1M1KH

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1m1kH00
2HVYD 3VMFB 3NVKE 5DCVA 3J7AR 1YJ9F 2BO1A 1W41A 3CG6A 4BW0B 3J80M 3V7EA 1QVGF 3G71F 5A2QM 1VQ8F 3G6EF 1X7OA 2JNBA 1IPAA 3OBWA 1K8AH 2ALEA 1QVFF 3LWRC 1VQNF 1W40A 3AGKA 3N4ZA 1Q7YH 2FC3A 3I55F 2I6DA 1VQ5F 3SIVA 2KG4A 5FJ4C 2KTVA 5GIPC 3CCEF 3CC4F 3NVIB 3CC7F 1W2BF 5EWRA 3NK7A 1M1KH 2LBXA 1VQ9F 2OTLF 3E1YA 3HJWC 3LWOC 1X52A 3CCMF 3ON1A 2OHWA 4TZZA 1W42A 1PXWA 3OW2F 4X3MA 1Q82H 1YITF 1JJ2F 3CMAF 5EO3A 1XBIA 3LFOA 3CCVF 5G4UC 5FLXM 5GANK 3JCMM 1VQMF 3CCSF 5GAPK 1VQLF 1KQSF 3FFMA 1YJNF 3V7QA 3G4SF 2QA4F 3IR9A 3N4YA 2WALA 1M90H 1T0KB 4BY9D 3J81M 3VI6A 3CXCF 3I56F 3LWVC 2OTJF 1GO0A 4NUTA 1KD1H 5GIOC 3O85A 1YI2F 5G4VC 1VQPF 1VQ7F 1W3EX 1K9MH 1X7PA 1VQKF 1CN7A 2VGMA 3CCRF 1S72F 5IT9M 3CD6F 3CCLF 1CK2A 1GZ0A 1YHQF 1N8RH 1VQOF 1GO1A 1ZWZA 3WXMB 3SIUA 1VQ4F 1H7MA 3CCJF 3CC2F 1RLGA 1Q86H 3GYQA 3MCAB 3OBYA 2QI2A 2AIFA 4C4WC 4LCKA 3LWPC 3CPWF 3PLAC 1E7KA 1RA4A 1K73H 3HAXD 2VGNA 3CPQA 2CZWA 1Q81H 2KTUA 3NK6A 3LWQC 2QEXF 3RA6A 3NMUC 2LBWA 1SDSA 3RA5A 1YIJF 2OZBA 3E20B 3JAMM 1KC8H 3CMEF 3CCUF 1DT9A 5GINC 4X3LA 1NJIH 3CCQF 1YJWF 3PAFA 1VQ6F 1NMUB
chains in the Genus database with same CATH superfamily
2HVYD 2DT4A 5DCVA 5FNVB 2HP0B 3J7AR 2Q1YA 4IHJA 1FNKA 4WBNA 2AIZP 2RHOA 3FPIA 4YJ2A 3Q8HA 2VAWA 3I7TA 3G71F 3F6MA 2VAPA 5IJ0B 4ERHA 1W59A 3HWUA 1VK3A 3VTIC 3OBWA 2ALEA 3JAWA 1W40A 3AGKA 1Q7YH 1VQNF 2FC3A 1XRGA 4O4IA 4NQ3A 3SIVA 2KG4A 2KTVA 5GIPC 3QUWA 5JVDB 3IKFA 4F6RA 5KMGA 2LBXA 1XHOA 5LA6B 1VQ9F 3F0FA 2OTLF 5EIBC 1J7HA 3OW2F 3VYUC 1Q82H 2DYYA 3LMEA 3N2GA 2HRYA 3UT5B 4TV9A 3RYHA 1JJ2F 4EI8A 3IMPA 5J2UA 3N2KA 2PHNA 4C8EA 5EIBD 3LFOA 4O4IB 3F0EA 3JALA 2HS0A 4F6RB 5JCOC 1VH8A 3S0WA 5KMGB 1VQMF 3CYPB 1OFUA 3HKEB 3MDOA 3ERNA 3N2GB 3V7QA 1T0AA 3N4YA 1SZQA 4O4HB 5J2UB 4U39A 3WPWA 1QD9A 3VI6A 2L26A 4ZHWA 2OTJF 2CW4A 4NUTA 3O85A 3HKDA 3C9TA 4M8IA 1JN1A 4EB6B 1S72F 5IT9M 4O4LB 5IYZA 3B6NA 3FD6A 3JAKA 4ZHQA 1JFFA 1VQ4F 1SA0A 3CCJF 4YJ3A 1RLGA 2FGYA 5HWEA 1W5FA 1FFXA 3GTZA 2AIFA 1VQVA 5JQGA 3HKDB 3LWPC 3CPWF 2Q1XA 1RA4A 1K73H 2Z1TA 1U3LA 5IYZB 5HP8A 4ZI7A 3MQWA 3RA6A 3JAKB 1SDSA 1W5EA 3S06A 3OONA 1SA0B 3CMEF 5GONA 4X3LA 1YJWF 2EWCA 4BT4A 1VQ6F 1NMUB 3JATA 3VMFB 5HXUA 1TVKB 3HKCA 3CG6A 5JH7B 2ZVYA 2HQSC 3V7EA 1QVGF 5A2QM 3WPXA 1W55A 2Z1FA 4I4TB 5GONB 2JNBA 4BT7A 3R0PA 3JATB 3I55F 5CB4A 4IIJA 1VQ5F 5CA1B 4BT2A 3TD3A 2HP3A 2YXZA 5IJ9B 3CC7F 3NVIB 1UFYA 2OTMA 3V4DA 4ZOLB 1X25A 3E1YA 3HJWC 3K14A 5KX5A 1PXWA 1W42A 4X1KA 2GLZA 4O2AA 5J2TA 3JASA 3VIUA 3C9RA 1W5BA 4I55A 5ITZA 3I3FA 3C9UA 2CWJA 4O2BA 4X20A 3CCVF 3VOAA 5BMVA 5G4UC 5FLXM 4DRXB 2GVIA 3V3TA 5CA0A 2RHJA 3JCMM 1JY8A 1Z5WA 2ZODA 5LP6C 3CYQA 5KX5B 4BT6A 3CCSF 4IHJB 4X1KB 1PF5A 4WBNB 1KQSF 4YJ2B 5EYPA 3G4SF 1FNJA 2QA4F 2CHTA 4U3JA 5ITZB 4O2BB 3GHZA 4X20B 1ODEA 3CXCF 3I56F 1GO0A 1YGYA 3M84A 5LXTA 5B8FA 5G4VC 1KNJA 2UYKA 1W3EX 3JAWB 1DBFA 1UI9A 1K9MH 3FD5A 1CN7A 2VGMA 3CCRF 2LBTA 2RHHA 3F0GA 1QAHA 1GZ0A 5EYPB 1N8RH 2B33A 3K2XA 4HNAA 3WGJA 4TV8A 3OBYA 4TV9B 3RYHB 3DC2A 5LXTB 4C4WC 3N2KB 3PLAC 1E7KA 3F0DA 3JALB 3HAXD 2QTPA 1Q81H 3VYTC 3NK6A 5JCOA 1IV4A 2QEXF 2LBWA 1H47A 3WJQA 1QU9A 3U0OA 3JAMM 3KJKA 3IEQA 5GINC 3RYFA 4EI7A 1NJIH 4KWEA 4I50A 3D54A 3JVHA 4B62A 1Q8RA 5HP7A 3S02A 2BTUA 2BO1A 1YJ9F 1W41A 4G4YA 3J80M 4B5CA 4B46A 3JARA 3P4EA 2V9YA 5AVMA 3KJJA 3K12A 3G6EF 1X7OA 3MBMA 5EZYA 1GX1A 4R40B 2YYEA 1COMA 4C82A 1K8AH 1QVFF 2IQQA 2VXYA 3N4ZA 1JFFB 3M4SA 2AMTA 3HTNA 4ZHQB 4FFBA 5FJ4C 4YJ3B 1FFXB 2H6LA 1IV3A 4BVQA 5JQGB 3LWOC 1X52A 2OHWA 3JARB 4TZZA 2UYNA 5C8YA 2Z1EA 5EZYB 1YITF 5MN5A 3E22A 4ZI7B 1KNKA 2HRUA 5MN6A 1XBIA 2CSLA 4X1IA 3WGNA 2UZHA 1OAPA 3KIZA 3M1XA 5GANK 2ZF8A 4RHAA 3P0ZA 5LOVA 1IV1A 2R6R1 2RHLA 5EB1B 3HKCB 1VQLF 2BTOA 2PMPA 1NQ3A 2N48A 2WALA 5HY4A 1T0KB 4C81A 2H8EA 4BY9D 2HP0A 3WGLA 4G4WA 5GIOC 2UYJA 3WJPA 2BTQB 1VQPF 1VQ7F 5LOVB 2W8BC 3WJRA 5CB4B 4IIJB 2IAFA 5IJ0A 3S0YA 5EB0A 1X7PA 1VQKF 3CD6F 3CCLF 2H8CA 4G4XA 3K0TA 1VQOF 1ZWZA 3WXMB 3SIUA 1TUBA 4C8GA 1H7MA 4G88A 3WGMA 4O2AB 5J2TB 1H48A 3JASB 3VCZA 5JVDA 3MCAB 1W5AA 2QI2A 3QTYA 4I55B 5HY1A 5LA6A 2ZAUA 4LCKA 2R751 4G4VA 4LNUA 3RE3A 2Z1UA 5BMVB 4BT5A 3CPQA 2HS3A 2CZWA 2VAMA 3MCQA 3C9SA 3UT5A 3VYSC 5CA0B 3P10A 2RB9A 3L7QA 1YIJF 1TUBB 5LP6A 3E20B 3CCUF 1DT9A 3C8LA 1XV2A 4ZHYB 2CVLA 3CCQF 3PAFA 4U3JB 4LNUB 3NVKE 3HKEA 3KE1A 4BW0B 1ONIA 4ZK7A 3ZOPA 4O4HA 3WGKA 1VQ8F 3D01A 3VO8A 1IV2A 5LP6B 1U40A 4XCQA 4X1YA 1IPAA 5HY0A 3LWRC 4BVSA 2I6DA 4HNAB 4TV8B 4EB6A 3CCEF 3CC4F 1W581 1JD1A 4O4LA 1W2BF 3NK7A 1Z5VA 5EWRA 1M1KH 3FBAA 2UYPA 3EORA 4BVTA 3S03A 2K1SA 1CLIA 3CCMF 3ON1A 5LYJA 1U3PA 3LYBA 4X3MA 4BT3A 4G4ZA 3DDNA 4X1YB 3ZO8A 3T80A 3CMAF 5EO3A 2LCAA 5HY2A 3RYFB 2IG8A 2ZVZA 4I50B 3BYQA 4O4JA 2GZLA 4C8IA 2G9IA 2ZOVA 3RYCA 5LYJB 5GAPK 1R1MA 3FFMA 4EI9A 4B45A 1YJNF 1FSZA 1RQ2A 3IR9A 3RYIA 1M90H 4PWTA 3J81M 1TVKA 3LWVC 3ZP4A 1KD1H 5JH7A 1YI2F 3HKBA 3CB2A 3VOBA 4BVRA 4O4JB 1RLUA 3IEWA 4FFBB 4I4TA 2NMUA 3QHDA 3IKEA 1U43A 1RQ7A 3RYCB 1CK2A 5HXZA 2P6YA 4TUYA 1YQNA 1YHQF 1GO1A 2HX0A 3RYIB 4RQOA 1W57A 5CA1A 2UYNB 3CC2F 5C8YB 4E6EA 1Q86H 3GYQA 2MQEA 3KHNA 3TD5A 2I6RA 2KGWA 5IJ9A 3E22B 3HKBB 4ZOLA 5FNVA 4X1IB 2Z01A 2CHSA 2VGNA 5EAZA 5MN4A 2F9ZC 4NWOB 1VHAA 3D00A 2KTUA 4TUYB 3LWQC 2HS4A 3NMUC 3RA5A 3S0HA 2OZBA 3TD4A 1KC8H 3ESJA 4DRXA 4DXDA 4ZHVA 3ELCA 3LDTA 3ZP7A
chains in the Genus database with same CATH topology
2HVYD 3VMFB 3NVKE 5DCVA 5HXUA 3J7AR 1YJ9F 2BO1A 1W41A 3CG6A 4BW0B 3J80M 3V7EA 1QVGF 3G71F 5A2QM 1VQ8F 3G6EF 1X7OA 4XCQA 2JNBA 1IPAA 3OBWA 1K8AH 2ALEA 5HY0A 1QVFF 3LWRC 4BVSA 1VQNF 1W40A 3AGKA 3N4ZA 1Q7YH 2FC3A 3I55F 2I6DA 4NQ3A 1VQ5F 3SIVA 2KG4A 5FJ4C 2KTVA 5GIPC 3CCEF 3CC4F 3NVIB 3CC7F 1W2BF 5EWRA 3NK7A 1M1KH 2LBXA 1VQ9F 4BVTA 2OTLF 3E1YA 4BVQA 3HJWC 3LWOC 1X52A 3CCMF 3ON1A 2OHWA 4TZZA 1W42A 1PXWA 3OW2F 2GLZA 4X3MA 1Q82H 1YITF 1JJ2F 3CMAF 4EI8A 5EO3A 1XBIA 3LFOA 3CCVF 5G4UC 5FLXM 5HY2A 3V3TA 5GANK 3JCMM 1VQMF 3CCSF 5GAPK 1VQLF 1KQSF 3FFMA 4EI9A 1YJNF 3V7QA 3G4SF 2QA4F 3IR9A 3N4YA 2WALA 1M90H 5HY4A 1T0KB 4BY9D 3J81M 3VI6A 3CXCF 3I56F 3LWVC 2OTJF 1GO0A 4NUTA 1KD1H 5GIOC 3O85A 1YI2F 5G4VC 1VQPF 1VQ7F 1W3EX 4BVRA 1K9MH 1X7PA 1VQKF 1CN7A 2VGMA 3CCRF 1S72F 5IT9M 3CD6F 3CCLF 1CK2A 5HXZA 1GZ0A 1YHQF 1N8RH 1VQOF 1GO1A 1ZWZA 3WXMB 3SIUA 1VQ4F 1H7MA 3CCJF 3CC2F 1RLGA 1Q86H 2FGYA 5HWEA 3GYQA 3MCAB 3OBYA 2QI2A 5HY1A 2AIFA 4C4WC 4LCKA 3LWPC 3CPWF 3PLAC 1E7KA 1RA4A 1K73H 3HAXD 2VGNA 3CPQA 2CZWA 1Q81H 2F9ZC 3D00A 2KTUA 3NK6A 3LWQC 2QEXF 3RA6A 3NMUC 2LBWA 1SDSA 3RA5A 1YIJF 2OZBA 3E20B 3JAMM 1KC8H 3CMEF 3CCUF 1DT9A 5GINC 4X3LA 4EI7A 1NJIH 3CCQF 1YJWF 3PAFA 1VQ6F 1NMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVY D;  3VMF B;  3NVK E;  5DCV A;  3J7A R;  1YJ9 F;  2BO1 A;  1W41 A;  3CG6 A;  4BW0 B;  3J80 M;  3V7E A;  1QVG F;  3G71 F;  5A2Q M;  1VQ8 F;  3G6E F;  1X7O A;  2JNB A;  1IPA A;  3OBW A;  1K8A H;  2ALE A;  1QVF F;  3LWR C;  1VQN F;  1W40 A;  3AGK A;  3N4Z A;  1Q7Y H;  2FC3 A;  3I55 F;  2I6D A;  1VQ5 F;  3SIV A;  2KG4 A;  5FJ4 C;  2KTV A;  5GIP C;  3CCE F;  3CC4 F;  3NVI B;  3CC7 F;  1W2B F;  5EWR A;  3NK7 A;  1M1K H;  2LBX A;  1VQ9 F;  2OTL F;  3E1Y A;  3HJW C;  3LWO C;  1X52 A;  3CCM F;  3ON1 A;  2OHW A;  4TZZ A;  1W42 A;  1PXW A;  3OW2 F;  4X3M A;  1Q82 H;  1YIT F;  1JJ2 F;  3CMA F;  5EO3 A;  1XBI A;  3LFO A;  3CCV F;  5G4U C;  5FLX M;  5GAN K;  3JCM M;  1VQM F;  3CCS F;  5GAP K;  1VQL F;  1KQS F;  3FFM A;  1YJN F;  3V7Q A;  3G4S F;  2QA4 F;  3IR9 A;  3N4Y A;  2WAL A;  1M90 H;  1T0K B;  4BY9 D;  3J81 M;  3VI6 A;  3CXC F;  3I56 F;  3LWV C;  2OTJ F;  1GO0 A;  4NUT A;  1KD1 H;  5GIO C;  3O85 A;  1YI2 F;  5G4V C;  1VQP F;  1VQ7 F;  1W3E X;  1K9M H;  1X7P A;  1VQK F;  1CN7 A;  2VGM A;  3CCR F;  1S72 F;  5IT9 M;  3CD6 F;  3CCL F;  1CK2 A;  1GZ0 A;  1YHQ F;  1N8R H;  1VQO F;  1GO1 A;  1ZWZ A;  3WXM B;  3SIU A;  1VQ4 F;  1H7M A;  3CCJ F;  3CC2 F;  1RLG A;  1Q86 H;  3GYQ A;  3MCA B;  3OBY A;  2QI2 A;  2AIF A;  4C4W C;  4LCK A;  3LWP C;  3CPW F;  3PLA C;  1E7K A;  1RA4 A;  1K73 H;  3HAX D;  2VGN A;  3CPQ A;  2CZW A;  1Q81 H;  2KTU A;  3NK6 A;  3LWQ C;  2QEX F;  3RA6 A;  3NMU C;  2LBW A;  1SDS A;  3RA5 A;  1YIJ F;  2OZB A;  3E20 B;  3JAM M;  1KC8 H;  3CME F;  3CCU F;  1DT9 A;  5GIN C;  4X3L A;  1NJI H;  3CCQ F;  1YJW F;  3PAF A;  1VQ6 F;  1NMU B; 
#chains in the Genus database with same CATH topology
 2HVY D;  2DT4 A;  5DCV A;  5FNV B;  2HP0 B;  3J7A R;  2Q1Y A;  4IHJ A;  1FNK A;  4WBN A;  2AIZ P;  2RHO A;  3FPI A;  4YJ2 A;  3Q8H A;  2VAW A;  3I7T A;  3G71 F;  3F6M A;  2VAP A;  5IJ0 B;  4ERH A;  1W59 A;  3HWU A;  1VK3 A;  3VTI C;  3OBW A;  2ALE A;  3JAW A;  1W40 A;  3AGK A;  1Q7Y H;  1VQN F;  2FC3 A;  1XRG A;  4O4I A;  4NQ3 A;  3SIV A;  2KG4 A;  2KTV A;  5GIP C;  3QUW A;  5JVD B;  3IKF A;  4F6R A;  5KMG A;  2LBX A;  1XHO A;  5LA6 B;  1VQ9 F;  3F0F A;  2OTL F;  5EIB C;  1J7H A;  3OW2 F;  3VYU C;  1Q82 H;  2DYY A;  3LME A;  3N2G A;  2HRY A;  3UT5 B;  4TV9 A;  3RYH A;  1JJ2 F;  4EI8 A;  3IMP A;  5J2U A;  3N2K A;  2PHN A;  4C8E A;  5EIB D;  3LFO A;  4O4I B;  3F0E A;  3JAL A;  2HS0 A;  4F6R B;  5JCO C;  1VH8 A;  3S0W A;  5KMG B;  1VQM F;  3CYP B;  1OFU A;  3HKE B;  3MDO A;  3ERN A;  3N2G B;  3V7Q A;  1T0A A;  3N4Y A;  1SZQ A;  4O4H B;  5J2U B;  4U39 A;  3WPW A;  1QD9 A;  3VI6 A;  2L26 A;  4ZHW A;  2OTJ F;  2CW4 A;  4NUT A;  3O85 A;  3HKD A;  3C9T A;  4M8I A;  1JN1 A;  4EB6 B;  1S72 F;  5IT9 M;  4O4L B;  5IYZ A;  3B6N A;  3FD6 A;  3JAK A;  4ZHQ A;  1JFF A;  1VQ4 F;  1SA0 A;  3CCJ F;  4YJ3 A;  1RLG A;  2FGY A;  5HWE A;  1W5F A;  1FFX A;  3GTZ A;  2AIF A;  1VQV A;  5JQG A;  3HKD B;  3LWP C;  3CPW F;  2Q1X A;  1RA4 A;  1K73 H;  2Z1T A;  1U3L A;  5IYZ B;  5HP8 A;  4ZI7 A;  3MQW A;  3RA6 A;  3JAK B;  1SDS A;  1W5E A;  3S06 A;  3OON A;  1SA0 B;  3CME F;  5GON A;  4X3L A;  1YJW F;  2EWC A;  4BT4 A;  1VQ6 F;  1NMU B;  3JAT A;  3VMF B;  5HXU A;  1TVK B;  3HKC A;  3CG6 A;  5JH7 B;  2ZVY A;  2HQS C;  3V7E A;  1QVG F;  5A2Q M;  3WPX A;  1W55 A;  2Z1F A;  4I4T B;  5GON B;  2JNB A;  4BT7 A;  3R0P A;  3JAT B;  3I55 F;  5CB4 A;  4IIJ A;  1VQ5 F;  5CA1 B;  4BT2 A;  3TD3 A;  2HP3 A;  2YXZ A;  5IJ9 B;  3CC7 F;  3NVI B;  1UFY A;  2OTM A;  3V4D A;  4ZOL B;  1X25 A;  3E1Y A;  3HJW C;  3K14 A;  5KX5 A;  1PXW A;  1W42 A;  4X1K A;  2GLZ A;  4O2A A;  5J2T A;  3JAS A;  3VIU A;  3C9R A;  1W5B A;  4I55 A;  5ITZ A;  3I3F A;  3C9U A;  2CWJ A;  4O2B A;  4X20 A;  3CCV F;  3VOA A;  5BMV A;  5G4U C;  5FLX M;  4DRX B;  2GVI A;  3V3T A;  5CA0 A;  2RHJ A;  3JCM M;  1JY8 A;  1Z5W A;  2ZOD A;  5LP6 C;  3CYQ A;  5KX5 B;  4BT6 A;  3CCS F;  4IHJ B;  4X1K B;  1PF5 A;  4WBN B;  1KQS F;  4YJ2 B;  5EYP A;  3G4S F;  1FNJ A;  2QA4 F;  2CHT A;  4U3J A;  5ITZ B;  4O2B B;  3GHZ A;  4X20 B;  1ODE A;  3CXC F;  3I56 F;  1GO0 A;  1YGY A;  3M84 A;  5LXT A;  5B8F A;  5G4V C;  1KNJ A;  2UYK A;  1W3E X;  3JAW B;  1DBF A;  1UI9 A;  1K9M H;  3FD5 A;  1CN7 A;  2VGM A;  3CCR F;  2LBT A;  2RHH A;  3F0G A;  1QAH A;  1GZ0 A;  5EYP B;  1N8R H;  2B33 A;  3K2X A;  4HNA A;  3WGJ A;  4TV8 A;  3OBY A;  4TV9 B;  3RYH B;  3DC2 A;  5LXT B;  4C4W C;  3N2K B;  3PLA C;  1E7K A;  3F0D A;  3JAL B;  3HAX D;  2QTP A;  1Q81 H;  3VYT C;  3NK6 A;  5JCO A;  1IV4 A;  2QEX F;  2LBW A;  1H47 A;  3WJQ A;  1QU9 A;  3U0O A;  3JAM M;  3KJK A;  3IEQ A;  5GIN C;  3RYF A;  4EI7 A;  1NJI H;  4KWE A;  4I50 A;  3D54 A;  3JVH A;  4B62 A;  1Q8R A;  5HP7 A;  3S02 A;  2BTU A;  2BO1 A;  1YJ9 F;  1W41 A;  4G4Y A;  3J80 M;  4B5C A;  4B46 A;  3JAR A;  3P4E A;  2V9Y A;  5AVM A;  3KJJ A;  3K12 A;  3G6E F;  1X7O A;  3MBM A;  5EZY A;  1GX1 A;  4R40 B;  2YYE A;  1COM A;  4C82 A;  1K8A H;  1QVF F;  2IQQ A;  2VXY A;  3N4Z A;  1JFF B;  3M4S A;  2AMT A;  3HTN A;  4ZHQ B;  4FFB A;  5FJ4 C;  4YJ3 B;  1FFX B;  2H6L A;  1IV3 A;  4BVQ A;  5JQG B;  3LWO C;  1X52 A;  2OHW A;  3JAR B;  4TZZ A;  2UYN A;  5C8Y A;  2Z1E A;  5EZY B;  1YIT F;  5MN5 A;  3E22 A;  4ZI7 B;  1KNK A;  2HRU A;  5MN6 A;  1XBI A;  2CSL A;  4X1I A;  3WGN A;  2UZH A;  1OAP A;  3KIZ A;  3M1X A;  5GAN K;  2ZF8 A;  4RHA A;  3P0Z A;  5LOV A;  1IV1 A;  2R6R 1;  2RHL A;  5EB1 B;  3HKC B;  1VQL F;  2BTO A;  2PMP A;  1NQ3 A;  2N48 A;  2WAL A;  5HY4 A;  1T0K B;  4C81 A;  2H8E A;  4BY9 D;  2HP0 A;  3WGL A;  4G4W A;  5GIO C;  2UYJ A;  3WJP A;  2BTQ B;  1VQP F;  1VQ7 F;  5LOV B;  2W8B C;  3WJR A;  5CB4 B;  4IIJ B;  2IAF A;  5IJ0 A;  3S0Y A;  5EB0 A;  1X7P A;  1VQK F;  3CD6 F;  3CCL F;  2H8C A;  4G4X A;  3K0T A;  1VQO F;  1ZWZ A;  3WXM B;  3SIU A;  1TUB A;  4C8G A;  1H7M A;  4G88 A;  3WGM A;  4O2A B;  5J2T B;  1H48 A;  3JAS B;  3VCZ A;  5JVD A;  3MCA B;  1W5A A;  2QI2 A;  3QTY A;  4I55 B;  5HY1 A;  5LA6 A;  2ZAU A;  4LCK A;  2R75 1;  4G4V A;  4LNU A;  3RE3 A;  2Z1U A;  5BMV B;  4BT5 A;  3CPQ A;  2HS3 A;  2CZW A;  2VAM A;  3MCQ A;  3C9S A;  3UT5 A;  3VYS C;  5CA0 B;  3P10 A;  2RB9 A;  3L7Q A;  1YIJ F;  1TUB B;  5LP6 A;  3E20 B;  3CCU F;  1DT9 A;  3C8L A;  1XV2 A;  4ZHY B;  2CVL A;  3CCQ F;  3PAF A;  4U3J B;  4LNU B;  3NVK E;  3HKE A;  3KE1 A;  4BW0 B;  1ONI A;  4ZK7 A;  3ZOP A;  4O4H A;  3WGK A;  1VQ8 F;  3D01 A;  3VO8 A;  1IV2 A;  5LP6 B;  1U40 A;  4XCQ A;  4X1Y A;  1IPA A;  5HY0 A;  3LWR C;  4BVS A;  2I6D A;  4HNA B;  4TV8 B;  4EB6 A;  3CCE F;  3CC4 F;  1W58 1;  1JD1 A;  4O4L A;  1W2B F;  3NK7 A;  1Z5V A;  5EWR A;  1M1K H;  3FBA A;  2UYP A;  3EOR A;  4BVT A;  3S03 A;  2K1S A;  1CLI A;  3CCM F;  3ON1 A;  5LYJ A;  1U3P A;  3LYB A;  4X3M A;  4BT3 A;  4G4Z A;  3DDN A;  4X1Y B;  3ZO8 A;  3T80 A;  3CMA F;  5EO3 A;  2LCA A;  5HY2 A;  3RYF B;  2IG8 A;  2ZVZ A;  4I50 B;  3BYQ A;  4O4J A;  2GZL A;  4C8I A;  2G9I A;  2ZOV A;  3RYC A;  5LYJ B;  5GAP K;  1R1M A;  3FFM A;  4EI9 A;  4B45 A;  1YJN F;  1FSZ A;  1RQ2 A;  3IR9 A;  3RYI A;  1M90 H;  4PWT A;  3J81 M;  1TVK A;  3LWV C;  3ZP4 A;  1KD1 H;  5JH7 A;  1YI2 F;  3HKB A;  3CB2 A;  3VOB A;  4BVR A;  4O4J B;  1RLU A;  3IEW A;  4FFB B;  4I4T A;  2NMU A;  3QHD A;  3IKE A;  1U43 A;  1RQ7 A;  3RYC B;  1CK2 A;  5HXZ A;  2P6Y A;  4TUY A;  1YQN A;  1YHQ F;  1GO1 A;  2HX0 A;  3RYI B;  4RQO A;  1W57 A;  5CA1 A;  2UYN B;  3CC2 F;  5C8Y B;  4E6E A;  1Q86 H;  3GYQ A;  2MQE A;  3KHN A;  3TD5 A;  2I6R A;  2KGW A;  5IJ9 A;  3E22 B;  3HKB B;  4ZOL A;  5FNV A;  4X1I B;  2Z01 A;  2CHS A;  2VGN A;  5EAZ A;  5MN4 A;  2F9Z C;  4NWO B;  1VHA A;  3D00 A;  2KTU A;  4TUY B;  3LWQ C;  2HS4 A;  3NMU C;  3RA5 A;  3S0H A;  2OZB A;  3TD4 A;  1KC8 H;  3ESJ A;  4DRX A;  4DXD A;  4ZHV A;  3ELC A;  3LDT A;  3ZP7 A; 
#chains in the Genus database with same CATH homology
 2HVY D;  3VMF B;  3NVK E;  5DCV A;  5HXU A;  3J7A R;  1YJ9 F;  2BO1 A;  1W41 A;  3CG6 A;  4BW0 B;  3J80 M;  3V7E A;  1QVG F;  3G71 F;  5A2Q M;  1VQ8 F;  3G6E F;  1X7O A;  4XCQ A;  2JNB A;  1IPA A;  3OBW A;  1K8A H;  2ALE A;  5HY0 A;  1QVF F;  3LWR C;  4BVS A;  1VQN F;  1W40 A;  3AGK A;  3N4Z A;  1Q7Y H;  2FC3 A;  3I55 F;  2I6D A;  4NQ3 A;  1VQ5 F;  3SIV A;  2KG4 A;  5FJ4 C;  2KTV A;  5GIP C;  3CCE F;  3CC4 F;  3NVI B;  3CC7 F;  1W2B F;  5EWR A;  3NK7 A;  1M1K H;  2LBX A;  1VQ9 F;  4BVT A;  2OTL F;  3E1Y A;  4BVQ A;  3HJW C;  3LWO C;  1X52 A;  3CCM F;  3ON1 A;  2OHW A;  4TZZ A;  1W42 A;  1PXW A;  3OW2 F;  2GLZ A;  4X3M A;  1Q82 H;  1YIT F;  1JJ2 F;  3CMA F;  4EI8 A;  5EO3 A;  1XBI A;  3LFO A;  3CCV F;  5G4U C;  5FLX M;  5HY2 A;  3V3T A;  5GAN K;  3JCM M;  1VQM F;  3CCS F;  5GAP K;  1VQL F;  1KQS F;  3FFM A;  4EI9 A;  1YJN F;  3V7Q A;  3G4S F;  2QA4 F;  3IR9 A;  3N4Y A;  2WAL A;  1M90 H;  5HY4 A;  1T0K B;  4BY9 D;  3J81 M;  3VI6 A;  3CXC F;  3I56 F;  3LWV C;  2OTJ F;  1GO0 A;  4NUT A;  1KD1 H;  5GIO C;  3O85 A;  1YI2 F;  5G4V C;  1VQP F;  1VQ7 F;  1W3E X;  4BVR A;  1K9M H;  1X7P A;  1VQK F;  1CN7 A;  2VGM A;  3CCR F;  1S72 F;  5IT9 M;  3CD6 F;  3CCL F;  1CK2 A;  5HXZ A;  1GZ0 A;  1YHQ F;  1N8R H;  1VQO F;  1GO1 A;  1ZWZ A;  3WXM B;  3SIU A;  1VQ4 F;  1H7M A;  3CCJ F;  3CC2 F;  1RLG A;  1Q86 H;  2FGY A;  5HWE A;  3GYQ A;  3MCA B;  3OBY A;  2QI2 A;  5HY1 A;  2AIF A;  4C4W C;  4LCK A;  3LWP C;  3CPW F;  3PLA C;  1E7K A;  1RA4 A;  1K73 H;  3HAX D;  2VGN A;  3CPQ A;  2CZW A;  1Q81 H;  2F9Z C;  3D00 A;  2KTU A;  3NK6 A;  3LWQ C;  2QEX F;  3RA6 A;  3NMU C;  2LBW A;  1SDS A;  3RA5 A;  1YIJ F;  2OZB A;  3E20 B;  3JAM M;  1KC8 H;  3CME F;  3CCU F;  1DT9 A;  5GIN C;  4X3L A;  4EI7 A;  1NJI H;  3CCQ F;  1YJW F;  3PAF A;  1VQ6 F;  1NMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...