4RQOA

Crystal structure of l-serine dehydratase from legionella pneumophila
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
457
structure length
444
Chain Sequence
NISVFDLFSIGIGPSSSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPETVDPASMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDKNPPPYPFATATELLKLCKKHHLTIAELMLVNEKTWRSTAEIHKGILDIAKVMDDCINNGCKHDGVLPGGLNLKRRAPDLYRKLIFEQSDIMNHLNLYAMAVNEENAAGGRIVTAPTNGAAGIIPAVLKYCQQAHDRMSNEDIYTYFLTAAAIGILYKKGASISGAEVGCQGEVGVASSMAAAGLTAVLGGTIEQVENAAEIAMEHHLGMTCDPVLGLVQIPCIERNAMGAVKAVNATRMALIGDGQHQISLDKVIKTMKQTGMDMQSIYKETSMGGLAVNLPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-serine dehydratase
publication title Structure of l-Serine Dehydratase from Legionella pneumophila: Novel Use of the C-Terminal Cysteine as an Intrinsic Competitive Inhibitor.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila str. thunder bay
molecule tags Lyase
total genus 139
structure length 444
sequence length 457
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2014-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 4rqoA01
3DDNA 2IQQA 1YGYA 4RQOA 3DC2A 2IAFA
chains in the Genus database with same CATH superfamily
3HKBA 4WBNA 2CHSA 4DRXB 3MQWA 3M1XA 5ITZB 3I56F 1K8AH 5GONA 3DC2A 5LP6C 4C8EA 5EIBC 2BO1A 3KJKA 2CSLA 3L7QA 3J81M 5CA0A 3K12A 4X1YB 1PXWA 5JCOC 3HTNA 3MBMA 3HKDB 3J80M 1X52A 4HNAA 5LXTA 2B33A 3F6MA 3HAXD 2G9IA 5J2UA 5IJ0A 1VH8A 1RQ2A 3HKEA 3RYIA 2AIZP 4F6RB 4LNUA 2HRYA 3LWRC 1VQ7F 5HY4A 3WGMA 3JASB 5LOVA 5EB1B 1QVFF 4BT4A 4BVTA 4TV8A 3VIUA 3VOBA 4ERHA 1W55A 3NVIB 1J7HA 1NQ3A 3FBAA 3WJQA 2ALEA 3NK6A 1W581 3TD3A 1X7PA 3O85A 3VCZA 1VQ5F 2ZVYA 5HWEA 1Z5WA 5GINC 3JAWA 3HKCA 4X20B 1IV2A 4IIJB 3CYPB 3C8LA 5KMGA 5LYJB 5EYPA 1YJWF 5IYZB 4YJ3A 3D54A 1UI9A 1FFXB 2BTOA 5A2QM 1XRGA 3VI6A 2R6R1 5GANK 3C9TA 2PMPA 5G4UC 1QD9A 2Z1EA 3RA6A 3VTIC 3D00A 2CWJA 2KGWA 3NMUC 3FD6A 2HX0A 2HP0B 2IAFA 2Z01A 2BTUA 3F0DA 5EAZA 5GIOC 1KD1H 2OTMA 3PAFA 1PF5A 4O2BB 3RE3A 1VQLF 3IEWA 4G4YA 2ZOVA 2EWCA 3ON1A 3P10A 5JVDB 3UT5B 3VYSC 5GIPC 1KC8H 1X25A 1CLIA 4M8IA 3K2XA 3CCQF 1VK3A 3MDOA 1RLGA 1H48A 5EIBD 4X1KA 1GX1A 4BVQA 4B46A 3Q8HA 5DCVA 1YHQF 3LYBA 1YJNF 2W8BC 4DRXA 5ITZA 4TV9B 3CPWF 3CCMF 3WJPA 2LCAA 2UYPA 1DBFA 4X1YA 2IG8A 3HKDA 5CB4B 5B8FA 1COMA 1SDSA 1W5AA 1Q82H 1FNKA 5EZYB 3V7EA 3SIVA 3JAKB 4I55A 4F6RA 3EORA 2GLZA 3CC7F 2UYKA 3S0YA 4B45A 3ERNA 2Q1XA 1YI2F 4ZK7A 3S02A 1GZ0A 2YXZA 5MN4A 2GVIA 4U39A 3CCJF 3K14A 3QHDA 4IHJB 4EB6B 1FNJA 2BTQB 1GO0A 3ZO8A 4YJ2B 1XV2A 3QTYA 3WGLA 1X7OA 1XBIA 2VGNA 2UYJA 3I7TA 1H47A 3N4ZA 1KQSF 3IKEA 4X20A 4I50B 4IIJA 5LYJA 1N8RH 3CD6F 5IYZA 3LWQC 3F0GA 1YQNA 1IV3A 3JATB 3VO8A 2LBXA 1XHOA 3E1YA 3V4DA 2RHLA 4E6EA 3T80A 1VQOF 5HP8A 3P0ZA 1W5BA 3JALB 3OBYA 2QA4F 2HS0A 3OBWA 3E22A 1W3EX 1KNJA 1W2BF 1UFYA 3I3FA 3CCUF 1Z5VA 4EI8A 4G4VA 3N2GB 1QVGF 1Q81H 2HP0A 3MCAB 4NWOB 3KE1A 1TVKA 2K1SA 1H7MA 3CCVF 1GO1A 2I6DA 4O2BA 1W57A 3ZOPA 2F9ZC 5FLXM 5JVDA 3UT5A 5MN6A 4R40B 1W59A 4O4HB 2AMTA 4U3JB 3WPWA 4O2AB 5J2TB 3LMEA 3CPQA 5BMVB 1Q8RA 3CXCF 3C9SA 2OZBA 2HQSC 4TUYB 2CHTA 3CC2F 3WGKA 4TV9A 1TUBB 3N2KB 5EWRA 3JARB 4ZOLA 5CA1B 1JJ2F 3RYFB 4ZHQA 2Z1UA 3CCSF 1JFFB 3R0PA 3RYCB 1VQ6F 1E7KA 2H8EA 3G6EF 5CB4A 3C9RA 1IV4A 3LWVC 1M1KH 2VXYA 3B6NA 3BYQA 5GONB 3RYHB 5EZYA 1YGYA 1RQ7A 5IJ9B 4PWTA 4TZZA 3JAKA 2VAPA 2RHHA 1U3LA 2LBWA 2V9YA 4BT7A 1KNKA 2MQEA 2HP3A 1K9MH 3IMPA 2WALA 3WJRA 4LCKA 2N48A 2ZF8A 4BVRA 5EB0A 3RYIB 3VYTC 2DYYA 1Q86H 3IR9A 4IHJA 4I4TB 3FFMA 1ZWZA 2KTVA 2UZHA 5FNVB 5JQGB 2P6YA 4G88A 2QEXF 1YITF 4YJ2A 3D01A 2CVLA 1OFUA 4I50A 3M84A 3VYUC 2RB9A 3CMAF 4X3MA 3ZP4A 5C8YB 4C81A 3F0FA 5G4VC 1VQVA 3JATA 1M90H 2OHWA 4O4JB 3IEQA 3I55F 5EO3A 3TD4A 3JAMM 3JALA 1QU9A 5EYPB 2FC3A 2GZLA 2Z1TA 4EI9A 4X3LA 4ZHVA 1S72F 3JASA 4C4WC 4FFBB 3PLAC 5LP6B 3OW2F 5KX5B 3N2GA 3ZP7A 3FD5A 4ZI7B 3CCRF 4RQOA 1IV1A 2AIFA 3JCMM 1W41A 4C8IA 5GAPK 3VOAA 3CC4F 3CYQA 2UYNB 4O4HA 3LFOA 3C9UA 5IT9M 2HS3A 4O2AA 5J2TA 5BMVA 5HXUA 3ELCA 3S0HA 1Q7YH 4TUYA 1W5EA 1FFXA 4KWEA 1VQ4F 3KHNA 3WGJA 3WGNA 3N2KA 3JARA 1RLUA 3V7QA 1SA0B 1VHAA 4XCQA 3NVKE 3P4EA 3FPIA 1JFFA 3RYCA 3U0OA 2H8CA 1ONIA 4B5CA 2Q1YA 1SZQA 3CG6A 2NMUA 3RYHA 1CN7A 5IJ9A 1T0KB 4BY9D 1U3PA 4X1IB 1VQMF 2QTPA 1RA4A 3CCEF 4O4IB 3M4SA 1T0AA 3J7AR 3CMEF 1NJIH 5HY1A 2I6RA 2PHNA 4B62A 3KJJA 4I55B 4G4XA 4I4TA 5FNVA 5JQGA 3WXMB 3G4SF 1U40A 1W42A 3TD5A 5JH7B 1VQ8F 4O4LB 1IPAA 2YYEA 3GHZA 4C82A 1QAHA 5C8YA 2VGMA 2ZAUA 5HY2A 3JVHA 5LA6B 3HWUA 4O4JA 2OTLF 3GTZA 3SIUA 3HKBB 4WBNB 3CCLF 2Z1FA 4G4ZA 1W5FA 2JNBA 5CA0B 3S0WA 5HY0A 4FFBA 2HVYD 4HNAB 5LXTB 3N4YA 4BT3A 5LP6A 5KX5A 5J2UB 5IJ0B 2RHJA 3HKEB 4DXDA 1FSZA 4LNUB 3E22B 5JCOA 4EB6A 4ZI7A 3LWPC 5LOVB 3ESJA 4TV8B 3F0EA 2CZWA 2UYNA 1VQNF 2HS4A 3QUWA 4NUTA 1TVKB 5AVMA 4C8GA 2FGYA 2ZVZA 2KG4A 2RHOA 3DDNA 1CK2A 3JAWB 1JY8A 1SA0A 3HKCB 4BVSA 4RHAA 5KMGB 3NK7A 4ZHYB 4YJ3B 4NQ3A 5MN5A 2DT4A 3AGKA 4ZHWA 1JN1A 3K0TA 3V3TA 3LDTA 1VQ9F 2H6LA 2HRUA 4ZOLB 3GYQA 2L26A 4ZHQB 4X1IA 4BT5A 3S03A 1YIJF 4O4IA 2CW4A 1K73H 3KIZA 3VMFB 1JD1A 3IKFA 1VQPF 3WPXA 4EI7A 3RA5A 2R751 2KTUA 3CB2A 3MCQA 4BW0B 1R1MA 2QI2A 4U3JA 1DT9A 1ODEA 3S06A 5FJ4C 4BT2A 2IQQA 4G4WA 1U43A 1YJ9F 5JH7A 2LBTA 2VAWA 1VQKF 4O4LA 2ZODA 5HP7A 3LWOC 1TUBA 1NMUB 5HXZA 3G71F 4BT6A 5CA1A 2VAMA 3RYFA 3E20B 4X1KB 1OAPA 3HJWC 2OTJF 3OONA 5LA6A 1W40A
chains in the Genus database with same CATH topology
3DDNA 2IQQA 1YGYA 4RQOA 3DC2A 2IAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDN A;  2IQQ A;  1YGY A;  4RQO A;  3DC2 A;  2IAF A; 
#chains in the Genus database with same CATH topology
 3HKB A;  4WBN A;  2CHS A;  4DRX B;  3MQW A;  3M1X A;  5ITZ B;  3I56 F;  1K8A H;  5GON A;  3DC2 A;  5LP6 C;  4C8E A;  5EIB C;  2BO1 A;  3KJK A;  2CSL A;  3L7Q A;  3J81 M;  5CA0 A;  3K12 A;  4X1Y B;  1PXW A;  5JCO C;  3HTN A;  3MBM A;  3HKD B;  3J80 M;  1X52 A;  4HNA A;  5LXT A;  2B33 A;  3F6M A;  3HAX D;  2G9I A;  5J2U A;  5IJ0 A;  1VH8 A;  1RQ2 A;  3HKE A;  3RYI A;  2AIZ P;  4F6R B;  4LNU A;  2HRY A;  3LWR C;  1VQ7 F;  5HY4 A;  3WGM A;  3JAS B;  5LOV A;  5EB1 B;  1QVF F;  4BT4 A;  4BVT A;  4TV8 A;  3VIU A;  3VOB A;  4ERH A;  1W55 A;  3NVI B;  1J7H A;  1NQ3 A;  3FBA A;  3WJQ A;  2ALE A;  3NK6 A;  1W58 1;  3TD3 A;  1X7P A;  3O85 A;  3VCZ A;  1VQ5 F;  2ZVY A;  5HWE A;  1Z5W A;  5GIN C;  3JAW A;  3HKC A;  4X20 B;  1IV2 A;  4IIJ B;  3CYP B;  3C8L A;  5KMG A;  5LYJ B;  5EYP A;  1YJW F;  5IYZ B;  4YJ3 A;  3D54 A;  1UI9 A;  1FFX B;  2BTO A;  5A2Q M;  1XRG A;  3VI6 A;  2R6R 1;  5GAN K;  3C9T A;  2PMP A;  5G4U C;  1QD9 A;  2Z1E A;  3RA6 A;  3VTI C;  3D00 A;  2CWJ A;  2KGW A;  3NMU C;  3FD6 A;  2HX0 A;  2HP0 B;  2IAF A;  2Z01 A;  2BTU A;  3F0D A;  5EAZ A;  5GIO C;  1KD1 H;  2OTM A;  3PAF A;  1PF5 A;  4O2B B;  3RE3 A;  1VQL F;  3IEW A;  4G4Y A;  2ZOV A;  2EWC A;  3ON1 A;  3P10 A;  5JVD B;  3UT5 B;  3VYS C;  5GIP C;  1KC8 H;  1X25 A;  1CLI A;  4M8I A;  3K2X A;  3CCQ F;  1VK3 A;  3MDO A;  1RLG A;  1H48 A;  5EIB D;  4X1K A;  1GX1 A;  4BVQ A;  4B46 A;  3Q8H A;  5DCV A;  1YHQ F;  3LYB A;  1YJN F;  2W8B C;  4DRX A;  5ITZ A;  4TV9 B;  3CPW F;  3CCM F;  3WJP A;  2LCA A;  2UYP A;  1DBF A;  4X1Y A;  2IG8 A;  3HKD A;  5CB4 B;  5B8F A;  1COM A;  1SDS A;  1W5A A;  1Q82 H;  1FNK A;  5EZY B;  3V7E A;  3SIV A;  3JAK B;  4I55 A;  4F6R A;  3EOR A;  2GLZ A;  3CC7 F;  2UYK A;  3S0Y A;  4B45 A;  3ERN A;  2Q1X A;  1YI2 F;  4ZK7 A;  3S02 A;  1GZ0 A;  2YXZ A;  5MN4 A;  2GVI A;  4U39 A;  3CCJ F;  3K14 A;  3QHD A;  4IHJ B;  4EB6 B;  1FNJ A;  2BTQ B;  1GO0 A;  3ZO8 A;  4YJ2 B;  1XV2 A;  3QTY A;  3WGL A;  1X7O A;  1XBI A;  2VGN A;  2UYJ A;  3I7T A;  1H47 A;  3N4Z A;  1KQS F;  3IKE A;  4X20 A;  4I50 B;  4IIJ A;  5LYJ A;  1N8R H;  3CD6 F;  5IYZ A;  3LWQ C;  3F0G A;  1YQN A;  1IV3 A;  3JAT B;  3VO8 A;  2LBX A;  1XHO A;  3E1Y A;  3V4D A;  2RHL A;  4E6E A;  3T80 A;  1VQO F;  5HP8 A;  3P0Z A;  1W5B A;  3JAL B;  3OBY A;  2QA4 F;  2HS0 A;  3OBW A;  3E22 A;  1W3E X;  1KNJ A;  1W2B F;  1UFY A;  3I3F A;  3CCU F;  1Z5V A;  4EI8 A;  4G4V A;  3N2G B;  1QVG F;  1Q81 H;  2HP0 A;  3MCA B;  4NWO B;  3KE1 A;  1TVK A;  2K1S A;  1H7M A;  3CCV F;  1GO1 A;  2I6D A;  4O2B A;  1W57 A;  3ZOP A;  2F9Z C;  5FLX M;  5JVD A;  3UT5 A;  5MN6 A;  4R40 B;  1W59 A;  4O4H B;  2AMT A;  4U3J B;  3WPW A;  4O2A B;  5J2T B;  3LME A;  3CPQ A;  5BMV B;  1Q8R A;  3CXC F;  3C9S A;  2OZB A;  2HQS C;  4TUY B;  2CHT A;  3CC2 F;  3WGK A;  4TV9 A;  1TUB B;  3N2K B;  5EWR A;  3JAR B;  4ZOL A;  5CA1 B;  1JJ2 F;  3RYF B;  4ZHQ A;  2Z1U A;  3CCS F;  1JFF B;  3R0P A;  3RYC B;  1VQ6 F;  1E7K A;  2H8E A;  3G6E F;  5CB4 A;  3C9R A;  1IV4 A;  3LWV C;  1M1K H;  2VXY A;  3B6N A;  3BYQ A;  5GON B;  3RYH B;  5EZY A;  1YGY A;  1RQ7 A;  5IJ9 B;  4PWT A;  4TZZ A;  3JAK A;  2VAP A;  2RHH A;  1U3L A;  2LBW A;  2V9Y A;  4BT7 A;  1KNK A;  2MQE A;  2HP3 A;  1K9M H;  3IMP A;  2WAL A;  3WJR A;  4LCK A;  2N48 A;  2ZF8 A;  4BVR A;  5EB0 A;  3RYI B;  3VYT C;  2DYY A;  1Q86 H;  3IR9 A;  4IHJ A;  4I4T B;  3FFM A;  1ZWZ A;  2KTV A;  2UZH A;  5FNV B;  5JQG B;  2P6Y A;  4G88 A;  2QEX F;  1YIT F;  4YJ2 A;  3D01 A;  2CVL A;  1OFU A;  4I50 A;  3M84 A;  3VYU C;  2RB9 A;  3CMA F;  4X3M A;  3ZP4 A;  5C8Y B;  4C81 A;  3F0F A;  5G4V C;  1VQV A;  3JAT A;  1M90 H;  2OHW A;  4O4J B;  3IEQ A;  3I55 F;  5EO3 A;  3TD4 A;  3JAM M;  3JAL A;  1QU9 A;  5EYP B;  2FC3 A;  2GZL A;  2Z1T A;  4EI9 A;  4X3L A;  4ZHV A;  1S72 F;  3JAS A;  4C4W C;  4FFB B;  3PLA C;  5LP6 B;  3OW2 F;  5KX5 B;  3N2G A;  3ZP7 A;  3FD5 A;  4ZI7 B;  3CCR F;  4RQO A;  1IV1 A;  2AIF A;  3JCM M;  1W41 A;  4C8I A;  5GAP K;  3VOA A;  3CC4 F;  3CYQ A;  2UYN B;  4O4H A;  3LFO A;  3C9U A;  5IT9 M;  2HS3 A;  4O2A A;  5J2T A;  5BMV A;  5HXU A;  3ELC A;  3S0H A;  1Q7Y H;  4TUY A;  1W5E A;  1FFX A;  4KWE A;  1VQ4 F;  3KHN A;  3WGJ A;  3WGN A;  3N2K A;  3JAR A;  1RLU A;  3V7Q A;  1SA0 B;  1VHA A;  4XCQ A;  3NVK E;  3P4E A;  3FPI A;  1JFF A;  3RYC A;  3U0O A;  2H8C A;  1ONI A;  4B5C A;  2Q1Y A;  1SZQ A;  3CG6 A;  2NMU A;  3RYH A;  1CN7 A;  5IJ9 A;  1T0K B;  4BY9 D;  1U3P A;  4X1I B;  1VQM F;  2QTP A;  1RA4 A;  3CCE F;  4O4I B;  3M4S A;  1T0A A;  3J7A R;  3CME F;  1NJI H;  5HY1 A;  2I6R A;  2PHN A;  4B62 A;  3KJJ A;  4I55 B;  4G4X A;  4I4T A;  5FNV A;  5JQG A;  3WXM B;  3G4S F;  1U40 A;  1W42 A;  3TD5 A;  5JH7 B;  1VQ8 F;  4O4L B;  1IPA A;  2YYE A;  3GHZ A;  4C82 A;  1QAH A;  5C8Y A;  2VGM A;  2ZAU A;  5HY2 A;  3JVH A;  5LA6 B;  3HWU A;  4O4J A;  2OTL F;  3GTZ A;  3SIU A;  3HKB B;  4WBN B;  3CCL F;  2Z1F A;  4G4Z A;  1W5F A;  2JNB A;  5CA0 B;  3S0W A;  5HY0 A;  4FFB A;  2HVY D;  4HNA B;  5LXT B;  3N4Y A;  4BT3 A;  5LP6 A;  5KX5 A;  5J2U B;  5IJ0 B;  2RHJ A;  3HKE B;  4DXD A;  1FSZ A;  4LNU B;  3E22 B;  5JCO A;  4EB6 A;  4ZI7 A;  3LWP C;  5LOV B;  3ESJ A;  4TV8 B;  3F0E A;  2CZW A;  2UYN A;  1VQN F;  2HS4 A;  3QUW A;  4NUT A;  1TVK B;  5AVM A;  4C8G A;  2FGY A;  2ZVZ A;  2KG4 A;  2RHO A;  3DDN A;  1CK2 A;  3JAW B;  1JY8 A;  1SA0 A;  3HKC B;  4BVS A;  4RHA A;  5KMG B;  3NK7 A;  4ZHY B;  4YJ3 B;  4NQ3 A;  5MN5 A;  2DT4 A;  3AGK A;  4ZHW A;  1JN1 A;  3K0T A;  3V3T A;  3LDT A;  1VQ9 F;  2H6L A;  2HRU A;  4ZOL B;  3GYQ A;  2L26 A;  4ZHQ B;  4X1I A;  4BT5 A;  3S03 A;  1YIJ F;  4O4I A;  2CW4 A;  1K73 H;  3KIZ A;  3VMF B;  1JD1 A;  3IKF A;  1VQP F;  3WPX A;  4EI7 A;  3RA5 A;  2R75 1;  2KTU A;  3CB2 A;  3MCQ A;  4BW0 B;  1R1M A;  2QI2 A;  4U3J A;  1DT9 A;  1ODE A;  3S06 A;  5FJ4 C;  4BT2 A;  2IQQ A;  4G4W A;  1U43 A;  1YJ9 F;  5JH7 A;  2LBT A;  2VAW A;  1VQK F;  4O4L A;  2ZOD A;  5HP7 A;  3LWO C;  1TUB A;  1NMU B;  5HXZ A;  3G71 F;  4BT6 A;  5CA1 A;  2VAM A;  3RYF A;  3E20 B;  4X1K B;  1OAP A;  3HJW C;  2OTJ F;  3OON A;  5LA6 A;  1W40 A; 
#chains in the Genus database with same CATH homology
 3DDN A;  2IQQ A;  1YGY A;  4RQO A;  3DC2 A;  2IAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...