1M1KH

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m1kH00
3CCRF 2AIFA 3FFMA 3CCJF 5GIPC 3J80M 1W2BF 1X52A 2OTLF 5G4VC 1QVGF 1K8AH 5DCVA 3CG6A 2ALEA 3NVIB 1PXWA 5EO3A 1K9MH 3PAFA 4X3MA 4X3LA 1E7KA 4BY9D 1VQOF 1GO0A 3LWQC 3N4ZA 3JCMM 3SIUA 3VMFB 5G4UC 3AGKA 1KQSF 1RLGA 1VQMF 1W40A 1X7OA 1VQNF 3J7AR 3MCAB 4NUTA 3V7QA 2OZBA 1JJ2F 3E1YA 3VI6A 3CCUF 3NMUC 5IT9M 1Q81H 1K73H 1W3EX 1YHQF 2VGNA 1XBIA 3GYQA 2KG4A 1YJNF 3ON1A 1VQ7F 1VQPF 3CPWF 5GINC 3CCQF 2BO1A 2LBXA 4TZZA 3I56F 2LBWA 2QEXF 3CD6F 3LWVC 1VQKF 1CN7A 3CC4F 2VGMA 3NVKE 1VQ8F 3HAXD 3WXMB 3CCMF 3CMAF 1YJ9F 3LWRC 2QI2A 1VQ4F 5GAPK 3V7EA 3CMEF 1RA4A 1YI2F 2QA4F 1Q86H 3CC2F 1ZWZA 3JAMM 3N4YA 3NK6A 5FLXM 1YIJF 3RA5A 3LWPC 3CC7F 3PLAC 2JNBA 1DT9A 2OHWA 3J81M 5GANK 3OW2F 1VQLF 1M90H 3NK7A 2CZWA 1VQ9F 3SIVA 5FJ4C 4LCKA 2KTVA 2I6DA 1M1KH 4BW0B 3LFOA 1W42A 3CCEF 1X7PA 1GZ0A 2OTJF 3CCLF 1N8RH 1CK2A 3CXCF 2FC3A 5A2QM 1VQ6F 2HVYD 1Q7YH 1S72F 1YITF 1T0KB 3HJWC 3E20B 3G71F 1IPAA 1YJWF 3OBWA 1Q82H 1KD1H 1SDSA 3O85A 3CPQA 5EWRA 2WALA 4C4WC 3RA6A 1H7MA 5GIOC 3CCVF 3IR9A 1NMUB 1QVFF 3G4SF 2KTUA 1NJIH 3LWOC 3I55F 3CCSF 1GO1A 3OBYA 1W41A 1VQ5F 3G6EF 1KC8H
chains in the Genus database with same CATH superfamily
1UI9A 5CA1B 2W8BC 3M4SA 3HKEB 3HKBA 5LA6A 4X1IA 2UYPA 3EORA 3CG6A 1U3PA 2IG8A 5IYZB 5MN4A 1Z5WA 3RYFB 4B45A 4ZOLA 1U3LA 3JAKB 4ERHA 5KX5A 2Z1UA 5KMGA 1KQSF 3MCQA 5LXTA 1JD1A 1VQMF 2ZOVA 3K2XA 3F6MA 4BVSA 2H8CA 1XV2A 3KJJA 4BT2A 3CCUF 3KE1A 1QD9A 1Q81H 1YHQF 2DT4A 5C8YA 3P10A 5HY0A 1W57A 2BTQB 3ON1A 3D01A 2CHTA 2YXZA 1TVKB 2R6R1 3CCQF 2N48A 2F9ZC 4TUYA 5EYPA 4TV8A 2LBWA 3CB2A 2NMUA 1W5AA 3JASA 4RQOA 3S0WA 2GVIA 4DRXA 3WPWA 3HAXD 4HNAA 1YJ9F 5EZYB 4BT3A 2QI2A 4X1KB 3V7EA 3K12A 3V4DA 2HRYA 4B62A 5CA0A 1JFFB 4TV8B 3NK6A 3F0FA 4O4IB 2ZVZA 2RHHA 3M1XA 5J2TB 2OHWA 3J81M 3ERNA 1Q8RA 3ZO8A 1KNKA 1DBFA 3BYQA 5IJ0B 3SIVA 5C8YB 1OAPA 5FJ4C 4EB6A 2CHSA 2K1SA 5BMVA 3DDNA 1GZ0A 3CCLF 4BT4A 1W5FA 3CXCF 2FC3A 3S0HA 3JAKA 5KX5B 1T0KB 3S03A 2HS3A 3OONA 3LDTA 4IHJA 4U3JB 4YJ2B 5LOVB 4O4JB 3RYIA 3K0TA 1SDSA 3IMPA 1IV4A 3WJRA 3S06A 3CPQA 5J2UA 4C4WC 2G9IA 1H7MA 2PHNA 3TD3A 2AIZP 3I7TA 3UT5B 4BVRA 3RYHB 4F6RA 4C82A 5J2UB 2VAPA 4O4HB 3QHDA 1TUBB 3LYBA 2V9YA 2LCAA 4I55B 3HKCB 2DYYA 4BVQA 3CCRF 5CB4A 3FFMA 3VCZA 3CCJF 4B46A 2HP0B 2L26A 5LP6B 2UYNB 2OTLF 2AMTA 3KIZA 4DXDA 1PXWA 1Z5VA 5JVDB 4I50A 4ZHYB 4X3MA 3CYPB 3V3TA 4X1YA 1YQNA 1H48A 1VQOF 4BY9D 3KHNA 3IEQA 3MDOA 5EB0A 3SIUA 3WGJA 2OTMA 3IKFA 4ZHWA 1W40A 1X7OA 2BTOA 3C9SA 3FD5A 5JQGB 1U43A 2I6RA 1JJ2F 3E1YA 5ITZB 1IV3A 4ZI7A 4X20A 5B8FA 5JQGA 3HKEA 2VGNA 5LA6B 3GYQA 1IV1A 3ELCA 2RHJA 5GONA 5JCOA 4NWOB 4FFBA 4O2AA 3C9UA 3F0GA 3DC2A 3WGLA 5MN6A 3VOAA 2QTPA 4O4LB 5GINC 4TV9A 2BO1A 4BVTA 2BTUA 3L7QA 1PF5A 3JARB 3E22B 2QEXF 3FBAA 3FPIA 3VOBA 1TVKA 3N2KB 2VGMA 1J7HA 2UYNA 3CCMF 1VQ4F 1W581 4IIJB 4X20B 3CMEF 1RA4A 3F0DA 5EIBD 4ZI7B 1YI2F 3P4EA 4BT6A 4ZHQB 1KNJA 4LNUB 3RA5A 3LWPC 3CC7F 2H8EA 3PLAC 2JNBA 3VYSC 5FNVB 4O4JA 4G4ZA 4U3JA 3GHZA 3RYCA 1R1MA 3OW2F 2KGWA 1M90H 3QUWA 2CZWA 1VQ9F 3RE3A 2I6DA 2KTVA 2ZVYA 3B6NA 3U0OA 3LFOA 1W42A 3TD5A 4EB6B 3HKDA 5HXZA 5LP6A 1N8RH 5LYJB 5CB4B 1Q7YH 1S72F 5IJ9B 1YITF 4YJ3B 3HJWC 1IPAA 1W5BA 1YJWF 3C9RA 4C8GA 4F6RB 3RYHA 3RA6A 4LNUA 3VIUA 4I4TB 1NMUB 2Q1XA 5CA0B 1JN1A 1QVFF 3I55F 2CW4A 2RHOA 4IIJA 3OBYA 1W41A 4EI9A 1VQ5F 5MN5A 5EZYA 3VYTC 5EB1B 1W55A 5GIPC 3N2GA 1X52A 5G4VC 1QVGF 5HXUA 5DCVA 1GX1A 2HRUA 1VQVA 5EO3A 1K9MH 4TUYB 4O2BB 4X3LA 1E7KA 2YYEA 3WPXA 3N4ZA 4FFBB 3JCMM 3VMFB 5J2TA 1RLGA 3J7AR 5LYJA 1CLIA 1X25A 3MCAB 5HP8A 2UYKA 3HKDB 3V7QA 2OZBA 4EI8A 3VI6A 5HY4A 4B5CA 1SZQA 2Q1YA 5IT9M 1K73H 3JAWA 3D00A 1XBIA 1XHOA 2KG4A 5KMGB 1VQ7F 1VQPF 4ZOLB 1FNJA 2GZLA 3JASB 2IQQA 4I50B 3VO8A 5HWEA 2LBXA 4TZZA 3CD6F 1RLUA 4R40B 3VYUC 1VQKF 2RB9A 5HY1A 1VHAA 4C8EA 4X1IB 4G4YA 2HP0A 2P6YA 2HS4A 4BT5A 3WJQA 2CWJA 3D54A 3LWRC 4WBNA 5GAPK 3M84A 1TUBA 4O4HA 3TD4A 3C9TA 3N2KA 2QA4F 5LP6C 1ZWZA 5EAZA 3UT5A 5FLXM 5JH7A 3VTIC 5LXTB 3CYQA 1DT9A 4G4XA 1XRGA 5GANK 3ZP7A 3MQWA 1SA0A 4G4WA 1QAHA 2UYJA 3WGNA 4BW0B 3CCEF 1X7PA 1H47A 2OTJF 3R0PA 2GLZA 1VQ6F 5AVMA 5EIBC 3QTYA 1FFXA 4E6EA 2CVLA 3OBWA 1KD1H 4O2BA 3O85A 1YGYA 1U40A 4M8IA 5EWRA 5GIOC 4O4IA 2Z1TA 2PMPA 3E22A 3CCVF 5JVDA 2RHLA 3IKEA 3JALB 2UZHA 3P0ZA 4ZK7A 2R751 3G4SF 4TV9B 3CCSF 4EI7A 1GO1A 1QU9A 3IEWA 3N2GB 2Z1EA 2VAMA 3WGMA 1KC8H 3JATB 5GONB 4C8IA 4XCQA 2AIFA 3HKCA 1NQ3A 1FSZA 1W2BF 3J80M 2LBTA 3HTNA 1COMA 1K8AH 5ITZA 2ALEA 3NVIB 1VH8A 2B33A 5HP7A 3PAFA 4KWEA 1GO0A 3RYIB 3LWQC 3F0EA 2VXYA 4X1YB 3HWUA 5G4UC 2FGYA 5IJ9A 3AGKA 2CSLA 5JH7B 1VQNF 3ESJA 4NUTA 5BMVB 3JVHA 3NMUC 2MQEA 1W3EX 1ONIA 5IJ0A 1YJNF 4I55A 3S0YA 4G88A 3KJKA 3RYFA 3CPWF 2H6LA 2ZAUA 4U39A 5FNVA 4C81A 4PWTA 1UFYA 1FNKA 3WJPA 2ZODA 4I4TA 3I56F 1JFFA 3LWVC 1CN7A 1JY8A 3CC4F 3FD6A 1RQ7A 3I3FA 3NVKE 4BT7A 3HKBB 4RHAA 2HS0A 4IHJB 4X1KA 5LOVA 3WXMB 4YJ2A 2Z1FA 3CMAF 5CA1A 4HNAB 3JAWB 2HX0A 1Q86H 3Q8HA 3CC2F 1ODEA 3JAMM 3N4YA 3JARA 1YIJF 3ZP4A 2EWCA 3K14A 5JCOC 2Z01A 3RYCB 1VK3A 4O2AB 1VQLF 3NK7A 4ZHVA 3MBMA 1W59A 4LCKA 4ZHQA 1M1KH 5HY2A 3GTZA 1OFUA 4NQ3A 1CK2A 3T80A 2IAFA 5A2QM 1SA0B 2HVYD 3ZOPA 3JATA 1IV2A 3E20B 3G71F 1Q82H 4DRXB 2HQSC 2WALA 3JALA 1T0AA 1W5EA 5IYZA 3IR9A 3LMEA 4G4VA 2ZF8A 5EYPB 1RQ2A 3S02A 2HP3A 2KTUA 1NJIH 2VAWA 3LWOC 4O4LA 3C8LA 3WGKA 1FFXB 4WBNB 3G6EF 1VQ8F 4YJ3A
chains in the Genus database with same CATH topology
3CCRF 4XCQA 2AIFA 3FFMA 3CCJF 5GIPC 3J80M 1W2BF 1X52A 2OTLF 5G4VC 1QVGF 1K8AH 5HXUA 5DCVA 3CG6A 2ALEA 3NVIB 1PXWA 5EO3A 1K9MH 3PAFA 4X3MA 4X3LA 3V3TA 1E7KA 4BY9D 1VQOF 1GO0A 3LWQC 3N4ZA 3JCMM 3SIUA 3VMFB 5G4UC 2FGYA 3AGKA 1KQSF 1RLGA 1VQMF 1W40A 1X7OA 1VQNF 3J7AR 3MCAB 4NUTA 3V7QA 4BVSA 2OZBA 4EI8A 1JJ2F 3E1YA 3VI6A 5HY4A 3CCUF 3NMUC 5IT9M 1Q81H 1K73H 1W3EX 1YHQF 3D00A 2VGNA 5HY0A 1XBIA 3GYQA 2KG4A 1YJNF 3ON1A 1VQ7F 1VQPF 3CPWF 5GINC 3CCQF 2BO1A 4BVTA 2F9ZC 5HWEA 2LBXA 4TZZA 3I56F 2LBWA 2QEXF 3CD6F 3LWVC 1VQKF 1CN7A 3CC4F 2VGMA 5HY1A 3NVKE 1VQ8F 3HAXD 3WXMB 3CCMF 3CMAF 1YJ9F 3LWRC 2QI2A 1VQ4F 5GAPK 3V7EA 3CMEF 1RA4A 1YI2F 2QA4F 1Q86H 3CC2F 1ZWZA 3JAMM 3N4YA 3NK6A 5FLXM 1YIJF 3RA5A 3LWPC 3CC7F 3PLAC 2JNBA 1DT9A 2OHWA 3J81M 5GANK 3OW2F 1VQLF 1M90H 3NK7A 2CZWA 1VQ9F 3SIVA 5FJ4C 4LCKA 2KTVA 2I6DA 1M1KH 4BW0B 5HY2A 3LFOA 1W42A 3CCEF 1X7PA 1GZ0A 5HXZA 2OTJF 3CCLF 1N8RH 4NQ3A 1CK2A 3CXCF 2FC3A 5A2QM 2GLZA 1VQ6F 2HVYD 1Q7YH 1S72F 1YITF 1T0KB 3HJWC 3E20B 3G71F 1IPAA 1YJWF 3OBWA 1Q82H 1KD1H 1SDSA 3O85A 3CPQA 5EWRA 2WALA 4C4WC 3RA6A 1H7MA 5GIOC 3CCVF 3IR9A 1NMUB 4BVRA 1QVFF 3G4SF 2KTUA 1NJIH 3LWOC 3I55F 3CCSF 4EI7A 1GO1A 3OBYA 1W41A 4EI9A 1VQ5F 3G6EF 1KC8H 4BVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR F;  2AIF A;  3FFM A;  3CCJ F;  5GIP C;  3J80 M;  1W2B F;  1X52 A;  2OTL F;  5G4V C;  1QVG F;  1K8A H;  5DCV A;  3CG6 A;  2ALE A;  3NVI B;  1PXW A;  5EO3 A;  1K9M H;  3PAF A;  4X3M A;  4X3L A;  1E7K A;  4BY9 D;  1VQO F;  1GO0 A;  3LWQ C;  3N4Z A;  3JCM M;  3SIU A;  3VMF B;  5G4U C;  3AGK A;  1KQS F;  1RLG A;  1VQM F;  1W40 A;  1X7O A;  1VQN F;  3J7A R;  3MCA B;  4NUT A;  3V7Q A;  2OZB A;  1JJ2 F;  3E1Y A;  3VI6 A;  3CCU F;  3NMU C;  5IT9 M;  1Q81 H;  1K73 H;  1W3E X;  1YHQ F;  2VGN A;  1XBI A;  3GYQ A;  2KG4 A;  1YJN F;  3ON1 A;  1VQ7 F;  1VQP F;  3CPW F;  5GIN C;  3CCQ F;  2BO1 A;  2LBX A;  4TZZ A;  3I56 F;  2LBW A;  2QEX F;  3CD6 F;  3LWV C;  1VQK F;  1CN7 A;  3CC4 F;  2VGM A;  3NVK E;  1VQ8 F;  3HAX D;  3WXM B;  3CCM F;  3CMA F;  1YJ9 F;  3LWR C;  2QI2 A;  1VQ4 F;  5GAP K;  3V7E A;  3CME F;  1RA4 A;  1YI2 F;  2QA4 F;  1Q86 H;  3CC2 F;  1ZWZ A;  3JAM M;  3N4Y A;  3NK6 A;  5FLX M;  1YIJ F;  3RA5 A;  3LWP C;  3CC7 F;  3PLA C;  2JNB A;  1DT9 A;  2OHW A;  3J81 M;  5GAN K;  3OW2 F;  1VQL F;  1M90 H;  3NK7 A;  2CZW A;  1VQ9 F;  3SIV A;  5FJ4 C;  4LCK A;  2KTV A;  2I6D A;  1M1K H;  4BW0 B;  3LFO A;  1W42 A;  3CCE F;  1X7P A;  1GZ0 A;  2OTJ F;  3CCL F;  1N8R H;  1CK2 A;  3CXC F;  2FC3 A;  5A2Q M;  1VQ6 F;  2HVY D;  1Q7Y H;  1S72 F;  1YIT F;  1T0K B;  3HJW C;  3E20 B;  3G71 F;  1IPA A;  1YJW F;  3OBW A;  1Q82 H;  1KD1 H;  1SDS A;  3O85 A;  3CPQ A;  5EWR A;  2WAL A;  4C4W C;  3RA6 A;  1H7M A;  5GIO C;  3CCV F;  3IR9 A;  1NMU B;  1QVF F;  3G4S F;  2KTU A;  1NJI H;  3LWO C;  3I55 F;  3CCS F;  1GO1 A;  3OBY A;  1W41 A;  1VQ5 F;  3G6E F;  1KC8 H; 
#chains in the Genus database with same CATH topology
 1UI9 A;  5CA1 B;  2W8B C;  3M4S A;  3HKE B;  3HKB A;  5LA6 A;  4X1I A;  2UYP A;  3EOR A;  3CG6 A;  1U3P A;  2IG8 A;  5IYZ B;  5MN4 A;  1Z5W A;  3RYF B;  4B45 A;  4ZOL A;  1U3L A;  3JAK B;  4ERH A;  5KX5 A;  2Z1U A;  5KMG A;  1KQS F;  3MCQ A;  5LXT A;  1JD1 A;  1VQM F;  2ZOV A;  3K2X A;  3F6M A;  4BVS A;  2H8C A;  1XV2 A;  3KJJ A;  4BT2 A;  3CCU F;  3KE1 A;  1QD9 A;  1Q81 H;  1YHQ F;  2DT4 A;  5C8Y A;  3P10 A;  5HY0 A;  1W57 A;  2BTQ B;  3ON1 A;  3D01 A;  2CHT A;  2YXZ A;  1TVK B;  2R6R 1;  3CCQ F;  2N48 A;  2F9Z C;  4TUY A;  5EYP A;  4TV8 A;  2LBW A;  3CB2 A;  2NMU A;  1W5A A;  3JAS A;  4RQO A;  3S0W A;  2GVI A;  4DRX A;  3WPW A;  3HAX D;  4HNA A;  1YJ9 F;  5EZY B;  4BT3 A;  2QI2 A;  4X1K B;  3V7E A;  3K12 A;  3V4D A;  2HRY A;  4B62 A;  5CA0 A;  1JFF B;  4TV8 B;  3NK6 A;  3F0F A;  4O4I B;  2ZVZ A;  2RHH A;  3M1X A;  5J2T B;  2OHW A;  3J81 M;  3ERN A;  1Q8R A;  3ZO8 A;  1KNK A;  1DBF A;  3BYQ A;  5IJ0 B;  3SIV A;  5C8Y B;  1OAP A;  5FJ4 C;  4EB6 A;  2CHS A;  2K1S A;  5BMV A;  3DDN A;  1GZ0 A;  3CCL F;  4BT4 A;  1W5F A;  3CXC F;  2FC3 A;  3S0H A;  3JAK A;  5KX5 B;  1T0K B;  3S03 A;  2HS3 A;  3OON A;  3LDT A;  4IHJ A;  4U3J B;  4YJ2 B;  5LOV B;  4O4J B;  3RYI A;  3K0T A;  1SDS A;  3IMP A;  1IV4 A;  3WJR A;  3S06 A;  3CPQ A;  5J2U A;  4C4W C;  2G9I A;  1H7M A;  2PHN A;  3TD3 A;  2AIZ P;  3I7T A;  3UT5 B;  4BVR A;  3RYH B;  4F6R A;  4C82 A;  5J2U B;  2VAP A;  4O4H B;  3QHD A;  1TUB B;  3LYB A;  2V9Y A;  2LCA A;  4I55 B;  3HKC B;  2DYY A;  4BVQ A;  3CCR F;  5CB4 A;  3FFM A;  3VCZ A;  3CCJ F;  4B46 A;  2HP0 B;  2L26 A;  5LP6 B;  2UYN B;  2OTL F;  2AMT A;  3KIZ A;  4DXD A;  1PXW A;  1Z5V A;  5JVD B;  4I50 A;  4ZHY B;  4X3M A;  3CYP B;  3V3T A;  4X1Y A;  1YQN A;  1H48 A;  1VQO F;  4BY9 D;  3KHN A;  3IEQ A;  3MDO A;  5EB0 A;  3SIU A;  3WGJ A;  2OTM A;  3IKF A;  4ZHW A;  1W40 A;  1X7O A;  2BTO A;  3C9S A;  3FD5 A;  5JQG B;  1U43 A;  2I6R A;  1JJ2 F;  3E1Y A;  5ITZ B;  1IV3 A;  4ZI7 A;  4X20 A;  5B8F A;  5JQG A;  3HKE A;  2VGN A;  5LA6 B;  3GYQ A;  1IV1 A;  3ELC A;  2RHJ A;  5GON A;  5JCO A;  4NWO B;  4FFB A;  4O2A A;  3C9U A;  3F0G A;  3DC2 A;  3WGL A;  5MN6 A;  3VOA A;  2QTP A;  4O4L B;  5GIN C;  4TV9 A;  2BO1 A;  4BVT A;  2BTU A;  3L7Q A;  1PF5 A;  3JAR B;  3E22 B;  2QEX F;  3FBA A;  3FPI A;  3VOB A;  1TVK A;  3N2K B;  2VGM A;  1J7H A;  2UYN A;  3CCM F;  1VQ4 F;  1W58 1;  4IIJ B;  4X20 B;  3CME F;  1RA4 A;  3F0D A;  5EIB D;  4ZI7 B;  1YI2 F;  3P4E A;  4BT6 A;  4ZHQ B;  1KNJ A;  4LNU B;  3RA5 A;  3LWP C;  3CC7 F;  2H8E A;  3PLA C;  2JNB A;  3VYS C;  5FNV B;  4O4J A;  4G4Z A;  4U3J A;  3GHZ A;  3RYC A;  1R1M A;  3OW2 F;  2KGW A;  1M90 H;  3QUW A;  2CZW A;  1VQ9 F;  3RE3 A;  2I6D A;  2KTV A;  2ZVY A;  3B6N A;  3U0O A;  3LFO A;  1W42 A;  3TD5 A;  4EB6 B;  3HKD A;  5HXZ A;  5LP6 A;  1N8R H;  5LYJ B;  5CB4 B;  1Q7Y H;  1S72 F;  5IJ9 B;  1YIT F;  4YJ3 B;  3HJW C;  1IPA A;  1W5B A;  1YJW F;  3C9R A;  4C8G A;  4F6R B;  3RYH A;  3RA6 A;  4LNU A;  3VIU A;  4I4T B;  1NMU B;  2Q1X A;  5CA0 B;  1JN1 A;  1QVF F;  3I55 F;  2CW4 A;  2RHO A;  4IIJ A;  3OBY A;  1W41 A;  4EI9 A;  1VQ5 F;  5MN5 A;  5EZY A;  3VYT C;  5EB1 B;  1W55 A;  5GIP C;  3N2G A;  1X52 A;  5G4V C;  1QVG F;  5HXU A;  5DCV A;  1GX1 A;  2HRU A;  1VQV A;  5EO3 A;  1K9M H;  4TUY B;  4O2B B;  4X3L A;  1E7K A;  2YYE A;  3WPX A;  3N4Z A;  4FFB B;  3JCM M;  3VMF B;  5J2T A;  1RLG A;  3J7A R;  5LYJ A;  1CLI A;  1X25 A;  3MCA B;  5HP8 A;  2UYK A;  3HKD B;  3V7Q A;  2OZB A;  4EI8 A;  3VI6 A;  5HY4 A;  4B5C A;  1SZQ A;  2Q1Y A;  5IT9 M;  1K73 H;  3JAW A;  3D00 A;  1XBI A;  1XHO A;  2KG4 A;  5KMG B;  1VQ7 F;  1VQP F;  4ZOL B;  1FNJ A;  2GZL A;  3JAS B;  2IQQ A;  4I50 B;  3VO8 A;  5HWE A;  2LBX A;  4TZZ A;  3CD6 F;  1RLU A;  4R40 B;  3VYU C;  1VQK F;  2RB9 A;  5HY1 A;  1VHA A;  4C8E A;  4X1I B;  4G4Y A;  2HP0 A;  2P6Y A;  2HS4 A;  4BT5 A;  3WJQ A;  2CWJ A;  3D54 A;  3LWR C;  4WBN A;  5GAP K;  3M84 A;  1TUB A;  4O4H A;  3TD4 A;  3C9T A;  3N2K A;  2QA4 F;  5LP6 C;  1ZWZ A;  5EAZ A;  3UT5 A;  5FLX M;  5JH7 A;  3VTI C;  5LXT B;  3CYQ A;  1DT9 A;  4G4X A;  1XRG A;  5GAN K;  3ZP7 A;  3MQW A;  1SA0 A;  4G4W A;  1QAH A;  2UYJ A;  3WGN A;  4BW0 B;  3CCE F;  1X7P A;  1H47 A;  2OTJ F;  3R0P A;  2GLZ A;  1VQ6 F;  5AVM A;  5EIB C;  3QTY A;  1FFX A;  4E6E A;  2CVL A;  3OBW A;  1KD1 H;  4O2B A;  3O85 A;  1YGY A;  1U40 A;  4M8I A;  5EWR A;  5GIO C;  4O4I A;  2Z1T A;  2PMP A;  3E22 A;  3CCV F;  5JVD A;  2RHL A;  3IKE A;  3JAL B;  2UZH A;  3P0Z A;  4ZK7 A;  2R75 1;  3G4S F;  4TV9 B;  3CCS F;  4EI7 A;  1GO1 A;  1QU9 A;  3IEW A;  3N2G B;  2Z1E A;  2VAM A;  3WGM A;  1KC8 H;  3JAT B;  5GON B;  4C8I A;  4XCQ A;  2AIF A;  3HKC A;  1NQ3 A;  1FSZ A;  1W2B F;  3J80 M;  2LBT A;  3HTN A;  1COM A;  1K8A H;  5ITZ A;  2ALE A;  3NVI B;  1VH8 A;  2B33 A;  5HP7 A;  3PAF A;  4KWE A;  1GO0 A;  3RYI B;  3LWQ C;  3F0E A;  2VXY A;  4X1Y B;  3HWU A;  5G4U C;  2FGY A;  5IJ9 A;  3AGK A;  2CSL A;  5JH7 B;  1VQN F;  3ESJ A;  4NUT A;  5BMV B;  3JVH A;  3NMU C;  2MQE A;  1W3E X;  1ONI A;  5IJ0 A;  1YJN F;  4I55 A;  3S0Y A;  4G88 A;  3KJK A;  3RYF A;  3CPW F;  2H6L A;  2ZAU A;  4U39 A;  5FNV A;  4C81 A;  4PWT A;  1UFY A;  1FNK A;  3WJP A;  2ZOD A;  4I4T A;  3I56 F;  1JFF A;  3LWV C;  1CN7 A;  1JY8 A;  3CC4 F;  3FD6 A;  1RQ7 A;  3I3F A;  3NVK E;  4BT7 A;  3HKB B;  4RHA A;  2HS0 A;  4IHJ B;  4X1K A;  5LOV A;  3WXM B;  4YJ2 A;  2Z1F A;  3CMA F;  5CA1 A;  4HNA B;  3JAW B;  2HX0 A;  1Q86 H;  3Q8H A;  3CC2 F;  1ODE A;  3JAM M;  3N4Y A;  3JAR A;  1YIJ F;  3ZP4 A;  2EWC A;  3K14 A;  5JCO C;  2Z01 A;  3RYC B;  1VK3 A;  4O2A B;  1VQL F;  3NK7 A;  4ZHV A;  3MBM A;  1W59 A;  4LCK A;  4ZHQ A;  1M1K H;  5HY2 A;  3GTZ A;  1OFU A;  4NQ3 A;  1CK2 A;  3T80 A;  2IAF A;  5A2Q M;  1SA0 B;  2HVY D;  3ZOP A;  3JAT A;  1IV2 A;  3E20 B;  3G71 F;  1Q82 H;  4DRX B;  2HQS C;  2WAL A;  3JAL A;  1T0A A;  1W5E A;  5IYZ A;  3IR9 A;  3LME A;  4G4V A;  2ZF8 A;  5EYP B;  1RQ2 A;  3S02 A;  2HP3 A;  2KTU A;  1NJI H;  2VAW A;  3LWO C;  4O4L A;  3C8L A;  3WGK A;  1FFX B;  4WBN B;  3G6E F;  1VQ8 F;  4YJ3 A; 
#chains in the Genus database with same CATH homology
 3CCR F;  4XCQ A;  2AIF A;  3FFM A;  3CCJ F;  5GIP C;  3J80 M;  1W2B F;  1X52 A;  2OTL F;  5G4V C;  1QVG F;  1K8A H;  5HXU A;  5DCV A;  3CG6 A;  2ALE A;  3NVI B;  1PXW A;  5EO3 A;  1K9M H;  3PAF A;  4X3M A;  4X3L A;  3V3T A;  1E7K A;  4BY9 D;  1VQO F;  1GO0 A;  3LWQ C;  3N4Z A;  3JCM M;  3SIU A;  3VMF B;  5G4U C;  2FGY A;  3AGK A;  1KQS F;  1RLG A;  1VQM F;  1W40 A;  1X7O A;  1VQN F;  3J7A R;  3MCA B;  4NUT A;  3V7Q A;  4BVS A;  2OZB A;  4EI8 A;  1JJ2 F;  3E1Y A;  3VI6 A;  5HY4 A;  3CCU F;  3NMU C;  5IT9 M;  1Q81 H;  1K73 H;  1W3E X;  1YHQ F;  3D00 A;  2VGN A;  5HY0 A;  1XBI A;  3GYQ A;  2KG4 A;  1YJN F;  3ON1 A;  1VQ7 F;  1VQP F;  3CPW F;  5GIN C;  3CCQ F;  2BO1 A;  4BVT A;  2F9Z C;  5HWE A;  2LBX A;  4TZZ A;  3I56 F;  2LBW A;  2QEX F;  3CD6 F;  3LWV C;  1VQK F;  1CN7 A;  3CC4 F;  2VGM A;  5HY1 A;  3NVK E;  1VQ8 F;  3HAX D;  3WXM B;  3CCM F;  3CMA F;  1YJ9 F;  3LWR C;  2QI2 A;  1VQ4 F;  5GAP K;  3V7E A;  3CME F;  1RA4 A;  1YI2 F;  2QA4 F;  1Q86 H;  3CC2 F;  1ZWZ A;  3JAM M;  3N4Y A;  3NK6 A;  5FLX M;  1YIJ F;  3RA5 A;  3LWP C;  3CC7 F;  3PLA C;  2JNB A;  1DT9 A;  2OHW A;  3J81 M;  5GAN K;  3OW2 F;  1VQL F;  1M90 H;  3NK7 A;  2CZW A;  1VQ9 F;  3SIV A;  5FJ4 C;  4LCK A;  2KTV A;  2I6D A;  1M1K H;  4BW0 B;  5HY2 A;  3LFO A;  1W42 A;  3CCE F;  1X7P A;  1GZ0 A;  5HXZ A;  2OTJ F;  3CCL F;  1N8R H;  4NQ3 A;  1CK2 A;  3CXC F;  2FC3 A;  5A2Q M;  2GLZ A;  1VQ6 F;  2HVY D;  1Q7Y H;  1S72 F;  1YIT F;  1T0K B;  3HJW C;  3E20 B;  3G71 F;  1IPA A;  1YJW F;  3OBW A;  1Q82 H;  1KD1 H;  1SDS A;  3O85 A;  3CPQ A;  5EWR A;  2WAL A;  4C4W C;  3RA6 A;  1H7M A;  5GIO C;  3CCV F;  3IR9 A;  1NMU B;  4BVR A;  1QVF F;  3G4S F;  2KTU A;  1NJI H;  3LWO C;  3I55 F;  3CCS F;  4EI7 A;  1GO1 A;  3OBY A;  1W41 A;  4EI9 A;  1VQ5 F;  3G6E F;  1KC8 H;  4BVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...