1M1KH

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m1kH00
5A2QM 3N4YA 3NK7A 1VQ7F 5GIPC 5G4VC 1QVFF 2KTUA 3N4ZA 1CK2A 3E20B 1YI2F 3JAMM 2QI2A 1YJWF 1VQ9F 3CC4F 3J80M 3G6EF 4X3MA 4C4WC 3I56F 1M90H 3OBWA 2FC3A 3CC7F 1Q82H 3I55F 3CCUF 1NMUB 3NVIB 3J81M 3CCQF 1ZWZA 3OW2F 3J7AR 3RA5A 1K9MH 2LBXA 3LWRC 2VGMA 1GO1A 2OTLF 1CN7A 3V7EA 2OTJF 3CPWF 3RA6A 1E7KA 3IR9A 3LWPC 3CPQA 2WALA 4TZZA 1KD1H 3NMUC 3WXMB 1VQNF 3HJWC 1Q86H 1H7MA 5EO3A 3LWOC 1W2BF 1YJ9F 1YJNF 1JJ2F 1W40A 1VQ6F 3ON1A 1GZ0A 2JNBA 2AIFA 4X3LA 2OHWA 1NJIH 1XBIA 1DT9A 1IPAA 1VQ4F 3MCAB 2HVYD 3LWQC 3NVKE 5GAPK 3PLAC 5EWRA 3CG6A 3G71F 3SIUA 2QA4F 3FFMA 1W42A 1VQMF 3CCJF 5IT9M 1Q7YH 3VI6A 3O85A 4LCKA 2I6DA 1M1KH 1KC8H 3HAXD 2LBWA 1KQSF 1RA4A 1VQLF 3CCVF 1QVGF 1YITF 1SDSA 1Q81H 2BO1A 3CMEF 5FLXM 3V7QA 3CCRF 1T0KB 3LWVC 4BW0B 3CCEF 1YHQF 5GANK 1VQ8F 1VQKF 1X7OA 1S72F 3E1YA 5GIOC 3CD6F 1X52A 5GINC 1X7PA 1VQ5F 2QEXF 3CCMF 2ALEA 3NK6A 3GYQA 1VQOF 1W41A 1K73H 3CC2F 1W3EX 3G4SF 1VQPF 1K8AH 3JCMM 5FJ4C 2KTVA 2OZBA 1PXWA 3PAFA 3CMAF 1N8RH 3LFOA 4NUTA 3CCLF 5DCVA 3CXCF 1YIJF 1RLGA 2KG4A 3AGKA 3SIVA 1GO0A 4BY9D 5G4UC 2VGNA 3OBYA 3VMFB 3CCSF 2CZWA
chains in the Genus database with same CATH superfamily
4U3JA 5A2QM 2YXZA 2CHSA 5GIPC 1QVFF 1CK2A 3RYFA 3WPXA 1VHAA 2AIZP 2NMUA 1YJWF 4FFBA 4X20A 1VQ9F 3LYBA 3I56F 2P6YA 5HP7A 3MDOA 1W55A 2FC3A 4EB6A 3CC7F 5J2TA 3I55F 1H48A 2RHOA 3J81M 3WGJA 4G4ZA 3CCQF 3J7AR 4TV8A 5EZYB 3LWRC 4YJ2A 1W581 1CN7A 4O2AB 3V7EA 3KJKA 4O4IB 2VAPA 4I50B 3VYSC 5KX5B 2V9YA 5LYJA 4F6RB 3LWPC 2WALA 4TZZA 5LOVB 1R1MA 1VQNF 1W5BA 5KMGB 2OTMA 3LWOC 1YJ9F 5IJ0A 4ZOLA 1W40A 2HP3A 4M8IA 1VQ6F 1GZ0A 4TV9A 4X3LA 2CW4A 2OHWA 2HP0B 2MQEA 1NJIH 1XBIA 3S0YA 1DT9A 4DXDA 3JALB 3LWQC 4IIJA 4TUYA 3M1XA 3CG6A 3SIUA 4PWTA 4YJ3A 5IT9M 4B45A 1JY8A 3V4DA 1YQNA 3VO8A 1M1KH 3HAXD 3F6MA 4O4HA 2ZAUA 2LBWA 4LNUA 4ZI7B 1YITF 3MCQA 5FLXM 2HX0A 2B33A 4X1IA 1JD1A 1XHOA 3IEWA 3LWVC 4BW0B 3CCEF 3CYQA 3UT5B 3HTNA 3VCZA 1VQ8F 5IYZB 1S72F 2Z1FA 3K14A 2PMPA 2UZHA 5CA1A 5JH7A 1VQOF 1W41A 3RYCB 1K73H 1QD9A 4BVRA 3F0GA 3JARB 5GONA 4ZHWA 2L26A 3M4SA 1PXWA 3CB2A 1N8RH 3S06A 3CCLF 1ODEA 2HRYA 3FBAA 4O4LA 1RLGA 3AGKA 2VAWA 3RYIA 4IHJA 1GO0A 4ZOLB 3ZP7A 3DC2A 4E6EA 4O2BA 3CCSF 5G4VC 5HY2A 2KTUA 3N4ZA 3WGKA 3L7QA 5JVDA 3ERNA 3JASA 3J80M 3WGMA 3G6EF 1FNJA 3HKDB 4O4JB 4DRXA 3S03A 5C8YA 5HY0A 1DBFA 3C9SA 3E22B 1Q82H 1PF5A 2CHTA 5J2UA 3TD5A 3S02A 4BT5A 3HKCA 5MN4A 1FSZA 1K9MH 4I55A 3JAKA 1GO1A 3VOBA 5CB4A 5LXTB 4O4HB 3LDTA 2OTJF 3QUWA 3RA6A 1E7KA 4B5CA 3NMUC 3WXMB 1Q86H 1H7MA 5CA0B 3R0PA 4WBNB 3I7TA 3IEQA 1COMA 2H6LA 5LA6A 5BMVA 5EIBD 2IAFA 3ON1A 4U39A 2N48A 3JAWB 1OAPA 2BTOA 2IG8A 2LBTA 1TUBB 5ITZB 1TVKB 3FPIA 1RQ2A 1U3LA 3PLAC 5JQGA 1U40A 2QA4F 5MN5A 2GZLA 3VYTC 1XV2A 2ZVZA 2Z1UA 2BTQB 3D00A 1Q8RA 3KJJA 3HKBA 4BVQA 1XRGA 4X1YA 1KQSF 4ZHYB 3CCVF 2Z1TA 3KHNA 1X25A 1SDSA 3CMEF 3KE1A 4EI8A 3CYPB 3ZP4A 4EI9A 1T0KB 2FGYA 5EYPA 4BT2A 5J2UB 3F0EA 1U3PA 1Z5VA 1X7OA 1IV2A 2H8CA 3JVHA 3E1YA 5GIOC 3N2KB 1X52A 4ZHQA 2ZOVA 3ELCA 5HWEA 2R751 3I3FA 5CB4B 1W3EX 1UI9A 1ONIA 3N2GA 1VQPF 4U3JB 2IQQA 4BVSA 2Q1YA 4HNAA 3RYFB 3JATA 5JCOC 1FNKA 3DDNA 4FFBB 4X20B 3B6NA 5LP6A 1RQ7A 5AVMA 4BY9D 1UFYA 4EB6B 5J2TB 1QU9A 3F0DA 3NK7A 5FNVA 3HKEA 3VOAA 5IJ9A 3K2XA 4TV8B 3JAMM 2UYNA 1YI2F 4YJ2B 2Z1EA 4G4XA 5B8FA 4C8GA 4X3MA 4BT3A 3GTZA 1H47A 4B62A 2ZVYA 3K12A 3S0HA 2CSLA 3CCUF 4C8EA 5LYJB 3C9TA 2CVLA 3QHDA 2Q1XA 3RA5A 3T80A 2VGMA 5MN6A 2OTLF 5IJ0B 3WJRA 3M84A 3GHZA 1CLIA 4TV9B 3C9UA 1KD1H 2LCAA 2HS3A 1IV1A 3HJWC 5EZYA 4I4TA 4IIJB 1JFFA 4TUYB 3VYUC 1W2BF 1YJNF 4O2AA 1JJ2F 2K1SA 4RQOA 4O4IA 4ZHQB 4I50A 2DT4A 1KNKA 4YJ3B 5KX5A 2AIFA 1T0AA 4F6RA 5LOVA 2YYEA 4X1KA 3F0FA 5HXUA 4HNAB 3Q8HA 1VQ4F 3MCAB 2HVYD 3C9RA 2Z01A 5EAZA 2HS4A 5EWRA 3G71F 4LNUB 1OFUA 3ESJA 3FFMA 2GLZA 3CCJF 4X1IB 3MBMA 1Q7YH 1SA0A 4G4VA 3VI6A 2VAMA 1VQVA 2I6DA 4XCQA 1YGYA 1W57A 1KC8H 2PHNA 1SZQA 3IKFA 1VQLF 5CA1B 5JH7B 1QVGF 1W5EA 4BVTA 1FFXA 2RHHA 5GONB 1W59A 4G4YA 5GANK 3CD6F 2BTUA 4O4LB 3EORA 1X7PA 5GINC 1VQ5F 3CCMF 3BYQA 4ZI7A 3RYIB 4IHJB 3CC2F 2HS0A 2EWCA 4ZHVA 3G4SF 4O2BB 2UYKA 4NQ3A 5FJ4C 2KTVA 3UT5A 1JN1A 4G88A 1GX1A 3WPWA 3CMAF 1KNJA 5IYZA 3LFOA 4NUTA 5JVDB 3WJQA 2KGWA 3CXCF 1YIJF 3JASB 2KG4A 4I4TB 4DRXB 1JFFB 3RYCA 3QTYA 5C8YB 5G4UC 2VGNA 1Z5WA 3IMPA 4ZK7A 2CZWA 3CC4F 3N4YA 3JARA 3TD4A 4G4WA 1VQ7F 3HKCB 3VTIC 3E20B 3D54A 4I55B 4X1KB 2QI2A 3JAKB 4C4WC 4C8IA 2HRUA 1M90H 3OBWA 4B46A 3WGLA 1NQ3A 3IKEA 4C81A 1NMUB 3NVIB 1ZWZA 3OW2F 1SA0B 2LBXA 3FD5A 4ERHA 1VH8A 3HKDA 4O4JA 5EIBC 3C8LA 4BT4A 5HXZA 5LA6B 5BMVB 2W8BC 3E22A 3FD6A 3CPWF 2ZF8A 3IR9A 2ZODA 3CPQA 2QTPA 1FFXB 3RYHA 1U43A 2AMTA 5HY1A 2UYJA 3V3TA 3HWUA 5EO3A 3RE3A 5HY4A 4NWOB 5LXTA 2RHLA 5JQGB 3ZO8A 4C82A 1IV4A 1QAHA 2I6RA 2JNBA 4EI7A 1IV3A 2HQSC 3P0ZA 1IPAA 3NVKE 4BT6A 3HKBB 5GAPK 5CA0A 4X1YB 4WBNA 3OONA 2F9ZC 1W42A 1VQMF 3JAWA 3VIUA 3K0TA 5EYPB 4BT7A 3TD3A 2DYYA 1TUBA 5ITZA 1TVKA 1W5FA 5EB1B 3KIZA 3O85A 4LCKA 1RA4A 1Q81H 2BO1A 3V7QA 2VXYA 3MQWA 3WGNA 3N2GB 3CCRF 2R6R1 4R40B 2UYPA 4RHAA 5KMGA 1YHQF 3JATB 4KWEA 3U0OA 1VQKF 3ZOPA 3P10A 2QEXF 5LP6B 2ALEA 3NK6A 3GYQA 1RLUA 1J7HA 3P4EA 3S0WA 1K8AH 2HP0A 3LMEA 3JCMM 3WJPA 5FNVB 1VK3A 3HKEB 5HP8A 2GVIA 5JCOA 2OZBA 2CWJA 3JALA 3PAFA 5EB0A 5IJ9B 3RYHB 2UYNB 5DCVA 3N2KA 3D01A 3SIVA 5LP6C 1W5AA 2G9IA 2RB9A 2H8EA 2RHJA 3OBYA 3VMFB
chains in the Genus database with same CATH topology
5A2QM 3N4YA 3NK7A 1VQ7F 5GIPC 5G4VC 1QVFF 5HY2A 2KTUA 3N4ZA 1CK2A 3E20B 1YI2F 3JAMM 2QI2A 1YJWF 1VQ9F 3CC4F 3J80M 3G6EF 4X3MA 4C4WC 3I56F 5HY0A 1M90H 3OBWA 2FC3A 3CC7F 1Q82H 3I55F 3CCUF 1NMUB 3NVIB 3J81M 3CCQF 1ZWZA 3OW2F 3J7AR 3RA5A 1K9MH 2LBXA 3LWRC 2VGMA 1GO1A 2OTLF 1CN7A 3V7EA 2OTJF 5HXZA 3CPWF 3RA6A 1E7KA 3IR9A 3LWPC 3CPQA 2WALA 4TZZA 1KD1H 3NMUC 3WXMB 1VQNF 3HJWC 1Q86H 5HY1A 1H7MA 3V3TA 5EO3A 3LWOC 5HY4A 1W2BF 1YJ9F 1YJNF 1JJ2F 1W40A 1VQ6F 3ON1A 1GZ0A 2JNBA 2AIFA 4X3LA 4EI7A 2OHWA 1NJIH 1XBIA 1DT9A 5HXUA 1IPAA 1VQ4F 3MCAB 2HVYD 3LWQC 3NVKE 5GAPK 3PLAC 5EWRA 3CG6A 3G71F 3SIUA 2QA4F 3FFMA 2F9ZC 1W42A 2GLZA 1VQMF 3CCJF 5IT9M 1Q7YH 3VI6A 3D00A 3O85A 4LCKA 2I6DA 4XCQA 4BVQA 1M1KH 1KC8H 3HAXD 2LBWA 1KQSF 1RA4A 1VQLF 3CCVF 1QVGF 1YITF 1SDSA 1Q81H 2BO1A 3CMEF 5FLXM 3V7QA 4EI8A 4BVTA 4EI9A 3CCRF 1T0KB 2FGYA 3LWVC 4BW0B 3CCEF 1YHQF 5GANK 1VQ8F 1VQKF 1X7OA 1S72F 3E1YA 5GIOC 3CD6F 1X52A 5GINC 1X7PA 1VQ5F 2QEXF 3CCMF 2ALEA 3NK6A 3GYQA 5HWEA 1VQOF 1W41A 1K73H 3CC2F 1W3EX 3G4SF 1VQPF 1K8AH 4BVRA 3JCMM 5FJ4C 4NQ3A 4BVSA 2KTVA 2OZBA 1PXWA 3PAFA 3CMAF 1N8RH 3LFOA 4NUTA 3CCLF 5DCVA 3CXCF 1YIJF 1RLGA 2KG4A 3AGKA 3SIVA 1GO0A 4BY9D 5G4UC 2VGNA 3OBYA 3VMFB 3CCSF 2CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q M;  3N4Y A;  3NK7 A;  1VQ7 F;  5GIP C;  5G4V C;  1QVF F;  2KTU A;  3N4Z A;  1CK2 A;  3E20 B;  1YI2 F;  3JAM M;  2QI2 A;  1YJW F;  1VQ9 F;  3CC4 F;  3J80 M;  3G6E F;  4X3M A;  4C4W C;  3I56 F;  1M90 H;  3OBW A;  2FC3 A;  3CC7 F;  1Q82 H;  3I55 F;  3CCU F;  1NMU B;  3NVI B;  3J81 M;  3CCQ F;  1ZWZ A;  3OW2 F;  3J7A R;  3RA5 A;  1K9M H;  2LBX A;  3LWR C;  2VGM A;  1GO1 A;  2OTL F;  1CN7 A;  3V7E A;  2OTJ F;  3CPW F;  3RA6 A;  1E7K A;  3IR9 A;  3LWP C;  3CPQ A;  2WAL A;  4TZZ A;  1KD1 H;  3NMU C;  3WXM B;  1VQN F;  3HJW C;  1Q86 H;  1H7M A;  5EO3 A;  3LWO C;  1W2B F;  1YJ9 F;  1YJN F;  1JJ2 F;  1W40 A;  1VQ6 F;  3ON1 A;  1GZ0 A;  2JNB A;  2AIF A;  4X3L A;  2OHW A;  1NJI H;  1XBI A;  1DT9 A;  1IPA A;  1VQ4 F;  3MCA B;  2HVY D;  3LWQ C;  3NVK E;  5GAP K;  3PLA C;  5EWR A;  3CG6 A;  3G71 F;  3SIU A;  2QA4 F;  3FFM A;  1W42 A;  1VQM F;  3CCJ F;  5IT9 M;  1Q7Y H;  3VI6 A;  3O85 A;  4LCK A;  2I6D A;  1M1K H;  1KC8 H;  3HAX D;  2LBW A;  1KQS F;  1RA4 A;  1VQL F;  3CCV F;  1QVG F;  1YIT F;  1SDS A;  1Q81 H;  2BO1 A;  3CME F;  5FLX M;  3V7Q A;  3CCR F;  1T0K B;  3LWV C;  4BW0 B;  3CCE F;  1YHQ F;  5GAN K;  1VQ8 F;  1VQK F;  1X7O A;  1S72 F;  3E1Y A;  5GIO C;  3CD6 F;  1X52 A;  5GIN C;  1X7P A;  1VQ5 F;  2QEX F;  3CCM F;  2ALE A;  3NK6 A;  3GYQ A;  1VQO F;  1W41 A;  1K73 H;  3CC2 F;  1W3E X;  3G4S F;  1VQP F;  1K8A H;  3JCM M;  5FJ4 C;  2KTV A;  2OZB A;  1PXW A;  3PAF A;  3CMA F;  1N8R H;  3LFO A;  4NUT A;  3CCL F;  5DCV A;  3CXC F;  1YIJ F;  1RLG A;  2KG4 A;  3AGK A;  3SIV A;  1GO0 A;  4BY9 D;  5G4U C;  2VGN A;  3OBY A;  3VMF B;  3CCS F;  2CZW A; 
#chains in the Genus database with same CATH topology
 4U3J A;  5A2Q M;  2YXZ A;  2CHS A;  5GIP C;  1QVF F;  1CK2 A;  3RYF A;  3WPX A;  1VHA A;  2AIZ P;  2NMU A;  1YJW F;  4FFB A;  4X20 A;  1VQ9 F;  3LYB A;  3I56 F;  2P6Y A;  5HP7 A;  3MDO A;  1W55 A;  2FC3 A;  4EB6 A;  3CC7 F;  5J2T A;  3I55 F;  1H48 A;  2RHO A;  3J81 M;  3WGJ A;  4G4Z A;  3CCQ F;  3J7A R;  4TV8 A;  5EZY B;  3LWR C;  4YJ2 A;  1W58 1;  1CN7 A;  4O2A B;  3V7E A;  3KJK A;  4O4I B;  2VAP A;  4I50 B;  3VYS C;  5KX5 B;  2V9Y A;  5LYJ A;  4F6R B;  3LWP C;  2WAL A;  4TZZ A;  5LOV B;  1R1M A;  1VQN F;  1W5B A;  5KMG B;  2OTM A;  3LWO C;  1YJ9 F;  5IJ0 A;  4ZOL A;  1W40 A;  2HP3 A;  4M8I A;  1VQ6 F;  1GZ0 A;  4TV9 A;  4X3L A;  2CW4 A;  2OHW A;  2HP0 B;  2MQE A;  1NJI H;  1XBI A;  3S0Y A;  1DT9 A;  4DXD A;  3JAL B;  3LWQ C;  4IIJ A;  4TUY A;  3M1X A;  3CG6 A;  3SIU A;  4PWT A;  4YJ3 A;  5IT9 M;  4B45 A;  1JY8 A;  3V4D A;  1YQN A;  3VO8 A;  1M1K H;  3HAX D;  3F6M A;  4O4H A;  2ZAU A;  2LBW A;  4LNU A;  4ZI7 B;  1YIT F;  3MCQ A;  5FLX M;  2HX0 A;  2B33 A;  4X1I A;  1JD1 A;  1XHO A;  3IEW A;  3LWV C;  4BW0 B;  3CCE F;  3CYQ A;  3UT5 B;  3HTN A;  3VCZ A;  1VQ8 F;  5IYZ B;  1S72 F;  2Z1F A;  3K14 A;  2PMP A;  2UZH A;  5CA1 A;  5JH7 A;  1VQO F;  1W41 A;  3RYC B;  1K73 H;  1QD9 A;  4BVR A;  3F0G A;  3JAR B;  5GON A;  4ZHW A;  2L26 A;  3M4S A;  1PXW A;  3CB2 A;  1N8R H;  3S06 A;  3CCL F;  1ODE A;  2HRY A;  3FBA A;  4O4L A;  1RLG A;  3AGK A;  2VAW A;  3RYI A;  4IHJ A;  1GO0 A;  4ZOL B;  3ZP7 A;  3DC2 A;  4E6E A;  4O2B A;  3CCS F;  5G4V C;  5HY2 A;  2KTU A;  3N4Z A;  3WGK A;  3L7Q A;  5JVD A;  3ERN A;  3JAS A;  3J80 M;  3WGM A;  3G6E F;  1FNJ A;  3HKD B;  4O4J B;  4DRX A;  3S03 A;  5C8Y A;  5HY0 A;  1DBF A;  3C9S A;  3E22 B;  1Q82 H;  1PF5 A;  2CHT A;  5J2U A;  3TD5 A;  3S02 A;  4BT5 A;  3HKC A;  5MN4 A;  1FSZ A;  1K9M H;  4I55 A;  3JAK A;  1GO1 A;  3VOB A;  5CB4 A;  5LXT B;  4O4H B;  3LDT A;  2OTJ F;  3QUW A;  3RA6 A;  1E7K A;  4B5C A;  3NMU C;  3WXM B;  1Q86 H;  1H7M A;  5CA0 B;  3R0P A;  4WBN B;  3I7T A;  3IEQ A;  1COM A;  2H6L A;  5LA6 A;  5BMV A;  5EIB D;  2IAF A;  3ON1 A;  4U39 A;  2N48 A;  3JAW B;  1OAP A;  2BTO A;  2IG8 A;  2LBT A;  1TUB B;  5ITZ B;  1TVK B;  3FPI A;  1RQ2 A;  1U3L A;  3PLA C;  5JQG A;  1U40 A;  2QA4 F;  5MN5 A;  2GZL A;  3VYT C;  1XV2 A;  2ZVZ A;  2Z1U A;  2BTQ B;  3D00 A;  1Q8R A;  3KJJ A;  3HKB A;  4BVQ A;  1XRG A;  4X1Y A;  1KQS F;  4ZHY B;  3CCV F;  2Z1T A;  3KHN A;  1X25 A;  1SDS A;  3CME F;  3KE1 A;  4EI8 A;  3CYP B;  3ZP4 A;  4EI9 A;  1T0K B;  2FGY A;  5EYP A;  4BT2 A;  5J2U B;  3F0E A;  1U3P A;  1Z5V A;  1X7O A;  1IV2 A;  2H8C A;  3JVH A;  3E1Y A;  5GIO C;  3N2K B;  1X52 A;  4ZHQ A;  2ZOV A;  3ELC A;  5HWE A;  2R75 1;  3I3F A;  5CB4 B;  1W3E X;  1UI9 A;  1ONI A;  3N2G A;  1VQP F;  4U3J B;  2IQQ A;  4BVS A;  2Q1Y A;  4HNA A;  3RYF B;  3JAT A;  5JCO C;  1FNK A;  3DDN A;  4FFB B;  4X20 B;  3B6N A;  5LP6 A;  1RQ7 A;  5AVM A;  4BY9 D;  1UFY A;  4EB6 B;  5J2T B;  1QU9 A;  3F0D A;  3NK7 A;  5FNV A;  3HKE A;  3VOA A;  5IJ9 A;  3K2X A;  4TV8 B;  3JAM M;  2UYN A;  1YI2 F;  4YJ2 B;  2Z1E A;  4G4X A;  5B8F A;  4C8G A;  4X3M A;  4BT3 A;  3GTZ A;  1H47 A;  4B62 A;  2ZVY A;  3K12 A;  3S0H A;  2CSL A;  3CCU F;  4C8E A;  5LYJ B;  3C9T A;  2CVL A;  3QHD A;  2Q1X A;  3RA5 A;  3T80 A;  2VGM A;  5MN6 A;  2OTL F;  5IJ0 B;  3WJR A;  3M84 A;  3GHZ A;  1CLI A;  4TV9 B;  3C9U A;  1KD1 H;  2LCA A;  2HS3 A;  1IV1 A;  3HJW C;  5EZY A;  4I4T A;  4IIJ B;  1JFF A;  4TUY B;  3VYU C;  1W2B F;  1YJN F;  4O2A A;  1JJ2 F;  2K1S A;  4RQO A;  4O4I A;  4ZHQ B;  4I50 A;  2DT4 A;  1KNK A;  4YJ3 B;  5KX5 A;  2AIF A;  1T0A A;  4F6R A;  5LOV A;  2YYE A;  4X1K A;  3F0F A;  5HXU A;  4HNA B;  3Q8H A;  1VQ4 F;  3MCA B;  2HVY D;  3C9R A;  2Z01 A;  5EAZ A;  2HS4 A;  5EWR A;  3G71 F;  4LNU B;  1OFU A;  3ESJ A;  3FFM A;  2GLZ A;  3CCJ F;  4X1I B;  3MBM A;  1Q7Y H;  1SA0 A;  4G4V A;  3VI6 A;  2VAM A;  1VQV A;  2I6D A;  4XCQ A;  1YGY A;  1W57 A;  1KC8 H;  2PHN A;  1SZQ A;  3IKF A;  1VQL F;  5CA1 B;  5JH7 B;  1QVG F;  1W5E A;  4BVT A;  1FFX A;  2RHH A;  5GON B;  1W59 A;  4G4Y A;  5GAN K;  3CD6 F;  2BTU A;  4O4L B;  3EOR A;  1X7P A;  5GIN C;  1VQ5 F;  3CCM F;  3BYQ A;  4ZI7 A;  3RYI B;  4IHJ B;  3CC2 F;  2HS0 A;  2EWC A;  4ZHV A;  3G4S F;  4O2B B;  2UYK A;  4NQ3 A;  5FJ4 C;  2KTV A;  3UT5 A;  1JN1 A;  4G88 A;  1GX1 A;  3WPW A;  3CMA F;  1KNJ A;  5IYZ A;  3LFO A;  4NUT A;  5JVD B;  3WJQ A;  2KGW A;  3CXC F;  1YIJ F;  3JAS B;  2KG4 A;  4I4T B;  4DRX B;  1JFF B;  3RYC A;  3QTY A;  5C8Y B;  5G4U C;  2VGN A;  1Z5W A;  3IMP A;  4ZK7 A;  2CZW A;  3CC4 F;  3N4Y A;  3JAR A;  3TD4 A;  4G4W A;  1VQ7 F;  3HKC B;  3VTI C;  3E20 B;  3D54 A;  4I55 B;  4X1K B;  2QI2 A;  3JAK B;  4C4W C;  4C8I A;  2HRU A;  1M90 H;  3OBW A;  4B46 A;  3WGL A;  1NQ3 A;  3IKE A;  4C81 A;  1NMU B;  3NVI B;  1ZWZ A;  3OW2 F;  1SA0 B;  2LBX A;  3FD5 A;  4ERH A;  1VH8 A;  3HKD A;  4O4J A;  5EIB C;  3C8L A;  4BT4 A;  5HXZ A;  5LA6 B;  5BMV B;  2W8B C;  3E22 A;  3FD6 A;  3CPW F;  2ZF8 A;  3IR9 A;  2ZOD A;  3CPQ A;  2QTP A;  1FFX B;  3RYH A;  1U43 A;  2AMT A;  5HY1 A;  2UYJ A;  3V3T A;  3HWU A;  5EO3 A;  3RE3 A;  5HY4 A;  4NWO B;  5LXT A;  2RHL A;  5JQG B;  3ZO8 A;  4C82 A;  1IV4 A;  1QAH A;  2I6R A;  2JNB A;  4EI7 A;  1IV3 A;  2HQS C;  3P0Z A;  1IPA A;  3NVK E;  4BT6 A;  3HKB B;  5GAP K;  5CA0 A;  4X1Y B;  4WBN A;  3OON A;  2F9Z C;  1W42 A;  1VQM F;  3JAW A;  3VIU A;  3K0T A;  5EYP B;  4BT7 A;  3TD3 A;  2DYY A;  1TUB A;  5ITZ A;  1TVK A;  1W5F A;  5EB1 B;  3KIZ A;  3O85 A;  4LCK A;  1RA4 A;  1Q81 H;  2BO1 A;  3V7Q A;  2VXY A;  3MQW A;  3WGN A;  3N2G B;  3CCR F;  2R6R 1;  4R40 B;  2UYP A;  4RHA A;  5KMG A;  1YHQ F;  3JAT B;  4KWE A;  3U0O A;  1VQK F;  3ZOP A;  3P10 A;  2QEX F;  5LP6 B;  2ALE A;  3NK6 A;  3GYQ A;  1RLU A;  1J7H A;  3P4E A;  3S0W A;  1K8A H;  2HP0 A;  3LME A;  3JCM M;  3WJP A;  5FNV B;  1VK3 A;  3HKE B;  5HP8 A;  2GVI A;  5JCO A;  2OZB A;  2CWJ A;  3JAL A;  3PAF A;  5EB0 A;  5IJ9 B;  3RYH B;  2UYN B;  5DCV A;  3N2K A;  3D01 A;  3SIV A;  5LP6 C;  1W5A A;  2G9I A;  2RB9 A;  2H8E A;  2RHJ A;  3OBY A;  3VMF B; 
#chains in the Genus database with same CATH homology
 5A2Q M;  3N4Y A;  3NK7 A;  1VQ7 F;  5GIP C;  5G4V C;  1QVF F;  5HY2 A;  2KTU A;  3N4Z A;  1CK2 A;  3E20 B;  1YI2 F;  3JAM M;  2QI2 A;  1YJW F;  1VQ9 F;  3CC4 F;  3J80 M;  3G6E F;  4X3M A;  4C4W C;  3I56 F;  5HY0 A;  1M90 H;  3OBW A;  2FC3 A;  3CC7 F;  1Q82 H;  3I55 F;  3CCU F;  1NMU B;  3NVI B;  3J81 M;  3CCQ F;  1ZWZ A;  3OW2 F;  3J7A R;  3RA5 A;  1K9M H;  2LBX A;  3LWR C;  2VGM A;  1GO1 A;  2OTL F;  1CN7 A;  3V7E A;  2OTJ F;  5HXZ A;  3CPW F;  3RA6 A;  1E7K A;  3IR9 A;  3LWP C;  3CPQ A;  2WAL A;  4TZZ A;  1KD1 H;  3NMU C;  3WXM B;  1VQN F;  3HJW C;  1Q86 H;  5HY1 A;  1H7M A;  3V3T A;  5EO3 A;  3LWO C;  5HY4 A;  1W2B F;  1YJ9 F;  1YJN F;  1JJ2 F;  1W40 A;  1VQ6 F;  3ON1 A;  1GZ0 A;  2JNB A;  2AIF A;  4X3L A;  4EI7 A;  2OHW A;  1NJI H;  1XBI A;  1DT9 A;  5HXU A;  1IPA A;  1VQ4 F;  3MCA B;  2HVY D;  3LWQ C;  3NVK E;  5GAP K;  3PLA C;  5EWR A;  3CG6 A;  3G71 F;  3SIU A;  2QA4 F;  3FFM A;  2F9Z C;  1W42 A;  2GLZ A;  1VQM F;  3CCJ F;  5IT9 M;  1Q7Y H;  3VI6 A;  3D00 A;  3O85 A;  4LCK A;  2I6D A;  4XCQ A;  4BVQ A;  1M1K H;  1KC8 H;  3HAX D;  2LBW A;  1KQS F;  1RA4 A;  1VQL F;  3CCV F;  1QVG F;  1YIT F;  1SDS A;  1Q81 H;  2BO1 A;  3CME F;  5FLX M;  3V7Q A;  4EI8 A;  4BVT A;  4EI9 A;  3CCR F;  1T0K B;  2FGY A;  3LWV C;  4BW0 B;  3CCE F;  1YHQ F;  5GAN K;  1VQ8 F;  1VQK F;  1X7O A;  1S72 F;  3E1Y A;  5GIO C;  3CD6 F;  1X52 A;  5GIN C;  1X7P A;  1VQ5 F;  2QEX F;  3CCM F;  2ALE A;  3NK6 A;  3GYQ A;  5HWE A;  1VQO F;  1W41 A;  1K73 H;  3CC2 F;  1W3E X;  3G4S F;  1VQP F;  1K8A H;  4BVR A;  3JCM M;  5FJ4 C;  4NQ3 A;  4BVS A;  2KTV A;  2OZB A;  1PXW A;  3PAF A;  3CMA F;  1N8R H;  3LFO A;  4NUT A;  3CCL F;  5DCV A;  3CXC F;  1YIJ F;  1RLG A;  2KG4 A;  3AGK A;  3SIV A;  1GO0 A;  4BY9 D;  5G4U C;  2VGN A;  3OBY A;  3VMF B;  3CCS F;  2CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...