB 3WJRA 2ZF8A 3LWPC 1IV2A 1KNJA 1PF5A 3CCQF 1UI9A 3CG6A 2HS3A 3FFMA 3N2GA 4X1YB 3IMPA 4I55B 2Q1YA 2HQSC 5ITZA 3K0TA 5HWEA 1M90H 1CLIA 3PAFA 4O4HA 1YI2F 3MQWA 5LP6C 4ZOLB 2G9IA 2BTUA 2OTMA 1TUBA 1VQVA 3CCUF 3HKCB 3RYCA 1YIJF 1H48A 1W55A 3CMEF 5GANK 2GLZA 5GONA 2RHJA 1K8AH 4WBNB 2OHWA 2AMTA 5CA1A 3RYIA 1Q7YH 2RHHA 4X1KB 5LP6A 3ELCA 4NUTA 4C8GA 1ZWZA 4C8EA 2LCAA 5GAPK 3T80A 1X25A 1PXWA 3N4ZA 2BO1A 4X3MA 3I7TA 3QTYA 3HJWC 4IHJB 3MBMA 2YYEA 4HNAA 1DT9A 1JJ2F 5HY2A 1KQSF 3LWQC 1GO1A 4TV8A 4B5CA 4YJ2B 3JAMM 1X7PA 3LFOA 1VQOF 4ZI7A 3P10A 1FNJA 1QVGF 4EB6B 3CXCF 5EYPB 1Z5WA 1SDSA 1H7MA 3Q8HA 3JASB 5CA0A 3WPWA 1YGYA 3JALB 1TVKB 4BT7A 1ODEA 2UYKA 2YXZA 3TD3A 5MN4A 3KJKA 4IIJB 3V3TA 4BVSA 1FSZA 3RYHA 3S03A 2KTVA 1VQ6F 1YJWF 3ZP4A 2P6YA 4C4WC 2RHOA 1U43A 5IJ9A 1IV3A 4G4VA 2VGMA 2HVYD 3S06A 3CCMF 2OTJF 3CPQA 1SZQA 3LWRC 3D00A 3HKDB 5HXZA 3P0ZA 5EO3A 5KX5A 3CCSF 5IYZB 1RA4A 3F0GA 1M1KH 5GINC 3C9SA 1W5FA 4B46A 2CZWA 4I50B 2IAFA 2Z1EA 3DDNA 3HAXD 5MN6A 5GIPC 4O2AA 3VTIC 3V7QA 3RA6A 5LYJA 3JCMM 1VQ4F 5EIBD 3ZP7A 1KNKA 4O4LA 3VYTC 1XRGA 3E1YA 3V4DA 3F6MA 3V7EA 3CB2A 3LDTA 2OZBA 2PMPA 5KMGB 4I4TA 3KIZA 2KG4A 4DRXB 3C8LA 5EB0A 1FFXA 1JN1A 5HP8A 4RHAA 2ZVYA 4O2BB 5JQGA 5CB4A 2FC3A 2L26A 3LWVC 1K9MH 1SA0B 2MQEA 4PWTA 1VQLF 4O4JA 4NQ3A 5JVDB 2CVLA 2CHSA 1JFFA 3JATA 4G4XA 3CCEF 4X1IA 2WALA 1X52A 1JY8A 2LBTA 3D54A 3VO8A 4BVRA 1RQ7A 2Z1FA 3MDOA 3IKEA 4LNUB 1W581 5JH7B 3JAKB 4X20B 3MCAB 2AIFA 1CK2A 5C8YB 4U3JB 1VH8A 3N2KB 5G4VC 1Q8RA 1Q82H 1VHAA 1QAHA 3CYQA 3WGLA 1IPAA 4TV9B 2DT4A 1GO0A 3IR9A 4X1YA 5EZYB 4B62A 1E7KA 4F6RB 4I55A 1XBIA 5EWRA 4ERHA 3CCJF 4EI9A 3WJPA 5LA6B 4C81A 5FNVA 5J2TB 1J7HA 1NMUB 1H47A 5LXTB 4ZOLA 1YJNF 1IV1A 4BY9D 4E6EA 5LOVA 2CWJA 3WGJA 2JNBA 3LYBA 3CCLF 5HY4A 4BW0B 1Q86H 2ZODA 2RB9A 3CYPB 5J2UB 1KD1H 4ZK7A 3UT5B 3HKBB 3SIUA 4HNAB 4WBNA 4TUYB 3E20B 1DBFA 3GHZA 4G4YA 3KHNA 5MN5A 3HKEB 4X1KA 1GX1A 2K1SA 2ZVZA 3ERNA 4ZI7B 3ON1A 2IG8A 3JARA 3K2XA 2N48A 3HTNA 4BVQA 3IEWA 3K14A 1QU9A 5BMVB 3C9UA 3SIVA 3OW2F 2RHLA 3WXMB 2OTLF 3I56F 4IHJA 1VQPF 3JAWB 3FD6A 4C82A 2QI2A 4YJ3B 3G6EF 3NVIB 1CN7A 4U39A 5IJ0A 2Q1XA 5A2QM 3J81M 2VAMA 3S0WA 3WJQA 3FD5A 4EB6A 5EYPA 4EI7A 3RYFB 5EIBC 2HS0A 3LMEA 3GTZA 1VQ7F 1YHQF 5HY1A 3IEQA 1GZ0A 1W5BA 3JASA 3ZO8A 3JALA 1TVKA 2HRYA 3JVHA 4FFBB 5EB1B 2KTUA 1K73H 2HP0A 3ZOPA 2QEXF 3F0DA 1T0AA 4IIJA 3IKFA 4O4IB 2H8EA 3U0OA 2AIZP 5IT9M 5B8FA 2HX0A 1XV2A 2CW4A 4O4LB 4ZHQB 3G4SF 2UYNA 2Z01A 3K12A 2BTOA 2VGNA 4BT2A 1VQMF 3NVKE 1RLUA 3CC7F 4I4TB 2EWCA 5IYZA 3VI6A 4LCKA 3FBAA 3CD6F 3E22B 2F9ZC 1W3EX 4DXDA 1COMA 3KE1A 3N4YA 4I50A 2I6DA 5JCOC 1VQ5F 3NMUC 2UYJA 2W8BC 3S0HA 1OFUA 1W41A 3EORA 3CCRF 5AVMA 2HS4A 3N2GB 2HP3A 4X3LA 2CSLA 3C9TA 1ONIA 1W2BF 1OAPA 5ITZB 3QUWA 4BT6A 3CCVF 4O4HB 1YQNA 1QVFF 1NQ3A 5JCOA 5HP7A 2DYYA 4KWEA 3DC2A 3ESJA 4M8IA 4O2BA 1SA0A 1IV4A 1TUBB 2VAPA 2QTPA 3KJJA 3RE3A 3RYCB 5JVDA 3TD5A 4BVTA 3QHDA 3WGKA 1Z5VA 3CMAF 5GONB 2R751 4ZHYB 3O85A 3M84A 5CA1B 3RYIB 5LP6B 3D01A 5FNVB 1VK3A 2PHNA 4LNUA 3TD4A 4BT3A 3OONA 5JH7A 3JAKA 4X20A 5LOVB 1KC8H 3P4EA 3J80M 5C8YA 4U3JA 3N2KA 3HKCA 4G4WA 4RQOA 3J7AR 1X7OA 2LBWA 3FPIA 2I6RA 4TV9A 5EZYA 1W5AA 2Z1TA 4F6RA 1VQKF 2ZAUA 3PLAC 2IQQA 4TV8B 5LA6A 3C9RA 5J2TA 2VXYA 1W40A 5LXTA 4G4ZA 4ZHWA 2BTQB 3JARB 3R0PA 3AGKA 1T0KB 1W59A 3WPXA 2B33A 3VIUA 1FNKA 5G4UC 2H8CA 2V9YA 3LWOC 1U3LA 4EI8A 3I3FA 2FGYA 3WGMA 5CA0B 5J2UA 5FJ4C 1RLGA 3UT5A 3HKBA 4TUYA 3M4SA 1W5EA 5HXUA 3HKEA 1U3PA 3RYHB 3VOBA 5IJ0B 2Z1UA 4YJ2A 3VCZA 5IJ9B 3NK6A
chains in the Genus database with same CATH topology
1VQMF 2WALA 1X52A 3CC7F 1ZWZA 1W42A 4XCQA 4BVRA 4TZZA 1VQ8F 5GAPK 3VI6A 4LCKA 3CD6F 1PXWA 3MCAB 3N4ZA 2AIFA 2BO1A 1W3EX 2F9ZC 1CK2A 1VQ9F 4X3MA 3N4YA 5G4VC 1N8RH 2I6DA 1VQ5F 3HJWC 3NMUC 1Q82H 3CC4F 2LBXA 1IPAA 1DT9A 1W41A 1JJ2F 1GO0A 3IR9A 1E7KA 5HY2A 3OBWA 3CCRF 3LWQC 1Q81H 1KQSF 1GO1A 1XBIA 5EWRA 3I55F 3JAMM 4X3LA 3CCJF 3OBYA 1X7PA 4EI9A 1YITF 5HY0A 3LFOA 1VQOF 1W2BF 1QVGF 3CXCF 1NMUB 1NJIH 1YJNF 3GYQA 1SDSA 3CCVF 4BY9D 1QVFF 3NK7A 2JNBA 3G71F 3CC2F 3CCLF 1H7MA 5HY4A 4BW0B 1Q86H 2ALEA 5GIOC 1KD1H 4BVTA 5DCVA 3SIUA 1S72F 3V3TA 4BVSA 2KTVA 3CMAF 1VQ6F 1YJWF 3E20B 4C4WC 3O85A 2VGMA 2HVYD 3CPWF 3CCMF 2OTJF 3CPQA 3ON1A 3VMFB 1VQNF 3LWRC 3D00A 5HXZA 4BVQA 5FLXM 5EO3A 3CCSF 1KC8H 1YJ9F 2QA4F 1RA4A 1M1KH 3J80M 3SIVA 5GINC 3WXMB 3OW2F 2OTLF 3RA5A 3J7AR 3I56F 1X7OA 3LWPC 2LBWA 1VQPF 2CZWA 3CCQF 3HAXD 2QI2A 3CG6A 5GIPC 3G6EF 3NVIB 3V7QA 3RA6A 3FFMA 1CN7A 1VQKF 3JCMM 1VQ4F 5A2QM 3J81M 3PLAC 3E1YA 3V7EA 1W40A 4EI7A 5HWEA 2OZBA 1M90H 1VQ7F 3PAFA 1YHQF 5HY1A 1YI2F 2KG4A 3AGKA 1T0KB 1GZ0A 5G4UC 3NVKE 3CCUF 2FC3A 3LWOC 3LWVC 1K9MH 4EI8A 2FGYA 1YIJF 2KTUA 1VQLF 1RLGA 5FJ4C 4NQ3A 1K73H 2QEXF 3CMEF 5GANK 2GLZA 5IT9M 5HXUA 1K8AH 2OHWA 3CCEF 1Q7YH 3G4SF 3NK6A 2VGNA 4NUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM F;  2WAL A;  1X52 A;  3CC7 F;  1ZWZ A;  1W42 A;  4TZZ A;  1VQ8 F;  5GAP K;  3VI6 A;  4LCK A;  3CD6 F;  1PXW A;  3MCA B;  3N4Z A;  2AIF A;  2BO1 A;  1W3E X;  1VQ9 F;  1CK2 A;  4X3M A;  3N4Y A;  5G4V C;  1N8R H;  2I6D A;  1VQ5 F;  3HJW C;  3NMU C;  1Q82 H;  3CC4 F;  2LBX A;  1IPA A;  1DT9 A;  1W41 A;  1JJ2 F;  1GO0 A;  3IR9 A;  1E7K A;  3OBW A;  3CCR F;  3LWQ C;  1Q81 H;  1KQS F;  1GO1 A;  1XBI A;  5EWR A;  3I55 F;  3JAM M;  4X3L A;  3CCJ F;  3OBY A;  1X7P A;  1YIT F;  3LFO A;  1VQO F;  1W2B F;  1QVG F;  3CXC F;  1NMU B;  1NJI H;  1YJN F;  3GYQ A;  1SDS A;  3CCV F;  4BY9 D;  1QVF F;  3NK7 A;  2JNB A;  3G71 F;  3CC2 F;  3CCL F;  1H7M A;  4BW0 B;  1Q86 H;  2ALE A;  5GIO C;  1KD1 H;  5DCV A;  3SIU A;  1S72 F;  2KTV A;  3CMA F;  1VQ6 F;  1YJW F;  3E20 B;  4C4W C;  3O85 A;  2VGM A;  2HVY D;  3CPW F;  3CCM F;  2OTJ F;  3CPQ A;  3ON1 A;  3VMF B;  1VQN F;  3LWR C;  5FLX M;  5EO3 A;  3CCS F;  1KC8 H;  1YJ9 F;  2QA4 F;  1RA4 A;  1M1K H;  3J80 M;  3SIV A;  5GIN C;  3WXM B;  3OW2 F;  2OTL F;  3RA5 A;  3J7A R;  3I56 F;  1X7O A;  3LWP C;  2LBW A;  1VQP F;  2CZW A;  3CCQ F;  3HAX D;  2QI2 A;  3CG6 A;  5GIP C;  3G6E F;  3NVI B;  3V7Q A;  3RA6 A;  3FFM A;  1CN7 A;  1VQK F;  3JCM M;  1VQ4 F;  5A2Q M;  3J81 M;  3PLA C;  3E1Y A;  3V7E A;  1W40 A;  2OZB A;  1M90 H;  1VQ7 F;  3PAF A;  1YHQ F;  1YI2 F;  2KG4 A;  3AGK A;  1T0K B;  1GZ0 A;  5G4U C;  3NVK E;  3CCU F;  2FC3 A;  3LWO C;  3LWV C;  1K9M H;  1YIJ F;  2KTU A;  1VQL F;  1RLG A;  5FJ4 C;  1K73 H;  2QEX F;  3CME F;  5GAN K;  5IT9 M;  1K8A H;  2OHW A;  3CCE F;  1Q7Y H;  3G4S F;  3NK6 A;  2VGN A;  4NUT A; 
#chains in the Genus database with same CATH topology
 1W42 A;  4XCQ A;  4TZZ A;  1VQ8 F;  5BMV A;  3VYS C;  1XHO A;  5KX5 B;  3VYU C;  1QD9 A;  1R1M A;  1VQ9 F;  5EAZ A;  4C8I A;  3JAW A;  1U40 A;  2UYP A;  1N8R H;  1W57 A;  2HP0 B;  4YJ3 A;  2CHT A;  3CC4 F;  2LBX A;  4R40 B;  3L7Q A;  4BT4 A;  4O2A B;  4B45 A;  3OBW A;  1Q81 H;  2ZOV A;  5LYJ B;  1RQ2 A;  3VOA A;  3I55 F;  3WGN A;  1JD1 A;  3OBY A;  1YIT F;  3RYF A;  5HY0 A;  2UYN B;  2NMU A;  2KGW A;  3HWU A;  3HKD A;  1NJI H;  3GYQ A;  3S0Y A;  3NK7 A;  3G71 F;  1FFX B;  3CC2 F;  4FFB A;  1UFY A;  5JQG B;  5CB4 B;  4G88 A;  2ALE A;  4O4I A;  4O4J B;  5GIO C;  3S02 A;  5DCV A;  1S72 F;  2GZL A;  3M1X A;  1JFF B;  4ZHQ A;  3F0E A;  3B6N A;  3JAT B;  3CPW F;  5KMG A;  2GVI A;  3MCQ A;  2VAW A;  2R6R 1;  4X1I B;  3VMF B;  1VQN F;  4DRX A;  2UZH A;  4ZHV A;  2H6L A;  5FLX M;  3BYQ A;  3E22 A;  3F0F A;  1YJ9 F;  2QA4 F;  2HRU A;  4BT5 A;  3RA5 A;  4NWO B;  3WJR A;  2ZF8 A;  3LWP C;  1IV2 A;  1KNJ A;  1PF5 A;  3CCQ F;  1UI9 A;  3CG6 A;  2HS3 A;  3FFM A;  3N2G A;  4X1Y B;  3IMP A;  4I55 B;  2Q1Y A;  2HQS C;  5ITZ A;  3K0T A;  5HWE A;  1M90 H;  1CLI A;  3PAF A;  4O4H A;  1YI2 F;  3MQW A;  5LP6 C;  4ZOL B;  2G9I A;  2BTU A;  2OTM A;  1TUB A;  1VQV A;  3CCU F;  3HKC B;  3RYC A;  1YIJ F;  1H48 A;  1W55 A;  3CME F;  5GAN K;  2GLZ A;  5GON A;  2RHJ A;  1K8A H;  4WBN B;  2OHW A;  2AMT A;  5CA1 A;  3RYI A;  1Q7Y H;  2RHH A;  4X1K B;  5LP6 A;  3ELC A;  4NUT A;  4C8G A;  1ZWZ A;  4C8E A;  2LCA A;  5GAP K;  3T80 A;  1X25 A;  1PXW A;  3N4Z A;  2BO1 A;  4X3M A;  3I7T A;  3QTY A;  3HJW C;  4IHJ B;  3MBM A;  2YYE A;  4HNA A;  1DT9 A;  1JJ2 F;  5HY2 A;  1KQS F;  3LWQ C;  1GO1 A;  4TV8 A;  4B5C A;  4YJ2 B;  3JAM M;  1X7P A;  3LFO A;  1VQO F;  4ZI7 A;  3P10 A;  1FNJ A;  1QVG F;  4EB6 B;  3CXC F;  5EYP B;  1Z5W A;  1SDS A;  1H7M A;  3Q8H A;  3JAS B;  5CA0 A;  3WPW A;  1YGY A;  3JAL B;  1TVK B;  4BT7 A;  1ODE A;  2UYK A;  2YXZ A;  3TD3 A;  5MN4 A;  3KJK A;  4IIJ B;  3V3T A;  4BVS A;  1FSZ A;  3RYH A;  3S03 A;  2KTV A;  1VQ6 F;  1YJW F;  3ZP4 A;  2P6Y A;  4C4W C;  2RHO A;  1U43 A;  5IJ9 A;  1IV3 A;  4G4V A;  2VGM A;  2HVY D;  3S06 A;  3CCM F;  2OTJ F;  3CPQ A;  1SZQ A;  3LWR C;  3D00 A;  3HKD B;  5HXZ A;  3P0Z A;  5EO3 A;  5KX5 A;  3CCS F;  5IYZ B;  1RA4 A;  3F0G A;  1M1K H;  5GIN C;  3C9S A;  1W5F A;  4B46 A;  2CZW A;  4I50 B;  2IAF A;  2Z1E A;  3DDN A;  3HAX D;  5MN6 A;  5GIP C;  4O2A A;  3VTI C;  3V7Q A;  3RA6 A;  5LYJ A;  3JCM M;  1VQ4 F;  5EIB D;  3ZP7 A;  1KNK A;  4O4L A;  3VYT C;  1XRG A;  3E1Y A;  3V4D A;  3F6M A;  3V7E A;  3CB2 A;  3LDT A;  2OZB A;  2PMP A;  5KMG B;  4I4T A;  3KIZ A;  2KG4 A;  4DRX B;  3C8L A;  5EB0 A;  1FFX A;  1JN1 A;  5HP8 A;  4RHA A;  2ZVY A;  4O2B B;  5JQG A;  5CB4 A;  2FC3 A;  2L26 A;  3LWV C;  1K9M H;  1SA0 B;  2MQE A;  4PWT A;  1VQL F;  4O4J A;  4NQ3 A;  5JVD B;  2CVL A;  2CHS A;  1JFF A;  3JAT A;  4G4X A;  3CCE F;  4X1I A;  2WAL A;  1X52 A;  1JY8 A;  2LBT A;  3D54 A;  3VO8 A;  4BVR A;  1RQ7 A;  2Z1F A;  3MDO A;  3IKE A;  4LNU B;  1W58 1;  5JH7 B;  3JAK B;  4X20 B;  3MCA B;  2AIF A;  1CK2 A;  5C8Y B;  4U3J B;  1VH8 A;  3N2K B;  5G4V C;  1Q8R A;  1Q82 H;  1VHA A;  1QAH A;  3CYQ A;  3WGL A;  1IPA A;  4TV9 B;  2DT4 A;  1GO0 A;  3IR9 A;  4X1Y A;  5EZY B;  4B62 A;  1E7K A;  4F6R B;  4I55 A;  1XBI A;  5EWR A;  4ERH A;  3CCJ F;  4EI9 A;  3WJP A;  5LA6 B;  4C81 A;  5FNV A;  5J2T B;  1J7H A;  1NMU B;  1H47 A;  5LXT B;  4ZOL A;  1YJN F;  1IV1 A;  4BY9 D;  4E6E A;  5LOV A;  2CWJ A;  3WGJ A;  2JNB A;  3LYB A;  3CCL F;  5HY4 A;  4BW0 B;  1Q86 H;  2ZOD A;  2RB9 A;  3CYP B;  5J2U B;  1KD1 H;  4ZK7 A;  3UT5 B;  3HKB B;  3SIU A;  4HNA B;  4WBN A;  4TUY B;  3E20 B;  1DBF A;  3GHZ A;  4G4Y A;  3KHN A;  5MN5 A;  3HKE B;  4X1K A;  1GX1 A;  2K1S A;  2ZVZ A;  3ERN A;  4ZI7 B;  3ON1 A;  2IG8 A;  3JAR A;  3K2X A;  2N48 A;  3HTN A;  4BVQ A;  3IEW A;  3K14 A;  1QU9 A;  5BMV B;  3C9U A;  3SIV A;  3OW2 F;  2RHL A;  3WXM B;  2OTL F;  3I56 F;  4IHJ A;  1VQP F;  3JAW B;  3FD6 A;  4C82 A;  2QI2 A;  4YJ3 B;  3G6E F;  3NVI B;  1CN7 A;  4U39 A;  5IJ0 A;  2Q1X A;  5A2Q M;  3J81 M;  2VAM A;  3S0W A;  3WJQ A;  3FD5 A;  4EB6 A;  5EYP A;  4EI7 A;  3RYF B;  5EIB C;  2HS0 A;  3LME A;  3GTZ A;  1VQ7 F;  1YHQ F;  5HY1 A;  3IEQ A;  1GZ0 A;  1W5B A;  3JAS A;  3ZO8 A;  3JAL A;  1TVK A;  2HRY A;  3JVH A;  4FFB B;  5EB1 B;  2KTU A;  1K73 H;  2HP0 A;  3ZOP A;  2QEX F;  3F0D A;  1T0A A;  4IIJ A;  3IKF A;  4O4I B;  2H8E A;  3U0O A;  2AIZ P;  5IT9 M;  5B8F A;  2HX0 A;  1XV2 A;  2CW4 A;  4O4L B;  4ZHQ B;  3G4S F;  2UYN A;  2Z01 A;  3K12 A;  2BTO A;  2VGN A;  4BT2 A;  1VQM F;  3NVK E;  1RLU A;  3CC7 F;  4I4T B;  2EWC A;  5IYZ A;  3VI6 A;  4LCK A;  3FBA A;  3CD6 F;  3E22 B;  2F9Z C;  1W3E X;  4DXD A;  1COM A;  3KE1 A;  3N4Y A;  4I50 A;  2I6D A;  5JCO C;  1VQ5 F;  3NMU C;  2UYJ A;  2W8B C;  3S0H A;  1OFU A;  1W41 A;  3EOR A;  3CCR F;  5AVM A;  2HS4 A;  3N2G B;  2HP3 A;  4X3L A;  2CSL A;  3C9T A;  1ONI A;  1W2B F;  1OAP A;  5ITZ B;  3QUW A;  4BT6 A;  3CCV F;  4O4H B;  1YQN A;  1QVF F;  1NQ3 A;  5JCO A;  5HP7 A;  2DYY A;  4KWE A;  3DC2 A;  3ESJ A;  4M8I A;  4O2B A;  1SA0 A;  1IV4 A;  1TUB B;  2VAP A;  2QTP A;  3KJJ A;  3RE3 A;  3RYC B;  5JVD A;  3TD5 A;  4BVT A;  3QHD A;  3WGK A;  1Z5V A;  3CMA F;  5GON B;  2R75 1;  4ZHY B;  3O85 A;  3M84 A;  5CA1 B;  3RYI B;  5LP6 B;  3D01 A;  5FNV B;  1VK3 A;  2PHN A;  4LNU A;  3TD4 A;  4BT3 A;  3OON A;  5JH7 A;  3JAK A;  4X20 A;  5LOV B;  1KC8 H;  3P4E A;  3J80 M;  5C8Y A;  4U3J A;  3N2K A;  3HKC A;  4G4W A;  4RQO A;  3J7A R;  1X7O A;  2LBW A;  3FPI A;  2I6R A;  4TV9 A;  5EZY A;  1W5A A;  2Z1T A;  4F6R A;  1VQK F;  2ZAU A;  3PLA C;  2IQQ A;  4TV8 B;  5LA6 A;  3C9R A;  5J2T A;  2VXY A;  1W40 A;  5LXT A;  4G4Z A;  4ZHW A;  2BTQ B;  3JAR B;  3R0P A;  3AGK A;  1T0K B;  1W59 A;  3WPX A;  2B33 A;  3VIU A;  1FNK A;  5G4U C;  2H8C A;  2V9Y A;  3LWO C;  1U3L A;  4EI8 A;  3I3F A;  2FGY A;  3WGM A;  5CA0 B;  5J2U A;  5FJ4 C;  1RLG A;  3UT5 A;  3HKB A;  4TUY A;  3M4S A;  1W5E A;  5HXU A;  3HKE A;  1U3P A;  3RYH B;  3VOB A;  5IJ0 B;  2Z1U A;  4YJ2 A;  3VCZ A;  5IJ9 B;  3NK6 A; 
#chains in the Genus database with same CATH homology
 1VQM F;  2WAL A;  1X52 A;  3CC7 F;  1ZWZ A;  1W42 A;  4XCQ A;  4BVR A;  4TZZ A;  1VQ8 F;  5GAP K;  3VI6 A;  4LCK A;  3CD6 F;  1PXW A;  3MCA B;  3N4Z A;  2AIF A;  2BO1 A;  1W3E X;  2F9Z C;  1CK2 A;  1VQ9 F;  4X3M A;  3N4Y A;  5G4V C;  1N8R H;  2I6D A;  1VQ5 F;  3HJW C;  3NMU C;  1Q82 H;  3CC4 F;  2LBX A;  1IPA A;  1DT9 A;  1W41 A;  1JJ2 F;  1GO0 A;  3IR9 A;  1E7K A;  5HY2 A;  3OBW A;  3CCR F;  3LWQ C;  1Q81 H;  1KQS F;  1GO1 A;  1XBI A;  5EWR A;  3I55 F;  3JAM M;  4X3L A;  3CCJ F;  3OBY A;  1X7P A;  4EI9 A;  1YIT F;  5HY0 A;  3LFO A;  1VQO F;  1W2B F;  1QVG F;  3CXC F;  1NMU B;  1NJI H;  1YJN F;  3GYQ A;  1SDS A;  3CCV F;  4BY9 D;  1QVF F;  3NK7 A;  2JNB A;  3G71 F;  3CC2 F;  3CCL F;  1H7M A;  5HY4 A;  4BW0 B;  1Q86 H;  2ALE A;  5GIO C;  1KD1 H;  4BVT A;  5DCV A;  3SIU A;  1S72 F;  3V3T A;  4BVS A;  2KTV A;  3CMA F;  1VQ6 F;  1YJW F;  3E20 B;  4C4W C;  3O85 A;  2VGM A;  2HVY D;  3CPW F;  3CCM F;  2OTJ F;  3CPQ A;  3ON1 A;  3VMF B;  1VQN F;  3LWR C;  3D00 A;  5HXZ A;  4BVQ A;  5FLX M;  5EO3 A;  3CCS F;  1KC8 H;  1YJ9 F;  2QA4 F;  1RA4 A;  1M1K H;  3J80 M;  3SIV A;  5GIN C;  3WXM B;  3OW2 F;  2OTL F;  3RA5 A;  3J7A R;  3I56 F;  1X7O A;  3LWP C;  2LBW A;  1VQP F;  2CZW A;  3CCQ F;  3HAX D;  2QI2 A;  3CG6 A;  5GIP C;  3G6E F;  3NVI B;  3V7Q A;  3RA6 A;  3FFM A;  1CN7 A;  1VQK F;  3JCM M;  1VQ4 F;  5A2Q M;  3J81 M;  3PLA C;  3E1Y A;  3V7E A;  1W40 A;  4EI7 A;  5HWE A;  2OZB A;  1M90 H;  1VQ7 F;  3PAF A;  1YHQ F;  5HY1 A;  1YI2 F;  2KG4 A;  3AGK A;  1T0K B;  1GZ0 A;  5G4U C;  3NVK E;  3CCU F;  2FC3 A;  3LWO C;  3LWV C;  1K9M H;  4EI8 A;  2FGY A;  1YIJ F;  2KTU A;  1VQL F;  1RLG A;  5FJ4 C;  4NQ3 A;  1K73 H;  2QEX F;  3CME F;  5GAN K;  2GLZ A;  5IT9 M;  5HXU A;  1K8A H;  2OHW A;  3CCE F;  1Q7Y H;  3G4S F;  3NK6 A;  2VGN A;  4NUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...