1QVFF

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1qvfF00
2AIFA 1VQPF 1W2BF 4TZZA 1T0KB 3NVKE 3RA6A 3CCUF 1K8AH 1YI2F 2BO1A 1E7KA 3CCVF 5FJ4C 1GZ0A 1XBIA 5G4UC 3I56F 2OZBA 3WXMB 5GANK 3CC2F 1K9MH 3CC7F 3N4ZA 3JCMM 3J7AR 2KG4A 3CPWF 2I6DA 3NMUC 5G4VC 5GIOC 2QA4F 2CZWA 3PAFA 3SIUA 3NK6A 1KD1H 3G4SF 2KTUA 1GO0A 1IPAA 1X52A 2VGMA 3CXCF 1YIJF 2OTLF 1VQMF 2OTJF 4X3LA 1JJ2F 1VQ4F 1GO1A 3VI6A 5GAPK 1VQ8F 3MCAB 4BW0B 3OBYA 1YJWF 2HVYD 3NVIB 2VGNA 5A2QM 3IR9A 1VQ5F 3CCLF 1VQ7F 5GIPC 2ALEA 1DT9A 1PXWA 4C4WC 1Q86H 1VQOF 1W41A 1KQSF 1SDSA 3G71F 3CG6A 1YHQF 3E20B 3NK7A 1N8RH 3E1YA 1QVGF 2JNBA 1VQ6F 1X7OA 2WALA 4NUTA 3CCSF 1M90H 3LWRC 1VQ9F 3V7EA 1CK2A 5EO3A 4LCKA 3CCEF 3LWPC 3VMFB 1M1KH 5GINC 1YJ9F 4BY9D 1W3EX 3LFOA 3CCJF 3AGKA 3FFMA 3CCQF 2LBWA 5DCVA 3OBWA 2KTVA 3CC4F 3ON1A 3HJWC 1Q81H 1RLGA 1ZWZA 3N4YA 1RA4A 2FC3A 3G6EF 3HAXD 3RA5A 2LBXA 3J81M 3I55F 3JAMM 1NMUB 1H7MA 3CCRF 1YITF 1NJIH 5EWRA 1W42A 2QEXF 5IT9M 5FLXM 1Q82H 3OW2F 1K73H 1QVFF 3O85A 1KC8H 1VQNF 3CCMF 2QI2A 1S72F 3LWVC 3V7QA 3J80M 3SIVA 1Q7YH 1CN7A 3CD6F 1W40A 1YJNF 3LWQC 1X7PA 3PLAC 1VQLF 3LWOC 3CPQA 3CMAF 3CMEF 3GYQA 1VQKF 4X3MA 2OHWA
chains in the Genus database with same CATH superfamily
1VQPF 1W2BF 5IYZA 3CCUF 1K8AH 1KNKA 5LYJB 2YXZA 1W57A 3JALB 4O4HA 1OFUA 5HP8A 3WJQA 5MN4A 3JCMM 3VOAA 3WJRA 2KG4A 2LBTA 3JATB 1VK3A 3WGJA 3UT5B 1U43A 2H8EA 2QA4F 1JN1A 2ZVZA 2ZODA 5BMVB 3F0FA 2CZWA 5ITZB 4FFBA 2CHSA 4RHAA 4YJ3A 1VH8A 2Z1UA 3JASA 2KTUA 4C8EA 3IMPA 1ONIA 1UFYA 4O2BA 4TV9A 4E6EA 4M8IA 4ZI7B 4BT2A 4O4IA 3F0EA 5IJ0B 3KHNA 1IV4A 3ELCA 5GONA 2OTLF 4G88A 5LYJA 4ZHQB 5KX5A 4X3LA 3V3TA 1JJ2F 4EI9A 2Z1FA 3IEQA 1VQ8F 4C8IA 4NWOB 1OAPA 2UYKA 4ZHWA 4ERHA 1ODEA 1VQ7F 5GIPC 1Q86H 3VO8A 3GTZA 3IEWA 3JAKA 5JVDB 5ITZA 5IJ9B 2H6LA 4X1YB 1QVGF 1Z5WA 4ZHVA 1W5FA 1X7OA 1VQ6F 2ZOVA 3MCQA 2GZLA 3WGKA 1H48A 5J2TB 5EAZA 2CHTA 1FFXA 3IKEA 3C9TA 3AGKA 5DCVA 3BYQA 1JFFB 4G4VA 1W55A 2KTVA 4U39A 3CC4F 5KMGA 1Q81H 3FD5A 5HXUA 3RA5A 5B8FA 1UI9A 2LBXA 4DRXB 5JCOA 3JAMM 3HWUA 5LA6B 1NMUB 3CCRF 2R6R1 3QUWA 1TUBA 3F0GA 1NJIH 5JVDA 5IJ9A 1XHOA 1Q82H 1QVFF 3S0WA 1KC8H 4B5CA 3WJPA 1VHAA 2BTUA 3CCMF 1S72F 3V7QA 3J80M 4ZOLB 5J2TA 2UYPA 1Q7YH 4PWTA 1CN7A 4RQOA 5CA1A 1YJNF 2OTMA 3D54A 1VQLF 2HRUA 3ERNA 5IYZB 1Z5VA 1T0AA 3NVKE 4WBNB 2EWCA 3FD6A 3RA6A 5FJ4C 1GZ0A 1COMA 1XBIA 4O4HB 2LCAA 3I56F 1GX1A 3LYBA 4EB6A 3CC2F 3QTYA 1W5EA 3CPWF 1U40A 2UZHA 4U3JA 5GIOC 4G4WA 4FFBB 2G9IA 4YJ3B 3C9UA 2F9ZC 5JCOC 1IV3A 4EI8A 5JQGB 4O2BB 4TV9B 3G4SF 5HY0A 3M84A 3TD4A 1XV2A 5GONB 3CXCF 2VGMA 3CYPB 1J7HA 2I6RA 3RYHA 5KX5B 1YIJF 4WBNA 2HS3A 2RB9A 2OTJF 3ZOPA 2IG8A 2UYNB 2YYEA 4X1IB 3MBMA 1VQ4F 1GO1A 2CW4A 5GAPK 5LP6C 3OBYA 3NVIB 1RQ2A 2DYYA 5EIBC 3IR9A 3V4DA 5EIBD 3CCLF 3JAWB 2ALEA 1DT9A 4X20B 3JAKB 3N2KA 1W41A 1KQSF 3RYFA 3CG6A 3HTNA 2V9YA 2L26A 5JQGA 2JNBA 5EB0A 3JARB 5FNVB 3VIUA 3KIZA 3CCSF 1FFXB 1IV2A 1VQ9F 4B46A 5EO3A 3DC2A 3R0PA 1VQVA 1M1KH 1YJ9F 2UYNA 4X1IA 3K12A 4R40B 2GLZA 5HXZA 1W59A 3Q8HA 3HKDB 3WPWA 4G4ZA 5KMGB 3K0TA 1W5AA 2GVIA 4C81A 3G6EF 2BTOA 2BTQB 3JAWA 1TUBB 4O4LA 4X20A 1H47A 2ZF8A 4HNAB 3MQWA 2QEXF 4I50B 5IT9M 2HX0A 2PMPA 5FLXM 2Q1XA 3LMEA 3RYCB 1K73H 3M4SA 3JARA 5FNVA 3HKCA 3K14A 3N2GA 5EB1B 3CB2A 5LP6B 5LOVB 5CA1B 3QHDA 1W40A 2P6YA 3S02A 2QTPA 3EORA 1PF5A 3LWQC 3RE3A 4LNUA 3HKDA 3S03A 3KJJA 3CPQA 4BVQA 4TV8A 1QAHA 3GYQA 1VQKF 1T0KB 4TZZA 2VXYA 2BO1A 2ZVYA 4EB6B 3T80A 4HNAA 5G4UC 4G4YA 2OZBA 2AIZP 4F6RA 2AMTA 4I50A 1K9MH 2H8CA 3CC7F 5AVMA 4B62A 3N4ZA 4U3JB 5JH7B 3J7AR 3RYCA 4XCQA 2I6DA 5MN6A 5G4VC 3C9SA 3GHZA 2UYJA 3ESJA 3TD5A 4ZK7A 5LP6A 2Q1YA 5LOVA 3VYTC 3ZO8A 3ZP7A 3PAFA 3P10A 3WGNA 4C8GA 3P0ZA 4O4JA 5C8YB 2IQQA 1GO0A 1QU9A 3RYHB 3S0HA 1IPAA 2Z1TA 1X52A 4BT6A 1JY8A 1FNJA 2HQSC 3C8LA 3FBAA 2RHHA 2CWJA 4BT7A 3CYQA 4TUYA 4BW0B 1YJWF 5EZYA 2VGNA 3WGMA 4IIJA 5A2QM 2ZAUA 2VAMA 3F6MA 3B6NA 2CVLA 5JH7A 3N2KB 3M1XA 3RYFB 3VCZA 4C4WC 1VQOF 1RQ7A 1IV1A 5MN5A 4BT4A 1YQNA 4BT5A 5C8YA 3S06A 1W5BA 3D01A 5HY1A 1M90H 3V7EA 2HS0A 2R751 3E22A 3K2XA 3VMFB 5GINC 3FFMA 3LDTA 3CCQF 3OBWA 3VYSC 1FSZA 1CLIA 3HJWC 1ZWZA 2HP3A 1RA4A 2FC3A 2RHLA 3HAXD 4O4LB 2N48A 3I55F 3WPXA 1H7MA 1NQ3A 4BVSA 5HWEA 5EWRA 3RYIB 5EYPA 5CA0A 2FGYA 1Q8RA 3HKCB 3OW2F 3O85A 3N2GB 2MQEA 3TD3A 1U3LA 2NMUA 2QI2A 3MDOA 2HS4A 2RHOA 1TVKB 4O2AA 3CD6F 5HP7A 4LNUB 1U3PA 3P4EA 3PLAC 5LXTB 4TV8B 3JVHA 3LWOC 4X3MA 1X25A 2AIFA 4BVTA 4I55A 4IHJA 1DBFA 1YI2F 1E7KA 3HKEB 4I4TB 3CCVF 4F6RB 3IKFA 3RYIA 3WXMB 3JALA 2K1SA 2HP0B 4KWEA 3VOBA 5GANK 3NMUC 2PHNA 2W8BC 4G4XA 3JATA 1R1MA 3UT5A 1TVKA 3SIUA 4O4JB 3NK6A 2Z01A 3KE1A 1KD1H 5BMVA 3DDNA 5LXTA 5J2UB 4EI7A 4B45A 3I3FA 2VAWA 1SA0B 3D00A 5HY2A 4ZI7A 1VQMF 4TUYB 5IJ0A 3HKEA 4I4TA 5EZYB 5CB4A 2KGWA 4IIJB 3VI6A 3MCAB 4ZHQA 2VAPA 2HVYD 1W581 4NQ3A 2HP0A 1VQ5F 1PXWA 3KJKA 1RLUA 1SDSA 3OONA 3G71F 4BVRA 3L7QA 1YHQF 3E20B 3S0YA 3NK7A 1N8RH 3E1YA 2CSLA 4BT3A 3HKBB 4YJ2B 2WALA 4X1YA 5J2UA 1YGYA 4NUTA 2Z1EA 4X1KB 3E22B 3LWRC 1CK2A 3F0DA 1SA0A 5HY4A 4LCKA 3CCEF 3LWPC 1SZQA 2HRYA 4BY9D 1W3EX 3LFOA 4DXDA 1KNJA 3CCJF 2LBWA 2IAFA 3FPIA 3I7TA 3ON1A 1JFFA 4ZHYB 1XRGA 5CB4B 1RLGA 3N4YA 1JD1A 3WGLA 3J81M 1YITF 5EYPB 3VTIC 4DRXA 5CA0B 5LA6A 1W42A 2B33A 2DT4A 4C82A 3HKBA 4YJ2A 4O2AB 1VQNF 3LWVC 4X1KA 3SIVA 3VYUC 2RHJA 4ZOLA 3JASB 3C9RA 1X7PA 1FNKA 1QD9A 3U0OA 3ZP4A 4I55B 3CMAF 4IHJB 3CMEF 2OHWA 4O4IB
chains in the Genus database with same CATH topology
2AIFA 1VQPF 1W2BF 4TZZA 4BVTA 1T0KB 3NVKE 3RA6A 3CCUF 1K8AH 1YI2F 2BO1A 1E7KA 3CCVF 5FJ4C 1GZ0A 1XBIA 5G4UC 3I56F 2OZBA 3WXMB 5GANK 3CC2F 1K9MH 3CC7F 3N4ZA 3JCMM 3J7AR 2KG4A 3CPWF 4XCQA 2I6DA 3NMUC 5G4VC 5GIOC 2QA4F 2F9ZC 2CZWA 3PAFA 3SIUA 3NK6A 1KD1H 4EI8A 3G4SF 5HY0A 2KTUA 1GO0A 4EI7A 1IPAA 1X52A 2VGMA 3D00A 3CXCF 1YIJF 5HY2A 2OTLF 1VQMF 2OTJF 4X3LA 3V3TA 1JJ2F 1VQ4F 4EI9A 1GO1A 3VI6A 5GAPK 1VQ8F 3MCAB 4BW0B 3OBYA 1YJWF 2HVYD 3NVIB 2VGNA 4NQ3A 3IR9A 5A2QM 1VQ5F 3CCLF 1VQ7F 5GIPC 2ALEA 1DT9A 1PXWA 4C4WC 1Q86H 1VQOF 1W41A 1KQSF 1SDSA 3G71F 3CG6A 4BVRA 1YHQF 3E20B 3NK7A 1N8RH 3E1YA 1QVGF 2JNBA 1VQ6F 1X7OA 2WALA 4NUTA 5HY1A 3CCSF 1M90H 3LWRC 1VQ9F 3V7EA 1CK2A 5EO3A 5HY4A 4LCKA 3CCEF 3LWPC 3VMFB 1M1KH 5GINC 1YJ9F 4BY9D 1W3EX 3LFOA 3CCJF 3AGKA 3FFMA 3CCQF 2LBWA 2GLZA 5HXZA 5DCVA 3OBWA 2KTVA 3CC4F 3ON1A 3HJWC 1Q81H 1RLGA 1ZWZA 3N4YA 1RA4A 2FC3A 5HXUA 3G6EF 3HAXD 3RA5A 2LBXA 3J81M 3I55F 3JAMM 1NMUB 1H7MA 3CCRF 1YITF 4BVSA 1NJIH 5HWEA 5EWRA 1W42A 2QEXF 5IT9M 2FGYA 5FLXM 1Q82H 3OW2F 1K73H 1QVFF 3O85A 1KC8H 1VQNF 3CCMF 2QI2A 1S72F 3LWVC 3V7QA 3J80M 3SIVA 1Q7YH 1CN7A 3CD6F 1W40A 1YJNF 3LWQC 1X7PA 3PLAC 1VQLF 3LWOC 3CPQA 4BVQA 3CMAF 3CMEF 3GYQA 1VQKF 4X3MA 2OHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIF A;  1VQP F;  1W2B F;  4TZZ A;  1T0K B;  3NVK E;  3RA6 A;  3CCU F;  1K8A H;  1YI2 F;  2BO1 A;  1E7K A;  3CCV F;  5FJ4 C;  1GZ0 A;  1XBI A;  5G4U C;  3I56 F;  2OZB A;  3WXM B;  5GAN K;  3CC2 F;  1K9M H;  3CC7 F;  3N4Z A;  3JCM M;  3J7A R;  2KG4 A;  3CPW F;  2I6D A;  3NMU C;  5G4V C;  5GIO C;  2QA4 F;  2CZW A;  3PAF A;  3SIU A;  3NK6 A;  1KD1 H;  3G4S F;  2KTU A;  1GO0 A;  1IPA A;  1X52 A;  2VGM A;  3CXC F;  1YIJ F;  2OTL F;  1VQM F;  2OTJ F;  4X3L A;  1JJ2 F;  1VQ4 F;  1GO1 A;  3VI6 A;  5GAP K;  1VQ8 F;  3MCA B;  4BW0 B;  3OBY A;  1YJW F;  2HVY D;  3NVI B;  2VGN A;  5A2Q M;  3IR9 A;  1VQ5 F;  3CCL F;  1VQ7 F;  5GIP C;  2ALE A;  1DT9 A;  1PXW A;  4C4W C;  1Q86 H;  1VQO F;  1W41 A;  1KQS F;  1SDS A;  3G71 F;  3CG6 A;  1YHQ F;  3E20 B;  3NK7 A;  1N8R H;  3E1Y A;  1QVG F;  2JNB A;  1VQ6 F;  1X7O A;  2WAL A;  4NUT A;  3CCS F;  1M90 H;  3LWR C;  1VQ9 F;  3V7E A;  1CK2 A;  5EO3 A;  4LCK A;  3CCE F;  3LWP C;  3VMF B;  1M1K H;  5GIN C;  1YJ9 F;  4BY9 D;  1W3E X;  3LFO A;  3CCJ F;  3AGK A;  3FFM A;  3CCQ F;  2LBW A;  5DCV A;  3OBW A;  2KTV A;  3CC4 F;  3ON1 A;  3HJW C;  1Q81 H;  1RLG A;  1ZWZ A;  3N4Y A;  1RA4 A;  2FC3 A;  3G6E F;  3HAX D;  3RA5 A;  2LBX A;  3J81 M;  3I55 F;  3JAM M;  1NMU B;  1H7M A;  3CCR F;  1YIT F;  1NJI H;  5EWR A;  1W42 A;  2QEX F;  5IT9 M;  5FLX M;  1Q82 H;  3OW2 F;  1K73 H;  1QVF F;  3O85 A;  1KC8 H;  1VQN F;  3CCM F;  2QI2 A;  1S72 F;  3LWV C;  3V7Q A;  3J80 M;  3SIV A;  1Q7Y H;  1CN7 A;  3CD6 F;  1W40 A;  1YJN F;  3LWQ C;  1X7P A;  3PLA C;  1VQL F;  3LWO C;  3CPQ A;  3CMA F;  3CME F;  3GYQ A;  1VQK F;  4X3M A;  2OHW A; 
#chains in the Genus database with same CATH topology
 1VQP F;  1W2B F;  5IYZ A;  3CCU F;  1K8A H;  1KNK A;  5LYJ B;  2YXZ A;  1W57 A;  3JAL B;  4O4H A;  1OFU A;  5HP8 A;  3WJQ A;  5MN4 A;  3JCM M;  3VOA A;  3WJR A;  2KG4 A;  2LBT A;  3JAT B;  1VK3 A;  3WGJ A;  3UT5 B;  1U43 A;  2H8E A;  2QA4 F;  1JN1 A;  2ZVZ A;  2ZOD A;  5BMV B;  3F0F A;  2CZW A;  5ITZ B;  4FFB A;  2CHS A;  4RHA A;  4YJ3 A;  1VH8 A;  2Z1U A;  3JAS A;  2KTU A;  4C8E A;  3IMP A;  1ONI A;  1UFY A;  4O2B A;  4TV9 A;  4E6E A;  4M8I A;  4ZI7 B;  4BT2 A;  4O4I A;  3F0E A;  5IJ0 B;  3KHN A;  1IV4 A;  3ELC A;  5GON A;  2OTL F;  4G88 A;  5LYJ A;  4ZHQ B;  5KX5 A;  4X3L A;  3V3T A;  1JJ2 F;  4EI9 A;  2Z1F A;  3IEQ A;  1VQ8 F;  4C8I A;  4NWO B;  1OAP A;  2UYK A;  4ZHW A;  4ERH A;  1ODE A;  1VQ7 F;  5GIP C;  1Q86 H;  3VO8 A;  3GTZ A;  3IEW A;  3JAK A;  5JVD B;  5ITZ A;  5IJ9 B;  2H6L A;  4X1Y B;  1QVG F;  1Z5W A;  4ZHV A;  1W5F A;  1X7O A;  1VQ6 F;  2ZOV A;  3MCQ A;  2GZL A;  3WGK A;  1H48 A;  5J2T B;  5EAZ A;  2CHT A;  1FFX A;  3IKE A;  3C9T A;  3AGK A;  5DCV A;  3BYQ A;  1JFF B;  4G4V A;  1W55 A;  2KTV A;  4U39 A;  3CC4 F;  5KMG A;  1Q81 H;  3FD5 A;  5HXU A;  3RA5 A;  5B8F A;  1UI9 A;  2LBX A;  4DRX B;  5JCO A;  3JAM M;  3HWU A;  5LA6 B;  1NMU B;  3CCR F;  2R6R 1;  3QUW A;  1TUB A;  3F0G A;  1NJI H;  5JVD A;  5IJ9 A;  1XHO A;  1Q82 H;  1QVF F;  3S0W A;  1KC8 H;  4B5C A;  3WJP A;  1VHA A;  2BTU A;  3CCM F;  1S72 F;  3V7Q A;  3J80 M;  4ZOL B;  5J2T A;  2UYP A;  1Q7Y H;  4PWT A;  1CN7 A;  4RQO A;  5CA1 A;  1YJN F;  2OTM A;  3D54 A;  1VQL F;  2HRU A;  3ERN A;  5IYZ B;  1Z5V A;  1T0A A;  3NVK E;  4WBN B;  2EWC A;  3FD6 A;  3RA6 A;  5FJ4 C;  1GZ0 A;  1COM A;  1XBI A;  4O4H B;  2LCA A;  3I56 F;  1GX1 A;  3LYB A;  4EB6 A;  3CC2 F;  3QTY A;  1W5E A;  3CPW F;  1U40 A;  2UZH A;  4U3J A;  5GIO C;  4G4W A;  4FFB B;  2G9I A;  4YJ3 B;  3C9U A;  2F9Z C;  5JCO C;  1IV3 A;  4EI8 A;  5JQG B;  4O2B B;  4TV9 B;  3G4S F;  5HY0 A;  3M84 A;  3TD4 A;  1XV2 A;  5GON B;  3CXC F;  2VGM A;  3CYP B;  1J7H A;  2I6R A;  3RYH A;  5KX5 B;  1YIJ F;  4WBN A;  2HS3 A;  2RB9 A;  2OTJ F;  3ZOP A;  2IG8 A;  2UYN B;  2YYE A;  4X1I B;  3MBM A;  1VQ4 F;  1GO1 A;  2CW4 A;  5GAP K;  5LP6 C;  3OBY A;  3NVI B;  1RQ2 A;  2DYY A;  5EIB C;  3IR9 A;  3V4D A;  5EIB D;  3CCL F;  3JAW B;  2ALE A;  1DT9 A;  4X20 B;  3JAK B;  3N2K A;  1W41 A;  1KQS F;  3RYF A;  3CG6 A;  3HTN A;  2V9Y A;  2L26 A;  5JQG A;  2JNB A;  5EB0 A;  3JAR B;  5FNV B;  3VIU A;  3KIZ A;  3CCS F;  1FFX B;  1IV2 A;  1VQ9 F;  4B46 A;  5EO3 A;  3DC2 A;  3R0P A;  1VQV A;  1M1K H;  1YJ9 F;  2UYN A;  4X1I A;  3K12 A;  4R40 B;  2GLZ A;  5HXZ A;  1W59 A;  3Q8H A;  3HKD B;  3WPW A;  4G4Z A;  5KMG B;  3K0T A;  1W5A A;  2GVI A;  4C81 A;  3G6E F;  2BTO A;  2BTQ B;  3JAW A;  1TUB B;  4O4L A;  4X20 A;  1H47 A;  2ZF8 A;  4HNA B;  3MQW A;  2QEX F;  4I50 B;  5IT9 M;  2HX0 A;  2PMP A;  5FLX M;  2Q1X A;  3LME A;  3RYC B;  1K73 H;  3M4S A;  3JAR A;  5FNV A;  3HKC A;  3K14 A;  3N2G A;  5EB1 B;  3CB2 A;  5LP6 B;  5LOV B;  5CA1 B;  3QHD A;  1W40 A;  2P6Y A;  3S02 A;  2QTP A;  3EOR A;  1PF5 A;  3LWQ C;  3RE3 A;  4LNU A;  3HKD A;  3S03 A;  3KJJ A;  3CPQ A;  4BVQ A;  4TV8 A;  1QAH A;  3GYQ A;  1VQK F;  1T0K B;  4TZZ A;  2VXY A;  2BO1 A;  2ZVY A;  4EB6 B;  3T80 A;  4HNA A;  5G4U C;  4G4Y A;  2OZB A;  2AIZ P;  4F6R A;  2AMT A;  4I50 A;  1K9M H;  2H8C A;  3CC7 F;  5AVM A;  4B62 A;  3N4Z A;  4U3J B;  5JH7 B;  3J7A R;  3RYC A;  4XCQ A;  2I6D A;  5MN6 A;  5G4V C;  3C9S A;  3GHZ A;  2UYJ A;  3ESJ A;  3TD5 A;  4ZK7 A;  5LP6 A;  2Q1Y A;  5LOV A;  3VYT C;  3ZO8 A;  3ZP7 A;  3PAF A;  3P10 A;  3WGN A;  4C8G A;  3P0Z A;  4O4J A;  5C8Y B;  2IQQ A;  1GO0 A;  1QU9 A;  3RYH B;  3S0H A;  1IPA A;  2Z1T A;  1X52 A;  4BT6 A;  1JY8 A;  1FNJ A;  2HQS C;  3C8L A;  3FBA A;  2RHH A;  2CWJ A;  4BT7 A;  3CYQ A;  4TUY A;  4BW0 B;  1YJW F;  5EZY A;  2VGN A;  3WGM A;  4IIJ A;  5A2Q M;  2ZAU A;  2VAM A;  3F6M A;  3B6N A;  2CVL A;  5JH7 A;  3N2K B;  3M1X A;  3RYF B;  3VCZ A;  4C4W C;  1VQO F;  1RQ7 A;  1IV1 A;  5MN5 A;  4BT4 A;  1YQN A;  4BT5 A;  5C8Y A;  3S06 A;  1W5B A;  3D01 A;  5HY1 A;  1M90 H;  3V7E A;  2HS0 A;  2R75 1;  3E22 A;  3K2X A;  3VMF B;  5GIN C;  3FFM A;  3LDT A;  3CCQ F;  3OBW A;  3VYS C;  1FSZ A;  1CLI A;  3HJW C;  1ZWZ A;  2HP3 A;  1RA4 A;  2FC3 A;  2RHL A;  3HAX D;  4O4L B;  2N48 A;  3I55 F;  3WPX A;  1H7M A;  1NQ3 A;  4BVS A;  5HWE A;  5EWR A;  3RYI B;  5EYP A;  5CA0 A;  2FGY A;  1Q8R A;  3HKC B;  3OW2 F;  3O85 A;  3N2G B;  2MQE A;  3TD3 A;  1U3L A;  2NMU A;  2QI2 A;  3MDO A;  2HS4 A;  2RHO A;  1TVK B;  4O2A A;  3CD6 F;  5HP7 A;  4LNU B;  1U3P A;  3P4E A;  3PLA C;  5LXT B;  4TV8 B;  3JVH A;  3LWO C;  4X3M A;  1X25 A;  2AIF A;  4BVT A;  4I55 A;  4IHJ A;  1DBF A;  1YI2 F;  1E7K A;  3HKE B;  4I4T B;  3CCV F;  4F6R B;  3IKF A;  3RYI A;  3WXM B;  3JAL A;  2K1S A;  2HP0 B;  4KWE A;  3VOB A;  5GAN K;  3NMU C;  2PHN A;  2W8B C;  4G4X A;  3JAT A;  1R1M A;  3UT5 A;  1TVK A;  3SIU A;  4O4J B;  3NK6 A;  2Z01 A;  3KE1 A;  1KD1 H;  5BMV A;  3DDN A;  5LXT A;  5J2U B;  4EI7 A;  4B45 A;  3I3F A;  2VAW A;  1SA0 B;  3D00 A;  5HY2 A;  4ZI7 A;  1VQM F;  4TUY B;  5IJ0 A;  3HKE A;  4I4T A;  5EZY B;  5CB4 A;  2KGW A;  4IIJ B;  3VI6 A;  3MCA B;  4ZHQ A;  2VAP A;  2HVY D;  1W58 1;  4NQ3 A;  2HP0 A;  1VQ5 F;  1PXW A;  3KJK A;  1RLU A;  1SDS A;  3OON A;  3G71 F;  4BVR A;  3L7Q A;  1YHQ F;  3E20 B;  3S0Y A;  3NK7 A;  1N8R H;  3E1Y A;  2CSL A;  4BT3 A;  3HKB B;  4YJ2 B;  2WAL A;  4X1Y A;  5J2U A;  1YGY A;  4NUT A;  2Z1E A;  4X1K B;  3E22 B;  3LWR C;  1CK2 A;  3F0D A;  1SA0 A;  5HY4 A;  4LCK A;  3CCE F;  3LWP C;  1SZQ A;  2HRY A;  4BY9 D;  1W3E X;  3LFO A;  4DXD A;  1KNJ A;  3CCJ F;  2LBW A;  2IAF A;  3FPI A;  3I7T A;  3ON1 A;  1JFF A;  4ZHY B;  1XRG A;  5CB4 B;  1RLG A;  3N4Y A;  1JD1 A;  3WGL A;  3J81 M;  1YIT F;  5EYP B;  3VTI C;  4DRX A;  5CA0 B;  5LA6 A;  1W42 A;  2B33 A;  2DT4 A;  4C82 A;  3HKB A;  4YJ2 A;  4O2A B;  1VQN F;  3LWV C;  4X1K A;  3SIV A;  3VYU C;  2RHJ A;  4ZOL A;  3JAS B;  3C9R A;  1X7P A;  1FNK A;  1QD9 A;  3U0O A;  3ZP4 A;  4I55 B;  3CMA F;  4IHJ B;  3CME F;  2OHW A;  4O4I B; 
#chains in the Genus database with same CATH homology
 2AIF A;  1VQP F;  1W2B F;  4TZZ A;  4BVT A;  1T0K B;  3NVK E;  3RA6 A;  3CCU F;  1K8A H;  1YI2 F;  2BO1 A;  1E7K A;  3CCV F;  5FJ4 C;  1GZ0 A;  1XBI A;  5G4U C;  3I56 F;  2OZB A;  3WXM B;  5GAN K;  3CC2 F;  1K9M H;  3CC7 F;  3N4Z A;  3JCM M;  3J7A R;  2KG4 A;  3CPW F;  4XCQ A;  2I6D A;  3NMU C;  5G4V C;  5GIO C;  2QA4 F;  2F9Z C;  2CZW A;  3PAF A;  3SIU A;  3NK6 A;  1KD1 H;  4EI8 A;  3G4S F;  5HY0 A;  2KTU A;  1GO0 A;  4EI7 A;  1IPA A;  1X52 A;  2VGM A;  3D00 A;  3CXC F;  1YIJ F;  5HY2 A;  2OTL F;  1VQM F;  2OTJ F;  4X3L A;  3V3T A;  1JJ2 F;  1VQ4 F;  4EI9 A;  1GO1 A;  3VI6 A;  5GAP K;  1VQ8 F;  3MCA B;  4BW0 B;  3OBY A;  1YJW F;  2HVY D;  3NVI B;  2VGN A;  4NQ3 A;  3IR9 A;  5A2Q M;  1VQ5 F;  3CCL F;  1VQ7 F;  5GIP C;  2ALE A;  1DT9 A;  1PXW A;  4C4W C;  1Q86 H;  1VQO F;  1W41 A;  1KQS F;  1SDS A;  3G71 F;  3CG6 A;  4BVR A;  1YHQ F;  3E20 B;  3NK7 A;  1N8R H;  3E1Y A;  1QVG F;  2JNB A;  1VQ6 F;  1X7O A;  2WAL A;  4NUT A;  5HY1 A;  3CCS F;  1M90 H;  3LWR C;  1VQ9 F;  3V7E A;  1CK2 A;  5EO3 A;  5HY4 A;  4LCK A;  3CCE F;  3LWP C;  3VMF B;  1M1K H;  5GIN C;  1YJ9 F;  4BY9 D;  1W3E X;  3LFO A;  3CCJ F;  3AGK A;  3FFM A;  3CCQ F;  2LBW A;  2GLZ A;  5HXZ A;  5DCV A;  3OBW A;  2KTV A;  3CC4 F;  3ON1 A;  3HJW C;  1Q81 H;  1RLG A;  1ZWZ A;  3N4Y A;  1RA4 A;  2FC3 A;  5HXU A;  3G6E F;  3HAX D;  3RA5 A;  2LBX A;  3J81 M;  3I55 F;  3JAM M;  1NMU B;  1H7M A;  3CCR F;  1YIT F;  4BVS A;  1NJI H;  5HWE A;  5EWR A;  1W42 A;  2QEX F;  5IT9 M;  2FGY A;  5FLX M;  1Q82 H;  3OW2 F;  1K73 H;  1QVF F;  3O85 A;  1KC8 H;  1VQN F;  3CCM F;  2QI2 A;  1S72 F;  3LWV C;  3V7Q A;  3J80 M;  3SIV A;  1Q7Y H;  1CN7 A;  3CD6 F;  1W40 A;  1YJN F;  3LWQ C;  1X7P A;  3PLA C;  1VQL F;  3LWO C;  3CPQ A;  4BVQ A;  3CMA F;  3CME F;  3GYQ A;  1VQK F;  4X3M A;  2OHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...