4TUYB

Tubulin-rhizoxin complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
424
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 171
structure length 424
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tuyB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tuyB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tuyB01
5MN5A 1TVKA 5JQGA 3ZBQA 2BTQB 5IJ9A 2Q1XA 3JATB 1TUBA 4IIJA 2XKAA 4EB6B 4ZI7B 5JH7A 2R6R1 5IJ9B 2VAPA 2R751 5LOVB 4U39A 3WGJA 4E6EA 1W59A 4I4TB 1FFXA 3JAWA 3RYFA 3RYCA 3HKCB 3JAKA 3JASB 5ITZB 4YJ3B 3VO9A 1JFFA 3VOAA 3M8KA 3RYCB 3ZIDA 4EI8A 5JVDB 4X1YA 2VXYA 3WGLA 4O2BA 2BTOA 4LNUA 4TV9B 4WBNA 3RYHB 5JVDA 4O4IA 3E22B 5CB4A 1TVKB 2RHHA 4B45A 2BTQA 4X20B 3HKBB 3VO8A 1SA0B 3HKEA 5JCOC 4M8IA 2GVIA 4XCQA 3WGMA 5JH7B 4FFBB 4YJ2B 1W5FA 1SA0A 5J2UA 1TUBB 3N2GA 3JAWB 3HKCA 5CA0B 4ZHQB 5CA1B 1Z5WA 4O4JB 5EYPA 4F6RB 5EZYB 5FNVA 3C8LA 3RYHA 3RB8A 4I50B 4ZOLA 1RQ2A 4KWEA 4F6RA 2RHJA 3VOBA 5KMGB 3HKDA 4IHJA 4TV8A 3JARA 1OFUA 4X20A 5KX5A 3UT5B 2Q1YA 4EI9A 5J2TB 1W5EA 4FFBA 4IIJB 4YJ2A 5LA6A 5IYZA 5KX5B 3VPAA 4HNAA 3HKEB 5MN6A 4I4TA 4DRXA 4B46A 5ITZA 5JCOA 5LYJB 1W581 4YJ3A 1JFFB 5J2UB 3WGNA 3M89A 4TUYA 4X1KA 3RYIA 4O4LA 4DRXB 4O2AB 4I55B 3CB2A 4O2BB 4X1IB 3WGKA 4TV9A 4WBNB 5EIBD 4EI7A 4U3JA 5LP6B 4O4LB 5LXTB 2RHLA 4O2AA 3N2KB 3JATA 5MN4A 3E22A 4IHJB 4TV8B 3JARB 5CB4B 2RHOA 4I50A 4ZOLB 3UT5A 5LP6A 5IJ0B 1W5BA 5LXTA 2XKBA 3V3TA 3N2KA 5LOVA 5KMGA 3JALB 5LA6B 5IYZB 4EB6A 4DXDA 4ZI7A 5IJ0A 1RLUA 5M7EA 5J2TA 4O4HA 5EIBC 1W5AA 3R4VA 3JALA 3N2GB 5GONB 4ZHQA 1FFXB 5LYJA 3RYFB 5CA0A 4O4JA 3JAKB 3JASA 5EYPB 5CA1A 4HNAB 4LNUB 2VAMA 3ZBPA 4O4HB 5BMVB 1RQ7A 2VAWA 5GONA 5C8YB 4X1IA 5LP6C 5FNVB 4X1YB 5EZYA 4U3JB 1FSZA 5BMVA 5JQGB 4TUYB 4X1KB 3RYIB 3HKBA 5C8YA 4I55A 3HKDB 1Z5VA 4O4IB
chains in the Genus database with same CATH superfamily
1EGMB 2G9IA 2CUTA 4PA3A 3HVJA 2C9ZA 5FYDA 1KD1W 5AHKA 3ASNB 3MF4A 5CD1A 2BBTA 2MTBA 1QC5B 5TX7A 3ILVA 2GPBA 5CXUA 1YVUA 1NN0A 2H0QA 4R8CA 3R7SA 4JP5A 2UUBB 1AK2A 4IHJF 2QEXF 2Q9LA 1IV4A 2REBA 4MS1B 4U1RA 4Z1MA 3JWIA 4BJ1A 3CJHA 4TSFG 2XASA 5LLTA 2XB2A 1JHYA 1KC1A 3ABIA 3GEEA 3L7LA 4NAVA 1P4GA 1WA5A 3HJWC 2PKQO 5KPDA 3OBYA 1YZKA 3IESA 3SBXA 1FP1D 1QYVA 2IXDA 3SZRA 3OECA 5L3FA 2VP4A 4H0FA 3P4YA 4WXPA 4EKGA 4EYGA 3DBLB 5EJEA 1E1RG 1G1XB 5LZ4A 1TM5E 1BTOA 1L7EA 4XFDA 5ALQA 2AG6A 1XMPA 3ACBA 3IP3A 2ZROA 3Q1LA 1GM5A 1L6IA 4K6FA 1R4MB 1LLDA 3I6BA 2VJDA 2I91A 3DE4X 2J9XB 2ZLBA 1T9BA 2DHQA 3LUGA 1QX4A 3NIBA 2DY1A 4N8SA 4PICA 4ZMSA 3THWB 1NA5A 2ZUEA 1LW6E 3T9CA 1CKEA 1SBCA 3SU8A 3TQRA 4D98A 3GC6A 1W35A 5JLAA 3DZ8A 3OZIA 5ALFA 4DY6A 2ONZA 1KOFA 4OAQA 1Q81H 4BLVA 3S28A 2NQ2C 3KQOA 2FVYA 3FDIA 3UJBA 4OFWA 1PG0A 1P91A 1DEKA 1P31A 3PF8A 4L9RA 1OBHA 5AI5A 5EC1C 1ZM9A 3DOEA 5A3VA 4PAWA 3NTQA 3OPYI 4G5XA 4NMHA 3LWOC 4NOLA 2HRQA 5BN5B 1A9SA 5H4GA 3QUAA 4PDLA 1RPAA 3HXOA 4BRSA 3VZQA 3CEJA 3H99A 1ZJWA 1NE2A 1EM6A 3AONB 2O1SA 2CNKA 3ZRVA 1DV2A 3GLUA 3WYBA 1AXGA 1O97C 1NTZH 4MLCA 1J8DA 1Q1QA 3Q3HA 3VH3A 1LWOA 1NRXA 3C14C 3UXYA 1R88A 2GN8A 3UANA 5ABPA 2H4WA 4QZVA 4P36A 2PBLA 4AF7A 4TN1A 1DKMA 4D5EA 2PUDA 1R6UA 5H80A 2FW6A 3RT9A 5BMOA 3ETJA 2AUNA 3IJ5A 1K3FA 3B78A 1W2GA 3GRCA 2PTGA 1K9MH 1BS2A 1H8HA 5HY2A 1X1SA 2G9UA 3IPAA 2EFYA 2QNBA 1TOAA 2IYRA 2P9QA 3JRNA 3LDAA 1E2QA 3OCWA 1DARA 4OJTA 4W6ZA 5ETJA 1TA4A 1UBRS 3VZSA 5CURA 2O8EA 2XDAA 2G3YA 2X8JB 2RI1A 3N2KB 2EATA 3R3UA 4FYPA 3DDHA 1ATZA 1QIDA 1PW7A 5JJEB 1A96A 3C16C 2LCQA 2FSHA 6REQA 2XQFA 4AAYA 1UQRA 4FWBA 3SJCC 3ML0A 4KPGA 1DAOA 3NFYA 4QUEA 5LQKA 2HZ7A 1DVRA 1FAFA 2EW1A 3JALA 1C9NA 2YUAA 3GWOA 5A4FS 4LRQA 4ZYZA 2F3RA 1R5OA 2DWQA 3FE2A 2MHCA 2QW8A 4GPBA 2A9VA 4B33A 4HBGA 4ODIA 4RABA 1FW6A 4Y8VA 2KBFA 4CM7A 2YL2A 2B7LA 3KJIA 4GE3A 4E4EA 3RARA 2WIAA 3A1DA 3MQWA 4D3ZA 5LMCA 1M6YA 1VE6A 4N23A 2W5UA 5EZQA 5JSKA 2ZRNA 4FDLA 1OYWA 1YIAA 3D6FA 3KSBC 4NR0A 1KDRA 1P5HA 4YCBA 2BTQB 1F3OA 1UKEA 2O0LA 4IGAA 4P81A 1JR6A 2I4RA 2ETNA 1TU0A 2XF8A 3IBYA 1IATA 4IIJA 4LXTA 3PTAA 3BGWA 3I2FA 3SZLA 3O8QA 1NTOA 4HFNA 1VQ9F 1Q1NA 3ZDEA 4EQZA 2BFDA 3UBTA 3MMXA 2QA4V 1PT8A 4M1TA 4ZOEA 3WQSB 3IEMA 1VHAA 2NZXA 2VRNA 1J5EB 3Q8XB 4HLNA 1DJPA 4AMUA 4HWOA 4JC5A 2HTFA 3SM9A 5JCZA 1XU7A 2C7VA 2VJMA 4C76A 1NF9A 3WMRA 1A9TA 3U56A 4POAA 2Z1UA 4NCHA 1RQLA 4WZAE 4YFYA 1UFOA 4BJ3A 2IPNA 4MI1A 2J6IA 2O3UA 4RHFA 5EGSA 3ROTA 2DERA 3JSLA 1BS9A 1Q3TA 4EL5A 1RCUA 3LCRA 1GR0A 2CHTA 1V48A 2WVHA 3VR4H 5IUNC 3ZJYA 3OM1A 1H05A 2WWHA 1BMFD 3BXXA 4M0PA 4NEHB 2F43A 3RFVA 3SIPA 4WOCA 5E1BA 2FFRA 5AXDA 3C6XA 1M73E 4BLPA 2AR0A 4BO2A 2ONKA 3I4CA 3OQJA 1GGJA 2DF8A 2PYJA 4LE1A 4PRLA 4QYMA 2WVGA 3JQAD 4P4NA 1DQYA 2JJ1A 4KLNA 5FOWA 5LDGA 5KSPA 2QV0A 1GT6A 4LZWA 2AI3A 4IPTA 5TPWA 3TD9A 5EBMC 4DYLA 1PZFA 1WVMA 1DQPA 2YHAA 3H1GA 3TI9A 3ZCVA 2VOEA 3DZFA 3H18A 3P9RA 4V02A 3UW1A 3VPGA 5BOSA 1VSQA 1KY5A 1YBFA 4NMWA 4FNAA 1TZJA 3TIXB 4G2KA 4A2QA 1P29A 1QAQA 3AEYA 2NO4A 2YCBA 3U7EB 3D54A 2D0OB 4YT4A 1XHZA 2FJUA 5IYZF 2XOXA 1KBQA 2C42A 3KKKA 5A5FA 3FR8A 2AEJA 2IS4A 2V6FA 3K79A 3AG5A 3AEKA 2CL6X 3PQFA 1EB8A 3GLHE 4GSYA 2CJFA 2FPIB 4QNRA 5DNEA 5K0NA 4EF5A 2AI2A 2RSLA 3LXMA 1IHUA 2GPTA 4HYEA 5IWCA 2Q5IA 3FYSA 4FSXA 4BWVA 2J9FB 2V03A 5FOXA 5AUNB 3CBQA 3PRJA 3QNUA 2RAUA 4MVMA 2IFTA 4XWGA 5FNVF 5LKRA 5JC8A 4HH1A 2GFHA 3QM1A 1K34A 3MMSA 4MQBA 3QU4A 2X19A 1ZITA 4UB8Z 2GCOA 2CNWD 2A5JA 2R8XA 3FVRA 3K1ZA 4YALA 3TDMA 2BR3A 1KK3A 1N0UA 1U5AA 3VH4A 1G8JA 4GZLA 4PC2A 3VA7A 3OF2A 2FSPA 1E7QA 3VDNB 4KYIB 4NQZA 1IVSA 1HWYA 4PV1B 1EZ1A 1L5MA 5BR8B 1ND6A 5EWLA 1Y7HA 4S1OA 1NJGA 4KO8A 5DX8A 4DB4A 2I67A 3MK31 3RUPA 4OGQB 3TI7A 4BVAA 1ZTEA 5LYJA 3IAEA 4CMGA 3PYLA 1QUEA 3FNHA 4C4TA 4ID9A 1UPXA 1L7PA 1OA1A 2F1OA 2DYYA 3CGWA 3GJSA 3QKTA 4R1PA 4J9ZB 2JIOA 4QGAA 4V24A 2FPSA 1K8AW 3TCXB 3I2HA 8ADHA 1YONA 1VP9A 1WN7A 3R1IA 4DUYB 4Y2UA 5GJWC 2BMWA 4MB6A 3UWMA 4PY2A 2A57A 4MWSA 4C8EA 5H68A 3QUTA 1KSGA 2Y0PA 4QGSA 2JFFA 3G3EA 4JK3A 2GYYA 5IHPA 3OPMA 4UU1A 4MW4A 7AT1A 1BRTA 4NCNA 5CDYA 2KQUA 4NJOA 4GRAA 5JOQA 1BO6A 2JFGA 4C7XA 2WLTA 3KFVA 1S8NA 2YXEA 5E4JA 4MR8A 4M7RA 2PTHA 2BFDB 4ASUA 1JZSA 3WQBA 3D7NA 3DYIA 3K9WA 3DV2A 4NC9A 3SYCA 1B3RA 2CHQA 5AIAA 4I81A 4N40A 4A7PA 3ZCXA 5JO0A 4MVRA 3ZKWB 3LCUA 1ONBA 2R7MA 2VJBA 3PRHA 1XTZA 4M6WA 4ZDJA 2XCOA 3DKVA 4KAFA 3SYAA 3I5MA 2JBAB 3BG5A 2W4IA 2R6DA 4ZEXA 5JJIA 3R44A 2B30A 1WP7A 3QVUA 4ARUA 4EKIA 3GJRA 2DFDA 3BMQB 1P45A 1T6YA 3P2EA 4LVCA 4E11A 5C7OO 4MPDA 5YASA 3E0QA 1C1YA 4CKEB 4RXTA 1GLGA 3VZBA 3EIFA 1XTTA 4XIYA 4JI3B 1AU9A 3ER9A 2VYQA 1M93A 4EGJA 1BGWA 2O0HA 1CJSA 1FX0A 1CT9A 3FYUA 1RM1B 1KNXA 1NBHA 1YDGA 2BKXA 1UIMA 4DV4O 4D0LB 4DSZA 3VVBA 1C0IA 5CAEA 1K7FB 1OGJA 2UYOA 3T4ZA 2Q5JA 3FTPA 5BSMA 4BVJA 5BZBA 4H16A 1XDSA 4EAQA 1UPFA 1R1MA 3KDAA 5B5EZ 1DXHA 2J7PD 3E9YA 3OLVA 5JHGB 4MV1A 1QUFA 2QMHA 3U16A 5IPFA 1UOOA 2VUIB 1NVKA 5KMGB 1O94A 2ZAOA 1H1LB 4C2BA 4PRKA 1QG6A 1RT9A 2FW1A 5KDLA 1NVGA 1W85B 3Q8HA 1XRNA 3HL4A 2PR7A 1R15A 2QYTA 1T5BA 2CVFA 2PYDA 1ULTA 3ESRA 3H5LA 1YZBA 5IAGA 3WB2A 3LU1A 3BFRA 4ZC1A 5G4UC 1JXOA 2DBYA 5IYZA 1BE6A 2ROQA 4JASA 4XGIA 3UK2A 1A76A 4TZKA 3VVMA 2YUTA 2QWRB 2H65A 2NV6A 4GYKA 4L76A 4XLLA 3KR9A 2VTBB 2XADA 4HTFA 4CHTA 2FE1A 2Y1XA 1USIA 3NNNA 4ZHVA 2Z2IA 3K96A 5FLEX 4JT4A 3OF5A 3P0FA 5AW7A 3WYCA 2H2FA 1TYAE 3BDVA 5KOYA 3FF1A 4W4TA 3DH0A 3R5TA 5ITVA 3BWDD 3GW8A 4OB6A 1SC9A 2NAPA 1GD1O 3E2PA 4ZPJA 1NBME 1GPDG 1SIWA 4ZK2A 1BE8A 3M4JA 2QD5A 1G8KA 3HABA 2W8BC 1Y6ZA 2FUG1 2L82A 3UTCA 5AG2A 1AZLA 3AY6A 1ILEA 3NHLA 4R7GA 5F2EA 3BSSA 3VU8A 1KSJA 4WZBA 3RUHA 1SAYA 4GPAA 2XMPA 2MR5A 3GP3A 2AG1A 2AYYA 1DAKA 1NMSA 4FLYA 4ZEOA 1IG0A 3O75A 4HAUA 3GH1A 4FFVA 1JFRA 4OHVA 1E3IA 1GDDA 1M1YB 1W73A 2ZUUA 3EIEA 3P9SA 5K0GA 3LP5A 3HUTA 2ZIMA 4KQKA 1XDWA 3A9SA 4MR9A 1GG8A 1TXGA 2E74B 1BMFA 5BW8A 1H2LA 2XKKA 2E4ZA 3GRKA 1U0GA 1GUDA 3TOCA 3ZHCA 2CE7A 3GZNB 3AEZA 4MQLA 3W2GA 4NG4A 3KQPA 5AWFC 2GK6A 3ZTTA 3PNOA 4U6SA 3R74A 4QU0A 4RHTA 5KQMA 5FBQB 1Q0ZA 3CC2F 2MMCA 4YUYA 1YI2V 5K9ZA 1T4MA 4QEKA 2HRBA 4KUMA 4B3SO 1KJJA 3KWFA 4K0RA 2EJUA 3WHPA 3KUKA 3S3TA 2XCIA 1T5IA 1QPBA 2IGBA 4HDQB 3KYDA 4BNGA 2XJ4A 4ON9A 4B7UA 1E2LA 2X7JA 4J7CA 2GRAA 4Q3KA 3ZXXA 3LKVA 1VMAA 2AG5A 4B79A 1NI8A 1E3WB 5KU7A 5DHUA 4X6XA 1C9DB 2E7ZA 3TXYA 1DADA 4O1HA 3V1KA 1TQ4A 1UPTA 2RCYA 2GN2A 2Z2XA 4JYCA 4QSMA 4J16C 5CT5A 2DSTA 3FRIA 4XPIB 4RGBA 2JLUA 5IKEA 3H9VA 2F8TA 1ZN8A 2AOWA 2MYTA 1Q5OA 4ZCPA 3BQ9A 4KWHA 1U2QA 2HRCA 3J80M 4IHAA 4B62A 3QYAA 3LGAA 4V0RA 2ZBVA 4XCQA 5JDIC 1YOVB 3EXEB 3KS9A 4FDAA 1W34A 1Z82A 2FZCA 4GOKA 4WADA 4DPLA 2QTBA 2VCEA 1PK8A 1D09A 2O8DB 1BX3A 2WM9B 3CLTD 5CVEA 1Q90D 2FW7A 4ZAGA 5EJ8A 1TCUA 4YRGA 4EHHA 4W5QA 1ZONA 1ESZA 2V7BA 3HJRA 5H3HA 2AK2A 1TECE 2RQ6A 3UAZA 1CUHA 1JLHA 2IYLD 3U39A 1DINA 3F6PA 1KC8H 4PLGA 4RFVA 1UDCA 4QE7A 5A4MS 1H47A 1ZK3A 4YJKA 1RXUA 1CR6A 1NQAO 3LSSA 2DECA 2NZJA 2QUHA 3QY9A 5IC5A 3HYSA 4MVJF 1I7NA 1YB6A 4TS1A 5I9SA 3SBEA 5J58A 4YMVA 3PXAA 3L75H 4P08A 3F4BA 1KAQA 3ILSA 3OESA 1ZJ4A 2PD3A 4ITVA 3QXCA 4RD2A 4ZC8A 2CZWA 3RWBA 4EI9A 3DHNA 3L0BA 4DK1A 3R5SA 1YE8A 2GJ8A 3AI3A 4XA8A 5BSVA 4IQFA 5EC8A 1CRPA 1CS0A 1SXJE 3H2YA 4KYTA 4YJ2A 3OZUA 3PZRA 5DDIP 2Y93A 4UXNA 1JAIA 2QYHA 3KYDB 1VSBA 1VJDA 1E1QD 1FB5A 2PUWA 2Q0XA 1IY1A 1KO1A 1SM4A 2YS6A 5IAAA 3PHHA 3MC1A 2XX3A 2CLMB 3K15A 4KTTE 2JLVA 4ZV9A 4DWWA 3OAAG 2CV1A 4KFSA 1TLFA 4L6CA 4B3BA 4OK3A 1CR4A 2HJ9A 3UHOA 2WA2A 2HPVA 4L2IA 3LDCA 2ZJ3A 3CVOA 5TEWA 1U7XA 1NV8A 3K58A 2IXEA 3CM0A 2BKAA 1GCIA 3NKLA 4NG5A 3GEBA 1XPOA 4DMUB 3MXTA 1BKYA 4BJ5A 3PHLA 1O7JA 3TDNA 4ZVKA 1WHSA 4I50A 3ZDRA 4QOGA 1IZZA 1VG8A 2OQ2A 3W4JA 1Z2AA 3HB1A 1B1CA 1FMJA 3A2NA 3NKVA 5ALWA 2XXJA 3H5AA 1D4AA 4MKGA 2H1RA 1HR0O 3NHYA 4NZZA 1MB9A 2CLIB 3REGA 2H1CA 1OZ0A 3K9AA 3FROA 2ORVA 1RM1C 2NSYA 3SC3A 1AI5A 1YDEA 3T5MA 1BNCA 3KQVA 2GVDC 1V54B 4DMCA 5I48A 1P81A 1SQ0A 2WF6A 5DEOA 2LVBA 3E05A 5JJKA 4BVSA 1Y7IA 4BBZA 3Q87B 2VAWA 4R2HA 4DEVA 1YEWA 3EXG2 3KOUA 1Q8RA 4LH7A 1D7OA 5B1OA 1OWPA 2B37A 2X23A 1I94O 3DCJA 4HGPA 4M0CA 3F5FA 4K46A 5BMVA 3IMEA 4JOSA 1RPJA 2VP3A 4B43A 3AJEA 4L8FA 1JUDA 3SJAC 2G36A 3BB4A 3UHAA 1ONIA 1E32A 5DGDA 1U8CB 4DDKA 2QRVB 3E1GA 2CXOA 2PPVA 2GD1O 1U2DA 2RGXA 4H60A 2HMAA 1Z0KA 2HQBA 4K40A 4JLPA 4MO9A 1X80A 1BCRA 2ZTVA 4DV4B 2A9JA 1CQJB 4J11A 1VL2A 3MTBA 3NAMA 4RHAA 4DBLE 4ZJZA 2R5WA 3V1UA 2H59A 2HXGA 3GFTA 1QVZA 3H0KA 2LJ2A 1Z16A 2FOXA 3A04A 1IRXA 1QO9A 2PZMA 2GEDA 3DNMA 3GV0A 4XW2A 3VPSA 4BNNA 1AHNA 5JCXA 3L49A 1PFKA 3QPWA 3ZHOA 3ND8A 3QMWA 1HYGA 5CEFA 4HK4A 1SCKA 3HMQA 4IXMA 3V9AA 3ESAA 3W9SA 5C3UA 1A7UA 5KBYA 3L6CA 5FPPA 2CLLB 4BFSA 4DLWA 2AFRA 3PCXA 1YTLA 3D7SA 1J7JA 3FBGA 3SBOA 4O4HF 3E22B 1UXJA 3QYJA 3SD7A 5B58T 1EAMA 2B2XA 2J3IA 4WLOA 3W4KA 3WGIA 3IKEA 2QORA 2RHMA 4WECA 3UO3A 2FPGA 4BZQA 1Y6XA 3O73A 4CM6A 1RZVA 1ST3A 4DL9A 3JQAB 3BCRA 3CLUD 4UZEA 5K6TA 3OE7A 4N3CA 3OJEA 1TUBB 1ODLA 4BX2A 4XDHA 2OAEA 3P7MA 1I1NA 2ZIGA 3B4SA 4IX9A 4KXMA 4LQDA 2H8KA 3K14A 3DWEX 4PQRA 4Q12A 4RJJA 4WXYB 3TZHA 4IJ6A 2NU6B 2UXCO 3H0CA 4X45A 2H52A 4J8PA 1L5WA 4OH1A 1QOQB 3L74H 3NP9A 4RJLA 1T3SA 3KSRA 2MSEB 4MPJA 1FKAO 4RJKA 5FL3A 4UAVA 2X7XA 2WKRA 4HTAA 2D0PB 4IXDA 1AR4A 4LOKA 1KHHA 4RQUA 1YBVA 2F1JA 4EPXA 3M70A 4PZYA 2PZSA 5KZMB 1FTYA 1I6MA 4GKBA 4AXBA 1QM5A 2GLUA 3R3JA 4MZDA 4N0QA 4TLAA 4HQ6A 5A06A 1PL6A 5E7QA 2ACWA 1QYRA 1AS2A 1K3UB 1CSEE 3CEPB 4UM5A 2GHIA 2OY0A 2D06A 2P06A 1OZGA 1XXHE 2EP7A 5IT4A 1H8EA 4KDFA 4W9NA 1OH5A 5HTOA 2QDXA 4GPTA 1QSGA 3OKAA 1JZTA 3O7MA 1P62B 3FPGA 2JFOA 4YR9A 1L4BA 1UODA 3EXFB 4YMUA 1VKRA 2JZOA 4GP7A 3FD8A 2XYGA 3D64A 3GY0A 4QXAA 3K9CA 4XJVA 5HKAA 5GAJA 3LBAA 3SPHA 5IT9A 4AKGA 3I3FA 2CBZA 2DT8A 2PZLA 3HUFA 1MOSA 3NLLA 4Z0NA 5H59A 1QRUA 4HC4A 1P74A 2Q6OA 3WIBA 2B6HA 1XJCA 4HG2A 1ISHA 4D6TH 1KYVA 2CN1A 4K2HA 3QVMA 4MV8A 4R8KA 4ZVLA 5BSUA 3L04A 4Z3OA 5AXAA 2HA7A 4GYWA 4QHTA 5IVHA 2IEIA 2UKDA 5CTAA 1O94C 2BV3A 4Y6GB 4ND6A 5J5VA 1KAMA 2EDCA 1CZKA 1MV5A 2FPOA 3ES9A 3SEAA 3OD4A 1LBSA 2ZRDA 4MJLA 3L0IB 2DHEA 3H1TA 2ZUDA 4KMMA 3FDJA 3H5IA 4BPRA 5BORA 3R8CA 2VTVA 5C8YB 1CY2A 1WF6A 4OMCA 3ZU6A 1UM9A 3MA0A 2IH4A 1D1PA 3IUNA 5LDHA 3FD5A 2WG0A 3DHWC 5AI6A 3RV3A 2HYIC 1EDEA 3FKSD 5K1XA 4K9SA 1R8XA 4MINA 3A4NA 1XDDA 2GHTA 2XAGA 1NDHA 5AQ1A 1HF3A 2PD4A 1Z7EA 2PKRA 3N8IA 4W8HA 4YIKA 4EJSC 3Q3VA 3FTQA 3SPGA 3H05A 4HWRA 5EQDA 3WR5A 3X2FA 1OBCA 2WUFA 3EHEA 3FZQA 3OGCC 4DRYA 1EBFA 3DZBA 4XWWA 4QPJA 5IJ9B 2GHRA 4UKDA 3SPCA 4UBJA 1X2EA 5FI0B 1DJOA 2IY7A 2YFQA 4DIFA 4YBRA 4IGGA 2ZT5A 4KQWA 2DYSC 2BI4A 1IOZA 1SCBA 2QN6A 2AB0A 1IJKA 3F7MA 3P9QA 1W4BA 4KBGA 1PZMA 4KN9S 3A9CA 4ZVQA 2Z3YA 3VOAA 1KEUA 3TLJA 2V7QG 3CRZA 3U1TA 1QRTA 1CE8A 1U0SY 4LVNA 1RWPA 3FMOB 2QTNA 2BFEA 1VGRA 1I2DA 2GARA 4WFQA 3UYKA 3WDSA 3X2SA 1WKVA 4MQEA 1VF5B 2AGAA 3CTPA 2MINA 3ANTA 1VJCA 2GF2A 3Q9UA 4TMWA 1E5TA 4GXQA 5DTRA 5IM5A 2CV0A 4MWCA 2C4HA 3C3CA 1F17A 1PQYA 4CBVA 1PL8A 2JIZA 2BSQA 2Y05A 1ZAKA 5AJWA 2ZTSA 1XZDA 2BCCH 1L8XA 3UM9A 2OXEA 2NXEA 1XT6A 3GHYA 1GTOA 3LO5A 4QGBA 1JSCA 4GBGA 3NGXA 2YIAA 2POCA 3KVRA 4PQFA 3UQ8A 1NG9A 1Y4MA 5CVUA 3GT0A 1NNSA 2CDBA 2ORWA 2LQTA 2F23A 1IQRA 3HACA 3C3WA 4TT8A 4YRLA 3T3GA 3TXXA 3UK6A 5B4UA 4JGSA 2ID9A 1M1NB 3IB6A 5AVYA 1XZPA 2FG5A 5JRZA 1E4EA 4KSBA 1N6HA 1ICEA 1KY3A 1L6RA 4UUNA 1NM5C 2I4NA 1YE5A 4IVNA 4MLZA 2W83A 2VK2A 2NO0A 3K2BA 4Q82A 4X8LA 2ZITA 5E6SA 3S1LA 3W3AD 5IDQA 3DFKA 3ZLTA 2OZPA 2V4UA 1U3TA 3Q11A 2QTPA 1JJBA 4XCVA 2HIHA 3NKFA 3AUKA 4DLXA 4Q93A 1XZAA 3J81k 1C8VB 4GF5A 3RJTA 4EENA 5BWMA 1WSDA 2IH1C 2PZKA 5CX1B 3RFCA 1FVFA 2PKQP 3DAYA 1VSTA 3DZIA 4BE7B 3PWTA 1U9JA 2OZLA 2OSBA 2XW6A 2VQEO 2IAFA 4NS1A 5FTJA 3ABLB 3N2NA 1MAHA 3HCEA 3GB9A 1G5HA 3CG4A 4YHHB 4Q00A 3V2GA 3EX7C 1RQNA 2YR0A 1PJLA 3U7QA 3HZOA 1ID1A 3RYIA 2XUAA 3GJTA 1R6NA 2WT9A 1OPRA 3I9V1 3L8DA 4LOIA 2AOUA 2C1EA 4ZT2A 2CEAA 2OESA 2ZJ4A 4M0KA 4KPUB 4O4LB 1ZG3A 4YFVA 4RSMA 5BURA 4QNMA 3GVCA 1RZ3A 3A1TA 4N7JA 4U0JA 1V4BA 4KAXA 3ZK7A 1W40A 3I5DA 2BHNA 3MWEB 2VXBA 5TNXA 1UL1X 3ZNQA 2QMEA 2HSGA 3CLSC 4RGYA 1KDPA 2M32A 4JVOA 2W58A 1IPFA 3JALB 3T12A 4DOMA 4KFUA 4B3CA 3BILA 8MHTA 3E86A 4ASUG 3WLNA 5D86A 5DMHA 1YNSA 2GUWA 3S27A 4DZTA 5FBRB 3LQ1A 2YC4C 9LDBA 4QVGA 3CE6A 4M4SA 3TTSA 2GZHA 4DYHA 2I9PA 1JJVA 2VH5R 4F3RA 4GR9A 4QGFA 3KXLA 4ZTUB 2GT1A 2QU7A 3PFBA 1YQQA 3D6UA 4ZZIA 1IJBA 3G9ZA 3I8OA 3KQNA 1FSZA 5LGNA 1E9AA 4ZDWA 4JDUA 2V5UA 4BVFA 2OCHA 1Z38A 4ZYTA 1A72A 5EHIA 4C89A 4CW7A 2Y69B 4ZT4A 3OSUA 3K0EA 2QM8A 1P1RA 2HX0A 2A33A 3E3MA 4HDMB 5L45A 4KQIA 2F66C 2BHSA 4C6TB 2UYKA 1NUAA 1C7ZA 1WQ3A 1TUBA 1QX3A 3WLMA 5TVKA 5AOCA 4M49A 3UJCA 5LZ5A 3KVYA 2ZUBA 3G88A 3M4SA 1BN7A 2A78A 1J8FA 4IDCA 3IAFA 3I6ZA 1BN6A 2A94A 1DDGA 1JR4A 3UB3A 3JASB 5K3AA 4HUJA 4YJ3B 3OFKA 3ZHBA 4DUYO 1VQLV 1UR5A 2B8NA 1FP6A 2Q3HA 2BE7A 3ZY6A 2XQVA 4BO4A 1PR9A 1Z6AA 4Q4JA 2YJNA 4ZI5A 3GZTB 1E9SA 2I3BA 3P9ZA 5EESA 4B81A 1QTQA 1TQHA 2CLKB 1H9CA 1X1TA 1KYOF 1J2EA 3OY7A 2F1IA 5L4LA 1HE3A 4DT1B 1PKEA 3UHJA 3D6NB 3CYFA 5EPOA 3U10A 3EC1A 5DP1A 3REOA 4CMIA 1E9CA 4A0HA 2H4HA 3SIXA 1OYVA 1F1BA 2CE4A 3AHHA 4M8KA 4DNXA 3ZK8A 1YQ9A 2EILB 4G2TA 3RFXA 4CF6A 1Y7LA 3F67A 5KTMA 1M8PA 5B66Z 1O08A 1SA0A 1V95A 1SU8A 2J9YB 3PCRB 4LOHA 5FPYA 3NETA 1DO2A 4RTMA 4V0MA 4HMPA 5K6AC 1KRWA 2HJWA 3SZGA 1YB7A 5JCPA 3CPEA 2J5QA 5C4IA 4N6OA 4LJRA 1VF7A 2PZGA 3DM9B 2FSSA 3G4SF 1SZXA 3RVBA 1YQDA 1O57A 4C4WC 1AY0A 5TRTA 1VLQA 4L73A 1P60A 1MO3A 4G89A 4II3A 3RHZA 4BFUA 3RYHA 3G2JA 1ZWKA 4KH0A 3W78A 8AT1A 3EPKA 3DT9A 3CWBH 4Z9BA 3R8XA 2IXBA 4WKOA 1GO1A 1QLJA 3ERNA 3ZGVA 3AB8A 2ZOVA 1SOUA 1BE3H 3HKDA 2DTEA 5FFMA 3PNMA 1E8DA 4OXRA 5GVRA 3C6ZA 1A4RA 4TKUA 3H1EA 1RPRA 3ESQA 3L8CA 2VHYA 2WD7B 3PEWA 3B09A 3EGDB 3GDFA 4F93B 1E3TA 4XLZA 5BSHA 5ECGC 3G7SA 3AVYA 4XB6B 5CG2A 3E9ZA 3GDHA 1OOEA 3PJSK 4MSWC 1TI7A 5CT8A 2X0NA 3CVXA 2QMZA 1L4FA 3R9WA 1AP5A 3DXRB 1P1IA 1M5IA 1B42A 1Z8HA 1PI3A 3NYIA 4KP4A 2OG2A 4Z7QB 1MJNA 1WETA 1XZBA 2LBXA 2BVNA 5CUQA 2IHJA 3JXEA 4BV2A 3CVYA 1QH1A 3LC0A 5LLSA 4ZRDA 2VDUE 1EE1A 3NVKI 2LO1A 3ZRSA 5TGZA 2O8FA 4PFKA 3GAMA 4LZLA 3CCEV 1QAOA 3JV7A 3V7UA 4C6RA 1FXHA 3IEUA 3O90A 4R1OA 4DV2O 4LFAB 1RM4A 1NSTA 1UDWA 2GCOB 2I1WA 3G8YA 4RU1A 3OEHG 5EK0A 1CRZA 3QLJA 3VV3A 4BMOB 4F5WA 5DBFA 3TQQA 5K0BA 1H4VB 3IE1A 1JDZA 4QYIB 3LWPC 3PHIA 3TKAA 2NU9A 3IAXA 5IBCA 5CYPA 3SQDA 3HEBA 4GI3A 4Q9AA 1RRMA 4LCUC 1NOIA 3LKZA 3UN1A 2XLBA 4ESOA 4UCRA 4OXQA 2WU3A 2ZTHA 2WT4A 1FFXB 4MW8A 4HUQB 1WHTA 3OT7A 5A2QN 5A3SA 5TQVA 4B44A 4D0GA 4PRYA 1SXIA 3OA2A 1NHWA 4R7ZA 1Z2EA 4D9HA 1JS1X 5IANA 2BEVA 5FBKA 1E94E 4JR0A 3EGIA 1ML3A 2PMKA 4DQKA 4P0PB 1AB5A 4YCJA 1PZHA 4UUJC 1TA8A 1SVMA 2BFMA 1AROP 4MVJM 4N8DA 4WVLA 5D3QA 4BQPA 5JNTA 3D8RA 2E4AA 1EQ2A 1I2ZA 3CR8A 3LWZA 3OPNA 4PGMA 4PSCA 3Q15C 1KH3A 4CDGA 5KHOC 4JJ7A 3AIOA 1IBMB 3OA0A 4WLUA 1OY1A 1OAOC 4JZGA 3B9QA 4FZVA 4TUYF 1CERA 6PFKA 1E2BA 2XNJA 2HLNA 3KG2A 2VSOA 4UUMA 1Q0QA 3DEFA 1N5OX 4LZAA 1K86A 2HWUA 2RG7A 2VEDA 3A3YA 4FB5A 3GUHA 3ZCPA 3EEYA 3HA3A 5ALJA 3GWGA 4DLRA 1K5QA 1VIBA 5C5EA 1Y5RA 5JVDB 1SUIA 1NFRA 3NB0A 1Q1GA 2OCLA 4FVTA 1SRRA 2O7QA 2W6CX 5TVGA 1BC5A 4KIFA 5CDTA 3SQWA 3T5CA 1G17A 3H9GA 1KI9A 2QDKA 2WWYA 1XAIA 1ZS9A 2IZOA 4C43A 3BUSA 2PKYX 5FOTA 4JVLA 1A5ZA 3WK5A 2QA4F 4ND5A 5BWNA 5EBLC 3SF0A 1WUYA 2VC2B 2J46A 4PZCA 3RVQA 3SP1A 2GHYA 1ZD3A 2LGJA 4DJ5X 4KXYA 1QKIA 3VDQA 4KLRA 1T6NA 2BLLA 3N2ZB 3DLBA 2FEMA 2JLBA 3DPIA 3E1YA 5DK6A 3S2SA 5HBRA 3CUSA 3DLHA 1WXWA 1EK1A 2EFGA 1NXQA 2ZAIA 2PGXA 3OTOB 1DI0A 4GXTA 2XVZA 3DWGA 3V1LA 5EI5A 5BXYA 2WJIA 4JR1A 3VQXA 2RB9A 4Q4LA 3O8LA 3VJLA 2WF9A 4NHEA 4KR7A 1FTSA 4KIWA 1RYDA 3GZNA 4XGQA 5E9AA 2OCKA 5L7WA 1X1DA 2XWJI 5DULA 4L6IA 2RCVA 3EWAA 1CR1A 4F4FA 3KYJB 1ZNQO 3VBBA 1MDFA 1OREA 2VO1A 1R0SA 3DB1A 3FSRA 3G9QA 3CX4A 2QVYX 1ZIXA 1CUFA 4LI3X 5HX7A 1GH6A 4L6AA 2ZD9A 3AR5A 1AQLA 1U7ZA 1VK3A 1BFDA 3DV9A 1NYRA 1FFTB 1QYWA 2E37A 3JX9A 1AZSC 3DEZA 4LX0A 4MQFA 5LA6F 1I3KA 2V7PA 2WTUA 2OGWA 4NFSA 2I6UA 5E1MA 1HEUA 1F2VA 4R1UA 5FB3A 3OIVA 4I9GA 1HYBA 3MWGA 2Q4OA 1L5LA 1XZFA 2V0GA 5J4VA 1R8SA 2HMVA 1XEXB 1C9JA 2QTLA 3KKQA 1BHO1 4L07A 2VI5A 4M88A 1NYTA 5G4LA 4MUFA 1FFYA 1EWTA 1JF8A 2IF2A 3EUFA 4ZT5A 1GXSA 1TIPA 1JLSA 2ACKA 1B93A 4TZTA 5M5BA 3RSGA 1Q20A 2GVZC 2H63A 1EXWA 4LGCA 3ND5A 2QUKA 4KE7A 3FB8C 2EOAA 2R7NA 3RSQA 4MEJA 1YU6A 4WNAB 1U6KA 5M2QA 3PQDA 4QU5A 2FMLA 3EFOA 3I9MA 1LDEA 4NOKA 2P2SA 1I6WA 3P4UA 2BIFA 5KS2A 3UJAA 2X8JA 3VQVA 4LE2A 5DYWA 3BA6A 3JQ8B 4HJRA 1F38A 4Q24A 3MB5A 3DVAB 5J2TF 3CCEF 3KT0A 2QNIA 4XARA 1OLUA 3MSXA 1C3OA 1LW7A 3DYVA 2FN8A 1SQVH 2O1EA 5EIBC 2P78A 3LNCA 4FW8A 1GKLA 4QPCA 1ODFA 4KRXA 2FMFA 4RUKA 5EUBA 3UAGA 4DR5O 1G41A 2UZ1B 3OONA 4O4IF 5CDHA 1UK6A 2VA8A 3AP1A 1OPXA 1OC4A 1ZGHA 4AJIA 3LXRA 1O58A 1MENA 3ZY2A 4N41A 3H8JA 4PF1A 4DKJA 1P4AA 3WSVA 3X1YA 1G3RA 1VIMA 3VC3A 4GUNA 1GPYA 1TT5B 3K32A 1MEJA 3R40A 4KQCA 4MRMB 5IDVA 3QPUA 1ZSNA 3ZYCA 5KHAA 2G1JA 1KDZA 1ZD2P 4DV5O 3HA2A 4UHDA 2JEUA 5ALSA 2Y92A 1HYEA 5IJ9A 5JAPA 3MBIA 1K6JA 3PGJA 1JSXA 3GI1A 4IDBA 2XOKG 3NWJA 1VSUA 1P75A 4OAPA 2I34A 4UREA 5DT9A 4TQUS 3TRDA 4P30A 3I42A 3KXIA 4MWZA 3I83A 2R84A 3GLKA 1PFGA 3OUUA 4R31A 4UMEA 1JR9A 3NR2A 4QPKA 2C5SA 3A9WA 3G8BA 3SMQA 4A0RA 1NUSA 5JRJA 1W4LA 2HA0A 1UBNA 4G56A 3A1WA 4NH4A 2C84A 1J20A 3N7UA 4IDEA 4TMVA 5A4DA 1LBTA 4C7VA 2DJ5A 1KQGA 2R1UA 2PUGA 3ZV5A 1ICIA 1Y8RB 3SPJA 2NSHA 2VNAA 1T9CA 3NBQA 4FONA 3D01A 1T0PA 4XD2A 5P8WA 5KQRA 1CIVA 1BDBA 2Q6IA 4L27A 4ZJPA 5B36A 5KTKA 4HLQB 1PD1A 2PLRA 2A0KA 3E9DA 3AG6A 2X4GA 3SR4A 1E2FA 2X8AA 3R9IA 4I0XB 1PLKA 2P4QA 4AK9A 2NQ8A 1PNTA 3IHLA 2QX4A 3IEVA 1UBUS 2WSSD 4KVFA 2H1IA 3QJYA 4PHCA 3WZMA 3F0FA 1JQ3A 2V5VA 2XOEA 4RD3A 3MS2A 2L17A 3V4PB 5AHXA 1G3QA 3OR6C 4WEOA 4I1PA 3KC2A 1NNI1 5H81A 2SNIE 1N5IA 4CEJA 3RD5A 3QFHA 2ZXWB 2HI0A 4JXXA 1I4TD 1H5NA 3COPA 2SKEA 2K2QB 3BJMA 2XA2A 5CHYA 5BWBA 3II6X 2O2ZA 7YASA 3E61A 1M2JA 2A3QA 3N5KA 4KR6A 3HSSA 2GNPA 1ZESA 4YY3B 3E7FA 4WZBB 3VOBA 3A3NA 4G27B 2HP8A 4ZZ3A 1M2OB 5GTDA 1CF9A 1XV2A 4FHGA 4C08A 1A9QA 1MU0A 3PNSA 3IMPA 4DAEA 2M6RA 4L4ZA 4X9QA 3U7RA 3RVSA 3JQBA 4Q9JA 3AR2A 3GFGA 2BT4A 3J80N 1XMIA 4NNOA 4QPPA 4C7MA 2XMDA 4W5OA 4XWYA 2FDRA 3L9DA 1KAOA 1FZTA 1GN6A 1K33A 4YYZA 5E9QA 4Y7CA 2ZZKA 4LF4B 2QI2A 5KTSA 5DHFA 2VF2A 3JWEA 4Q7EA 3LWVC 2ZTUA 4D79A 2OO5A 1BEEA 3PD7A 3WFZA 3U9SA 1S89A 3JS5A 3O3NB 5DYIA 2JI8A 4BO0A 4YDSA 3S3XA 4WE3A 1DNPA 2RAFA 4AURA 1HXHA 1OROA 4M0LA 2VNKA 2OTLF 3BAAA 1X3SA 2RG1A 1PP9H 5ADVA 3OO0A 4NP6A 4ANFA 4BO8A 2Q6TA 2FC3A 4HATA 3DBHA 3L40A 4HXEB 3A0RA 2A9QA 4DQ0A 1X42A 2VTEA 2C4WA 3INNA 1Z0JA 2GMWA 1AJQA 2EZUA 3KB6A 3QMMA 2WEKA 4M7WA 4OMUA 4B71A 5B6JA 4D9MA 4M1EA 2HADA 4PNHA 2YCLA 3JASA 3IVGA 3OLYA 4FQ8A 2WICA 1ITZA 5IFLA 1V5GA 3U3JA 3C3AA 5HXZA 2P9TA 4ZGWA 2IYQA 1FXUA 3NT4A 5KTRA 1GSAA 1YR3A 4FFRA 4X1KB 1GITA 1JDVA 1M2VA 4JB3A 4D56A 1NIPA 1RJEA 2OHFA 3C98A 1R50A 2K5UA 4Q1VA 1QJCA 3T1CA 3INRA 4IIDA 3CXHF 3OOEA 5D5HA 1JHDA 2HFEC 2IDMA 3BK2A 2WVJA 3BMCB 1EX7A 1DG9A 3BD7A 4I66A 4WKPA 5HMMA 1DTWA 1USKA 5ELLA 1AGPA 1DUSA 4IY1A 2GBCA 3DZJA 3F90A 3AG3C 2QRVA 1MUUA 2OXIA 1QIKA 4YX9A 4DMFA 3FWKA 1RHUA 3K72B 5DIZA 1FBTA 1J90A 2WOOA 4NSNA 4X3PA 5A4AA 2C82A 4EF6A 5LWQA 4DA6A 5ITZB 1OLXB 2FE4A 3N0XA 1CY0A 2EERA 1HYQA 4NABA 4U8HA 1COMA 2OXCA 2W93A 3AL0C 3M4YA 1OFUX 1WPGA 4NULA 3BWMA 1K73H 4AKSA 3CC2V 4BMCA 5L6MB 4QREA 2TYSB 3V33A 4JVMA 3TR5A 1Y76A 2RBEA 2WIBA 4FIPC 3ZUGA 4O3MA 5KYWB 3HGMA 3WTBA 2HRUA 3MGCA 2H9AA 4OCZA 4OB8A 3BT7A 5DGHA 3BHIA 5LZ9A 1XMVA 4M36A 3HKEA 1EG7A 4B2PA 3DC2A 1RBZA 3VZCA 5KDOA 2ZRGA 2RJ3A 1V9PA 2Q69A 2GCGA 3NC1C 2B5OA 4H77A 4L3VA 2EEZA 4MR7A 2H6LA 4P86A 4UXHA 2H2GA 4MKRA 2XB4A 1N9KA 4HCJA 3PC4A 1G5QA 4U6QA 2WKSA 3RROA 3F9RA 3UV6A 3MVEA 4B4KA 4UOEA 3AFGA 1TYDE 3NHSA 2DULA 2OZKA 3CH4B 2N04A 1ESNA 2VPTA 3BX1A 3FYUC 5BSRA 1F2UA 4JUBA 5FOQA 5M04A 3FPHA 4Y3UA 2PD6A 4ZQGA 4S2UA 1A7AA 4PDRA 1Z8NA 1P80A 2CGNA 3PFGA 4F2HA 4P0QB 1R0LA 1IQPA 2AN5A 4CH6A 1BHBA 2HRYA 3ST7A 2QRNA 4TYNA 4FM1A 4JB8A 2FJPA 4PBTA 2WWFA 2WLKA 1IEXA 1B23P 1HT1E 2ZAMA 3TZ6A 1U0BB 2QZSA 1NASA 1EVKA 5A02A 3KEGA 4EFKA 2P9EA 4XPZA 3DBHB 3VAYA 4AO7A 3L84A 2V7VA 2YHSA 5FPHA 4YAJA 2C31A 2R60A 4QG7A 4PYRA 2Z04A 5FNZA 1KJQA 4DILA 4ED9A 1KI7A 3TWOA 1NXOA 4KL8S 1DUVG 4AJNA 621PA 1C0PA 2Q8VA 4NYJR 3RADC 2J9RA 3NASA 2AXQA 5JD4A 3DWIA 2PS3A 3G6WA 4G81A 1GVHA 3DCNA 2ZJ6A 2O0KA 2FKXA 3PN1A 1FS6A 1RYHA 1K6MA 2ZYDA 5EE5B 1G1AA 2EKQA 4Q4CA 2DWEC 3OEEG 2WHEA 2FXVA 3D36A 1P3JA 1TADA 2ZKIA 3FPBA 2HMYB 4A8HA 1XTRA 1YOVA 4YK7A 4XQCA 4ZVVA 3O0TA 1QFYA 4J0FA 4C8GA 1P77A 4NARA 3TL3A 3U4HA 3QWIA 3W2FA 3QE3A 2BBSA 2IU0A 3L18A 3SCZA 4MVJA 3MJCA 5D1HA 2WLNA 5DI9A 1NVWQ 3RRZA 4HDCA 3RNOA 1V4NA 1KTIA 2FUNB 1NG1A 5AXBA 4DXHA 2CHGA 3FLEA 4REMA 3I9FA 3PX7A 5LP6C 3B5IA 3N7AA 4XFKA 3QUWA 1ADCA 1DX9A 1N5LA 2PX0A 3K05A 1ZOLA 2XNDA 3M4ZA 1XDGA 2QN9A 4UMDA 5H0IA 5HYVA 1X1QA 3DOIA 1NP6A 2Q27A 3FYCA 4RPGA 2AMLA 2NO6A 2ZSUA 2Z57A 4U7TB 2CDCA 3UT6A 4IQ8A 3INGA 3L07A 3EXG1 1FRVA 1AR1B 2ZBDA 4P3OA 4QBGB 2HNBA 4UVEA 1KSFX 4LCBA 4ENUA 1T9GS 1TVMA 1OIXA 4CEIB 1F0NA 2A9FA 2HIGA 3RC7A 3VZRA 1OLOA 5T4HA 4BMNA 3ZD7A 4GVPA 1JIKA 1NTMH 1CFJA 3CXRA 8LDHA 3AHCA 3FW1A 3LHSA 1POWA 5B3LA 2BZSA 3Q40A 4HADA 4F2DA 1J6UA 1WEHA 2BR5A 1ZC3A 5I3ZA 1VRWA 3S0JA 3V4RA 5SYNA 1ZWIC 4HB2A 5DNUA 3I6YA 2QY9A 1F8GA 4N54A 1A27A 2VHTA 5DTQA 2FR8A 1TTTA 3A05A 3QE0A 3IOBA 1JVSA 4ZYLA 4CG0A 4CMEA 5DLDA 1HTTA 1PLLA 1VCMA 3PFIA 2XBMA 1S8FA 5CA1F 1FTQA 4F4JA 4B9AA 3WDLA 3L70H 3OCYA 2HBZA 2LV8A 3L0DA 2P90A 2GUGA 2EZOA 3R65A 1DBWA 1V3VA 1IPAA 3UV3A 4BAYA 3LHDA 1TAEA 3TMYA 5HEKA 3WJRA 4AWXA 3A9TA 3PEFA 3LT1A 4HAYA 3DULA 4KJZA 1O0BA 5HZKA 3IVRA 4QXQA 4D9IA 1OE0A 2C94A 4CF3A 3HBAA 5CMUA 3VKUA 1T2VA 4DR7B 2DPLA 2HJRA 4UNRA 1UEXC 5IF9A 3WPXA 3SZOA 2QJ1A 3FCYA 1CUXA 4IIUA 2ZVJA 3A32A 4D8YA 5DSXA 4BY9D 3EYAA 3MYRA 4JB0A 4TL7A 1Y6JA 3QOFA 5I01A 3WMXA 2G77B 2YVQA 3ZV3A 5BSFA 2X2FA 2DWOA 1UPBA 3PUIA 1RXSA 3DC7A 1WAZA 2W6QA 4L02A 2WLSA 4R2XA 4EW6A 3DE7X 3GVIA 1E63A 2FHSA 4ZI3A 2ZAYA 4L5YA 1NI5A 4EX7A 9GPBA 4NPAA 1C2YA 1QANA 3KKMA 1R3IC 4KP7A 5KNDA 1LNZA 2EX3A 1QKJA 4J7UA 4RA9A 1G64A 3M3HA 4DDTA 4X1KA 1M2VB 3K20A 4RAQA 4BDTA 1UWVA 2BTUA 3NUZA 1X86B 4Q7LA 2IOQA 1RLGA 3VUEA 3U0ZA 4V2UA 1BQ3A 1XU4A 2GZDA 4U3JA 1CEXA 1LX7A 4JLUA 4KKXB 3SX4A 2ZZNA 4EP1A 3ON1A 3OLXA 3E89A 2D7JA 2FP4A 2REXB 2BFAA 1HDIA 3QU2A 4TV8B 1SK8A 2QX7A 1EQAA 3GG2A 1FXKA 4MGZR 5CNMA 5DO9A 2YWEA 4MROA 4OHZA 1W7AA 4TKMA 3PC3A 1VGVA 3ZQ4A 2PX4A 4FJCC 1IPHA 1RM5A 2EQ5A 2QT0A 2ZTMA 3CZCA 3GA7A 4MQMA 2YQ4A 5FA8A 5JASA 3BE6A 4IVPA 3ZGXA 2HRRA 4W1RA 3OFNG 3ZI7A 4IIVA 5M7EA 2P6YA 4D26A 4LCEA 2WJWA 2JFBA 1OWLA 5DRTA 4F9GA 5JO9A 1Z6GA 3GVXA 5BVHA 1RI4A 4G88A 1CQXA 3OURA 3RTCA 3D2BA 1Q7GA 1MC4A 4QU9A 2ADQB 3JQBC 4R50A 1BU8A 3MT7A 4DSTA 2F6RA 3YASA 4BNYA 4QDTA 3EJWA 4UXJA 4W5HA 3FDZA 4KHPB 5FLYA 3HWSA 5L3ZA 3K0SA 3CZ5A 5F3RA 1LTHR 1NNUA 5JQGB 4LISA 2RHTA 1F23A 3HKBA 4EVIA 5HZHA 4LTDA 2FHPA 3N3BC 4F6LA 2WIJA 5LZ8A 3FXAA 1M2WA 3EMBA 3GLSA 4YXWA 3GLIE 4C4PA 4BR6A 2HF8A 3BH6A 3PC8C 2O8CB 4LSZA 4HGZA 1CZNA 2BD0A 4C0SA 3DAOA 1MQ9A 2YZ2A 4FD2A 2WUWE 1ZLXA 1YFJA 2R6R1 4B8YA 4P5PA 6CHYA 1DTSA 1E2PA 1M0TA 2ACEA 5LQAA 2FK8A 2QXUA 3F0TA 4I8DA 4URUR 4PHHA 4YPVA 1URPA 4IINA 1X7XA 3LHKA 4JC0A 4M8SA 1F2TA 4LDJA 4B31A 5JAZA 5KU1A 4CGYA 1IDOA 1FYWA 4PX2A 4JWKA 3O9OA 4KNVA 4L1KA 3GAZA 3L8EA 3B6JA 3UH0A 121PA 5FKJA 4MVOA 1G20E 1AB6A 3M6WA 5HBGA 4DJDC 3SLRA 3S7TA 2RH4A 3VJKA 3TBFA 3K2XA 3I9NA 1KI3A 3I3SR 2DFLA 2GNOA 1FFEA 1FYFA 4BT7A 3DTVA 1R0ZA 2WSLA 4J6FA 2YRXA 5IP5A 1ZCAA 4CUKA 2OD9A 1F9EA 2UXBO 3BPZA 2VPXA 4NJEB 3MNFA 4WVFA 1QNMA 2BOCC 2V8OA 2XNKA 2DQ0A 4IHKA 3WV4A 3W7XA 1JR3A 1YR7A 3LQRA 5JDCA 4PG4A 3ZP4A 2AA3A 3TW8B 3BD6A 3EHBB 3HBLA 3P8ZA 3DDNA 3LBNA 3P9YA 4LYFA 1IWBB 5CBPA 2I87A 4XX0A 1BXKA 1V1JA 1NRIA 2V58A 3KPUA 4MO2A 4D0SA 1US8A 1JN0A 1U11A 1FP2A 3GYQA 5EMKA 1AKUA 3SJAA 4HAOA 2I22A 1Z2NX 3CKKA 3UVEA 3RR2A 2C2HA 4IH9A 2X1HA 3R7WA 5KUTA 3JARA 1G5FA 5EHZA 2Q7HA 4WKGA 1VXRA 4EHKA 4ICGA 2A14A 3GGCA 5EAIA 3RGGA 3RVPA 3FI9A 2I8AA 1W2HA 3LQYA 4L7QA 3MRXA 4ZPXA 1SIOA 2XA9A 1FDWA 4CMBA 3CEHA 3GRPA 4TRMA 3UTDA 3OD1A 3U09A 3AERB 2FRVA 1V54C 4WZAA 5A9RA 3KJXA 2J0QA 1DWPA 3I30X 3Q6MA 4BW0B 3EJ6A 4B4OA 4TZ6A 3JY6A 1P3DA 1Z28A 4C87A 1H4TA 4B7EA 2O14A 2C5EA 2NZUG 3WLFA 3SS8A 4LVUA 2IPMA 3M0EA 4D9FA 4B6FA 2P67A 3FMFA 1PNQA 2OMEA 7MDHA 4BFCA 1QB8A 4N03A 3NEAA 5BY2A 1V11A 2GILA 4TLEA 3H2SA 2VDWA 3UOGA 3GFRA 2PGDA 2QRLA 2GN1A 4CM9D 3D00A 4H33A 3BCHA 1Q0LA 3UJ7A 3L6EA 4O8CA 4C8IA 3WL8A 2I3DA 5CFLA 3HRHA 5E1AC 1Q82H 3CB4A 4Q48A 2ZI4A 3LMEA 4NTXA 3KP1A 4B6PA 3BREA 1Z2OX 3P2MA 4GP9A 3BWBA 4JKYA 4ZIBA 5CGQB 2M98A 2XNCA 4AMBA 2QN1A 4Y9SA 2RH9B 3WKDA 5EB1B 3CNEA 1FTWA 1JZQA 2XPCA 3SYNA 3SKYA 1K4MA 1PR3A 1NXPA 1KIMA 5H9WA 1N78A 2K6GA 2RH5A 3CF4G 4MRSA 2VF8A 3GFPA 3D3NA 1XAGA 2ODNA 4Q1EA 4YLEA 3J7AU 5CT9A 4RTQA 5CDGA 2O3SA 2JHGA 4Y2RA 3T9FA 1R8QA 4PLVA 2NO7A 2V9ZA 3LW7A 4DCGA 5HJEA 3AG7A 3B12A 1SCUB 4LY0A 4CM9A 3S40A 2KG4A 5EVJA 3NWEA 5C93A 4UVAA 1KKCA 2Q3FA 4AUEA 5EP3A 1BXRB 2FF5A 4Y0VA 3RSHA 4CGZA 5ENVA 1IWPB 3R3VA 1FMTA 2HIAA 1UZMA 4HPJB 4PM4A 3D0RA 3U26A 2AW3A 2R4QA 2WP0A 4H6WA 1RIFA 4QX6A 1A77A 5GIOC 2I29A 5JH7A 1PT7A 4LY3A 2QVZX 4DLUA 5D7BA 2HLPA 5TPZD 2VJMB 5FAKA 5LHIA 2DFTA 2J0VA 3AYXB 3U4QA 2R66A 3JAWA 1H2EA 3D36C 4P3KA 2VDKB 5K1ZA 2JD0A 1UBTS 2JFXA 3ZMSA 5KHGA 2JA1A 2JFPA 3D31A 3DT6A 3L8YA 3M3PA 4PQGA 5DBOA 3WKAA 4BNFA 1H7MA 5T6BA 4DDMA 4YV2A 3QY0A 2IUUA 3KHTA 1MOFA 4E2LA 5ICSA 1KD1H 2COEA 4R2MA 4O0MA 2HJVA 1G291 2R9IA 2EIKC 3H5OA 4BFYA 2VGNA 1K3TA 4HO1X 3TMAA 2VJPA 4X8AA 2KWIA 3DUWA 1FYEA 5J1SB 2R5FA 5JBNA 1H6AA 2HO4A 4ARVA 3SR2C 1XLWA 2PU7A 2ORIA 4BNLA 1R9JA 3FGOA 1IHOA 4MWEA 2AKAB 1S01A 3MN1A 5DW0A 1G18A 5I9MA 3DMDA 2Q9UA 5GM2A 4IV8A 3X44A 4RTLA 1P7VA 1VRVA 1VSVA 2D2XA 2OK7A 2Z4TA 2E6UX 2HS3A 3WE7A 4TRJA 3U0VA 4DSAA 1J2RA 1ZH0A 1WJZA 3VTIC 2GPWA 3CW2A 3FHJA 4N7MA 1MX9A 1Q57A 2Q0SA 4D6XA 4KWEA 2XOKD 2H7VA 3BK1A 2XGSA 1XEWX 4JNKA 3V7EA 4LPSA 4ZTBA 3ZKAA 3OM8A 2WWGA 1BVUA 1YI1A 1GQRA 1XREA 1YFZA 1G6OA 2DPXA 2P8SA 5BVGA 4A8TA 1ORDA 1P9OA 2OPHA 3TQFA 4AMZA 1AVMA 3BXZA 3GN1A 2YWRA 2GI4A 4IFBA 4EKNB 3CO5A 5HQ3A 1NJIW 1AQUA 3UKOA 2YWCA 1I0LA 2H2AA 3THXB 4CMEC 2WJAA 2ZJ5A 3IC9A 2QUAA 5KNDH 2Q2WA 5D01A 4CTNA 3AG4B 5F3DA 1PS8A 4G25A 1FF9A 3E20B 1F0YA 3ETCA 1XVIA 4KU4A 1JU3A 3IS3A 4M76B 3UAYA 1VA5A 3EA4A 3PC7A 4KPUA 5AUOB 5DNDA 2XZLA 2ZCVA 5DM6V 5EXEA 3I55V 3HXLA 2QR2A 3FHLA 3PLRA 2PT7A 4L4UA 4MUIA 3T99A 4DJTA 2ABWA 4Q3CA 1WVIA 5FWAA 2VK8A 2JDIG 1LDMA 1P5FA 2XVMA 3KM0A 4G85A 4Y2PA 3ZN0A 1MQSA 2IELA 1SO8A 1NLUA 2JBAA 2FYTA 3FYDA 2YIBD 3V7FA 4ETNA 4G8JA 1N1MA 3ETNA 1XD2A 2WIFA 2G8LA 1CX9B 1SQ5A 4LF5B 3B51X 3O2QB 3PNQA 5H3CA 1AK1A 1FJ2A 3D0QA 1MRNA 5J2TA 1CUYA 3T9DA 4YRSA 2PS9A 2FZWA 1UKYA 1G0OA 2EJVA 1VKZA 1K88A 4ZVNA 1N4AA 5LDDC 1X8XA 5FPRA 1GUAA 3L4BA 2UU9B 1GTL1 5EMJA 4N39A 2P41A 3ADDA 3N8NA 5CYOA 5G41A 1LJUA 1Y3HA 3UMFA 5ALZA 1NW3A 4H1UA 2GHQA 4YXWG 1G9SA 1CTQA 1M83A 1SBHA 1SVSA 1IFXA 1W57A 1UADA 2YV5A 2WD9A 4NCIA 1OCOC 1O1YA 1JB9A 4Y6RA 2P7HA 1HNXB 1R6XA 4BFWA 4LZPA 4R1SA 5TLSA 3V3KA 2Z6VA 3VSAA 4F9FA 5ECWA 5JJLA 4X62O 1IHXA 2YJ4A 2GBGA 1E62A 4PYLA 1FTGA 5DK4A 2J7PA 3VM6A 4BXOA 4N9WA 1I9GA 2MYPA 4GU5A 5AK5A 3QITA 5JQWA 4W9MC 3STLC 3GB7C 1LDGA 1PVVA 4PQEA 5F1PA 4DDUA 5IS2A 3IULA 3ROMA 3BFVA 3TSCA 5TR9A 1A69A 2YY6A 5JTUA 5KWIA 4MS1A 3R0VA 1P2UA 5JS2A 3AIMA 1ZI9A 3EZLA 2DWUA 1N4CA 3IKFA 1SXJA 2QE7D 4QFMA 1Z4JA 1FYDA 4DIMA 3L7KA 2QL9A 1DRJA 1BXGB 3U37A 1MRZA 4F4UA 2OHHA 3RCBA 5GTIZ 4OF4A 4TTIA 4UDOA 4LTNA 3D02A 1CZLA 2RJZA 1FJGB 3T9AA 1X3LA 3IV6A 2XUDA 3FIJA 1SA0B 1U31A 2GPAA 1Y5MA 1U9CA 1YR1A 1O8BA 3E53A 4C4AA 2IS6A 4RQEA 5EIXA 1QD9A 2PZJA 3R5HA 1OLUB 4NZ9A 4AVYA 1DLBA 1VP3A 1ELOA 3HDHA 1BJTA 1ACMA 3D6MA 3PC8A 2V7XA 3E3OA 2BFPA 3BRSA 2HKOA 3JQAA 3RSZA 2Y0IA 1OX4A 2IBZH 5FV4A 4LSGA 1C7IA 1SG0A 1TGVA 3EQ2A 2EFJA 5GIPE 1I0ZA 2YNMA 5FPSA 4CXMA 2LIVA 1C3EA 5LD2B 5JNVA 1DIHA 4FOSA 4G1CA 4BLSA 5AK6A 1C1XB 1ZK4A 1HR0B 2ES4A 4GG1A 2A5FA 1T2DA 4X3OA 3ZHXA 2M6YA 3CV3A 4FTWA 3THRA 2SCUA 4MW1A 2OSVA 3RU7A 1VQ5V 4DPKA 2QEXV 1FFAA 2O20A 2ZYWX 3A9RA 3EEFA 3VU9B 3HXMA 3FPIA 1HDEA 1L1EA 2OBBA 3K57A 3NOOA 4UDNA 1VLZA 1SZDA 2ZDIA 1DAHA 3H1PA 1RHRA 1Z26A 1C9KA 2GTPA 2VH1A 1EVIA 4CM4B 2V45A 1X7ZB 1XQ1A 3O83A 4HAMA 1E61A 3BJEA 2C20A 3R75A 3V4VB 2RHCA 4CLRA 5HMLA 3SJBC 3QVWA 4I8XA 4RL4A 5IMSA 3JQRA 1K7CA 1QHIA 4LMPA 1P2TA 3V7WA 1JPXA 1OX4B 1XDBA 1DIRA 5JZSA 2YIMA 1PDVA 3UMGA 5KVVA 4PSUA 2BMVA 2GWHA 4FFSA 4HQLA 1LC3A 1GGKA 3C5CA 3VOTA 2PGJA 3W1VA 2CNLA 2I80A 2VDQB 3MWDB 1U8TA 4MH0R 2I33A 4NR1A 3W0LB 2P6JA 5JJJB 4CJXA 1FA9A 2FMTA 4LJ7A 3DMTC 1RI3A 4FLWA 1N6PA 1OZHA 2I4OA 1V5IA 2WU8A 1ZD5A 3HY3A 3E27A 4RADA 1T26A 1PSDA 2C03A 4ZODA 1W36B 3SOZA 4ZHQA 5KNLA 3MRVA 4JX9A 1CVLA 1IHDA 4LDNA 5KOIA 1Z4MA 3JPWA 4UEKA 4PC3A 1MAAA 4R8LA 2QV7A 2AZ2A 5CG1A 3TAUA 2GDZA 1P1JA 5K8LA 1QBKC 1QGYA 2YS8A 3KEQA 3EF0A 3RYIB 2CFSA 2NNUA 2IDZA 4N12A 3OP1A 3Q4HA 1O96B 2P6MA 4XIFA 5TQ0B 4FD3A 3ZS8C 1EI9A 1ZCBA 2QSJA 4POOA 1UFRA 1QZXA 1TX4B 3I04M 3G0DA 2ANCA 4HEHA 1WZUA 3BWYA 3SZUA 3VPDA 3E9QA 3VU9A 3IT2A 5B7QA 1OTHA 4FXPA 4M7OA 3A1CA 2UVDA 1J7KA 1MV8A 2ZINA 2XIJA 2PRKA 5EZ5A 5LOVB 2R1VB 4Q34A 4HLUA 1QHXA 1KVTA 4TQAA 3I23A 5DCWA 3SHOA 5C4MA 5ED4A 1P39A 3PL1A 4ND7A 1E1QA 4KOAA 4PSAA 3IEXA 1GVNB 3T7JA 3ZU3A 1D5CA 1SBIA 1GEGA 3B6EA 4NTZA 4TWKA 4NYKA 3R09A 2QLFA 4RS4A 5TS2A 2ZPUA 3DB2A 3OMXA 6ADHA 1T5SA 4A82A 1ZH6A 1WB9A 3WAGA 2AFVA 4KSYA 1Z2DA 4LJ9A 2KSDA 4X5OA 4JHLA 5ALXA 4EO7A 5CJJA 4L08A 3U81A 4JI6O 2C3PA 1PLJA 2QP4A 1N92A 4B3XA 2NNWB 2Z9BA 3D5TA 1RFLA 3MEQA 1NUPA 2E85A 1R3LC 2NYAA 1PEAA 1T0KB 2FFAA 4K8XA 3N2EA 1N1EA 4FS8A 4WRRA 5CM9C 5DP2A 4MVJP 6LDHA 1W44A 2IZ0A 1SD2A 2XOKA 3B82A 4UZSA 4YJ2B 3M81A 5CTJA 3IQWA 1PSWA 5AKHA 1UBHS 1F9AA 1M8FA 3W1EA 1LPMA 1P4HA 4JJAA 2Q73A 2J3JA 5CBPB 5AW5A 1ZL8A 3KJFA 1WCV1 4OVKA 1EXVA 1EDOA 1ZWLA 4O4JB 3V4LA 4MVJD 3IDSA 3CZRA 4NI5A 2OP0A 4OEHA 4B34A 3NEYA 7MHTA 1E5XA 4WCFC 2VHUA 1RQ2A 2KJQA 5AM4A 4F91B 1M5RA 4FJ2A 3PXGA 3ZTWA 1JJAA 4BY9E 1C8LA 2AVDA 2PFKA 4MVQA 2IV7A 3URMA 3B40A 1VE9A 2WZQA 3K6KA 3M33A 5JAMA 4FCWA 2CUZA 1ZVMA 3CKYA 5EUMA 4M38A 3COVA 2X9NA 3HFRA 5HRCA 2VPPA 2OHGA 4XBFA 1ZINA 1ZUHA 5TE9A 5B7NA 3UB4A 1JILA 1CY8A 1I36A 1EUCB 1ORHA 3GQBA 3MBKA 4X7RA 5LP6F 4TQDA 1XLVA 4EHBA 1WZCA 2JGRA 1NR1A 3SYQA 4JTDB 1N2EA 2D7CA 5F77A 5IAJA 1ODSA 4Y2JA 4XVQA 3MTJA 3NTRA 5J5CA 4BOYA 5C5CA 4MIEA 2ET6A 3D3WA 4UXIA 2VS0A 2ZYHA 3W6OA 2O0JA 2PUCA 2WC1A 1YVPA 5LP1A 2BGUA 1VOTA 1XNJA 2DUMA 2M6LA 3GRFA 1UXOA 4C6SA 2ILTA 1BWRA 3KO8A 4D9CA 2V59A 2B2CA 4G37A 5A5EA 2ZTLA 4WV3A 1OI3A 4ECAA 4Z3KA 3JCZA 2YFYA 3HZHA 2DKFA 4GBJA 1KDVA 3DSQA 1CVIA 2FGKA 4Q4DA 4ALNA 3EZ9A 5I4KA 3CZQA 1E5VA 3PUZA 1XOUA 4ZKDA 3PWZA 1E6KA 4ZZ1A 2M6KA 2JCVA 2X40A 3DL7A 4X3MA 2OGUA 5BSEA 4NS4A 2PUBA 4XR9A 3IT1A 1WP9A 1IX9A 4I3GA 3KQLA 3VX3A 3F6YA 1E4OA 3AZQA 2GM4A 1UBEA 2AJ8A 1G4YB 3M3DA 1W47A 4DR1B 1RABA 3ZX5A 4DCTA 3T1OA 1CV2A 1RLIA 1PR0A 2J3HA 1G2OA 2Y1EA 1CIPA 1YUNA 3VMFB 2FV8A 3FUTA 4URZR 3WMGA 3R9XB 3KD3A 3U4MA 3NGMA 4QWMA 4RY9A 3F0EA 1VHQA 3HG7A 1JQKA 4IOJA 4BO5A 5BXQC 1B26A 4D81A 2CDNA 1UBOS 4I55A 1A32A 3IAAA 3T1NA 1Z63A 2YHIA 5B1IA 3RM3A 5HFLA 1SQGA 5MN5A 2A5DA 4M1QA 3OFVA 1SXJD 1YHZA 1BWQA 4ZT6A 3WNCA 1ECPA 2YH2A 2FZEA 2DT4A 3KLPX 4WZZA 1UJWB 1HV8A 4WK4B 3MJSA 3WVNA 1XTIA 3O8RA 4B4WA 4BC1A 4PDVA 1XTKA 3ODGA 1XZKA 4E2FA 3J81A 3AKZA 3CRAA 1PJCA 2JKVA 2VP5A 2VVTA 2OBLA 2ZIXA 4EHFA 3GMDA 3RBXA 5LU9A 4TTVA 1J00A 1LPAB 5JXHA 3WDMA 4UASA 4HVTA 3K5MA 3VI6A 5ALDA 3ZXSA 5B64A 2OXFA 2R4UA 2VYND 4P4TA 3D5QA 3WG7B 3P9KA 3AF4A 4FSDA 2D00A 3SY8A 4YGYA 1KRXA 5AVKA 3EFOB 4EUFA 4FZ1A 4UTNA 4XWKA 4N7RA 3GGPA 3WLTA 3TCKA 2L2QA 4XB1A 3WK6A 4YAGA 3AM5A 1GRVA 3PWKA 5CDUA 1T3GA 1G5TA 2WJ6A 3BKXA 4KFRA 3BRWD 4ZT7A 3EGCA 5HKLA 4GKAA 5KNCA 2PMBA 3LYUA 1ZD8A 4PVDA 3FZEA 4OD0A 4V3BA 4XIJA 2XVAA 5ENZA 3JAMA 1FVOA 4F9TA 1A8HA 4X89A 4AILC 5KUKA 2XECA 4P31A 4Q4AA 3AVVA 3GVPA 1IMOA 2AK3A 5FUMA 1SIBE 1QDUA 2H1LA 2HHAA 5LL6P 3MWYW 1E18A 4PO9A 2Q1UA 1ULSA 2D1QA 1FDVA 3OE4A 2FA9A 3K5HA 4P3NA 3VH1A 5EB0A 4R83A 3BXFA 1N8RH 3ZBTA 4CNQA 3U44B 5BQOA 4QOFA 2NLJC 2QAGA 3NWPA 5MFZA 5CAEB 3R76A 2D5AA 1HETA 4RF3A 1F4NA 5JR3A 3QPBA 3N76A 3CPHA 5I4IA 2JGMA 3C3MA 3JZFA 1WMAA 3DL4A 5IT5A 2I6FA 2CY0A 1FMLA 4FS3A 3EB9A 4D7AA 4G5OA 2X0IA 1SXJC 1CY7A 1CY4A 4JYPA 1BFKA 1E2DA 1ECLA 1Y1KE 4G4XA 4DJJA 1XCJA 1Z2CA 3VQTA 3DMHA 3MCTA 1VZ3A 1WDKA 3G71V 3JSAA 4MS3B 3CCMV 5IMBA 4DM4A 2WJZB 3ZI4A 4MEAA 3QA9A 1YR8A 3VPBA 5HUHA 3KLMX 3M84A 2VNHA 3W9BA 1RP3B 4IKOA 1HNZB 2YXHA 5EMNA 4BQOA 1O9HA 4JSRA 4ZEMA 1PWZA 4BN5A 4JAVA 1RVDA 1V96A 2JRIA 2FPKA 2GBFA 3HB5X 1LI5A 2XVXA 5IWAO 1TRHA 3S0HA 3K94A 4GR5A 2OEPA 1RP7A 4URWR 4P2ZA 4B87A 1I4WA 1PN3A 3PHGA 2OCIA 1JBEA 5GIPC 1GN4A 1DHRA 3IPCA 1R9NA 1C0LA 2PXAA 3AUJB 2XB9A 4INOA 4YCAA 5KDDA 1GPKA 2B7CA 1NMQA 2ARKA 3ABUA 1RE0A 4QVKA 3HCCA 1QK4A 3DW3X 5IYZB 3ROEA 2IXTA 5JPCA 4V0KA 4W7SA 4DMKA 4TTSA 1ZLZA 5ICCA 2VF4X 2C9BA 1IBMO 1BT8A 1IRIA 1HL7A 1VHWA 4ID3A 2ZI3A 2W6IA 3ZN2A 4LZNA 5JSHA 4IX1A 5AD1A 1R0BA 1JT2A 1VYUA 1X39A 4I1YA 2JGEA 2QQFA 3BBLA 2BFNA 4V0LA 4HN9A 3RVMA 1XKLA 2H54A 4AECA 3KJGA 4L72A 3IP6A 3S44A 2F3QA 4K86A 3JQPA 2OILA 2FJ0A 2PHZA 4R2LA 4EUNA 5ADHA 3CE2A 3FYEB 4M0MA 4H08A 4QUAA 3I8XA 1EKXA 4M1OA 2RK6A 1V55B 4IMIB 4J42A 2HDNB 5A3RA 1C30B 1ZNWA 4FJ0A 2WJHA 4JOBA 3LWRC 3V97A 5KWVA 1CDEA 2AL7A 1D2GA 1I32A 1DKUA 1A8IA 4DV1B 1LJLA 3C43A 1RYEA 3RW0A 2WTNA 4X91A 1JTFA 4KSCA 5K2MA 2J0UB 4N01A 2VKQA 2W6PA 1UOPA 5KI6A 1D7AA 4BNIA 1MZEA 1YFLA 3HVIA 4NY1A 4TV8F 3AH8A 4HZGA 2OKCA 1CUWA 1FFXA 1YTFB 2C2WA 2RKWA 4EAAA 5L40A 1KK0A 1ZA1A 5KOHB 4ITUA 4U9HS 1E5DA 4HL6A 1L8OA 1YJBA 2OO5C 5KAIZ 1UJ5A 5JANA 1P4RA 2G17A 2XHZA 2P68A 2P9FA 2Y76A 4BNDA 3KSAC 1ZDMA 3KQYA 2AMTA 3I01M 1E96A 3ZGYA 3ASOC 1YI0A 1JDPA 1N57A 3T5BA 1C7QA 1FRQA 2YHBA 3PSAA 4U8GA 2OLJA 3ROQA 2CTPA 3MGGA 3TTWA 1U8ZA 2NVOA 5FF9A 3WIUA 5BRNA 1C9EA 5HKKD 3TTXA 1GUFA 3HNPA 1PJ2A 4GLOA 2O8DA 5B7PA 2J1LA 2BKLA 4YUAA 1HY3A 4K81B 1HT2E 2C88A 4CM8B 3I9JA 1O9GA 1FZQA 4IRMA 1UWKA 1WSAA 3ADPA 1JEQB 3TQCA 3ZDDA 2IS1A 1Z3IX 5G3YA 3NBFA 1V6AA 2J3LA 3E7WA 3E4DA 3ZV4A 1ACJA 1RHMA 5K8VA 4RXMA 3NTVA 2R2GA 3KJZA 4IWNA 2K1EA 1KKUA 3F78A 1H66A 4L3WA 4E15A 5J4KA 2RGNC 5HRUA 1RPOA 2HCTA 4EA7A 4EL0A 2W0SA 4AKEA 2HIMA 5G02A 2DQYA 1SVKA 4JWTA 1L5KA 2HR3A 1ZP6A 4MW7A 4NIMA 3QBJA 5BR4A 1JHVA 1YKGA 3AETA 1ZXBA 1K3EA 3ELUA 2YYSA 2D2IA 4TYMA 5EFOA 3USZA 3OM0A 2WTXA 5E79Z 5HY1A 1E66A 3FDFA 4G2NA 1L4UA 3H2BA 3MJDA 1TZBA 1B8UA 5H82A 3TL6A 2F43B 3V5NA 3PKJA 1GZ5A 1KGDA 2WFZA 4YRDA 1DAEA 3ETLA 3K09A 2QF7A 1YCGA 2BFFB 3H4TA 3NAGA 1N5MA 3OFNA 4H4CA 4P7KA 3VKWA 3TRHA 2C3UA 1JIXA 1ZR2A 7REQA 3ICPA 3ESDA 1CZHA 1UFIA 1C2TA 1Y3IA 1UBCA 1ZY2A 1OLXA 3K4PA 3LJKA 1A4UA 1UC5B 4GT1A 2QUZA 4KB5A 5TISZ 2NU7A 5JROA 4YLGA 4JKOA 2BBWA 1PZXA 3B3FA 5H8WA 1D1QA 2H5LA 2AD5A 3KUDA 1XKXA 2WQZA 1Z07A 2P6NA 3KOMA 4ZQHA 3M99B 1QCYA 3ILXA 1MB0A 4QASA 3F0GA 2HHHO 1A71A 1R8YA 1WTAA 4ZJUA 2Z58A 5M34A 1T9DA 1QWSA 4CLXA 4B74A 4BNUA 3AR9A 2IHVA 2AFHB 2ZIAA 4NESA 1Z88A 4ZYWA 3SC6A 2IW1A 3AFOA 3O38A 4CR7A 1CWUA 3DEAA 3Q1KA 1N77A 4MULA 1FSPA 3MELA 3WLJA 3P27A 4KDRA 3FIUA 4HMQA 3GEHA 4FE3A 5JSZB 4LBEC 2C29D 2C7RA 1CDOA 1IXYA 1NVUQ 1KEEB 4ZU3A 1RYBA 3KWLA 4G6ZA 4P53A 4Z1MD 3CMAF 2FQ1A 3GWZA 3QYPA 4FGZA 1ULAA 5CFOA 4CQNA 1JHXA 1BX1A 2CJWA 4JKIA 4OMDA 4X63A 4HF7A 3ZBPA 1KYYA 1YCHA 2IDKA 3Q5GA 3MRSA 3Q4HB 1O96A 1NZDA 2HTEA 3WI7A 4DIOA 4YPOA 1GZHB 1SWWA 3RSFA 2BSXA 3OC0A 3ZY3A 1WUKS 2VBGA 4UDYX 1G5PA 4KOEC 3SVTA 1VYTA 1V5EA 1UAAA 1MVOA 1H0HA 1B0AA 1IXBA 2V9CA 1IWOA 3AUSA 4DN6A 1P1HA 4W5RA 5AM3A 2P65A 2OTMA 3R0IA 4HQRA 4TTPA 4BRZA 1E20A 4ATNA 2XE4A 4GIBA 3GBPA 5EP4A 1NNEA 3FNFA 1VCOA 3W2TA 1AMOA 3K6RA 3SG0A 4DJEC 4PN7A 2Z01A 1EG2A 1WXQA 4J80A 3H13A 5CLQA 5U1PA 3GCGA 5LGUA 3FVWA 1EP1B 1M3SA 4NBTA 3CCLV 1GZ7A 1UJMA 3IUQA 3KPYA 5C18A 3ZIUA 1RI5A 3ABZA 4GMFA 3IKTA 1K7DA 2WWXA 3W2HA 1XNRB 3DE5X 3G1UA 3CWCA 4YO7A 3W5AA 1U63A 1EUZA 3GQVA 5ER6A 4BZWA 2YV2A 3ACDA 1FIUA 1YDXA 1FQWA 1NBMA 5C1DA 2ZDHA 3NEPX 2GFQA 1T2NA 3ROPA 5TQ2A 3V2HA 2XUHA 4LE0A 1W0KG 2D5BA 4PIVA 1N3LA 4DA7A 1ARZA 1L5HA 2PKWA 7ADHA 3BF8A 1VQ6V 1RWNA 2UXXA 4LYAA 1U4OA 2W8BB 1Y33E 4HMOA 2J4DA 1IEVA 3T1YO 4E6PA 3COJA 3WPWA 2JGAA 2O7NA 3G17A 2C7PA 4F5DA 3UJNA 1AURA 2QG9A 1AM4D 1ULHA 1T5OA 3SSOA 1NHGA 2XAAA 1E1NA 2OZBA 3GGSA 4HEA6 3W6PA 1QV9A 4HQFA 2PSDA 1RHJA 3G2KA 4AL4A 3C3BA 2H3EA 3FKSG 1L5QA 5A2QA 1DT3A 1NVDA 3H1IH 2WK1A 2Q67A 4YT5A 3U3OA 4MKFA 3C0KA 5IW8A 5E2AA 4LY9A 5HF9A 2XXAB 1B14A 3VR4D 1AE1A 1EJ2A 3G0HA 1CZRA 4HDOB 3IUPA 1EK2A 3K8ZA 4QAJA 5EXTA 4YRMA 4EEZA 3T35A 4FIZA 2CVQA 3B1WA 4B3RO 4MUNA 4OK5A 3ND9A 1CNFA 1U0OC 2G0TA 2XHBA 1J9EA 1F0KA 1P73A 3CLVA 4Q1AA 5FUYA 2OORA 1BAPA 3CINA 3ZR4B 5LHGA 1E98A 1HA3A 3EXAA 4WACA 1SPBS 4BKQA 3N1UA 2ZFUA 4MUXA 4UEWA 5H1YA 3G4SV 3MCVA 3I7TA 4MP8A 4J6EA 4OK6A 3FHTA 3TBHA 4KXLA 4LW8A 5CNJA 3U49A 1M7GA 2Q5LA 3KTAA 3QPAA 3KLOA 5IKOA 1YK0A 3IA7A 4QQ8A 3R3XA 4RFSA 4C0XA 1EE9A 2AE2A 5HJ7A 5FI1B 1YMVA 3KJNA 3STTA 3NHBA 3EXHB 3IKMB 4X00A 1ZX3A 2Q4RA 1WXDA 3R7BA 4QICA 3GIWA 1LV7A 2P30A 5BQXA 5GJCA 4JLBA 3J80A 3P96A 4HWSA 3FVTA 4LBVA 1B76A 2W2PA 3ROZA 4YDRA 3Q3EA 3VVLA 5K20A 4GLXA 4EH1A 2AI1A 1I6LA 2OO3A 2YN2A 2UXDO 3GJ3A 3GO4A 4JDPA 4MHOA 5AI9A 5A6SA 3DMRA 4BFTA 2HEIA 1GQSA 1UPAA 4WESA 3FFXA 4C4YA 2O2EA 2UZ0A 4D9JA 4F7WA 3HY6A 4BGVA 3QBVA 2MCFA 4LY6A 4GXRA 2TMDA 4HQKA 2ZYRA 3ZDAA 1YNOA 4R7TA 3RG8A 2O6LA 1ZVKA 2ZNIA 4RD0A 4YMIA 4HVCA 4ZYVA 1CEQA 1FW8A 4MUMA 1ZU5A 4RORA 1YCDA 4RSRA 5AVMA 2B69A 4RVCA 2HLDG 1NYLA 2ZI6A 3SDSA 5JAIA 4XJXA 2BH9A 5IT0A 1G5RA 1HH4A 1C1HA 3I2GA 2JAHA 1XRMA 2WV7A 3PCTA 2FPWA 2JH3A 4L5CA 2VAPA 2LKCA 5JBIA 3BF7A 2G82A 2OLEA 3RG2A 1W59A 1TJ3A 2GEBA 1GAJA 3JAKA 2ZYSA 4K7JA 1VL0A 4U2CA 3HPLC 1I33A 4R4JA 1GEEA 3PNLA 1V1MA 3CGGA 3C45A 3EVBA 1L8DA 3ZVLA 4PG8A 4S04A 3FTDA 4JI3O 2A0UA 3SNKA 2NW6A 3D4IA 3N0WA 4N65A 4LXXA 2WHYA 4HZ3A 3UUFA 2FI1A 1FXKC 3DMNA 4CN9A 2W98A 1JLLA 5EG5A 4ZEVA 3HXQA 4I2NA 4O1MA 3NVAA 5H6QA 1I2MA 1LSSA 4QAQA 3AZPA 1A2KC 1E3DA 1A9RA 2HHCA 2NZ8A 2V3WA 3PQEA 3HUEA 2I4LA 3MMZA 4I9HA 4AF8A 3P2YA 1CJUC 2W6MA 3CRCA 1FE8A 1NIJA 4GUDA 5CCDA 2KQXA 4RYDA 4W63A 4G4GA 1RU3A 3KYCB 3LE8A 2UZ1A 2HP0A 3H0EA 3IIJA 1ZCFA 3PDIB 3ZZNA 1DUIA 3HBJA 4D3FA 4DCNA 2ZRCA 2N3ZA 4D97A 5B4TA 2I54A 4UW9A 1EDDA 4NVPA 4X64B 2HS0A 3JPYA 4Y2YA 4BAUA 1X87A 4FHFA 4PZEA 3RRXA 3SIRA 3VR2D 2QVGA 2V4MA 4NQRA 1TLTA 2C98A 2W2XA 2Y1LA 4I7ZB 2GZLA 3FWZA 3KXPA 2B8WA 1JDTA 1II0A 2QRZA 4I1RA 5CFZA 2Y4TA 4B2IA 2YEVB 4Q19A 1NF3A 5FPQA 5JPDA 1KQPA 1UJBA 2I76A 2P5UA 2JCXA 1JI3A 3BZBA 4V2IA 2W2TA 1WS6A 3F6RA 1P2GA 4KXXA 2X9QA 4RDHA 1WX1A 2ZYIA 4RYLA 4UNPA 5GMOA 3GVMA 2VCHA 4OPHA 1Q91A 5EJIA 2G0AA