4RQOA

Crystal structure of l-serine dehydratase from legionella pneumophila
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
457
structure length
444
Chain Sequence
NISVFDLFSIGIGPSSSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPETVDPASMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDKNPPPYPFATATELLKLCKKHHLTIAELMLVNEKTWRSTAEIHKGILDIAKVMDDCINNGCKHDGVLPGGLNLKRRAPDLYRKLIFEQSDIMNHLNLYAMAVNEENAAGGRIVTAPTNGAAGIIPAVLKYCQQAHDRMSNEDIYTYFLTAAAIGILYKKGASISGAEVGCQGEVGVASSMAAAGLTAVLGGTIEQVENAAEIAMEHHLGMTCDPVLGLVQIPCIERNAMGAVKAVNATRMALIGDGQHQISLDKVIKTMKQTGMDMQSIYKETSMGGLAVNLPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-serine dehydratase
publication title Structure of l-Serine Dehydratase from Legionella pneumophila: Novel Use of the C-Terminal Cysteine as an Intrinsic Competitive Inhibitor.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila str. thunder bay
total genus 139
structure length 444
sequence length 457
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 4rqoA01
3DDNA 2IAFA 4RQOA 2IQQA 3DC2A 1YGYA
chains in the Genus database with same CATH superfamily
4O2BB 3N2KB 2AIFA 2RHJA 2VAWA 1IPAA 2Q1XA 3K0TA 1UI9A 3OW2F 1E7KA 3RA5A 3QHDA 3I56F 3F0FA 3ELCA 5EZYA 3ZO8A 2YXZA 5HY4A 1SA0A 2KTVA 3QTYA 4XCQA 1ONIA 4IHJB 4X20A 3CC2F 4RHAA 1FNKA 3TD4A 3WGKA 3HTNA 2OTJF 3WJQA 3UT5A 3JCMM 1PF5A 2FC3A 3HKDA 5MN6A 5CA0A 3CYQA 5CA1B 3LWVC 3SIUA 2I6RA 3P10A 1H48A 1YJ9F 3ZOPA 4LNUA 1YJWF 5G4VC 2UZHA 2WALA 4O4IA 1FFXB 1Z5WA 3DC2A 5IJ0B 1Z5VA 3S03A 3I55F 1T0KB 5HP7A 3IKEA 3P0ZA 3CCRF 2PMPA 4X3MA 5C8YA 2QA4F 1QU9A 4I55A 3V7QA 1Q86H 1DBFA 1W42A 3HKEA 2Z1FA 3PLAC 4I50B 1ODEA 3IEQA 5KMGB 3CCEF 4ZHYB 3HAXD 3V3TA 1QVFF 4RQOA 4ZHVA 4X1YA 3WGMA 1W57A 5GONA 4R40B 4TV9B 3JARA 5IJ9A 2QI2A 4C8IA 4O4LB 1KNJA 2BO1A 3RYHA 2ZODA 5B8FA 4BT4A 5LXTA 4ZHQA 3BYQA 4O2BA 5EIBC 1NJIH 1TVKA 5CB4B 1XHOA 3JASA 3G4SF 3VYSC 5ITZB 5JH7B 3E1YA 3AGKA 2LCAA 3WPXA 3S0WA 4WBNB 1QD9A 3RYFA 1IV4A 3M1XA 4NWOB 4I4TA 5J2UA 4ERHA 4BT2A 4BT5A 4EB6B 1GO0A 1VQVA 2VXYA 4M8IA 3N4YA 2RHLA 4BVTA 3SIVA 5EWRA 3N2GB 4O2AB 4TV8B 5EO3A 3CMAF 3ZP4A 3I3FA 4B46A 3E20B 5AVMA 3HJWC 3CXCF 3WJRA 2QTPA 2CHTA 2CHSA 3KJJA 3IKFA 4BVRA 2LBXA 3RYIB 1K73H 4X3LA 1XV2A 3S0YA 3V7EA 3NMUC 3HKCA 1Q82H 1RQ2A 4DRXA 3JAMM 3F0GA 4PWTA 3CCVF 2UYNA 3CCQF 2MQEA 1Q81H 3VYTC 2UYKA 3GTZA 3LFOA 2Z01A 2ZVZA 3HKBA 5LOVB 1S72F 5GANK 3G6EF 5KMGA 3WGJA 3S0HA 4X1KA 1VQKF 2JNBA 1KNKA 1JFFB 3R0PA 5EAZA 2CW4A 3WPWA 5EB0A 1J7HA 4X1IA 5EYPB 3S06A 2CSLA 4BT7A 2FGYA 3JATB 4YJ2A 3LWOC 2K1SA 1X7OA 3JALB 3KHNA 3KIZA 2DYYA 5DCVA 4O4HB 5JQGA 5J2TA 1YJNF 5CB4A 1W59A 1U3PA 4E6EA 3FBAA 1CN7A 5ITZA 3RYCB 1R1MA 2HS4A 3LYBA 5A2QM 2GZLA 1YIJF 3LWPC 4O4JA 3B6NA 3K14A 3F0EA 3CCSF 3MCQA 2RHOA 3CB2A 2OHWA 3OBYA 3ON1A 5HP8A 3CC4F 2IAFA 1Q7YH 2H8EA 5JCOA 2DT4A 1VQ5F 2AMTA 1VQ4F 2ZOVA 5EIBD 3JAWB 1TUBA 1H7MA 2H6LA 4TUYB 1VQ6F 2CZWA 2HP0A 2ZVYA 3N2GA 4F6RA 5JVDA 2QEXF 3VIUA 2KTUA 3CCLF 5GIOC 1U40A 3CPQA 1W5AA 1FNJA 5FNVA 1W41A 3GHZA 3CPWF 3ERNA 4BW0B 5MN5A 3MDOA 1YI2F 3JAKA 2CWJA 1YQNA 3L7QA 3E22A 4U3JA 3WJPA 1YITF 4C8EA 2OTLF 1VQLF 5LA6B 4HNAA 5LP6B 4YJ3B 4FFBB 3IEWA 5BMVB 1M90H 3K2XA 2HP3A 4ZK7A 4C82A 3N2KA 5GAPK 2LBWA 1OFUA 2CVLA 2HS3A 4BVQA 2W8BC 1Q8RA 1IV1A 4G4WA 3RA6A 5EZYB 1SA0B 1XRGA 3C9TA 3NK6A 2H8CA 1W55A 4X20B 2RHHA 3VI6A 3C8LA 4IHJA 2YYEA 3Q8HA 2I6DA 3QUWA 3UT5B 1NMUB 2R6R1 1VQNF 4BY9D 3VOAA 4O4HA 4C8GA 5HY2A 3C9UA 3VCZA 2VGMA 3KE1A 5CA0B 1RQ7A 1W3EX 2ALEA 1JY8A 1FSZA 5HY0A 2AIZP 3CYPB 5CA1A 4NQ3A 1RA4A 3F0DA 2KGWA 3VTIC 1U3LA 2EWCA 4O4IB 1QAHA 1KQSF 1FFXA 2G9IA 3FD5A 5IJ0A 3WXMB 3JAWA 5C8YB 4NUTA 4TUYA 3M84A 1K9MH 3CCJF 3HKEB 3LWQC 4KWEA 1X52A 3C9SA 2OTMA 2GVIA 5HY1A 3N4ZA 1CK2A 5LP6C 4I50A 2VGNA 3RE3A 3S02A 3D00A 3IR9A 1VHAA 2L26A 3K12A 2HRUA 4EI7A 4X1YB 2VAPA 1ZWZA 2HS0A 2UYPA 5GONB 2BTOA 2PHNA 3JARB 1T0AA 4FFBA 5IJ9B 3CMEF 4TV9A 5KX5B 1W5EA 5LXTB 1DT9A 4O4LA 1QVGF 4ZHQB 2R751 2ZAUA 1YHQF 1TVKB 4IIJB 2F9ZC 3FFMA 3JASB 2NMUA 2HVYD 1XBIA 4TZZA 1IV3A 3CCMF 2GLZA 3CC7F 5JH7A 3WGNA 3NK7A 4B5CA 3RYFB 1W5FA 4WBNA 3D54A 1UFYA 3FD6A 5IYZB 5HWEA 5IT9M 3NVIB 3MQWA 4I4TB 5J2UB 1X25A 1VQ9F 1SZQA 1W581 4BVSA 3VOBA 4EB6A 3VO8A 2KG4A 2HX0A 1OAPA 1W40A 3MBMA 4ZI7B 3G71F 1IV2A 1W2BF 1RLGA 1KD1H 3DDNA 3LDTA 1RLUA 5HXZA 3J81M 5JCOC 4O2AA 4TV8A 5G4UC 3CCUF 1NQ3A 3FPIA 1SDSA 1U43A 3TD5A 1GZ0A 1JJ2F 2HRYA 4G4XA 4G88A 2ZF8A 3GYQA 3LMEA 4ZOLB 3M4SA 1W5BA 3RYIA 1VK3A 3HKCB 4DRXB 5LYJB 1K8AH 2UYNB 5HXUA 2BTUA 1YGYA 4BT6A 1VQPF 3HKBB 1KC8H 3U0OA 3KJKA 4X1KB 5LOVA 1VH8A 4ZHWA 2Z1EA 1JFFA 3VMFB 4X1IB 3F6MA 5GIPC 5EYPA 4G4YA 2Z1TA 4YJ2B 2UYJA 1VQ8F 2HQSC 3OONA 3JATA 1GO1A 3C9RA 5KX5A 3V4DA 3D01A 3JALA 4C81A 5JQGB 5J2TB 1JD1A 4IIJA 2V9YA 3ZP7A 1PXWA 3HKDB 2BTQB 2Q1YA 1VQOF 5FJ4C 1VQMF 3CG6A 3RYCA 1VQ7F 3NVKE 4O4JB 3LWRC 1GX1A 5IYZA 2OZBA 4LNUB 4EI8A 3ESJA 1N8RH 2VAMA 3IMPA 3J7AR 2LBTA 4B62A 1TUBB 3I7TA 3MCAB 1M1KH 3VYUC 3CD6F 1CLIA 4BT3A 3JVHA 4G4ZA 4ZI7A 3WGLA 2HP0B 4I55B 4F6RB 4LCKA 5JVDB 4C4WC 3J80M 1JN1A 4G4VA 5FNVB 3TD3A 2N48A 5MN4A 5EB1B 4B45A 3JAKB 3OBWA 4DXDA 3E22B 3EORA 4U3JB 2B33A 5GINC 2IG8A 3P4EA 4HNAB 1X7PA 3PAFA 1COMA 3HWUA 5LA6A 1H47A 5LP6A 3O85A 2P6YA 4YJ3A 4ZOLA 3T80A 2IQQA 5BMVA 3RYHB 2Z1UA 5FLXM 2RB9A 4EI9A 4U39A 5LYJA
chains in the Genus database with same CATH topology
3DDNA 2IAFA 4RQOA 2IQQA 3DC2A 1YGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDN A;  2IAF A;  4RQO A;  2IQQ A;  3DC2 A;  1YGY A; 
#chains in the Genus database with same CATH topology
 4O2B B;  3N2K B;  2AIF A;  2RHJ A;  2VAW A;  1IPA A;  2Q1X A;  3K0T A;  1UI9 A;  3OW2 F;  1E7K A;  3RA5 A;  3QHD A;  3I56 F;  3F0F A;  3ELC A;  5EZY A;  3ZO8 A;  2YXZ A;  5HY4 A;  1SA0 A;  2KTV A;  3QTY A;  4XCQ A;  1ONI A;  4IHJ B;  4X20 A;  3CC2 F;  4RHA A;  1FNK A;  3TD4 A;  3WGK A;  3HTN A;  2OTJ F;  3WJQ A;  3UT5 A;  3JCM M;  1PF5 A;  2FC3 A;  3HKD A;  5MN6 A;  5CA0 A;  3CYQ A;  5CA1 B;  3LWV C;  3SIU A;  2I6R A;  3P10 A;  1H48 A;  1YJ9 F;  3ZOP A;  4LNU A;  1YJW F;  5G4V C;  2UZH A;  2WAL A;  4O4I A;  1FFX B;  1Z5W A;  3DC2 A;  5IJ0 B;  1Z5V A;  3S03 A;  3I55 F;  1T0K B;  5HP7 A;  3IKE A;  3P0Z A;  3CCR F;  2PMP A;  4X3M A;  5C8Y A;  2QA4 F;  1QU9 A;  4I55 A;  3V7Q A;  1Q86 H;  1DBF A;  1W42 A;  3HKE A;  2Z1F A;  3PLA C;  4I50 B;  1ODE A;  3IEQ A;  5KMG B;  3CCE F;  4ZHY B;  3HAX D;  3V3T A;  1QVF F;  4RQO A;  4ZHV A;  4X1Y A;  3WGM A;  1W57 A;  5GON A;  4R40 B;  4TV9 B;  3JAR A;  5IJ9 A;  2QI2 A;  4C8I A;  4O4L B;  1KNJ A;  2BO1 A;  3RYH A;  2ZOD A;  5B8F A;  4BT4 A;  5LXT A;  4ZHQ A;  3BYQ A;  4O2B A;  5EIB C;  1NJI H;  1TVK A;  5CB4 B;  1XHO A;  3JAS A;  3G4S F;  3VYS C;  5ITZ B;  5JH7 B;  3E1Y A;  3AGK A;  2LCA A;  3WPX A;  3S0W A;  4WBN B;  1QD9 A;  3RYF A;  1IV4 A;  3M1X A;  4NWO B;  4I4T A;  5J2U A;  4ERH A;  4BT2 A;  4BT5 A;  4EB6 B;  1GO0 A;  1VQV A;  2VXY A;  4M8I A;  3N4Y A;  2RHL A;  4BVT A;  3SIV A;  5EWR A;  3N2G B;  4O2A B;  4TV8 B;  5EO3 A;  3CMA F;  3ZP4 A;  3I3F A;  4B46 A;  3E20 B;  5AVM A;  3HJW C;  3CXC F;  3WJR A;  2QTP A;  2CHT A;  2CHS A;  3KJJ A;  3IKF A;  4BVR A;  2LBX A;  3RYI B;  1K73 H;  4X3L A;  1XV2 A;  3S0Y A;  3V7E A;  3NMU C;  3HKC A;  1Q82 H;  1RQ2 A;  4DRX A;  3JAM M;  3F0G A;  4PWT A;  3CCV F;  2UYN A;  3CCQ F;  2MQE A;  1Q81 H;  3VYT C;  2UYK A;  3GTZ A;  3LFO A;  2Z01 A;  2ZVZ A;  3HKB A;  5LOV B;  1S72 F;  5GAN K;  3G6E F;  5KMG A;  3WGJ A;  3S0H A;  4X1K A;  1VQK F;  2JNB A;  1KNK A;  1JFF B;  3R0P A;  5EAZ A;  2CW4 A;  3WPW A;  5EB0 A;  1J7H A;  4X1I A;  5EYP B;  3S06 A;  2CSL A;  4BT7 A;  2FGY A;  3JAT B;  4YJ2 A;  3LWO C;  2K1S A;  1X7O A;  3JAL B;  3KHN A;  3KIZ A;  2DYY A;  5DCV A;  4O4H B;  5JQG A;  5J2T A;  1YJN F;  5CB4 A;  1W59 A;  1U3P A;  4E6E A;  3FBA A;  1CN7 A;  5ITZ A;  3RYC B;  1R1M A;  2HS4 A;  3LYB A;  5A2Q M;  2GZL A;  1YIJ F;  3LWP C;  4O4J A;  3B6N A;  3K14 A;  3F0E A;  3CCS F;  3MCQ A;  2RHO A;  3CB2 A;  2OHW A;  3OBY A;  3ON1 A;  5HP8 A;  3CC4 F;  2IAF A;  1Q7Y H;  2H8E A;  5JCO A;  2DT4 A;  1VQ5 F;  2AMT A;  1VQ4 F;  2ZOV A;  5EIB D;  3JAW B;  1TUB A;  1H7M A;  2H6L A;  4TUY B;  1VQ6 F;  2CZW A;  2HP0 A;  2ZVY A;  3N2G A;  4F6R A;  5JVD A;  2QEX F;  3VIU A;  2KTU A;  3CCL F;  5GIO C;  1U40 A;  3CPQ A;  1W5A A;  1FNJ A;  5FNV A;  1W41 A;  3GHZ A;  3CPW F;  3ERN A;  4BW0 B;  5MN5 A;  3MDO A;  1YI2 F;  3JAK A;  2CWJ A;  1YQN A;  3L7Q A;  3E22 A;  4U3J A;  3WJP A;  1YIT F;  4C8E A;  2OTL F;  1VQL F;  5LA6 B;  4HNA A;  5LP6 B;  4YJ3 B;  4FFB B;  3IEW A;  5BMV B;  1M90 H;  3K2X A;  2HP3 A;  4ZK7 A;  4C82 A;  3N2K A;  5GAP K;  2LBW A;  1OFU A;  2CVL A;  2HS3 A;  4BVQ A;  2W8B C;  1Q8R A;  1IV1 A;  4G4W A;  3RA6 A;  5EZY B;  1SA0 B;  1XRG A;  3C9T A;  3NK6 A;  2H8C A;  1W55 A;  4X20 B;  2RHH A;  3VI6 A;  3C8L A;  4IHJ A;  2YYE A;  3Q8H A;  2I6D A;  3QUW A;  3UT5 B;  1NMU B;  2R6R 1;  1VQN F;  4BY9 D;  3VOA A;  4O4H A;  4C8G A;  5HY2 A;  3C9U A;  3VCZ A;  2VGM A;  3KE1 A;  5CA0 B;  1RQ7 A;  1W3E X;  2ALE A;  1JY8 A;  1FSZ A;  5HY0 A;  2AIZ P;  3CYP B;  5CA1 A;  4NQ3 A;  1RA4 A;  3F0D A;  2KGW A;  3VTI C;  1U3L A;  2EWC A;  4O4I B;  1QAH A;  1KQS F;  1FFX A;  2G9I A;  3FD5 A;  5IJ0 A;  3WXM B;  3JAW A;  5C8Y B;  4NUT A;  4TUY A;  3M84 A;  1K9M H;  3CCJ F;  3HKE B;  3LWQ C;  4KWE A;  1X52 A;  3C9S A;  2OTM A;  2GVI A;  5HY1 A;  3N4Z A;  1CK2 A;  5LP6 C;  4I50 A;  2VGN A;  3RE3 A;  3S02 A;  3D00 A;  3IR9 A;  1VHA A;  2L26 A;  3K12 A;  2HRU A;  4EI7 A;  4X1Y B;  2VAP A;  1ZWZ A;  2HS0 A;  2UYP A;  5GON B;  2BTO A;  2PHN A;  3JAR B;  1T0A A;  4FFB A;  5IJ9 B;  3CME F;  4TV9 A;  5KX5 B;  1W5E A;  5LXT B;  1DT9 A;  4O4L A;  1QVG F;  4ZHQ B;  2R75 1;  2ZAU A;  1YHQ F;  1TVK B;  4IIJ B;  2F9Z C;  3FFM A;  3JAS B;  2NMU A;  2HVY D;  1XBI A;  4TZZ A;  1IV3 A;  3CCM F;  2GLZ A;  3CC7 F;  5JH7 A;  3WGN A;  3NK7 A;  4B5C A;  3RYF B;  1W5F A;  4WBN A;  3D54 A;  1UFY A;  3FD6 A;  5IYZ B;  5HWE A;  5IT9 M;  3NVI B;  3MQW A;  4I4T B;  5J2U B;  1X25 A;  1VQ9 F;  1SZQ A;  1W58 1;  4BVS A;  3VOB A;  4EB6 A;  3VO8 A;  2KG4 A;  2HX0 A;  1OAP A;  1W40 A;  3MBM A;  4ZI7 B;  3G71 F;  1IV2 A;  1W2B F;  1RLG A;  1KD1 H;  3DDN A;  3LDT A;  1RLU A;  5HXZ A;  3J81 M;  5JCO C;  4O2A A;  4TV8 A;  5G4U C;  3CCU F;  1NQ3 A;  3FPI A;  1SDS A;  1U43 A;  3TD5 A;  1GZ0 A;  1JJ2 F;  2HRY A;  4G4X A;  4G88 A;  2ZF8 A;  3GYQ A;  3LME A;  4ZOL B;  3M4S A;  1W5B A;  3RYI A;  1VK3 A;  3HKC B;  4DRX B;  5LYJ B;  1K8A H;  2UYN B;  5HXU A;  2BTU A;  1YGY A;  4BT6 A;  1VQP F;  3HKB B;  1KC8 H;  3U0O A;  3KJK A;  4X1K B;  5LOV A;  1VH8 A;  4ZHW A;  2Z1E A;  1JFF A;  3VMF B;  4X1I B;  3F6M A;  5GIP C;  5EYP A;  4G4Y A;  2Z1T A;  4YJ2 B;  2UYJ A;  1VQ8 F;  2HQS C;  3OON A;  3JAT A;  1GO1 A;  3C9R A;  5KX5 A;  3V4D A;  3D01 A;  3JAL A;  4C81 A;  5JQG B;  5J2T B;  1JD1 A;  4IIJ A;  2V9Y A;  3ZP7 A;  1PXW A;  3HKD B;  2BTQ B;  2Q1Y A;  1VQO F;  5FJ4 C;  1VQM F;  3CG6 A;  3RYC A;  1VQ7 F;  3NVK E;  4O4J B;  3LWR C;  1GX1 A;  5IYZ A;  2OZB A;  4LNU B;  4EI8 A;  3ESJ A;  1N8R H;  2VAM A;  3IMP A;  3J7A R;  2LBT A;  4B62 A;  1TUB B;  3I7T A;  3MCA B;  1M1K H;  3VYU C;  3CD6 F;  1CLI A;  4BT3 A;  3JVH A;  4G4Z A;  4ZI7 A;  3WGL A;  2HP0 B;  4I55 B;  4F6R B;  4LCK A;  5JVD B;  4C4W C;  3J80 M;  1JN1 A;  4G4V A;  5FNV B;  3TD3 A;  2N48 A;  5MN4 A;  5EB1 B;  4B45 A;  3JAK B;  3OBW A;  4DXD A;  3E22 B;  3EOR A;  4U3J B;  2B33 A;  5GIN C;  2IG8 A;  3P4E A;  4HNA B;  1X7P A;  3PAF A;  1COM A;  3HWU A;  5LA6 A;  1H47 A;  5LP6 A;  3O85 A;  2P6Y A;  4YJ3 A;  4ZOL A;  3T80 A;  2IQQ A;  5BMV A;  3RYH B;  2Z1U A;  5FLX M;  2RB9 A;  4EI9 A;  4U39 A;  5LYJ A; 
#chains in the Genus database with same CATH homology
 3DDN A;  2IAF A;  4RQO A;  2IQQ A;  3DC2 A;  1YGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...