1M1KH

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m1kH00
3E20B 3I56F 1RA4A 3ON1A 5GIOC 1E7KA 4X3MA 3LWQC 1VQLF 2KG4A 2LBXA 2VGNA 5FLXM 1X7OA 3CMEF 1YJWF 1DT9A 1W41A 3OBWA 3CMAF 1YITF 1Q7YH 3CC7F 1M1KH 1GO0A 1M90H 3G71F 1IPAA 3G4SF 1Q82H 4C4WC 3CG6A 3RA5A 2BO1A 2KTUA 3CCRF 3NVKE 1NJIH 5G4UC 3NVIB 3LWOC 1VQKF 5IT9M 3AGKA 1VQNF 2LBWA 3NK6A 1VQPF 1ZWZA 2OZBA 3LWRC 3FFMA 1K9MH 1QVGF 3PLAC 3CCLF 3CCMF 3CCEF 2HVYD 1K8AH 3CCUF 3MCAB 2ALEA 5DCVA 3J7AR 2VGMA 1KC8H 1KQSF 3VMFB 3CCSF 3J81M 3LWVC 5GANK 4BW0B 3LFOA 5G4VC 3JCMM 5GINC 1KD1H 1YHQF 3G6EF 2JNBA 3JAMM 2CZWA 2WALA 4BY9D 3HJWC 1YJNF 3HAXD 3GYQA 1YJ9F 2FC3A 1W40A 3CC2F 3SIUA 1JJ2F 2OTJF 3CXCF 1VQ7F 3VI6A 1VQMF 4TZZA 1NMUB 1RLGA 1H7MA 1YIJF 1SDSA 1Q81H 1PXWA 3NK7A 3SIVA 3J80M 3I55F 3OBYA 1VQ9F 3WXMB 3E1YA 5EWRA 1X7PA 3N4YA 5GAPK 1CN7A 2KTVA 1VQOF 2I6DA 2QEXF 3CCJF 1K73H 1W42A 1Q86H 1W3EX 2QI2A 1VQ8F 3CCQF 5EO3A 3CD6F 3V7QA 5FJ4C 3CCVF 2AIFA 1QVFF 3NMUC 3OW2F 1VQ5F 3PAFA 1VQ6F 3RA6A 1S72F 3CC4F 1GO1A 5GIPC 1YI2F 2OHWA 4LCKA 3N4ZA 1W2BF 3O85A 3LWPC 2OTLF 2QA4F 1VQ4F 3CPWF 3CPQA 3IR9A 1CK2A 1X52A 1GZ0A 1N8RH 4NUTA 5A2QM 3V7EA 1T0KB 4X3LA 1XBIA
chains in the Genus database with same CATH superfamily
3MBMA 2HQSC 4U3JA 5GIOC 3ZO8A 5BMVA 3D00A 5CA1B 4TV9B 1XHOA 2LBXA 4X1YB 1W59A 5EB1B 5FLXM 3K12A 1X7OA 3S0YA 1UI9A 3CMAF 4EB6B 1Q7YH 3HKCA 5IJ9B 4G88A 2HRYA 1RQ7A 2PMPA 1SZQA 3D01A 4ZOLB 1NJIH 3NVIB 2HX0A 1IV1A 1VQPF 5CB4A 5J2TA 3LWRC 2OZBA 1K9MH 3VOBA 1U40A 3CCLF 5LP6B 2ZAUA 2VXYA 2HP0A 3UT5B 4ZHYB 2Z1TA 4I55B 5LOVA 4O2AA 3S0HA 5J2UB 3LFOA 5G4VC 2Z01A 5GINC 1YHQF 3VYTC 3G6EF 4IHJB 1JFFB 1VHAA 3JAMM 4BT2A 2CZWA 4TUYA 3HJWC 3RYFA 1VH8A 4BT4A 1GX1A 2R751 5HWEA 5KMGA 3FBAA 1YGYA 1Z5VA 1VQ7F 3N2KA 2W8BC 4ZHVA 1FFXB 3VO8A 1VQMF 3JALB 3TD5A 1H7MA 2K1SA 1YIJF 4X1IA 2GLZA 3NK7A 4G4ZA 3JAKA 3I55F 3HKEA 1FSZA 4O4IB 5AVMA 2F9ZC 5JQGB 2R6R1 3F0FA 4X1KB 4O2BA 3KIZA 1Q8RA 3JATA 2QI2A 4LNUA 4R40B 3CD6F 1TVKA 5EZYA 5EIBD 3RYIA 3C9SA 3NMUC 5LA6B 1VQ6F 3JASB 3RA6A 3WPWA 1S72F 5HY0A 2GVIA 3WPXA 2Z1UA 5HP8A 4LCKA 3N4ZA 3KE1A 5GONB 1W2BF 3JVHA 2QA4F 4BT5A 3FD5A 3HKDA 5HXZA 3RYHB 3P0ZA 2BTQB 5IYZB 4ZK7A 3S06A 4NUTA 3C8LA 3V7EA 2G9IA 4X3LA 2HS4A 3M1XA 3IKEA 4EI9A 3I56F 3ON1A 5JCOC 4G4VA 3LWQC 1VQLF 2Q1YA 3QTYA 2VAPA 4O4LB 1DT9A 1YITF 3CB2A 3CC7F 2QTPA 1GO0A 2P6YA 2UYJA 3WGKA 1Q82H 2H6LA 3CG6A 3RA5A 5MN6A 4FFBA 3LWOC 5IT9M 3AGKA 2CW4A 1XV2A 3MQWA 3NK6A 1QVGF 1IV2A 3PLAC 5HY4A 3CCMF 1CLIA 5LXTA 5CA0A 1VK3A 5KX5A 3MCQA 3VCZA 3J7AR 3RE3A 3VOAA 2VGMA 1IV4A 3FD6A 3VYUC 3WGNA 3WGLA 4B46A 3P10A 4BW0B 4I4TA 3LMEA 1FNJA 3TD4A 3MDOA 1JD1A 4WBNB 4E6EA 4DRXA 4BVQA 2AIZP 3P4EA 1FNKA 3S03A 4YJ2B 2ZVZA 3HTNA 2OTMA 5ITZA 1YJ9F 4I50B 2ZODA 1W40A 4TV8A 3WGJA 3CC2F 3E22A 3SIUA 4HNAB 5LYJA 3QHDA 4O4HA 3TD3A 3VI6A 2IAFA 5KMGB 3F0DA 2B33A 5FNVA 5JVDB 5EIBC 3CYPB 1NMUB 3N2GB 2HS3A 3IMPA 5IJ0A 1PXWA 3JAWB 3ESJA 3OBYA 4NQ3A 3GHZA 3D54A 5EWRA 1X7PA 1NQ3A 4RQOA 1VQOF 2I6DA 1JN1A 5CA1A 3WJRA 4TV9A 1Q86H 4X1YA 5MN5A 2H8CA 3V7QA 4O4JB 5FJ4C 1W581 2AIFA 3T80A 1QVFF 4EB6A 3VYSC 1VQ5F 3PAFA 3KJJA 1J7HA 4ZOLA 4C8EA 2CVLA 3O85A 1IV3A 1T0AA 3ZP4A 1W5EA 3CPWF 1ONIA 3CPQA 1CK2A 1SA0B 2VAMA 2V9YA 5LP6A 3HKDB 2AMTA 3RYCB 1ODEA 3WJQA 2OTLF 4BT3A 3UT5A 3JARB 1RA4A 5B8FA 5HY2A 2FGYA 4I55A 4X3MA 3VTIC 2RB9A 2KG4A 1U3LA 1X25A 5HY1A 5J2UA 1KNKA 3HWUA 2YXZA 2Z1EA 4ZI7B 1YJWF 1W41A 3OBWA 2UYNB 4IHJA 3G71F 1JFFA 1IPAA 3G4SF 2BTOA 2KTUA 5G4UC 3C9RA 3HKBB 1VQNF 5JH7A 4X20B 3FFMA 4B45A 5EYPB 2KGWA 1TUBB 2HVYD 1K8AH 2Z1FA 3MCAB 4ZHQB 2UYPA 1FFXA 2ALEA 4F6RB 3JALA 3U0OA 3CYQA 5LXTB 4U3JB 3VMFB 5BMVB 3BYQA 4C82A 3WJPA 3LWVC 5GANK 1OFUA 4O4IA 4BT6A 2VAWA 5JQGA 1H48A 1PF5A 2CSLA 4X1KA 3JCMM 4I4TB 1YQNA 3Q8HA 1UFYA 3HKCB 3IEQA 2ZVYA 2WALA 1W5BA 2GZLA 5LA6A 2EWCA 3GYQA 3K2XA 3JASA 5CB4B 3IKFA 5J2TB 4BVTA 1JJ2F 2OTJF 3CXCF 1U3PA 4YJ3A 5GONA 3E22B 4TZZA 2HP0B 3RYHA 2BTUA 2RHOA 5IYZA 1W55A 2I6RA 5LP6C 1SDSA 3SIVA 5LOVB 2YYEA 3OONA 4O2AB 3DC2A 1VQ9F 2CWJA 4BT7A 4ERHA 3E1YA 3N4YA 4U39A 2KTVA 3F0GA 3ELCA 3F6MA 2PHNA 5HP7A 1K73H 1W3EX 2RHHA 2CHSA 3CCQF 3WGMA 4C8IA 2ZOVA 4TUYB 4O4LA 3IEWA 3RYFB 3S0WA 3CCVF 3L7QA 3B6NA 5C8YA 1RQ2A 1GO1A 3V3TA 2ZF8A 4IIJA 1YI2F 2OHWA 1XRGA 3N2KB 4BVSA 3M4SA 2CHTA 4XCQA 3IR9A 1QU9A 1GZ0A 2IQQA 4X1IB 5A2QM 1N8RH 3JAKB 3LYBA 3HKEB 1T0KB 1XBIA 3E20B 3KHNA 2UZHA 1E7KA 4O2BB 4DXDA 5JCOA 3JATB 4LNUB 2VGNA 1TVKB 2N48A 5EZYB 5IJ9A 4WBNA 3RYIB 3CMEF 1QAHA 1QD9A 1M1KH 1DBFA 1M90H 4C4WC 2BO1A 3CCRF 3NVKE 4YJ2A 1VQKF 5EAZA 2LBWA 3R0PA 1OAPA 4I50A 1ZWZA 1VQVA 1W5AA 4EI8A 4HNAA 5JH7B 3CCEF 3CCUF 2DT4A 1Z5WA 4G4XA 2IG8A 5JVDA 5DCVA 3I3FA 4G4YA 3EORA 3ERNA 3N2GA 1KC8H 3VIUA 1KQSF 3CCSF 3JAWA 3J81M 5MN4A 2LCAA 2HP3A 3V4DA 1H47A 3K14A 3S02A 1KNJA 1KD1H 3C9TA 2H8EA 4BVRA 2DYYA 2JNBA 3ZOPA 4BY9D 4O4JA 3KJKA 4RHAA 2L26A 1YJNF 3HAXD 4FFBB 3F0EA 4NWOB 5HXUA 2FC3A 3FPIA 2Q1XA 4M8IA 4EI7A 5CA0B 1U43A 2NMUA 1JY8A 3ZP7A 5KX5B 1SA0A 4YJ3B 3M84A 1RLGA 3GTZA 1Q81H 3RYCA 4B62A 3J80M 3WXMB 3JARA 4C8GA 5GAPK 1CN7A 4B5CA 4DRXB 2QEXF 3CCJF 5EB0A 1W42A 1VQ8F 1W5FA 3K0TA 5EO3A 2MQEA 3DDNA 4ZI7A 4PWTA 2UYNA 5ITZB 3LDTA 3OW2F 3CC4F 5GIPC 4TV8B 2HS0A 2HRUA 2UYKA 5LYJB 1R1MA 4O4HB 3HKBA 5C8YB 3LWPC 4ZHWA 1RLUA 4X20A 4IIJB 1COMA 3QUWA 5FNVB 2LBTA 1VQ4F 4G4WA 1X52A 3C9UA 3I7TA 5EYPA 2RHLA 1TUBA 4C81A 4KWEA 5IJ0B 4ZHQA 1W57A 4F6RA 2RHJA
chains in the Genus database with same CATH topology
4EI9A 3E20B 3I56F 1RA4A 3ON1A 5HY2A 5GIOC 2FGYA 4X3MA 1E7KA 3D00A 3LWQC 1VQLF 2KG4A 2LBXA 5HY1A 2VGNA 5FLXM 1X7OA 3CMEF 1YJWF 1DT9A 1W41A 3OBWA 3CMAF 1YITF 1Q7YH 3CC7F 1M1KH 1GO0A 1M90H 3G71F 1IPAA 3G4SF 1Q82H 4C4WC 3CG6A 3RA5A 2BO1A 2KTUA 3CCRF 3NVKE 1NJIH 5G4UC 3NVIB 3LWOC 1VQKF 5IT9M 3AGKA 1VQNF 2LBWA 3NK6A 1VQPF 1ZWZA 2OZBA 3LWRC 3FFMA 1K9MH 1QVGF 4EI8A 3PLAC 5HY4A 3CCLF 3CCMF 3CCEF 2HVYD 1K8AH 3CCUF 3MCAB 2ALEA 5DCVA 3J7AR 2VGMA 1KC8H 1KQSF 3VMFB 3CCSF 3J81M 3LWVC 5GANK 4BW0B 3LFOA 5G4VC 3JCMM 5GINC 1KD1H 1YHQF 4BVRA 3G6EF 4BVQA 2JNBA 3JAMM 2CZWA 2WALA 4BY9D 3HJWC 1YJNF 3HAXD 5HXUA 5HWEA 3GYQA 1YJ9F 2FC3A 4BVTA 1W40A 3CC2F 3SIUA 1JJ2F 2OTJF 3CXCF 1VQ7F 3VI6A 4EI7A 1VQMF 4TZZA 1NMUB 1RLGA 1H7MA 1YIJF 1SDSA 1Q81H 2GLZA 1PXWA 3NK7A 3SIVA 3J80M 3I55F 3OBYA 1VQ9F 3WXMB 4NQ3A 3E1YA 2F9ZC 5EWRA 1X7PA 3N4YA 5GAPK 1CN7A 2KTVA 1VQOF 2I6DA 2QEXF 3CCJF 1K73H 1W42A 1Q86H 1W3EX 2QI2A 1VQ8F 3CCQF 5EO3A 3CD6F 3V7QA 5FJ4C 3CCVF 2AIFA 1QVFF 3NMUC 3OW2F 1VQ5F 3PAFA 1VQ6F 3RA6A 1S72F 5HY0A 3CC4F 1GO1A 5GIPC 3V3TA 1YI2F 2OHWA 4LCKA 3N4ZA 1W2BF 3O85A 3LWPC 4BVSA 2OTLF 2QA4F 5HXZA 1VQ4F 4XCQA 3CPQA 3IR9A 1CK2A 1X52A 3CPWF 1GZ0A 1N8RH 4NUTA 5A2QM 3V7EA 1T0KB 4X3LA 1XBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E20 B;  3I56 F;  1RA4 A;  3ON1 A;  5GIO C;  1E7K A;  4X3M A;  3LWQ C;  1VQL F;  2KG4 A;  2LBX A;  2VGN A;  5FLX M;  1X7O A;  3CME F;  1YJW F;  1DT9 A;  1W41 A;  3OBW A;  3CMA F;  1YIT F;  1Q7Y H;  3CC7 F;  1M1K H;  1GO0 A;  1M90 H;  3G71 F;  1IPA A;  3G4S F;  1Q82 H;  4C4W C;  3CG6 A;  3RA5 A;  2BO1 A;  2KTU A;  3CCR F;  3NVK E;  1NJI H;  5G4U C;  3NVI B;  3LWO C;  1VQK F;  5IT9 M;  3AGK A;  1VQN F;  2LBW A;  3NK6 A;  1VQP F;  1ZWZ A;  2OZB A;  3LWR C;  3FFM A;  1K9M H;  1QVG F;  3PLA C;  3CCL F;  3CCM F;  3CCE F;  2HVY D;  1K8A H;  3CCU F;  3MCA B;  2ALE A;  5DCV A;  3J7A R;  2VGM A;  1KC8 H;  1KQS F;  3VMF B;  3CCS F;  3J81 M;  3LWV C;  5GAN K;  4BW0 B;  3LFO A;  5G4V C;  3JCM M;  5GIN C;  1KD1 H;  1YHQ F;  3G6E F;  2JNB A;  3JAM M;  2CZW A;  2WAL A;  4BY9 D;  3HJW C;  1YJN F;  3HAX D;  3GYQ A;  1YJ9 F;  2FC3 A;  1W40 A;  3CC2 F;  3SIU A;  1JJ2 F;  2OTJ F;  3CXC F;  1VQ7 F;  3VI6 A;  1VQM F;  4TZZ A;  1NMU B;  1RLG A;  1H7M A;  1YIJ F;  1SDS A;  1Q81 H;  1PXW A;  3NK7 A;  3SIV A;  3J80 M;  3I55 F;  3OBY A;  1VQ9 F;  3WXM B;  3E1Y A;  5EWR A;  1X7P A;  3N4Y A;  5GAP K;  1CN7 A;  2KTV A;  1VQO F;  2I6D A;  2QEX F;  3CCJ F;  1K73 H;  1W42 A;  1Q86 H;  1W3E X;  2QI2 A;  1VQ8 F;  3CCQ F;  5EO3 A;  3CD6 F;  3V7Q A;  5FJ4 C;  3CCV F;  2AIF A;  1QVF F;  3NMU C;  3OW2 F;  1VQ5 F;  3PAF A;  1VQ6 F;  3RA6 A;  1S72 F;  3CC4 F;  1GO1 A;  5GIP C;  1YI2 F;  2OHW A;  4LCK A;  3N4Z A;  1W2B F;  3O85 A;  3LWP C;  2OTL F;  2QA4 F;  1VQ4 F;  3CPW F;  3CPQ A;  3IR9 A;  1CK2 A;  1X52 A;  1GZ0 A;  1N8R H;  4NUT A;  5A2Q M;  3V7E A;  1T0K B;  4X3L A;  1XBI A; 
#chains in the Genus database with same CATH topology
 3MBM A;  2HQS C;  4U3J A;  5GIO C;  3ZO8 A;  5BMV A;  3D00 A;  5CA1 B;  4TV9 B;  1XHO A;  2LBX A;  4X1Y B;  1W59 A;  5EB1 B;  5FLX M;  3K12 A;  1X7O A;  3S0Y A;  1UI9 A;  3CMA F;  4EB6 B;  1Q7Y H;  3HKC A;  5IJ9 B;  4G88 A;  2HRY A;  1RQ7 A;  2PMP A;  1SZQ A;  3D01 A;  4ZOL B;  1NJI H;  3NVI B;  2HX0 A;  1IV1 A;  1VQP F;  5CB4 A;  5J2T A;  3LWR C;  2OZB A;  1K9M H;  3VOB A;  1U40 A;  3CCL F;  5LP6 B;  2ZAU A;  2VXY A;  2HP0 A;  3UT5 B;  4ZHY B;  2Z1T A;  4I55 B;  5LOV A;  4O2A A;  3S0H A;  5J2U B;  3LFO A;  5G4V C;  2Z01 A;  5GIN C;  1YHQ F;  3VYT C;  3G6E F;  4IHJ B;  1JFF B;  1VHA A;  3JAM M;  4BT2 A;  2CZW A;  4TUY A;  3HJW C;  3RYF A;  1VH8 A;  4BT4 A;  1GX1 A;  2R75 1;  5HWE A;  5KMG A;  3FBA A;  1YGY A;  1Z5V A;  1VQ7 F;  3N2K A;  2W8B C;  4ZHV A;  1FFX B;  3VO8 A;  1VQM F;  3JAL B;  3TD5 A;  1H7M A;  2K1S A;  1YIJ F;  4X1I A;  2GLZ A;  3NK7 A;  4G4Z A;  3JAK A;  3I55 F;  3HKE A;  1FSZ A;  4O4I B;  5AVM A;  2F9Z C;  5JQG B;  2R6R 1;  3F0F A;  4X1K B;  4O2B A;  3KIZ A;  1Q8R A;  3JAT A;  2QI2 A;  4LNU A;  4R40 B;  3CD6 F;  1TVK A;  5EZY A;  5EIB D;  3RYI A;  3C9S A;  3NMU C;  5LA6 B;  1VQ6 F;  3JAS B;  3RA6 A;  3WPW A;  1S72 F;  5HY0 A;  2GVI A;  3WPX A;  2Z1U A;  5HP8 A;  4LCK A;  3N4Z A;  3KE1 A;  5GON B;  1W2B F;  3JVH A;  2QA4 F;  4BT5 A;  3FD5 A;  3HKD A;  5HXZ A;  3RYH B;  3P0Z A;  2BTQ B;  5IYZ B;  4ZK7 A;  3S06 A;  4NUT A;  3C8L A;  3V7E A;  2G9I A;  4X3L A;  2HS4 A;  3M1X A;  3IKE A;  4EI9 A;  3I56 F;  3ON1 A;  5JCO C;  4G4V A;  3LWQ C;  1VQL F;  2Q1Y A;  3QTY A;  2VAP A;  4O4L B;  1DT9 A;  1YIT F;  3CB2 A;  3CC7 F;  2QTP A;  1GO0 A;  2P6Y A;  2UYJ A;  3WGK A;  1Q82 H;  2H6L A;  3CG6 A;  3RA5 A;  5MN6 A;  4FFB A;  3LWO C;  5IT9 M;  3AGK A;  2CW4 A;  1XV2 A;  3MQW A;  3NK6 A;  1QVG F;  1IV2 A;  3PLA C;  5HY4 A;  3CCM F;  1CLI A;  5LXT A;  5CA0 A;  1VK3 A;  5KX5 A;  3MCQ A;  3VCZ A;  3J7A R;  3RE3 A;  3VOA A;  2VGM A;  1IV4 A;  3FD6 A;  3VYU C;  3WGN A;  3WGL A;  4B46 A;  3P10 A;  4BW0 B;  4I4T A;  3LME A;  1FNJ A;  3TD4 A;  3MDO A;  1JD1 A;  4WBN B;  4E6E A;  4DRX A;  4BVQ A;  2AIZ P;  3P4E A;  1FNK A;  3S03 A;  4YJ2 B;  2ZVZ A;  3HTN A;  2OTM A;  5ITZ A;  1YJ9 F;  4I50 B;  2ZOD A;  1W40 A;  4TV8 A;  3WGJ A;  3CC2 F;  3E22 A;  3SIU A;  4HNA B;  5LYJ A;  3QHD A;  4O4H A;  3TD3 A;  3VI6 A;  2IAF A;  5KMG B;  3F0D A;  2B33 A;  5FNV A;  5JVD B;  5EIB C;  3CYP B;  1NMU B;  3N2G B;  2HS3 A;  3IMP A;  5IJ0 A;  1PXW A;  3JAW B;  3ESJ A;  3OBY A;  4NQ3 A;  3GHZ A;  3D54 A;  5EWR A;  1X7P A;  1NQ3 A;  4RQO A;  1VQO F;  2I6D A;  1JN1 A;  5CA1 A;  3WJR A;  4TV9 A;  1Q86 H;  4X1Y A;  5MN5 A;  2H8C A;  3V7Q A;  4O4J B;  5FJ4 C;  1W58 1;  2AIF A;  3T80 A;  1QVF F;  4EB6 A;  3VYS C;  1VQ5 F;  3PAF A;  3KJJ A;  1J7H A;  4ZOL A;  4C8E A;  2CVL A;  3O85 A;  1IV3 A;  1T0A A;  3ZP4 A;  1W5E A;  3CPW F;  1ONI A;  3CPQ A;  1CK2 A;  1SA0 B;  2VAM A;  2V9Y A;  5LP6 A;  3HKD B;  2AMT A;  3RYC B;  1ODE A;  3WJQ A;  2OTL F;  4BT3 A;  3UT5 A;  3JAR B;  1RA4 A;  5B8F A;  5HY2 A;  2FGY A;  4I55 A;  4X3M A;  3VTI C;  2RB9 A;  2KG4 A;  1U3L A;  1X25 A;  5HY1 A;  5J2U A;  1KNK A;  3HWU A;  2YXZ A;  2Z1E A;  4ZI7 B;  1YJW F;  1W41 A;  3OBW A;  2UYN B;  4IHJ A;  3G71 F;  1JFF A;  1IPA A;  3G4S F;  2BTO A;  2KTU A;  5G4U C;  3C9R A;  3HKB B;  1VQN F;  5JH7 A;  4X20 B;  3FFM A;  4B45 A;  5EYP B;  2KGW A;  1TUB B;  2HVY D;  1K8A H;  2Z1F A;  3MCA B;  4ZHQ B;  2UYP A;  1FFX A;  2ALE A;  4F6R B;  3JAL A;  3U0O A;  3CYQ A;  5LXT B;  4U3J B;  3VMF B;  5BMV B;  3BYQ A;  4C82 A;  3WJP A;  3LWV C;  5GAN K;  1OFU A;  4O4I A;  4BT6 A;  2VAW A;  5JQG A;  1H48 A;  1PF5 A;  2CSL A;  4X1K A;  3JCM M;  4I4T B;  1YQN A;  3Q8H A;  1UFY A;  3HKC B;  3IEQ A;  2ZVY A;  2WAL A;  1W5B A;  2GZL A;  5LA6 A;  2EWC A;  3GYQ A;  3K2X A;  3JAS A;  5CB4 B;  3IKF A;  5J2T B;  4BVT A;  1JJ2 F;  2OTJ F;  3CXC F;  1U3P A;  4YJ3 A;  5GON A;  3E22 B;  4TZZ A;  2HP0 B;  3RYH A;  2BTU A;  2RHO A;  5IYZ A;  1W55 A;  2I6R A;  5LP6 C;  1SDS A;  3SIV A;  5LOV B;  2YYE A;  3OON A;  4O2A B;  3DC2 A;  1VQ9 F;  2CWJ A;  4BT7 A;  4ERH A;  3E1Y A;  3N4Y A;  4U39 A;  2KTV A;  3F0G A;  3ELC A;  3F6M A;  2PHN A;  5HP7 A;  1K73 H;  1W3E X;  2RHH A;  2CHS A;  3CCQ F;  3WGM A;  4C8I A;  2ZOV A;  4TUY B;  4O4L A;  3IEW A;  3RYF B;  3S0W A;  3CCV F;  3L7Q A;  3B6N A;  5C8Y A;  1RQ2 A;  1GO1 A;  3V3T A;  2ZF8 A;  4IIJ A;  1YI2 F;  2OHW A;  1XRG A;  3N2K B;  4BVS A;  3M4S A;  2CHT A;  4XCQ A;  3IR9 A;  1QU9 A;  1GZ0 A;  2IQQ A;  4X1I B;  5A2Q M;  1N8R H;  3JAK B;  3LYB A;  3HKE B;  1T0K B;  1XBI A;  3E20 B;  3KHN A;  2UZH A;  1E7K A;  4O2B B;  4DXD A;  5JCO A;  3JAT B;  4LNU B;  2VGN A;  1TVK B;  2N48 A;  5EZY B;  5IJ9 A;  4WBN A;  3RYI B;  3CME F;  1QAH A;  1QD9 A;  1M1K H;  1DBF A;  1M90 H;  4C4W C;  2BO1 A;  3CCR F;  3NVK E;  4YJ2 A;  1VQK F;  5EAZ A;  2LBW A;  3R0P A;  1OAP A;  4I50 A;  1ZWZ A;  1VQV A;  1W5A A;  4EI8 A;  4HNA A;  5JH7 B;  3CCE F;  3CCU F;  2DT4 A;  1Z5W A;  4G4X A;  2IG8 A;  5JVD A;  5DCV A;  3I3F A;  4G4Y A;  3EOR A;  3ERN A;  3N2G A;  1KC8 H;  3VIU A;  1KQS F;  3CCS F;  3JAW A;  3J81 M;  5MN4 A;  2LCA A;  2HP3 A;  3V4D A;  1H47 A;  3K14 A;  3S02 A;  1KNJ A;  1KD1 H;  3C9T A;  2H8E A;  4BVR A;  2DYY A;  2JNB A;  3ZOP A;  4BY9 D;  4O4J A;  3KJK A;  4RHA A;  2L26 A;  1YJN F;  3HAX D;  4FFB B;  3F0E A;  4NWO B;  5HXU A;  2FC3 A;  3FPI A;  2Q1X A;  4M8I A;  4EI7 A;  5CA0 B;  1U43 A;  2NMU A;  1JY8 A;  3ZP7 A;  5KX5 B;  1SA0 A;  4YJ3 B;  3M84 A;  1RLG A;  3GTZ A;  1Q81 H;  3RYC A;  4B62 A;  3J80 M;  3WXM B;  3JAR A;  4C8G A;  5GAP K;  1CN7 A;  4B5C A;  4DRX B;  2QEX F;  3CCJ F;  5EB0 A;  1W42 A;  1VQ8 F;  1W5F A;  3K0T A;  5EO3 A;  2MQE A;  3DDN A;  4ZI7 A;  4PWT A;  2UYN A;  5ITZ B;  3LDT A;  3OW2 F;  3CC4 F;  5GIP C;  4TV8 B;  2HS0 A;  2HRU A;  2UYK A;  5LYJ B;  1R1M A;  4O4H B;  3HKB A;  5C8Y B;  3LWP C;  4ZHW A;  1RLU A;  4X20 A;  4IIJ B;  1COM A;  3QUW A;  5FNV B;  2LBT A;  1VQ4 F;  4G4W A;  1X52 A;  3C9U A;  3I7T A;  5EYP A;  2RHL A;  1TUB A;  4C81 A;  4KWE A;  5IJ0 B;  4ZHQ A;  1W57 A;  4F6R A;  2RHJ A; 
#chains in the Genus database with same CATH homology
 4EI9 A;  3E20 B;  3I56 F;  1RA4 A;  3ON1 A;  5HY2 A;  5GIO C;  2FGY A;  4X3M A;  1E7K A;  3D00 A;  3LWQ C;  1VQL F;  2KG4 A;  2LBX A;  5HY1 A;  2VGN A;  5FLX M;  1X7O A;  3CME F;  1YJW F;  1DT9 A;  1W41 A;  3OBW A;  3CMA F;  1YIT F;  1Q7Y H;  3CC7 F;  1M1K H;  1GO0 A;  1M90 H;  3G71 F;  1IPA A;  3G4S F;  1Q82 H;  4C4W C;  3CG6 A;  3RA5 A;  2BO1 A;  2KTU A;  3CCR F;  3NVK E;  1NJI H;  5G4U C;  3NVI B;  3LWO C;  1VQK F;  5IT9 M;  3AGK A;  1VQN F;  2LBW A;  3NK6 A;  1VQP F;  1ZWZ A;  2OZB A;  3LWR C;  3FFM A;  1K9M H;  1QVG F;  4EI8 A;  3PLA C;  5HY4 A;  3CCL F;  3CCM F;  3CCE F;  2HVY D;  1K8A H;  3CCU F;  3MCA B;  2ALE A;  5DCV A;  3J7A R;  2VGM A;  1KC8 H;  1KQS F;  3VMF B;  3CCS F;  3J81 M;  3LWV C;  5GAN K;  4BW0 B;  3LFO A;  5G4V C;  3JCM M;  5GIN C;  1KD1 H;  1YHQ F;  4BVR A;  3G6E F;  4BVQ A;  2JNB A;  3JAM M;  2CZW A;  2WAL A;  4BY9 D;  3HJW C;  1YJN F;  3HAX D;  5HXU A;  5HWE A;  3GYQ A;  1YJ9 F;  2FC3 A;  4BVT A;  1W40 A;  3CC2 F;  3SIU A;  1JJ2 F;  2OTJ F;  3CXC F;  1VQ7 F;  3VI6 A;  4EI7 A;  1VQM F;  4TZZ A;  1NMU B;  1RLG A;  1H7M A;  1YIJ F;  1SDS A;  1Q81 H;  2GLZ A;  1PXW A;  3NK7 A;  3SIV A;  3J80 M;  3I55 F;  3OBY A;  1VQ9 F;  3WXM B;  4NQ3 A;  3E1Y A;  2F9Z C;  5EWR A;  1X7P A;  3N4Y A;  5GAP K;  1CN7 A;  2KTV A;  1VQO F;  2I6D A;  2QEX F;  3CCJ F;  1K73 H;  1W42 A;  1Q86 H;  1W3E X;  2QI2 A;  1VQ8 F;  3CCQ F;  5EO3 A;  3CD6 F;  3V7Q A;  5FJ4 C;  3CCV F;  2AIF A;  1QVF F;  3NMU C;  3OW2 F;  1VQ5 F;  3PAF A;  1VQ6 F;  3RA6 A;  1S72 F;  5HY0 A;  3CC4 F;  1GO1 A;  5GIP C;  3V3T A;  1YI2 F;  2OHW A;  4LCK A;  3N4Z A;  1W2B F;  3O85 A;  3LWP C;  4BVS A;  2OTL F;  2QA4 F;  5HXZ A;  1VQ4 F;  4XCQ A;  3CPQ A;  3IR9 A;  1CK2 A;  1X52 A;  3CPW F;  1GZ0 A;  1N8R H;  4NUT A;  5A2Q M;  3V7E A;  1T0K B;  4X3L A;  1XBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...