1QVFF

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1qvfF00
2HVYD 2KTVA 3WXMB 1YIJF 3CCLF 2LBWA 2CZWA 5FLXM 1X7OA 1W42A 1Q7YH 1PXWA 2QEXF 1RA4A 5DCVA 1QVGF 1JJ2F 3CCVF 3RA5A 3FFMA 5GIOC 3CC2F 1VQKF 1VQ5F 4X3MA 1NJIH 3PLAC 1VQNF 1Q86H 3CCSF 3CPWF 3N4YA 5G4VC 1W41A 3J80M 3CG6A 3I56F 3NK7A 1S72F 3G71F 3OBYA 2WALA 2LBXA 3J7AR 2AIFA 1CK2A 1X52A 3GYQA 5EO3A 4X3LA 3LWOC 3G4SF 3LWPC 1VQMF 1QVFF 3CPQA 3E20B 5GIPC 1XBIA 3E1YA 2QA4F 5GANK 3MCAB 3JAMM 1RLGA 1ZWZA 2FC3A 2JNBA 1N8RH 1KQSF 5FJ4C 1VQ9F 3CMEF 3OW2F 4TZZA 3CD6F 4C4WC 3CC7F 2KTUA 1IPAA 1GO1A 1SDSA 3N4ZA 3CCQF 1VQ4F 3NMUC 5EWRA 2ALEA 3LFOA 1NMUB 3HJWC 5G4UC 1M1KH 5GAPK 1VQLF 3V7EA 1K73H 5GINC 3CC4F 1YITF 3JCMM 1YJ9F 1W2BF 1DT9A 2KG4A 1KD1H 1E7KA 2BO1A 3HAXD 2OHWA 5A2QM 3NVKE 3G6EF 1X7PA 1VQPF 5IT9M 3VI6A 3LWQC 1VQOF 1YJWF 1H7MA 2VGNA 3CCEF 3NK6A 1Q82H 3I55F 1VQ7F 2QI2A 4NUTA 2VGMA 3LWVC 3CCJF 4BY9D 3PAFA 3CCMF 1YI2F 3OBWA 3CCRF 1YHQF 1Q81H 2I6DA 1W40A 3RA6A 3CCUF 3SIUA 1T0KB 3J81M 1KC8H 2OTJF 4BW0B 3LWRC 1M90H 1GZ0A 3SIVA 3ON1A 1VQ6F 1K9MH 2OZBA 3V7QA 3AGKA 3CXCF 1YJNF 1K8AH 3O85A 3NVIB 1W3EX 1GO0A 2OTLF 3VMFB 3IR9A 4LCKA 1CN7A 1VQ8F 3CMAF
chains in the Genus database with same CATH superfamily
2DT4A 2KTVA 3WXMB 4ZI7A 5EB1B 4F6RA 3UT5B 5FLXM 3WGJA 1JJ2F 1GX1A 1X7OA 4BVSA 1RA4A 3HKDB 2R6R1 3TD3A 4KWEA 3CC2F 1VQKF 4X3MA 1NJIH 1PF5A 1Q8RA 5LA6B 2F9ZC 3CYQA 1Q86H 2ZOVA 1Z5VA 3JASA 2VAWA 4RHAA 2YYEA 4IIJB 2LBXA 1H47A 3RYIA 3J7AR 1X52A 2HS3A 2YXZA 3S0WA 5IJ0A 2H8CA 3C9SA 1KNKA 1OFUA 1VQMF 3CPQA 4FFBB 1UFYA 5CB4A 5GANK 5MN4A 1IV2A 1RLGA 1N8RH 2IAFA 3OW2F 3CD6F 4X1YB 3KJJA 2I6RA 3CC7F 2KTUA 4EI7A 3S03A 1W59A 3F0DA 2CWJA 5CA0B 1DBFA 4ZOLA 1H48A 4I55A 3JAWA 3R0PA 3DDNA 3HJWC 3TD5A 1XV2A 4G88A 5IYZA 3HTNA 3MDOA 3HKDA 5EZYA 3C9UA 3CC4F 1YJ9F 1DT9A 2KG4A 5EYPB 3F0GA 2BO1A 4IHJA 3HWUA 4BT3A 5IT9M 3T80A 3V3TA 3VI6A 3LWQC 5LA6A 4ERHA 1VQOF 1YJWF 2RHOA 1H7MA 1R1MA 2VGNA 3N2GB 3NK6A 3BYQA 4C82A 3LDTA 4X20B 4M8IA 3I55F 4HNAA 4G4WA 2VGMA 4I50B 5HP8A 3LWVC 3CCJF 5HWEA 4ZHYB 3HKCB 3CCMF 1YI2F 5JCOC 3KE1A 3JARA 1W40A 4FFBA 4U39A 5HY1A 3L7QA 3CCUF 4F6RB 3HKEB 2UYNA 1T0KB 2ZVYA 1KC8H 2OTJF 3LWRC 3IEQA 3ELCA 3ON1A 3D54A 2VXYA 4EI8A 3AGKA 3D00A 3CXCF 5CA0A 1GO0A 3WGNA 4B62A 4X1IA 3WPXA 4ZHVA 3K2XA 3Q8HA 3C8LA 3CB2A 2Q1XA 1NQ3A 3WPWA 3JASB 5GONB 3MQWA 2Q1YA 1FFXA 2BTOA 1KNJA 3RYIB 3B6NA 2RB9A 2QEXF 1JD1A 3WGMA 4G4YA 1RQ7A 4O2BB 3VO8A 5EYPA 1SZQA 1SA0A 1YQNA 2HP3A 5CB4B 1T0AA 2CHSA 3VYTC 3RA5A 1UI9A 4WBNB 3N2GA 3PLAC 1VQNF 1U40A 2GLZA 4B5CA 3CCSF 3CPWF 3N4YA 2HRYA 5G4VC 3J80M 5JCOA 1W5AA 4G4XA 3NK7A 4I50A 4BVTA 2GVIA 4ZK7A 4ZOLB 3FD5A 3HKCA 1CK2A 4O4JA 5EO3A 4U3JB 4X1KA 3LWOC 3F0EA 3HKEA 5HXUA 4I4TB 1XBIA 2QA4F 3K0TA 3M4SA 2EWCA 5IYZB 3MCAB 5MN5A 3ESJA 4DRXA 2JNBA 4O4IA 1JY8A 5EZYB 4TZZA 1QD9A 3I7TA 4IHJB 5EAZA 1GO1A 3N4ZA 3IKFA 1FNKA 5CA1A 1VH8A 2ALEA 5EWRA 5GONA 4HNAB 5FNVB 1W5FA 5C8YB 3JVHA 3C9TA 5B8FA 3V7EA 1U3PA 3JATA 4TV9B 3VOAA 2BTQB 3JARB 1X25A 4O2BA 2LCAA 2UYNB 2Z1TA 3S02A 2H8EA 3JCMM 1E7KA 2DYYA 4WBNA 1VQPF 1X7PA 4LNUA 4YJ2B 4R40B 5EB0A 2PMPA 3E22A 1FNJA 3ERNA 3LMEA 5EIBD 2R751 3ZO8A 4X1IB 4NUTA 3P0ZA 4C8EA 4U3JA 1QAHA 4I4TA 2I6DA 3RA6A 1FFXB 3J81M 1M90H 2PHNA 3F0FA 1SA0B 4C8GA 4BT4A 5HXZA 1K9MH 5JVDA 3V7QA 1YJNF 2HP0B 3O85A 1Z5WA 1W3EX 4RQOA 2OTLF 4TUYA 3IR9A 4LCKA 3KIZA 5HY2A 3MBMA 3RYHA 5AVMA 3WGKA 5ITZA 3CMAF 1VQ8F 5FNVA 2AMTA 5C8YA 3VOBA 3CCLF 3IKEA 4B46A 1COMA 3TD4A 4TV9A 3WJRA 3ZOPA 4O4JB 1W42A 1PXWA 2FGYA 4X1KB 4ZHQB 3CYPB 5KX5A 5J2TA 2RHJA 3HKBA 4YJ2A 5BMVA 4DRXB 5GIOC 4O4IB 1VQ5F 3DC2A 5HY4A 5JH7A 2MQEA 4E6EA 3IMPA 1S72F 1W5EA 3OBYA 3JAKB 3VYSC 5CA1B 2AIFA 3VYUC 3GYQA 3QUWA 4O4LA 4X3LA 3ZP4A 3FBAA 3LWPC 3E20B 5GIPC 3E1YA 2V9YA 2P6YA 3JATB 3JAMM 1ZWZA 4XCQA 1OAPA 3CMEF 2Z01A 4PWTA 3EORA 1VHAA 3V4DA 2HP0A 2QTPA 4LNUB 1IPAA 1SDSA 2K1SA 3E22B 3U0OA 2CSLA 3RYCB 1JFFA 1VQ4F 3NMUC 1TVKA 1RLUA 2IG8A 1NMUB 3D01A 5G4UC 5GAPK 1TUBB 2BTUA 5HP7A 3M1XA 4ZHQA 1QU9A 4EB6A 5GINC 1YITF 2W8BC 3HAXD 2OHWA 3NVKE 3G6EF 2OTMA 3CCEF 5JVDB 4BVQA 4DXDA 2IQQA 3S0YA 1W57A 3RYFA 1VQ7F 2ZAUA 5IJ9B 4TUYB 1W55A 3JAKA 4NQ3A 2CHTA 3RYHB 5ITZB 3PAFA 2HRUA 1YHQF 3N2KB 1VK3A 3SIUA 5MN6A 4G4ZA 3K14A 3SIVA 2LBTA 4TV8B 3MCQA 5LP6A 5JQGA 3GTZA 1U43A 3GHZA 4B45A 5EIBC 5KX5B 5LOVB 5J2TB 2NMUA 3HKBB 3C9RA 3IEWA 2OZBA 5BMVB 4ZHWA 3RYCA 2HQSC 4BT5A 5JH7B 4YJ3A 5J2UB 2Z1EA 3P4EA 3I3FA 2HVYD 1YIJF 2LBWA 1TUBA 2CZWA 5HY0A 4BVRA 1Q7YH 4O4LB 1U3LA 5DCVA 1VQVA 1QVGF 1JN1A 2B33A 3CCVF 5LYJA 2HS0A 3FFMA 1XRGA 3JALA 4G4VA 2ZVZA 4O2AA 1IV3A 2CVLA 2VAPA 5IJ9A 3VIUA 1W41A 3VCZA 3CG6A 2GZLA 3I56F 2L26A 1W5BA 3RE3A 3QTYA 3G71F 2WALA 1JFFB 2UYPA 2Z1UA 3UT5A 1TVKB 3N2KA 3S0HA 4C81A 1ODEA 3G4SF 3LYBA 2N48A 1QVFF 2H6LA 2HX0A 2KGWA 4TV8A 4BT7A 4O4HB 2FC3A 1KQSF 4EB6B 5FJ4C 3OONA 1VQ9F 5LOVA 4BT6A 4C4WC 5KMGB 5LXTB 4BT2A 3WJQA 3ZP7A 2VAMA 5J2UA 1XHOA 4IIJA 3CCQF 3P10A 1J7HA 4NWOB 3WGLA 3RYFB 3LFOA 3M84A 3WJPA 3K12A 2RHLA 4C8IA 2CW4A 4ZI7B 1M1KH 1VQLF 1IV4A 1IV1A 2UYKA 1K73H 1RQ2A 3VTIC 4X1YA 1W2BF 1KD1H 5A2QM 5LP6B 3KJKA 1CLIA 5JQGB 2G9IA 3QHDA 2ZODA 1Q82H 2ZF8A 3F6MA 5LP6C 4EI9A 2QI2A 4YJ3B 3FPIA 4BY9D 1YGYA 3OBWA 3CCRF 1Q81H 2HS4A 5IJ0B 3S06A 2AIZP 4BW0B 4O4HA 2Z1FA 1GZ0A 2RHHA 2UZHA 1VQ6F 5LYJB 5KMGA 5LXTA 1ONIA 1K8AH 1FSZA 3JALB 4X20A 1W581 3NVIB 3FD6A 4O2AB 3VMFB 2UYJA 1CN7A 4I55B 3KHNA 3JAWB
chains in the Genus database with same CATH topology
2HVYD 2KTVA 3WXMB 1YIJF 3CCLF 2LBWA 2CZWA 5FLXM 5HY0A 1X7OA 4BVSA 1W42A 4BVRA 1Q7YH 1PXWA 2FGYA 2QEXF 1RA4A 5DCVA 1QVGF 1JJ2F 3CCVF 3RA5A 3FFMA 5GIOC 3CC2F 1VQKF 1VQ5F 4X3MA 1NJIH 3PLAC 5HY4A 1VQNF 2F9ZC 2GLZA 3CCSF 1Q86H 3CPWF 3N4YA 5G4VC 1W41A 3J80M 3CG6A 3I56F 4BVTA 3NK7A 1S72F 3G71F 3OBYA 2WALA 2LBXA 3J7AR 2AIFA 1CK2A 1X52A 3GYQA 5EO3A 4X3LA 3LWOC 5HXUA 3G4SF 3LWPC 1VQMF 1QVFF 3CPQA 3E20B 5GIPC 1XBIA 3E1YA 2QA4F 5GANK 3MCAB 3JAMM 1RLGA 1ZWZA 2FC3A 2JNBA 1N8RH 1KQSF 5FJ4C 4XCQA 1VQ9F 3CMEF 3OW2F 4TZZA 3CD6F 4C4WC 3CC7F 2KTUA 4EI7A 1IPAA 1GO1A 1SDSA 3N4ZA 3CCQF 1VQ4F 3NMUC 5EWRA 2ALEA 3LFOA 1NMUB 3HJWC 5G4UC 1M1KH 5GAPK 1VQLF 3V7EA 1K73H 5GINC 3CC4F 1YITF 3JCMM 1YJ9F 1W2BF 1DT9A 2KG4A 1KD1H 1E7KA 2BO1A 3HAXD 2OHWA 5A2QM 3NVKE 3G6EF 1X7PA 1VQPF 5IT9M 3V3TA 3VI6A 3LWQC 1VQOF 1YJWF 1H7MA 2VGNA 3CCEF 3NK6A 4BVQA 1Q82H 3I55F 1VQ7F 4EI9A 2QI2A 4NUTA 2VGMA 3LWVC 3CCJF 4NQ3A 4BY9D 3PAFA 5HWEA 3CCMF 3OBWA 3CCRF 1YHQF 1YI2F 1Q81H 2I6DA 1W40A 3RA6A 5HY1A 3CCUF 3SIUA 1T0KB 3J81M 1KC8H 2OTJF 4BW0B 3LWRC 1M90H 1GZ0A 3SIVA 3ON1A 1VQ6F 4EI8A 5HXZA 1K9MH 2OZBA 3V7QA 3AGKA 3D00A 3CXCF 1YJNF 1K8AH 3O85A 3NVIB 1W3EX 1GO0A 2OTLF 3VMFB 3IR9A 4LCKA 1CN7A 5HY2A 1VQ8F 3CMAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVY D;  2KTV A;  3WXM B;  1YIJ F;  3CCL F;  2LBW A;  2CZW A;  5FLX M;  1X7O A;  1W42 A;  1Q7Y H;  1PXW A;  2QEX F;  1RA4 A;  5DCV A;  1QVG F;  1JJ2 F;  3CCV F;  3RA5 A;  3FFM A;  5GIO C;  3CC2 F;  1VQK F;  1VQ5 F;  4X3M A;  1NJI H;  3PLA C;  1VQN F;  1Q86 H;  3CCS F;  3CPW F;  3N4Y A;  5G4V C;  1W41 A;  3J80 M;  3CG6 A;  3I56 F;  3NK7 A;  1S72 F;  3G71 F;  3OBY A;  2WAL A;  2LBX A;  3J7A R;  2AIF A;  1CK2 A;  1X52 A;  3GYQ A;  5EO3 A;  4X3L A;  3LWO C;  3G4S F;  3LWP C;  1VQM F;  1QVF F;  3CPQ A;  3E20 B;  5GIP C;  1XBI A;  3E1Y A;  2QA4 F;  5GAN K;  3MCA B;  3JAM M;  1RLG A;  1ZWZ A;  2FC3 A;  2JNB A;  1N8R H;  1KQS F;  5FJ4 C;  1VQ9 F;  3CME F;  3OW2 F;  4TZZ A;  3CD6 F;  4C4W C;  3CC7 F;  2KTU A;  1IPA A;  1GO1 A;  1SDS A;  3N4Z A;  3CCQ F;  1VQ4 F;  3NMU C;  5EWR A;  2ALE A;  3LFO A;  1NMU B;  3HJW C;  5G4U C;  1M1K H;  5GAP K;  1VQL F;  3V7E A;  1K73 H;  5GIN C;  3CC4 F;  1YIT F;  3JCM M;  1YJ9 F;  1W2B F;  1DT9 A;  2KG4 A;  1KD1 H;  1E7K A;  2BO1 A;  3HAX D;  2OHW A;  5A2Q M;  3NVK E;  3G6E F;  1X7P A;  1VQP F;  5IT9 M;  3VI6 A;  3LWQ C;  1VQO F;  1YJW F;  1H7M A;  2VGN A;  3CCE F;  3NK6 A;  1Q82 H;  3I55 F;  1VQ7 F;  2QI2 A;  4NUT A;  2VGM A;  3LWV C;  3CCJ F;  4BY9 D;  3PAF A;  3CCM F;  1YI2 F;  3OBW A;  3CCR F;  1YHQ F;  1Q81 H;  2I6D A;  1W40 A;  3RA6 A;  3CCU F;  3SIU A;  1T0K B;  3J81 M;  1KC8 H;  2OTJ F;  4BW0 B;  3LWR C;  1M90 H;  1GZ0 A;  3SIV A;  3ON1 A;  1VQ6 F;  1K9M H;  2OZB A;  3V7Q A;  3AGK A;  3CXC F;  1YJN F;  1K8A H;  3O85 A;  3NVI B;  1W3E X;  1GO0 A;  2OTL F;  3VMF B;  3IR9 A;  4LCK A;  1CN7 A;  1VQ8 F;  3CMA F; 
#chains in the Genus database with same CATH topology
 2DT4 A;  2KTV A;  3WXM B;  4ZI7 A;  5EB1 B;  4F6R A;  3UT5 B;  5FLX M;  3WGJ A;  1JJ2 F;  1GX1 A;  1X7O A;  4BVS A;  1RA4 A;  3HKD B;  2R6R 1;  3TD3 A;  4KWE A;  3CC2 F;  1VQK F;  4X3M A;  1NJI H;  1PF5 A;  1Q8R A;  5LA6 B;  2F9Z C;  3CYQ A;  1Q86 H;  2ZOV A;  1Z5V A;  3JAS A;  2VAW A;  4RHA A;  2YYE A;  4IIJ B;  2LBX A;  1H47 A;  3RYI A;  3J7A R;  1X52 A;  2HS3 A;  2YXZ A;  3S0W A;  5IJ0 A;  2H8C A;  3C9S A;  1KNK A;  1OFU A;  1VQM F;  3CPQ A;  4FFB B;  1UFY A;  5CB4 A;  5GAN K;  5MN4 A;  1IV2 A;  1RLG A;  1N8R H;  2IAF A;  3OW2 F;  3CD6 F;  4X1Y B;  3KJJ A;  2I6R A;  3CC7 F;  2KTU A;  4EI7 A;  3S03 A;  1W59 A;  3F0D A;  2CWJ A;  5CA0 B;  1DBF A;  4ZOL A;  1H48 A;  4I55 A;  3JAW A;  3R0P A;  3DDN A;  3HJW C;  3TD5 A;  1XV2 A;  4G88 A;  5IYZ A;  3HTN A;  3MDO A;  3HKD A;  5EZY A;  3C9U A;  3CC4 F;  1YJ9 F;  1DT9 A;  2KG4 A;  5EYP B;  3F0G A;  2BO1 A;  4IHJ A;  3HWU A;  4BT3 A;  5IT9 M;  3T80 A;  3V3T A;  3VI6 A;  3LWQ C;  5LA6 A;  4ERH A;  1VQO F;  1YJW F;  2RHO A;  1H7M A;  1R1M A;  2VGN A;  3N2G B;  3NK6 A;  3BYQ A;  4C82 A;  3LDT A;  4X20 B;  4M8I A;  3I55 F;  4HNA A;  4G4W A;  2VGM A;  4I50 B;  5HP8 A;  3LWV C;  3CCJ F;  5HWE A;  4ZHY B;  3HKC B;  3CCM F;  1YI2 F;  5JCO C;  3KE1 A;  3JAR A;  1W40 A;  4FFB A;  4U39 A;  5HY1 A;  3L7Q A;  3CCU F;  4F6R B;  3HKE B;  2UYN A;  1T0K B;  2ZVY A;  1KC8 H;  2OTJ F;  3LWR C;  3IEQ A;  3ELC A;  3ON1 A;  3D54 A;  2VXY A;  4EI8 A;  3AGK A;  3D00 A;  3CXC F;  5CA0 A;  1GO0 A;  3WGN A;  4B62 A;  4X1I A;  3WPX A;  4ZHV A;  3K2X A;  3Q8H A;  3C8L A;  3CB2 A;  2Q1X A;  1NQ3 A;  3WPW A;  3JAS B;  5GON B;  3MQW A;  2Q1Y A;  1FFX A;  2BTO A;  1KNJ A;  3RYI B;  3B6N A;  2RB9 A;  2QEX F;  1JD1 A;  3WGM A;  4G4Y A;  1RQ7 A;  4O2B B;  3VO8 A;  5EYP A;  1SZQ A;  1SA0 A;  1YQN A;  2HP3 A;  5CB4 B;  1T0A A;  2CHS A;  3VYT C;  3RA5 A;  1UI9 A;  4WBN B;  3N2G A;  3PLA C;  1VQN F;  1U40 A;  2GLZ A;  4B5C A;  3CCS F;  3CPW F;  3N4Y A;  2HRY A;  5G4V C;  3J80 M;  5JCO A;  1W5A A;  4G4X A;  3NK7 A;  4I50 A;  4BVT A;  2GVI A;  4ZK7 A;  4ZOL B;  3FD5 A;  3HKC A;  1CK2 A;  4O4J A;  5EO3 A;  4U3J B;  4X1K A;  3LWO C;  3F0E A;  3HKE A;  5HXU A;  4I4T B;  1XBI A;  2QA4 F;  3K0T A;  3M4S A;  2EWC A;  5IYZ B;  3MCA B;  5MN5 A;  3ESJ A;  4DRX A;  2JNB A;  4O4I A;  1JY8 A;  5EZY B;  4TZZ A;  1QD9 A;  3I7T A;  4IHJ B;  5EAZ A;  1GO1 A;  3N4Z A;  3IKF A;  1FNK A;  5CA1 A;  1VH8 A;  2ALE A;  5EWR A;  5GON A;  4HNA B;  5FNV B;  1W5F A;  5C8Y B;  3JVH A;  3C9T A;  5B8F A;  3V7E A;  1U3P A;  3JAT A;  4TV9 B;  3VOA A;  2BTQ B;  3JAR B;  1X25 A;  4O2B A;  2LCA A;  2UYN B;  2Z1T A;  3S02 A;  2H8E A;  3JCM M;  1E7K A;  2DYY A;  4WBN A;  1VQP F;  1X7P A;  4LNU A;  4YJ2 B;  4R40 B;  5EB0 A;  2PMP A;  3E22 A;  1FNJ A;  3ERN A;  3LME A;  5EIB D;  2R75 1;  3ZO8 A;  4X1I B;  4NUT A;  3P0Z A;  4C8E A;  4U3J A;  1QAH A;  4I4T A;  2I6D A;  3RA6 A;  1FFX B;  3J81 M;  1M90 H;  2PHN A;  3F0F A;  1SA0 B;  4C8G A;  4BT4 A;  5HXZ A;  1K9M H;  5JVD A;  3V7Q A;  1YJN F;  2HP0 B;  3O85 A;  1Z5W A;  1W3E X;  4RQO A;  2OTL F;  4TUY A;  3IR9 A;  4LCK A;  3KIZ A;  5HY2 A;  3MBM A;  3RYH A;  5AVM A;  3WGK A;  5ITZ A;  3CMA F;  1VQ8 F;  5FNV A;  2AMT A;  5C8Y A;  3VOB A;  3CCL F;  3IKE A;  4B46 A;  1COM A;  3TD4 A;  4TV9 A;  3WJR A;  3ZOP A;  4O4J B;  1W42 A;  1PXW A;  2FGY A;  4X1K B;  4ZHQ B;  3CYP B;  5KX5 A;  5J2T A;  2RHJ A;  3HKB A;  4YJ2 A;  5BMV A;  4DRX B;  5GIO C;  4O4I B;  1VQ5 F;  3DC2 A;  5HY4 A;  5JH7 A;  2MQE A;  4E6E A;  3IMP A;  1S72 F;  1W5E A;  3OBY A;  3JAK B;  3VYS C;  5CA1 B;  2AIF A;  3VYU C;  3GYQ A;  3QUW A;  4O4L A;  4X3L A;  3ZP4 A;  3FBA A;  3LWP C;  3E20 B;  5GIP C;  3E1Y A;  2V9Y A;  2P6Y A;  3JAT B;  3JAM M;  1ZWZ A;  4XCQ A;  1OAP A;  3CME F;  2Z01 A;  4PWT A;  3EOR A;  1VHA A;  3V4D A;  2HP0 A;  2QTP A;  4LNU B;  1IPA A;  1SDS A;  2K1S A;  3E22 B;  3U0O A;  2CSL A;  3RYC B;  1JFF A;  1VQ4 F;  3NMU C;  1TVK A;  1RLU A;  2IG8 A;  1NMU B;  3D01 A;  5G4U C;  5GAP K;  1TUB B;  2BTU A;  5HP7 A;  3M1X A;  4ZHQ A;  1QU9 A;  4EB6 A;  5GIN C;  1YIT F;  2W8B C;  3HAX D;  2OHW A;  3NVK E;  3G6E F;  2OTM A;  3CCE F;  5JVD B;  4BVQ A;  4DXD A;  2IQQ A;  3S0Y A;  1W57 A;  3RYF A;  1VQ7 F;  2ZAU A;  5IJ9 B;  4TUY B;  1W55 A;  3JAK A;  4NQ3 A;  2CHT A;  3RYH B;  5ITZ B;  3PAF A;  2HRU A;  1YHQ F;  3N2K B;  1VK3 A;  3SIU A;  5MN6 A;  4G4Z A;  3K14 A;  3SIV A;  2LBT A;  4TV8 B;  3MCQ A;  5LP6 A;  5JQG A;  3GTZ A;  1U43 A;  3GHZ A;  4B45 A;  5EIB C;  5KX5 B;  5LOV B;  5J2T B;  2NMU A;  3HKB B;  3C9R A;  3IEW A;  2OZB A;  5BMV B;  4ZHW A;  3RYC A;  2HQS C;  4BT5 A;  5JH7 B;  4YJ3 A;  5J2U B;  2Z1E A;  3P4E A;  3I3F A;  2HVY D;  1YIJ F;  2LBW A;  1TUB A;  2CZW A;  5HY0 A;  4BVR A;  1Q7Y H;  4O4L B;  1U3L A;  5DCV A;  1VQV A;  1QVG F;  1JN1 A;  2B33 A;  3CCV F;  5LYJ A;  2HS0 A;  3FFM A;  1XRG A;  3JAL A;  4G4V A;  2ZVZ A;  4O2A A;  1IV3 A;  2CVL A;  2VAP A;  5IJ9 A;  3VIU A;  1W41 A;  3VCZ A;  3CG6 A;  2GZL A;  3I56 F;  2L26 A;  1W5B A;  3RE3 A;  3QTY A;  3G71 F;  2WAL A;  1JFF B;  2UYP A;  2Z1U A;  3UT5 A;  1TVK B;  3N2K A;  3S0H A;  4C81 A;  1ODE A;  3G4S F;  3LYB A;  2N48 A;  1QVF F;  2H6L A;  2HX0 A;  2KGW A;  4TV8 A;  4BT7 A;  4O4H B;  2FC3 A;  1KQS F;  4EB6 B;  5FJ4 C;  3OON A;  1VQ9 F;  5LOV A;  4BT6 A;  4C4W C;  5KMG B;  5LXT B;  4BT2 A;  3WJQ A;  3ZP7 A;  2VAM A;  5J2U A;  1XHO A;  4IIJ A;  3CCQ F;  3P10 A;  1J7H A;  4NWO B;  3WGL A;  3RYF B;  3LFO A;  3M84 A;  3WJP A;  3K12 A;  2RHL A;  4C8I A;  2CW4 A;  4ZI7 B;  1M1K H;  1VQL F;  1IV4 A;  1IV1 A;  2UYK A;  1K73 H;  1RQ2 A;  3VTI C;  4X1Y A;  1W2B F;  1KD1 H;  5A2Q M;  5LP6 B;  3KJK A;  1CLI A;  5JQG B;  2G9I A;  3QHD A;  2ZOD A;  1Q82 H;  2ZF8 A;  3F6M A;  5LP6 C;  4EI9 A;  2QI2 A;  4YJ3 B;  3FPI A;  4BY9 D;  1YGY A;  3OBW A;  3CCR F;  1Q81 H;  2HS4 A;  5IJ0 B;  3S06 A;  2AIZ P;  4BW0 B;  4O4H A;  2Z1F A;  1GZ0 A;  2RHH A;  2UZH A;  1VQ6 F;  5LYJ B;  5KMG A;  5LXT A;  1ONI A;  1K8A H;  1FSZ A;  3JAL B;  4X20 A;  1W58 1;  3NVI B;  3FD6 A;  4O2A B;  3VMF B;  2UYJ A;  1CN7 A;  4I55 B;  3KHN A;  3JAW B; 
#chains in the Genus database with same CATH homology
 2HVY D;  2KTV A;  3WXM B;  1YIJ F;  3CCL F;  2LBW A;  2CZW A;  5FLX M;  5HY0 A;  1X7O A;  4BVS A;  1W42 A;  4BVR A;  1Q7Y H;  1PXW A;  2FGY A;  2QEX F;  1RA4 A;  5DCV A;  1QVG F;  1JJ2 F;  3CCV F;  3RA5 A;  3FFM A;  5GIO C;  3CC2 F;  1VQK F;  1VQ5 F;  4X3M A;  1NJI H;  3PLA C;  5HY4 A;  1VQN F;  2F9Z C;  2GLZ A;  3CCS F;  1Q86 H;  3CPW F;  3N4Y A;  5G4V C;  1W41 A;  3J80 M;  3CG6 A;  3I56 F;  4BVT A;  3NK7 A;  1S72 F;  3G71 F;  3OBY A;  2WAL A;  2LBX A;  3J7A R;  2AIF A;  1CK2 A;  1X52 A;  3GYQ A;  5EO3 A;  4X3L A;  3LWO C;  5HXU A;  3G4S F;  3LWP C;  1VQM F;  1QVF F;  3CPQ A;  3E20 B;  5GIP C;  1XBI A;  3E1Y A;  2QA4 F;  5GAN K;  3MCA B;  3JAM M;  1RLG A;  1ZWZ A;  2FC3 A;  2JNB A;  1N8R H;  1KQS F;  5FJ4 C;  4XCQ A;  1VQ9 F;  3CME F;  3OW2 F;  4TZZ A;  3CD6 F;  4C4W C;  3CC7 F;  2KTU A;  4EI7 A;  1IPA A;  1GO1 A;  1SDS A;  3N4Z A;  3CCQ F;  1VQ4 F;  3NMU C;  5EWR A;  2ALE A;  3LFO A;  1NMU B;  3HJW C;  5G4U C;  1M1K H;  5GAP K;  1VQL F;  3V7E A;  1K73 H;  5GIN C;  3CC4 F;  1YIT F;  3JCM M;  1YJ9 F;  1W2B F;  1DT9 A;  2KG4 A;  1KD1 H;  1E7K A;  2BO1 A;  3HAX D;  2OHW A;  5A2Q M;  3NVK E;  3G6E F;  1X7P A;  1VQP F;  5IT9 M;  3V3T A;  3VI6 A;  3LWQ C;  1VQO F;  1YJW F;  1H7M A;  2VGN A;  3CCE F;  3NK6 A;  4BVQ A;  1Q82 H;  3I55 F;  1VQ7 F;  4EI9 A;  2QI2 A;  4NUT A;  2VGM A;  3LWV C;  3CCJ F;  4NQ3 A;  4BY9 D;  3PAF A;  5HWE A;  3CCM F;  3OBW A;  3CCR F;  1YHQ F;  1YI2 F;  1Q81 H;  2I6D A;  1W40 A;  3RA6 A;  5HY1 A;  3CCU F;  3SIU A;  1T0K B;  3J81 M;  1KC8 H;  2OTJ F;  4BW0 B;  3LWR C;  1M90 H;  1GZ0 A;  3SIV A;  3ON1 A;  1VQ6 F;  4EI8 A;  5HXZ A;  1K9M H;  2OZB A;  3V7Q A;  3AGK A;  3D00 A;  3CXC F;  1YJN F;  1K8A H;  3O85 A;  3NVI B;  1W3E X;  1GO0 A;  2OTL F;  3VMF B;  3IR9 A;  4LCK A;  1CN7 A;  5HY2 A;  1VQ8 F;  3CMA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...