4TUYB

Tubulin-rhizoxin complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
424
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 171
structure length 424
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tuyB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tuyB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tuyB01
5GONB 3JATB 4I55B 4U3JB 5JH7B 5J2UB 4KWEA 3VO8A 4EB6B 5CB4B 3N2GA 4O4JA 4O4IB 4X1IA 2VXYA 1RQ7A 4DRXA 5CA0A 4X1KB 4B46A 1W5FA 3HKEB 4ZOLA 5EIBD 1JFFA 5EYPB 1RLUA 2R751 3ZBPA 5EYPA 4I4TB 5JVDB 5LP6C 5IYZA 3E22A 1TVKB 3JARA 4TV8A 4F6RA 3RYIB 2RHLA 5LYJA 2RHOA 2RHJA 1TVKA 1RQ2A 3R4VA 4O4LB 4O2BB 4O2AB 4FFBB 5J2TB 4HNAB 4O2BA 4O4LA 5EZYA 5C8YA 4X1KA 4ZI7A 5IJ0A 5KX5B 4TV8B 5LXTA 5IJ9B 5LA6A 4EB6A 5CB4A 5CA1A 3N2GB 4O4JB 4X1IB 4O4HB 3CB2A 4YJ3B 5LP6B 4B45A 2GVIA 5C8YB 5MN5A 1W581 5FNVA 3HKCA 4FFBA 5CA1B 3JAKB 5J2UA 4X1YB 3VOAA 4E6EA 5LP6A 4F6RB 1Z5WA 4U39A 3RB8A 5BMVB 3WGMA 4IIJB 2VAMA 2R6R1 4YJ2A 5M7EA 5MN4A 5J2TA 3N2KA 5JCOA 5ITZA 3VPAA 4O4HA 4IHJB 4TUYB 3HKBA 3JASA 5EZYB 3JALA 5LXTB 2XKAA 5CA0B 4I50A 5JQGA 3RYHA 5KMGB 3ZBQA 4YJ3A 3VO9A 3M89A 4I50B 5JQGB 5ITZB 1W5AA 1W59A 3M8KA 4LNUB 4O2AA 1W5EA 3RYFA 3WGJA 5IYZB 4LNUA 3ZIDA 4O4IA 1JFFB 1SA0B 5EIBC 3JAKA 4WBNA 5LA6B 4I55A 4U3JA 5FNVB 3JAWA 3V3TA 3HKEA 3JARB 4ZOLB 1FSZA 3WGLA 3N2KB 4DXDA 3C8LA 5BMVA 2RHHA 3HKDA 4X20A 1TUBA 3RYIA 5JCOC 5JH7A 3WGNA 4EI8A 1FFXA 4X1YA 4ZI7B 1TUBB 5IJ0B 2Q1XA 4ZHQB 3HKBB 3JASB 2XKBA 4HNAA 1SA0A 4YJ2B 3RYCA 5KX5A 3RYFB 3HKDB 4X20B 4EI9A 4IHJA 3RYCB 4DRXB 4XCQA 2VAPA 5MN6A 3E22B 2BTOA 4M8IA 4IIJA 3HKCB 3RYHB 5KMGA 3VOBA 3JAWB 5IJ9A 5LOVB 4TUYA 1W5BA 4WBNB 3JALB 5LOVA 4TV9A 2BTQB 1OFUA 4TV9B 3JATA 1Z5VA 2Q1YA 3UT5A 4I4TA 5JVDA 2BTQA 4EI7A 1FFXB 3UT5B 5GONA 3WGKA 4ZHQA 2VAWA 5LYJB
chains in the Genus database with same CATH superfamily
3UG6A 3TEFA 1AKWA 1U3UA 1UPFA 7ABPA 1FK8A 4EFBA 1TD9A 4HN4B 2HXSA 1CQWA 3ASNB 4Q5IA 1R9GA 4ZYYA 5C5EA 1JVNA 2FDRA 2I4MA 1QH8B 4AY5A 4LP8A 1E4EA 5ALZA 2QE7G 2O3UA 3DCJA 4MLDA 3HO1A 1RI2A 1KKCA 4GKJO 5L7WA 4KUMA 2BWJA 1GQYA 2WJZB 1XN1A 3FGZA 3PCXA 2UYKA 1ATIA 3JSNA 1V3TA 2JBWA 2YQ4A 3CU5A 3WSVA 3GLFA 1YB4A 2JJ1A 3C90A 1KERA 4AJEA 5T57A 1O3YA 3ENVA 1P7BA 3H1EA 3L7DA 1Z28A 3EE6A 2HADA 5CA3A 1UWLA 1JDUA 4CBCA 2ZI9A 3OFNG 1TTTA 3G2HA 1G0NA 2BGIA 2WWFA 2RH9B 4BAYA 2P6YA 4KQMA 4KLAA 1G21E 1L4BA 1IHUA 2AVNA 3EFHA 3TLAA 3K3WA 4DR7O 1YR2A 5A7GA 5FOVA 2PSEA 3UXEA 4GXQA 4KBFA 3MBIA 5FWDA 4BPBA 5KKCA 1JDBC 3DAYA 3HPQA 3I64A 1ZLZA 2UXDB 4LIPD 5KSZA 2BFCA 3G6EV 4JGIA 1M34E 1EVZA 1P8JA 5H9CA 4JI3B 2AMVA 3WOVA 1I94B 1DX6A 4MGEA 4CEIB 4Q03A 5IDQA 1KI4A 3E9RA 2DQKA 1HR0O 3F6EX 1E6UA 4I7EA 1YTUA 1SB8A 4DV3O 2YYYA 3S0WA 4DLNA 1MGPA 1EJ0A 3JALA 2ZSUA 3KOXA 4EY3A 5CB0A 1BTOA 4CI9A 1IMJA 1GU7A 2C7QA 4Q3AA 2D5LA 1E2IA 4E88A 1KEPA 1Y63A 1V4BA 1RVDA 2BC9A 2G70A 1WUJS 3P7MA 3AOEC 3LQQA 5PGMA 1DTWA 4DA7A 3ESRA 4Q9HA 3IKFA 3PYXA 4P7JA 4EY6A 5KYYA 5A3VA 1Q95A 2QHXA 2A1TR 4GF5A 2PI5A 3INTA 4US2R 5KWSA 2RK4A 1Q0UA 2CTRA 2W2OA 4DV0O 3KZ1E 4ZIRB 4JI2B 3SJAA 3TDKA 1OE0A 3HJGA 3RG2A 2IJKA 3H16A 2GCEA 3TOXA 3IBTA 1INLA 3NIGB 3RODA 3HYTA 4N9QA 1IPEA 3RFFA 1U98A 1XEWX 1W55A 1LPSA 5K4AA 5AW6A 1JVMA 2JHCA 4L6AA 4PIMA 2QAGC 3ROPA 4F4CA 2J0VA 1LLQA 3ZXSA 3WNDA 2PU5A 4PXSA 5J5CA 4BQRA 5GIOE 1WL8A 3W7XA 2QIPA 2ES4A 4OL9A 4UZFA 3PUJA 1ZC3A 5BQXA 4CS2A 2Q62A 3UWMA 3CX3A 2P4VA 5B3JA 4XPIB 1U3WA 3O3NB 2EINB 3S02A 4FD3A 1JEYB 1OCZB 4ZKDA 4FR5A 2YHBA 4U7TB 1YTFB 1Z25A 3GPIA 1LPAB 2OQIA 1S2DA 1E9AA 3EXEB 3FTPA 3K35A 2D1QA 3HLYA 2P7IA 4DLUA 2HCFA 4UKDA 5BSFA 1NF3A 3AFMA 4DR6B 2BELA 2IPMA 2PYDA 3A4TA 4K81B 3RU3A 5L53A 1V3UA 3OZBA 3UVEA 1VQ4F 1KOLA 3O8RA 4RV5A 1ZM2A 1M8JA 3QVLA 5IT9M 2GA9A 3PDCA 4XFDA 2C5HA 1F0KA 2BMVA 2UZHA 4IO0A 4JBGA 4KQFA 3DEHA 3BY6A 3DMTC 1HQYE 3B1JA 3CF4G 3HMKA 2IXEA 2W2LA 3I4FA 4IGAA 4R3WA 3MXOA 5JR3A 2E4VA 3FOWA 1U6JA 4KXRA 1OBCA 2B5OA 3DDSA 3K5IA 3MQ4A 1FFBA 2B5VA 1PUJA 1DC4A 1XO1A 2WIDA 3S4YA 2QU7A 1Q15A 2QRUA 3Q7SA 4OY3A 4EFNA 5I7WA 1EJ2A 1QU9A 2GGSA 4BKMA 4I0XA 3VVBA 3RCBA 4CKCA 4LHYA 4F4FA 1K34A 2NMVA 1UPCA 4BGUA 5CFNA 2FDCA 1CZHA 2QMEA 2AN5A 3IJ5A 3T2MA 1ZVQA 3Q5EA 1BRMA 3AJDA 4PX2A 4X45A 1Y8AA 2R70A 2BR4A 3BH6A 5DCUA 5JTUA 2EJ7A 1BMFG 1RTKA 1N2CB 2C95A 3RRXA 4B2IA 3E7XA 2XUIA 4ABTA 1TJPB 4YRLA 3UWDA 3M9XA 4TV8B 2JCYA 3DEIA 4AP9A 1AA6A 1JIVA 1W4LA 1F7VA 3GBPA 2NXEA 2REXB 3UMVA 1L9KA 1CXZA 2X7RB 3KUCA 1ZR2A 1KI8A 3DZCA 1VQLF 2VT6A 4JITA 2WAXA 3FFWA 4C7VA 9GPBA 2OD9A 1RYZA 4TROA 3KIZA 2YBDA 2LW7A 4NOMA 3F6YA 4G4GA 4ZICA 3KWLA 5BW6B 3P9PA 1E20A 1QONA 3W5VA 5BOSB 2JA2A 3BAFA 4HKTA 4RANA 3TBHA 1MC4A 1EFHA 3LQYA 1PG5A 3GLRA 1Q1BA 3B1WA 3F96A 5EMNA 2IE0A 1O94D 1K5QA 5GQSA 1S9HA 2WLIA 4M1TA 1BE8A 3RIGA 1BCSB 1GKIA 1VQPV 3IMGA 2BFBA 2WAMA 1QLEC 3N7TA 3I9NA 5DPMA 3MFYA 1U0FA 3ZE6A 5JTTA 3MJ4A 4DL9A 1OCEA 1OJ7A 3HJCA 2IH3C 1UBRS 3BG5A 4ZMSA 3K2QA 1ZK2A 3W9BA 4GSKA 4XD7A 3RVBA 4ZO6A 1ZN9A 3QJGA 4ASUG 2CJWB 3GLHA 3WGYA 1GQ2A 3DBVO 1KQOA 3OEYA 4JLNA 3H18A 1YQDA 1I5YA 3LH5A 3CZPA 4XARA 1WP8A 1R0CA 3CPQA 2IHKA 3MWLA 3FVQA 4HQFA 2QQ5A 4Z7OB 2ZWIA 3NJRA 4MV6A 4K9PA 1JG7A 4DKXA 1PU2A 2K4MA 4JVSB 4HYYA 4ZARA 3SZLA 1LLCA 2O3SA 3KUXA 4CQLA 2ACEA 3PX7A 4N0DA 5B5EZ 3KZCA 4MROA 2VPTA 3FB6C 4AL4A 2AG5A 2FLVA 5CA1F 1RCTE 3CR3C 4F7DA 1XDGA 3PDHA 3TQIA 5HTOA 3HKBB 1UPBA 4NICA 1QPGA 3A26A 1UXJA 3D2LA 2HSGA 2H4HA 3DVQX 3EYWA 5ALOA 3FD8A 4BFUA 5DN6D 3DEAA 3HYNA 1UJWB 5IY5B 2XHZA 2IY7A 1EXWA 3KVOA 1OLSA 2B94A 1S8NA 1EN6A 4PRZA 5EEGA 5AM2A 4MV8A 4YVFA 1NW7A 3Q3HA 5IRCD 1VE6A 3QX9A 5FOXA 1RVV1 2NUAB 2RH4A 2C5AA 1A72A 5EZ6B 4O2BF 1LI7A 4ZREA 2QE7A 1BMFD 3PZRA 4LQLA 4D80A 1PJQA 4E13A 5GMOA 4YPFA 2R0QC 2C82A 4EPTA 2IG8A 5IBQA 3ROGA 3F5FA 4FHFA 2ZIZA 3N8IA 1NU1H 1C8VB 2FCRA 3RC3A 3U3XA 1WSDA 3GAMA 2WPNA 2JANA 2QNRA 3IUPA 4M54A 4M6WB 1UKEA 2HMSA 5FUYA 3A4VA 3O8LA 3SC2B 4J0JA 1R0YA 3OU2A 1QBKC 7YASA 1G7SA 3S1SA 3S3XA 1SC4A 3OD4A 1PFGA 1Y9JA 1KB9F 3QTBA 1KETA 2Z3WA 3IP9A 3OQIB 2QRVA 4W1SA 1D5AA 5JH7B 2Q8QA 2HHHB 1N33B 3CIFA 3PC6A 3T1VA 2XKJE 1CV2A 1BXGB 3UAZA 3NALA 2VI5A 3TQSA 3LHFA 2WZCA 2R8RA 2WG0A 2OV2A 3BF8A 3L0DA 3S99A 2LNDA 2PUWA 4CMAA 3QVSA 4HNUA 1T6BY 3SJBC 4Y1FA 2A57A 2QD3A 2X77A 2EIXA 2Y1GA 2GPAA 1ZK0A 3HB9A 4MV5A 1A76A 4ND8B 3O2NA 2MSNA 1JQLB 1WDMA 1KI9A 1TZMA 1XZFA 2P41A 4QQRA 3W9UA 1BVHA 4OJTA 5AI8A 3UB3A 3VRHA 1HDYA 2ALJA 1T91A 3OEHA 3EBPA 3TFWA 1CT9A 1GRJA 1MH9A 3UZUA 4K46A 1GPH1 3O2JA 5CMLA 3M6MD 3CHYA 1RYFA 4B71A 2QYHA 4HAWA 1FF9A 5LGUA 2JAPA 3K15A 4C4XA 4CBVA 2TMGA 4OFWA 4G5GA 5FUWA 2YS7A 1Y1KE 2BKLA 2CUNA 4B4VA 1M72A 1DNPA 1P6UA 2AJCA 2P35A 3NWBA 5KEIA 3BQNB 2B34A 2CLEB 2FEWB 5GADl 3W3ZB 4M36A 5K03A 1DBSA 5TNXA 1NRWA 3WY9A 5LQUA 1LSUA 3C6KA 3QK7A 5BSMA 3EASA 3RS9A 4QXMA 5AJTA 1XXHA 2H7YA 4OFXA 1L5QA 3EEYA 4NDAA 4I1UA 1ZGJA 3BSFA 1UFVA 2WJ3A 3OKFA 4DV4O 3PI7A 1K27A 5BMVB 3EGXA 4W7SA 2I66A 1II8B 2RFLA 4ZN6A 4FMDF 5TARA 1KD1W 1Z6TA 2AOXA 5J2TA 2ZZMA 3K6JA 2ABWA 5CDFE 3RVNA 3M1LA 4UNRA 3F73A 1MSWD 1I5EA 3VU3A 4FYXA 1JHXA 1UJBA 4JJEA 1EWTA 4HQKA 1KNQA 1JPNA 2PHNA 1T1SA 3MB5A 4H0LB 2ERCA 4C76A 3MPUA 5A06A 2GD1O 3G85A 4OHYA 5DEDA 1WP9A 4KDCA 1H7MA 3GFBA 4KFCA 4YT5A 4PRLA 2XVXA 1C3JA 5HXAA 3O75A 1HDRA 1T36A 5EHQA 3H2ZA 3WGTA 5B4TA 2WWIA 4MJ3A 5HRCA 2IP4A 3GLGA 2Y48A 1BHSA 2O2EA 4I3GA 2NV6A 4I6JA 1U28C 4RA9A 5I4BA 3L70H 4P0PB 1RBMA 1AU9A 2ZSJA 4N5NA 3SN6A 1XI2A 1YHQV 4P38A 2FC3A 1IN5A 4IDHA 5HRUA 4CF4A 1KYXA 1VBMA 1Z4IA 1QAHA 3JD0A 1JX6A 4G4SO 1N8KA 4OV6B 2NNLD 3EDQA 4NULA 4IZIA 4QPJC 1QNMA 3GRFA 3EIHA 4KXQA 3ZU6A 3G71F 4AJHA 1HM5A 3FTQA 1GN2A 1SOWA 3OAAA 3BQ9A 5FLYA 4N40A 4YREA 1KBZA 4WESB 4LUCA 4YQZA 3DDHA 3CTMA 4Q0MA 1P7GA 3DDZX 2AC2A 3P4XA 5DTQA 2Y6UA 3SQNA 5JEEA 4A36A 3NHZA 3QSGA 1QVFU 3T8YA 4AJPA 2DFTA 2F9MA 1DCMA 5HKKA 4Q3LA 1T0IA 1DJQA 4Y2UA 2JD0A 2PUVA 2PHZA 4XUEA 1XWWA 4BO1A 1WLSA 4EHIA 3BGDA 1B1CA 4OXKA 2VS0A 3MCAB 1MAAA 2IUFA 3JQAD 4YO7A 1B0AA 1HDEA 6LDHA 1Q6HA 5EIFA 3C9RA 4G4WA 1Y1RA 1E9FA 1FMJA 2DWPA 2PG3A 2OV4A 1WF6A 3EH1A 3KJNA 3R5JA 4FIZA 4OQEA 1YITF 1RABA 2IIQA 3AJRA 4JFRA 5EVJA 3IR6A 3O73A 3A04A 5DGCA 2ZUWA 4OQNA 1J1IA 4AB1A 2XDQA 2WA3A 3TW6A 1CZOA 4FSXA 2YIVX 3EWSA 3O6VA 3HGTA 1YZ3A 2WD7B 2JEOA 1LBTA 3IUQA 2HJFC 1TVEA 3LBYA 1VPWA 4LTMA 2V1UA 1UDRA 3CCRV 1K7EB 2CNWD 1TKAA 4A1OA 3SQLA 4J3JA 2H1HA 4JJGA 1W0JD 5CP8A 4KUGA 2PU7A 3IJEB 2BEUA 2QD5A 2GR9A 1QGUB 3DJYA 4WWHA 3I5YA 2JFNA 4WOJA 4ON9A 3IODA 2DEUA 1AJNA 3NPMA 4O8ZA 4F1WA 3UGKA 3AV0B 4QBKA 5JNUA 3HJFA 4RHCA 3UAGA 3K0AA 1Q16A 3VI6A 4Z99A 1A8IA 3DM5A 3E3AA 3FGOA 3V4SA 1WXEA 1E7YA 5FL7A 3C8MA 1DJOA 3CZ9A 1KNJA 1BOFA 1SKQA 1F9AA 3KJQA 5T5QA 4AIIA 5CA1A 2GD2A 2QZPA 4LQDA 4HO1X 2ANBA 4MMZB 1H1LA 4LBWA 1SQ5A 5LP6B 4LF8O 1HV8A 3WLOA 1O95D 4IEIA 1PK7A 4QDXA 3AXSA 3DC5A 3ET4A 1CWUA 2AUTA 4RJ2A 1AP6A 4J0IA 1ONBA 1ACLA 3A1CA 5C1IA 3LY7A 4LY3A 2OQRA 3VISA 5CG1A 2C9ZA 3Q11A 1V4NA 5SY9A 1WB5A 2YFQA 2GM5A 1C2YA 3TUJC 3VPFA 2IH4A 2BBOA 1YKFA 1D2EA 2P77A 1YDFA 3PJFA 3OIWA 1NBEA 4JZYA 3PTLA 1U9IC 4JOSA 1DMSA 2EYUA 4J2TA 1AHHA 3QZUA 5FBRB 3SF8A 5JXWA 4M87A 3OT7A 4ALMA 5TQ2A 3O31A 2P62A 4CMHA 1PBTA 1LNQA 1X1DA 4DK1A 3H1GA 3RYHA 1FDOA 1GXSB 2K1EA 1I4EB 4TN5A 2BFBB 4PHHA 4MS4A 4JBXA 4GR9A 2WHQA 5KWIA 2N1BA 1CVRA 3HB4X 1Z8HA 3GT4A 3R7WA 1CUWA 4Q1VA 3GJ5A 4U1RA 2ARHA 1VG8A 3CUEF 4NU0A 3T3OA 1YJ8A 3N59A 4A8JB 2X8AA 1ZYUA 1LY1A 4OKIA 5HKBA 4LZJA 3QLVA 3EQ8A 4H17A 5JU6A 5B1EA 4JV5O 4QXRA 1HTTA 2Q29A 5IUJC 1SY7A 3CCSV 3R65A 1N2ZA 3PQ4A 2P27A 1W87A 3ICCA 2A88A 3OY2A 4MVCA 4OP1A 2HAEA 3RFVA 5BYKA 6ADHA 1R27A 2F9ZC 1F8UA 3I04M 3UMJA 3SYCA 4Y2RA 4MA0A 2V5UA 1JH8A 2BGJA 1S76D 3F98A 1EX6A 3AO0B 4MXDA 2Q7HA 2PIDA 2LDBA 2NACA 3DZHA 3R0JA 4O0LA 2GPNA 1YZLA 2QLJA 3JVVA 4J80A 1U3TA 4MVJP 4MWBA 4G84A 2BTOA 1JKFA 3QQPA 3Q1LA 4OQYA 1F7UA 5JY1A 1E3SA 4JLWA 1YZYA 1LUVA 1KZ6A 4ZU6X 3MQFA 5IJ9A 1S72V 1IC6A 1K08A 1Z16A 3LE8A 3T1OA 4OH1A 2AFHA 2XYRA 3REFA 2OCAA 8LDHA 3BHMA 2JLYA 4B17A 1DKPA 4JA0A 2WHYA 4WKBA 4H7JA 1P73A 3OMWA 3IPYA 3RRFA 5BZBA 3VNRA 2V7VA 3QBVA 4S2EA 5F3WB 1JEDA 4U2DA 4PXYA 1U3LA 4EJFA 4PYNA 2H8GA 4F93B 3RM3A 1IMOA 3AHDA 3KZXA 2VT3A 2O57A 1MZVA 1CZRA 4AP5A 2XSZA 1NRXA 4I1IA 5LZ8A 3RRMA 1OVGA 4KIGA 2VF2A 1VP9A 2VZ0A 3U3DA 1H2FA 5J2UB 4NKRA 2W71A 4K26A 4K9MA 4KN9S 4OF4A 2XHBA 4UCXA 5GM1A 3UMRA 1M1NA 2MDTA 1F5NA 4MV4A 4PZ0A 5IAKA 1ESZA 3PNMA 3VU1A 1DJNA 3OOYA 4QOEA 4BLVA 3EMBA 2CJPA 4HYOA 3ZVKA 4URYR 1R6UA 1DUVG 1QTIA 1TT5A 2AH5A 1DIRA 1Q6YA 1G9TA 4BDTA 1EXMA 1Z34A 2QN9A 4DA0A 2MK3A 1WS6A 5AVMA 3RYIB 3ZNOA 2HZBA 3AXTA 2W0XA 4KDRA 5HTKA 2H4YA 3H2SA 2OBBA 4QXOA 3WYNA 3QUCA 3RTEA 5BUCA 1T1EA 5JNLA 1IX9A 1M6WA 3NOOA 1SB9A 1Y4DE 2EX1A 2ZIUB 2ZT5A 3A06A 2V5VA 4DIDA 4U6SA 3ANSA 4YRRA 2WQ6A 5JW6A 3VOUA 1K7CA 1QYIA 1PJBA 3MT8A 4C7MA 3UV3A 3JCMM 1P1IA 1PL8A 4N3CA 3UJ6A 2C99A 2CDAA 1CY1A 5C46F 4HB3A 1Z83A 2FSPA 4HLNA 5CURA 1V1RB 3S70A 2MSLA 4EARA 2GK7A 2PT7A 4Q18A 2OGUA 1DO8A 4KODA 4JQCA 4KV7A 5IJWA 1NLFA 2C2GA 3TBFA 2E5LO 1X8KA 4WGFA 5EUMA 4OX9B 4EUHA 3TR5A 3VU9B 1CEYA 2PV0A 1AM4D 4L5IA 4AJ4A 1SHLA 4DLVA 5DM70 3JASA 2NVUB 1GTG1 2AZDA 2YV1A 3OZEA 2EIKC 3W2FA 3H9EO 1KOGA 1G60A 2ZJ4A 3N0WA 1Y3DE 3BCHA 1RKVA 3EY9A 4QPZA 3RIHA 1VOTA 2B0JA 1AB6A 1P3Y1 2VRCD 4EG1A 4CLOA 3AC0A 3BA9A 5LB4A 4ALJA 3H3JA 1AO0A 1PVOA 4POOA 2H9IA 2QG9A 1NXPA 1E2JA 1OYVA 2ZIGA 2JS5A 4W4KA 4EELA 3CRZA 3H83A 1LPOA 1N3BA 1EUCB 2BFDA 2Q27A 1WBJB 4DQUA 1WPQA 2FSGA 4QASA 1EGQA 2IDMA 4EX6A 4YMVA 1OI7A 3D8TA 5LMNB 2B4AA 4E7PA 1KJ9A 4QKQA 1SH7A 3SXUB 3D5EA 1A7KA 2NZUG 4PG6A 5F7OA 1DWUA 1UOEA 4WKPA 2AHRA 1J5EO 3V32A 2AEJA 5CB4F 3DH0A 2BEVB 1HT1E 1XL4A 3IAUA 1EN5A 3ITEA 5DX8A 1NI4B 1T29A 4F11A 5FPOA 3QHDA 1L5YA 1VI6A 4C1NA 4F4IA 5IU6A 2AYXA 4H37A 2C0QA 1ISSA 4EMSA 4Q1AA 3RUDA 1T3GA 2WYIA 4TTQA 5EO3A 2PWZA 2JASA 4R2XA 1MMFB 4K40A 4QZVA 2AZXA 1M1KW 4NNPA 3CYQA 4IX1A 3G0DA 4C30A 2J32A 5DHTA 1ZJ4A 1NUSA 2YOGA 4KQ9A 4PHGA 4V0ME 1O8BA 1F8YA 4R7ZA 1EBUA 2DTXA 4WESA 1KEUA 1L8DA 4RFLA 4UFNA 5LOVA 4ETWA 5FDFA 2CW4A 3VZPA 2Y92A 4MPPA 4P4LA 4TV8F 4G8DA 1VKNA 5IKEA 3F9CA 2IXGA 3R24A 3C4QA 4Z3KA 4NRDA 1NKVA 1FUKA 1BVRA 3WV5A 3EIUA 4WPGA 2QZSA 4WV3A 1XQWA 3HCEA 3KETA 1NVAA 2OKCA 1O08A 1NYQA 3IPAA 1YFZA 2JIOA 2XTMA 3ZH9B 4BUZA 5I8ZA 4IXWA 4LMPA 4TS9A 2HG5C 3HU5A 1ID1A 4OXRA 4NH4A 3GWKC 3H1FA 3SS8A 1XNQO 5FEUA 4NCJA 4QXPA 4NAHA 5CH8A 3HMQA 4LNHA 1FDRA 1T2AA 1PL4A 3AR7A 1U8TA 3F5TA 2WB4A 5HF6A 1RIIA 3SYPA 5KTTA 4BGIA 2GCOB 1ODCA 1CRZA 3HG7A 4E03A 5B7QA 4O2RA 2CL6X 2DJ5A 3U4DA 1I5OA 5I9MA 2J4DA 1ZN8A 3PEVA 5LB2A 3TUZC 1E6WA 1XTVA 2JLUA 3J80N 1ODEA 1A7UA 1TJ4A 3BE6A 5D84A 2HSWA 2JCSA 5IN4A 2Q3BA 3F6BX 3JQBC 4R8CA 2G63A 3B60A 1VCMA 4UPEA 5K0GA 2F8SA 1Q82H 2A1TS 3TQRA 1TUGA 1O5TA 3TPFA 3LI2A 5C7OO 2ZGVA 5P21A 5TGTA 2B7CA 4HNQA 3IQDB 4X84A 1G5TA 2ZT7A 2DF8A 3GT0A 3WWOA 3F5SA 5JDCC 4RC9A 3TOSA 5KSWB 3O84A 2R11A 3FWHA 4MW1A 1DGSA 1T9BA 5CA1B 2HK9A 3D9QX 4V2IA 3VHRA 3EIQA 1VKOA 1XZ8A 3L79A 5LP6A 4BVAA 3BD7A 2JJQA 2Q7GA 3HQ4O 1GFWA 4B81A 1YU6A 4AUMA 2P9BA 5I7UA 4RTJA 3VJLA 6REQA 4RQOA 4EGQA 1V96A 1XVAA 4F5ZA 1YS4A 2XIQA 2F8TA 5CN0A 1CZLA 1J42A 3IAM1 1PQWA 3EVAA 4YFVA 5E4YA 5A6SB 2CLFB 3T9DA 3ZY6A 4B3FX 4K35A 1KTVA 5FJ4C 1XIVA 5H82A 5CA0B 3PLAC 1MAHA 3DF9A 1WBBA 5DIZA 4WK4B 4YJ3A 4NATA 4DHWA 3AKEA 2CXPA 2GZDA 2WJYA 1EHCA 2AQ8A 1JHMA 1V5EA 3EW7A 4G1MB 5K1ZA 3WWYA 3U5TA 2I87A 2ZB2A 4CODB 3OZTA 5DYYA 2RAPA 1G6KA 2QAGB 3AONB 1XRQA 3MJEA 4U00A 1AKUA 5EIBC 1SIWA 1HNZO 3LGSA 3MMXA 1GXSA 4I14A 4IQFA 4RXTA 4ZK6A 3E86A 4F60A 4MWDA 1TAUA 2GWRA 1FMLA 1JSXA 2IJIA 1F0YA 3SSMA 1FUUA 1C2TA 4E7OA 4L50A 1N34O 1NU8A 1U2DC 1RPTA 4OG2A 4D0RA 5G4KA 3O1IC 3WYEA 2ISSD 2J4FA 3NI2A 3CCRF 1WA5A 3AW9A 4ZI7B 5GTIZ 3OO1A 4RDXA 4HGNA 1AKVA 1ZD4A 2TMKA 4FXPA 4PNZA 1J8YF 4BRUA 1RSZA 3WRWA 5KOHB 4HAIA 1X1TA 1LSSA 4G65A 3E81A 5KCMA 2NNWB 1QTNA 5IG2A 2YUAA 1LBQA 1SVIA 1ZI9A 2CLHB 3SPGA 1IN8A 3D54A 4JENA 3V1NA 5ICCA 3SSOA 3NDRA 3FD6A 1T8TA 2WMYA 2VYQA 2GBLA 3LHIA 5GAPK 1GFIA 4R2LA 1UMDB 2J08A 1ODJA 1HFEL 4JC5A 1BMFA 1U5BB 2XIJA 4MQ5A 5PNTA 2M6SA 3NTVA 4GOJA 1T8RA 2IV7A 1U6KA 1NJ6A 1JKMA 3CPHA 4BNMA 1T8UA 3BRCA 3L8CA 4JGSA 1WB6A 4LGYA 3CCQF 2C8JA 2JARA 4LK3A 1SETA 1ZKMA 4JLMA 3O91A 3VQWA 1RM5A 4N0EA 5CFZA 2IZ7A 3LVRE 3NJ8A 3WAJA 4FR2A 2VTBA 1TC2A 3TWOA 3HBMA 3KVRA 1JN1A 5IT0A 2JLQA 2IDKA 2GO7A 1W2WB 3VI4B 2JBAB 3LUCA 1IE3A 4DR5O 3UMSA 3ANYB 4MUGA 2AG0A 4U6NA 2RHCA 4P3XA 2DJVA 3BK7A 5F51A 5HZGA 2GO1A 3ZDEA 9LDTA 1VL6A 5K8VA 1OIWA 2QTVA 1KHTA 5TEVA 1MV8A 1SKVA 3LM8A 3HTNA 5DNCA 1S72F 1KKDA 2I76A 3IRVA 2B1IA 4JYCA 2Y67A 4M0FA 2ZE8A 3O4RA 4F6RA 2L0XA 1VQ8V 2PIAA 1H85A 3IKVA 3LT0A 3VKUA 4DV6B 1GZ6A 3BRWA 4JA2A 1LVHA 5AKLA 4EHLA 2EW2A 4YIHA 3D3QA 2PS0A 1N6RA 2D2VA 2PL5A 3GHZA 1GNTA 5T8KC 4DRYA 3BD9A 5B1IA 1P0FA 2P7HA 2ZRPA 4HEHA 1NV9A 3SOZA 4Z2AA 4YUAA 3ZJUA 2J0SA 1XNRB 2J46A 4M9RA 3TVDA 3SPCA 4X5OA 1W0KG 4F7WA 1XCJA 3B6IA 5L3SA 3TJTA 2FMLA 2CK3G 2FJ0A 3R0VA 4X6YA 4PAMA 2NU9A 5FHQA 4F56A 4EKYA 1QFYA 1KZ9A 3AEZA 4DLXA 5J3JA 1MH1A 1J20A 4EO7A 2DFNA 1QYVA 4JXXA 3RSCA 4OOEA 4BRSA 2OD2A 5AD1A 4I1SA 1EA5A 2OT3B 3EMVA 3OKPA 2ZQYA 5DHFA 1FLVA 1FXHA 3FTDA 3I9OA 3NGXA 4KAJA 5ALUA 3FHCB 2IWHA 2J9XB 3K6KA 5BXYA 1MABG 1JTFA 1DXQA 3DLPX 1CY0A 2OHWA 2FGYA 1OZAA 2A9VA 3N2EA 3PWZA 1OXKB 1Q2XA 2LJ2A 2VYVD 3ZHXA 3GLKA 2HGSA 4R1MA 4RY8A 1SBQA 4KE6A 4NMHA 3P19A 5EC1C 2HKIA 2B1RA 4H7PA 1ZFNA 1GMGA 3DOCA 4AHCA 1I7LA 4I0WB 2WG1A 4ZO4A 4X6UA 2Q4PA 1S2OA 2FP4A 1YRBA 2HQOA 5EJ4A 4ER7A 5FL3A 1KMNA 3NTOA 4WA8A 2CCGA 1NF8A 1Y1TA 5JHGB 4OA8A 5AW7A 4I55A 4N0MA 1UZAA 2OOSA 2QUHA 3FCCA 4P6VF 3SIPA 4CIVA 2ILVA 2HJSA 3ASVA 2X5XA 3FNGA 1S89A 1E2QA 1N5MA 3U40A 1RKUA 3A2MA 1XBLA 4BLTA 4D9KA 5IFKA 4KTTE 3R8CA 3K04A 1DOHA 4LMBA 2WZDA 3RYIA 2PWYA 2H52A 3A11A 3OPQA 2PRJA 2QTGA 3AQ4A 1SUSA 5F4BA 3ZKWA 2LBTA 3LYAA 1KOJA 2VTDA 2WJIA 5E0KB 3IEMA 4ZOCA 3GD7A 3MWGA 4M98A 3GDWA 4DDKA 1T26A 1HT2E 3L0OA 4G27B 1T25A 2WWTA 2JH9A 2YTZA 1M0EA 3Q0TA 4L27A 5AM5A 3O8BA 4NJMA 3L3BA 4JI6O 4TOIA 2Q21A 3CZRA 2E5FA 3IBYA 3LVFO 4H9GA 4JP2A 1NI4A 3SZ3A 3RC9A 2XY4A 4A82A 4F84A 1WWKA 2H65A 2P9GA 2J7PA 4GC5A 2YS6A 3OVMA 4P3PA 4RVGA 3STVA 3ZXXA 3L1IA 2OIGA 3OEHG 1YCFA 3NHPA 4QTXA 4U7WA 5IH7A 4ARCA 2YWEA 1I7FA 2R8XA 4BMCA 3VO1A 3G67A 3CRW1 2ZPUA 2C4TA 3AK2A 3DPSA 3O92A 4QJBA 4QATA 2GLUA 3EGWA 5CFMA 1SQGA 2QRJA 1PJCA 4S35A 5DDIP 5AUNB 5H3LA 4HQLA 2BJHA 4JN6B 3UK2A 1EPUA 5HS6A 4IXNA 1KQNA 3ZWBA 1MX1A 3OPYA 1NONA 3RRNA 3WVNA 4BMSA 1PR3A 1WF3A 4PELA 3P1JA 2ON6A 4P98A 3ELWA 3W4KA 3T7JA 4B6EA 1FJHA 1PKXA 4NMXB 4JBNA 3JYOA 3UK1A 1L3BA 2ODWA 4INZA 4YUXA 3T4UA 2ZIVB 1EESA 1L5ZA 1NZDA 1YJCA 2PZGA 4IR7A 4BT5A 3OLYA 4QYSA 1R9JA 4WXHA 3EW9A 2B4YA 1C0KA 1HEYA 1K5HA 1P18A 4YA6A 4EJ2A 4H6XA 4WLOA 3HFGA 1X7DA 1Z3CA 4IW3B 4YP6A 1W0JA 4F06A 4KR6A 2KKWA 3FAKA 4N4AA 4WNCA 4EY8A 4IDEA 2PMWB 4TZTA 3ONVA 5G41A 1D4FA 1D6MA 2GCOA 2DYRB 1COWG 5IWCA 4Q1BA 4YMIA 3U7RA 5BNWA 2YXHA 1XNGA 3HA7A 3NG1A 1HNWB 4LC1A 2DYSC 1PJ4A 3LY8A 3TSCA 1YI2F 3KP1A 5DF1A 4KYUA 4OIMA 2PLRA 1ROPA 3PQ7A 2YH2A 1BMQA 4AMVA 4YCAA 4LBEC 1PP4A 2ENUA 1RAEA 1B2LA 4MDHA 3SQDA 4FCVA 3T06B 3W06A 4EA8A 4MDFA 3DEFA 1CNEA 2WY2D 2ZAIA 1QIFA 1PGJA 2PYIA 4UEWA 3N87A 4ZIBA 4H0CA 4DEVA 4OB6A 1K7DA 4DV5B 1SD5A 2RBEA 3H3FA 1J70A 1UJMA 4O4IF 3ZWWA 4IMPA 4YONB 1NJSA 5DM1A 2GD0A 3LLMA 2IVFA 1KDOA 4MW9A 1GPLA 3GN2A 2JDIG 1N2JA 2B5UA 1FFWA 1HO3A 5HY4A 1J7JA 1EJ6A 1V5WA 2D59A 2J3IA 4KVGA 5IVKA 3KR9A 3L9WA 2IYUA 1EP3B 1ZWLA 3CEIA 1SU4A 2CYAA 4LSMA 5DXFA 4EEKA 5I9LA 1CEZA 4L9AA 4ES6A 1OLXB 2BZSA 4AQYB 3HM9A 5KUMA 1XHXA 4Z1VA 5A6SA 2V03A 3U61B 2RHBA 1ULZA 1W8IA 3U0VA 2XI4A 3WNQA 1M8PA 3ZLTA 1J7HA 2EFEB 5ADVA 1E5VA 1VBNA 3EQ7A 3QXCA 5A9RA 2VK1A 3NFYA 3BJRA 3LO8A 4C0HA 2O8EB 3I9V1 4BQOA 1BNCA 3G13A 2HV8A 1V2GA 2VHQA 4WKOA 5SZHB 5SYNA 4PA7A 4CCYB 1W7AA 4I6GA 4RY2A 4FDLA 4C4ZA 1DCTA 3HNRA 2H0QA 4PRYA 3EVTA 2RGAA 4G41A 1R3KC 2IBZH 4ND5A 4Y2SA 5KA6A 4GDMA 1E59A 2V7XA 3Q9UA 2BOVA 1EX9A 3C4VA 3W2HA 2H8EA 5FLXA 1TK9A 3NIFB 1NL3A 2XT0A 3LLCA 4XD7D 4LOJA 1U7DA 2X4IA 4HNRA 4HWGA 4JIGA 4KVAA 4QRIA 4CM4B 4PANA 4DWOA 1MXHA 5JCPA 5F35A 4X9QA 3RIXA 1QH8A 4LYJA 2JK1A 3VTZA 4ZQEA 1T9GS 3WHPA 1ZL8A 4OLFA 1APBA 1SVNA 1U2QA 3TVTA 1J7KA 3ROTA 4OX9O 2G07A 3GMIA 4D0LB 3EVZA 2J6CA 1H2ZA 1SQBH 1UJ6A 3SDLA 1G5QA 1UQRA 3C98A 1M75A 1BVUA 1CUVA 2GFIA 3ZDFA 2SHKA 3SVTA 3CV3A 4PZCA 2NQ2C 3LO5A 1CLIA 3I12A 4GMKA 1EBOA 3PRJA 5KOJA 3R7LA 2LO1A 3KELA 4L8YA 1P2DA 1E64A 2FFBA 1YOVB 2XNDD 2C7PA 1OA1A 1F6WA 3VR4H 2VHJA 3RFUA 3LLVA 2KX7A 4IKPA 1AKMA 4RNDB 4ZEWA 4B3TB 1KZ7B 1UK6A 2VUUA 5DIFA 5FH9A 3KCXA 4G8CA 5J43A 1P1RA 1KRXA 4G5RA 4Y6RA 4YTEA 1Y6XA 4UULA 4ZYVA 1SUIA 2GXQA 1VZ3A 3CIOA 4IDNA 3VIUA 1EE2A 3VYRB 3OOEA 4RL6A 1G5IA 1KUQA 1QR6A 4C8IA 2OORC 4DG9A 3S3WA 1AROP 4FJCC 3BYQA 2GEKA 3RFXA 5JZOA 1J5EB 3E23A 2C84A 3AG5A 4I9NA 1H9CA 3UAWA 5EE5B 2Q69A 4XJVA 1SC3A 1SQXH 3KAQA 3LA8A 3NORA 1A5AB 4BXOA 1COZA 1QHTA 1NX6A 3ZDDA 5HEKA 4GGPA 1G4YB 2OGTA 2ZYHA 4HUJA 4KOAA 4RIEA 2PAAA 2P65A 3ZJTA 3PNOA 5I4IA 3QKSA 4X1KA 4ZI7A 2MSWA 4OSOA 2JA1A 2BFPA 2X76A 3MWJA 1RP1A 4WE3A 2WFLB 3RJMA 4YT8A 1J0DA 5ALEA 3LWQC 4ZOQI 3LTNC 1NQAO 3FVTA 2JAQA 1OV6A 3EGCA 4WCDA 5I7FA 4PHZA 1OZHA 2PSSA 4HDSB 3CC2V 2DY0A 4WY5A 3FMIA 1IBKO 3L6UA 1UANA 2R2GA 1G6UA 3NMUC 5KAFZ 5AVSA 3NTQA 3QNEA 5AW1A 6CHYA 4GOKA 4D46A 1QVGF 5CB6A 4IL6Z 3JYPA 4YP7A 3VOAA 1ONSA 1VMIA 2VSOA 1YE3A 4IFIA 3SX2A 5ES3A 2HU5A 1P60A 3DL4A 4NFHA 1IQRA 1AMNA 3DVLA 1ZH2A 5CEEA 2O0LA 3BDVA 4DYHA 4R9RA 3BFRA 2AQIA 1ZL2A 5EZYB 4NMLA 3ZYZA 2BOBC 4XWKA 5I01A 2YFYA 2W2QA 3LRXA 3EEBA 5D3KA 5FRDA 4UD2A 1EZVH 1EEXB 1L0LH 1N2BA 4RSRA 1GG8A 3G9ZA 1W5AA 2X7HA 5K4HA 1W41A 4UM9B 3WICA 4G1EB 2P40A 1DC5A 1NBMA 5T3YA 1VHQA 2B99A 4UEKA 1GO1A 1FLAA 3BULA 3D6NB 3TTWA 1S5JA 3TCXB 4FHEA 1RE1A 1GV1A 1JSLA 3LQKA 1AQYA 1O9BA 4OMUA 4D7TA 2I1LA 3R3JA 1RWMA 4QNNA 3QQ5A 1XPOA 4J4BA 5NULA 3G3EA 3ACDA 4Q21A 2JAWA 3L41A 2HSJA 3UWKA 2ZVYA 1GRVA 3BHPA 1GHTA 4EI8A 1E1NA 2NO6A 4DBZA 3FPIA 3C8HA 3O8QB 1E3TA 4H18A 2Z0MA 3DXXA 2F9FA 3STXA 5DBEX 3TMYA 4DLPA 3K4QA 2X1MA 2XGMA 1EFTA 5HGJA 3HY4A 4L8GA 1YVDA 4ZAYA 4PIPA 1E92A 4X66B 1XMJA 1YWGO 2GLTA 2XOXA 4UEQA 2M6KA 1MB4A 4NCBA 2G4LA 1JA0A 4DFDA 3W5IA 3VVCA 3B9RA 4BP3A 4GS5A 4JL8A 4XWTA 2AOWA 3EDOA 4GKKO 1BHBA 3WB1A 1G8KA 3F6CA 1MHPA 3B9PA 1N25A 2WT4A 4P22A 3T3MB 2GRUA 2KQXA 1XDCA 5A9SB 1ZX3A 3UO3A 4I0XB 1FSFA 1II0A 4YLEA 1J2JA 5TDHA 5A4DA 1DWQA 5DHUA 1DAEA 1JBEA 4NJMB 1IBMO 2W4QA 3GFFA 5B2FA 4UDOA 1OBFO 3ZHSA 1MC1A 2IBMA 5L3FA 3P9RA 4XDZA 4H2DA 4XTRA 1F5SA 6GPBA 3ONDA 2C20A 2QG4A 4ZCQA 3UAOA 1KFJB 3N28A 1YXMA 4MULA 4MPJA 4P7KA 1P74A 1ESEA 2CY0A 1ACMA 2HCJB 2YJ6A 1QPBA 2Q7XA 4AMGA 2B5WA 5GM2A 2IOFA 1P5RA 2GCIA 2QQFA 4JLAA 3STTA 1FTSA 3B3FA 4CH6A 3LCRA 2ZRDA 3EFOB 3PXGA 4Z1MD 3L5OA 2VOJA 1QRRA 3OOHA 1RMQA 3MBKA 3OHPA 1NT4A 1PO7A 4PCLA 5EJ5A 2QTRA 1Z8FA 4NV0A 2JEXA 5IF3A 3MGGA 2JGUA 4R9VA 1DHRA 5CUQA 3TPCA 4D9BA 5REQA 4DV7B 3G0GA 3OIUA 3K70B 3IFXA 4I36A 3CO5A 2CKDA 3DS8A 3ZHYA 1UJ2A 2XTJA 3FFBA 2W6JD 4DADA 4C4TA 2RDCA 2OTJV 1RQ2A 2GHYA 3HDTA 3G80A 5KQPA 4LVCA 4GZMA 2IZ5A 4Y18A 1Z2PX 2VDNB 1N5OX 3WQSB 2UZ4A 1MJFA 4NIMA 2H4ZA 3I2KA 1PHPA 5EFOA 4JR0A 1Z73A 4G8BA 3RVRA 1XPRA 3WLMA 1M5RA 3FF4A 1G1XB 3K12A 3QIVA 2FN3A 3WK6A 2YIBD 2BV3A 4N8DA 4OK6A 4GBMA 5BW4A 2V4UA 2RG1A 4KBGA 5BT8A 2ZB7A 1PKEA 1DSSG 3SYTA 1NWCA 3AUFA 2O50A 2G1UA 3ETJA 4RENA 4TMTA 4Y2TA 4YRPA 4TMKA 4QO7A 3F4LA 3WK5A 2CL0X 1I4TD 5JCOA 3PE3A 1BH6A 5BSKA 3S3TA 4Z9YA 3HKBA 4RQTA 4JBWA 2G1AA 3OQBA 2RGNA 3BTUA 3KJIA 2BCCH 1I2DA 4MKXA 2R3SA 1WZUA 5FYDA 1S8OA 3B85A 2X0JA 5AFSA 1QKIA 3NC1C 4Y30A 5A03A 2JHFA 5E3JA 4QX6A 3AF5A 1EI9A 5HFJA 1Z6GA 1KMIZ 1YJAA 4LCBA 1Q77A 4F4LA 4C82A 1XDSA 3A6JA 3C2QA 3LRPA 2N0SA 4HMQA 1VYVA 5DX1A 1K4YA 3RU9A 1Q81W 1DBWA 3CSSA 1DAMA 2GM3A 3WRXA 4PYQA 2IPNA 4BJ6A 1ODSA 4GYYA 4PZZA 4Q9DA 1NG9A 3BD8A 3H0KA 1YC5A 2CNNA 2YMLA 4AF7A 3F5WC 1NC1A 4MIOA 4BCBA 5AYVA 3SE7A 1CEEA 1VL8A 1AHIA 5LGTA 1GYRA 2XADA 3B89A 1KE2A 2BZ0A 1FFAA 4G23A 2WVGA 4LJ6A 4MTOA 4O0MA 3QF4B 1FU7A 2JFOA 3F6PA 3G5AA 2XDYA 4B0OA 2DAPA 2O8EA 2ZK7A 2FSFA 4XDGA 2WDZA 1KYOF 3W7SA 1XYGA 1I0ZA 2Z3ZA 3DTYA 3WTCA 4EDHA 4KIUA 2GLXA 4OHRA 4HB2A 1KYWA 1RZVA 4FE3A 3NFRA 4W7IA 3WLIA 3DKIA 4BNGA 4J7UA 1FNDA 1ISFA 1HNNA 2VYCA 4TQAA 1GTOA 5AJXA 1WP7A 3O1HB 2O0HA 2ADMA 4G8JA 4JODA 3P0ZA 1G8YA 3MDOA 2RONA 2AIRA 1G55A 1KEVA 1V16B 3JCZA 4OJYA 5EE1A 2HLHA 2VTEA 2XWQA 4LHZA 1PGNA 1XALA 1Q1GA 1XB2A 2FUG1 2C9BA 2RHDA 3OUUA 1V54B 1UMBA 2PNFA 1NLMA 2VWQA 4RAQA 4REQA 4BX2A 5A3QA 3PPVA 4OHPA 3E8MA 3HU3A 3KXLA 1G3MA 3V7QA 4RQBA 2HRYA 5CLHA 4QG7A 3GLSA 3APQA 2Q0QA 4WEQA 1M1YA 4P36A 4IVNA 1H05A 5HY1A 4JZKA 2QUAA 5JZVA 5ENZA 1SCKA 4YRSA 2RGEA 3AUXA 1D03A 3AFHA 3L06A 4P08A 3R0XA 4PPQA 4D3YA 3CCCA 3GYQA 1BEUB 4ZHQA 1JSCA 2IEDA 2IYYA 2KW5A 3A1UA 3BJEA 4HX2A 4RFSB 1V45E 1FNJA 3NEAA 5AM4A 3U7EB 3BL5A 3K03A 1KP9A 3N1UA 5HIIA 1VQ5V 3CLSC 4L95C 1XMOO 1KU6A 2E6UX 3GVHA 3IE0A 3RV3A 1Q1QA 4PQFA 5DYNA 4XCVA 2YWDA 2HJ9A 3FSGD 1XXHB 4FJ0A 4UNIA 3WWDA 2I91A 3JQGA 1E9EA 3FX2A 1K5DA 1VE5A 3O94A 5FP0A 4F1JA 4UCVA 1H5QA 2EJWA 2BRUC 3I2JA 2WINI 3LUDA 1W85A 3DE6X 1BCCH 2LBXA 4JOCA 3FYSA 2D2IA 3GEHA 4RDHA 5EBMC 5D87A 3GBSA 1FMFA 4PGFA 1Z75A 3PYLA 2QMYA 3PEUA 3WXBA 1BJRE 5FBHA 2Z1MA 1L7NA 2FWIA 2JGLA 2PL1A 3GLQA 4BFSA 1D04A 5H9WA 2FHSA 4OEHA 3LXXA 4DM4A 3THWB 4HUQB 1Y76B 1A9PA 1NRIA 1K6EA 1KU0A 2P2GA 5AVTA 4XWOA 4MKHA 4L72A 3LC7O 2NV2B 5DBFA 4AY3A 4Z53A 4PSDA 3DOHA 3OP4A 1UFRA 4IVRA 2XF8A 3GLGB 5A1TA 2YI8A 3RS3A 3W5HA 3J7AR 2YV2A 5B1DA 4R4JA 1G2IA 1O6BA 4FEEA 4JU9A 3SKVA 4IIVA 1GN9A 1QVWA 2YHIA 2ZUBA 2PUSA 5HFMA 2UUCO 2VK8A 3NYWA 3P96A 4HJXA 4TXJA 3UA3A 1H1DA 3L9DA 1RKBA 5F7ZA 2C7RA 2EBFX 5CLGA 1MFPA 1BOOA 2HDNB 1AZTA 1M2GA 3Q1KA 4TUYB 5FPHA 4CKEA 1IN7A 2ZRMA 3L73H 4KFSA 5KOJB 2BL4A 3E18A 2G5TA 3CGWA 1PG0A 5CEFA 2WHPA 1QS0A 3V1YA 3ZEAA 2FPSA 3GNTA 5K6TA 4XDKA 4W8OA 1FIUA 3NAQA 4CTNA 2OGZA 1NZJA 3GEBA 4JJ7A 1M8FA 1NF2A 1SCJA 1XROA 1R0LA 2AR0A 2ZOSA 5HBGA 4AMUA 1H4SA 4RVNA 2WIBA 2VJAA 3QKRA 4PDLA 1J2RA 1T4CB 1HMPA 1UAGA 1W88B 4B4OA 4V1CB 4YXFA 1DXHA 2ZI6A 4D26A 1K73H 3FDXA 1LB1B 2Q0SA 1QOQB 1Y8ZA 3SQOA 4RGQA 5HJ2A 1TL7C 4NVPA 4NMWA 4UTPA 1RQGA 4L15A 1GUYA 3LW7A 4R1QA 3ME5A 3C3TA 2H59A 1DDOA 2FU5C 4GRDA 4XAQA 3KQMA 4Q3CA 1JQDA 5LA6F 4YRGA 3U9LA 1XEFA 1RPJA 1VJRA 1XMVA 5E1MA 4YRTA 1I14A 2P5OA 4MR7A 3FUWA 3TW8A 1GLVA 4YJ2B 5FPTA 4E51A 1Z88A 3P20A 2ODQA 4RTPA 4QDUA 5CCEA 1Z4NA 4DMRA 1TEHA 4C0SA 2BP7A 1UKYA 2CHFA 4BO2A 5JZSA 4RORA 1JHDA 3V8MA 1VG9B 1N32B 3LRTA 3UJ7A 2YYAA 5AVVA 3X1ZA 5HJ5A 3ZHUA 2BEUB 1NVGA 3QP9A 4DCJA 3CEHA 5KQGA 3CH7A 1RXYA 1AZLA 1WUIS 2J7PD 4YI5A 2QRGA 2CE4A 3T3NA 3H86A 4OM8A 4JYPA 4WASA 1VE3A 3HBAA 4GP9A 1Q11A 2ZI4A 3PUYA 4H1VA 3A6GA 3KTOA 4KCGA 3TBKA 4A9AA 4RTNA 4AY2A 4I8DA 4DV1B 1DP4A 5KS2A 3IQZA 4EB0A 4Y1RA 3A4YA 5ALHA 3W78A 2WSMA 3KSZO 1R1BA 3PENA 2PUCA 1YA6A 2XXAA 3CCJF 2DPGA 4U7PB 5EP2A 1UEXC 2BFNA 3R6WA 4JUIA 1H1LB 4TXMA 2A86A 3U9TA 3ZWYA 4LZPA 5DTJA 2Y0IA 3VO8A 1JHQA 2FW9A 3FLAA 2QM3A 4O4IB 3BGVA 5DXAA 2HLDD 2D1TA 1YSCA 1WXFA 2GCGA 2QMQA 2OQ2A 3PHJA 4R84A 4QUJA 3JD3A 1O9HA 1WXIA 2EGHA 2HUNA 3HVIA 4HVCA 3TAXA 4NHEA 2CMKA 2XB8A 3D00A 3DSQA 4JJIA 2G0TA 1L6RA 2F43A 4KFUA 3K09A 3LK7A 2NXNA 4BEJA 2RGRA 2J9RA 4IWNA 4QUDA 5KJEA 2ARKA 3NP9A 3TSYA 4AC9A 2VQFO 4AJOA 2OZLB 2FN8A 3HUTA 2B3TA 3BTSA 3SF8B 4DK0A 4NXNO 2QVXX 5I45A 2VF4X 2VNIA 3M0EA 1Q1AA 1V7PC 2HEPA 3I04A 3VCZA 3OZSA 1KJJA 4YIPA 2XT9A 4C4WC 1KDPA 2CSXA 1FQJA 3ROQA 3O0TA 1GCIA 4F3CA 3B2NA 4MS4B 1XRMA 4EHDA 1VK3A 2NT3A 3ZHZA 4L07A 3ZY4A 1SHKA 1GQFA 1KS9A 2XRYA 2ZAGA 3KL4A 1TEVA 1NTMH 1N0UA 2GILA 4QOFA 1YOBA 2QTNA 3IUYA 3L0ZA 4DNPA 1JFVA 3G59A 1AVTA 1ZUNB 2W37A 3GAZA 4C8EA 4KQWA 4W6QA 5ALNA 4FE7A 5E9WA 3RUCA 3ZW8A 4B48A 1U0BB 5GWXA 2JAOA 1UJ5A 3CCMF 3ZCXA 4HWTA 1L2TA 4XKJA 4A2CA 4DC0A 4A8JA 5KB3A 1GPKA 3BC1A 3W7UA 4DABA 1ZOIA 4WCEV 2J4CA 3EZYA 4J1NA 1YI2V 2HVKC 1GGJA 1V9LA 2IPLA 5A5VA 1IHDA 3AVYA 1K4DC 1GGNA 2PGOA 1I7QB 1L7AA 1NDHA 2BUAA 1E79D 3EXFB 5DCWA 5F7XA 4GWLA 4UBMA 3MILA 5AW9A 4BB9A 1C4WA 1QRUA 4GZ3A 1WV0A 2IDZA 2X5NA 4MV1A 2Q0OC 3W4JA 2ZE7A 2CHTA 1G16A 3KTFA 1ISIA 1K6JA 4H60A 4Z3DA 4W9MC 3L9XA 2GKGA 4Y6LA 4FMCF 1V8DA 2H1IA 2VDPB 1DPFA 1MSDA 1ESDA 2BMWA 3V1UA 3F7TA 4BP8A 5KBYA 2C2AA 2UVPB 2YUTA 5C37A 1FYEA 4YP5A 3BIXA 2FFQA 3L6RA 1Z7YA 2PZBA 1BDHA 2FWPA 4L5YA 1G8PA 1PZEA 1ULAA 2IYOA 2OV8A 3MJFA 4HBZA 4MITA 1FSZA 1L7MA 4UDYX 2X41A 2HR3A 2OCYC 4R9UC 1PZGA 3OE7D 2HLNA 2FMHA 1NX9A 2H3EA 4MVJI 1L8QA 3ZE2B 4BNUA 2F9LA 1T3LA 2G9QA 3H4IA 1YZKA 3R09A 3D6TB 1T9KA 4RLSA 3ZO8A 3PNBA 1M2OB 1B0UA 1UOPA 4L51A 2IP1A 1TXGA 1JG2A 4Z0PA 4IUYA 4ZV7A 1IXMA 1E6LA 1F48A 2H1FA 2FUKA 4PPFA 3OU6A 3IA2A 4CUJA 1GO2A 4ENPA 1SHTX 2ONYA 1T9GR 1RU3A 4H4EA 4DGSA 3CCEV 3RK1A 5CNKA 4Z4FA 1T2NA 2ZE5A 3OFJA 1CY2A 4MRMA 3ESJA 1SBHA 4OQZA 4XSGA 4AI6A 2FQQA 3LCJA 5LGNA 3JAWB 3GG2A 4OREX 3ZUGA 1XTTA 4KITB 1NVTA 4BATA 4X7RA 1K98A 1Q0TA 3HA2A 4KQGA 4OMFG 1I9CA 2WF9A 1TI7A 3E3MA 3ZMVA 4IICA 3TJMA 2FEKA 2E76B 4FWBA 3D1VA 3O95A 4G25A 5ETJA 3L4EA 4C0WA 1J1UA 4YCSA 1E2UA 1QFJA 1TW3A 3I58A 4RK4A 1VQ9V 5EC2C 1Y3HA 2A5JA 2M1XA 2ODTX 3CN9A 3CN7A 3RA6A 1UDBA 2O3RA 2C9YA 2OO7A 4MARA 3OTOO 2F43G 3UJ3X 1WKCA 1Y5MA 1YGYA 4FN4A 4HQNA 2HLDG 1VYTA 1IN1A 2IOQA 1T13A 3K8ZA 2XUZA 4P34A 4D9MA 2OIEA 2VGMA 4MS3B 5CVCA 4NBKA 4B4DA 2YN0A 2AE2A 3OLXA 5ALMA 2WZBA 3PAFA 5I3ZA 1I7NA 1KAEA 4LSZA 3BE5A 4Z4IA 2V8BA 2X5OA 4EKNB 3RT3C 4W8HA 5DHPA 1NW6A 1MRNA 1XQ1A 5KHAA 3WLEA 1X7XB 2DUNA 3ZU4A 4DMMA 3NYRA 3G71V 1KKMA 1CVIA 4R40A 5D1NA 1OC4A 2I6GA 2QWRB 1W46A 1CSEE 1XTUA 2EATA 3FYUB 3LPMA 5ULLA 4HLUC 2A33A 2X6AA 2C9CA 2GK3A 3BHNA 4X7BA 4XYBA 3JYNA 4Y2PA 3VKFA 4DYVA 2EF1A 1K8AH 3ILVA 3LA6A 2E4AA 3SS9X 4ENRA 3KCQA 1YS7A 5BN3A 2P2DA 4ZCIA 1UAAA 2DPXA 2VKTA 1Z8NA 4TQDA 2X0NA 1A1SA 1G21B 1I0LA 3CX8A 1ZRMA 3PF8A 1MEOA 3IMEA 3KCNA 2YHAA 1C9KA 3DCIA 5DM0A 4C07A 2VT7A 3AG3B 4FINA 4JCOA 1ENYA 1KPHA 1IAQA 2ZJFA 3P97A 4UM7A 1IJBA 2EL9A 4CCAA 2XBUA 4FFBA 2WKQA 3OM0A 2A9QA 5I9TA 3JWIA 4OHKA 3BTVA 3RT1A 4S24A 2A84A 4YT4A 3EZGA 1E7SA 1OSNA 1K2VN 4ZJZA 3DE7X 1YJNV 1ISRA 1R66A 1WRBA 3N39C 5F21A 5L8VA 3DOOA 2I9KA 4YDQA 2VP5A 3HUUA 4B3MO 3OSUA 3FSJX 2EIMC 1G64A 3DDCA 2FR0A 2P7TC 2BM8A 3DMDA 3CRCA 4C20A 2JIMA 2GZRA 4B6JA 1N9GA 1KK1A 3O0DA 1KKUA 1EX7A 1QK3A 2WYWA 3MT9A 4ARSA 4MTGA 3EARA 1XCPA 3LT1A 4D4KA 1SC5B 4N7BA 2ZRJA 2QWPB 4MO2A 4E5SA 1E1DA 3B20A 2NSLA 3MLBA 4RS4A 4BLQA 3K08A 2ORED 4ZOBA 1USUA 1YULA 2J3DA 1QS0B 1YFKA 3C7KA 3EQ2A 5EA2A 3W8FA 4EKGA 2W70A 1RAGA 3ZE7A 5HF5A 3TFQA 4QUGA 3WJAA 9ABPA 1R4NB 3OM9A 3AL3A 3U3MA 1M0TA 2IM9A 1GN6A 3AY6A 1BWPA 1X2BA 3DEJA 2QLTA 4FLUA 1KSFX 2QD1A 2VYFA 1A5ZA 1Q86H 3DFMA 3EXHB 1NMSA 2G82A 1RBYA 4UHBA 3E3OA 3AIKA 3UBTA 4JF3A 1YR9A 3M7MX 4FCWA 4IIGA 4QULA 1N2OA 2Q68A 4WOBA 2WHXA 1SBCA 3CM0A 2BFCB 3R3UA 2P78A 4ERHA 3KTAA 2JLCA 2YOFA 1X94A 1PL0A 4M9CA 1SOUA 4CEIA 4IM7A 2GZ2A 1TUEA 3WJRA 3L75H 4UVAA 1PAUA 4ZDWA 3DGEA 3K9BA 3QXSA 1L4EA 4M1OA 2I2XB 4A5SA 2B8WA 2BBSA 3TL3A 1C1XB 1UKVY 2J0UB 4B7EA 3GNLA 4GUDA 4BZWA 1S7GA 3GX1A 4C6TA 1OZFA 3PD1A 4JLJA 3JALB 1XR3A 5I7OA 1ZD2P 1ZRHA 1LU9A 1E2FA 2DFLA 1VI5A 2PGDA 4IXMA 2APJA 1Q82W 1ADGA 1KMCA 1OW3B 1WX1A 1XMIA 2YHIB 4YMWA 1Q81H 1K4MA 3A9SA 4IDFA 4URZR 4DJEC 1Q8IA 2A59A 1YDHA 5CXUA 1OB5A 5AJVB 1DDIA 2FW8A 3V7EA 2EP5A 1TYDE 2ZP1A 4KO1S 1FDSA 2EQ5A 1M6HA 5B58T 5BORA 4YN3A 1XGKA 1PZFA 3DBHA 5DFAA 5B3KA 1RZUA 1H42A 4PLCA 2F4VB 4DO2A 1A7AA 1LX7A 1NULA 3GJTA 4GI5A 2GETA 1RRKA 1ML4A 2V54A 4YWHA 1FVFA 1MC5A 4A92A 3L7LA 3KQSA 3W6PA 4MKRA 4Z1MA 1G5HA 1HR0B 4OQLA 2WYUA 1KQSF 1VYHA 1VKJA 4GYKA 5SY4A 5AVOA 2WLLB 1NRJB 4Y2YA 1TO1E 2C4VA 4V1CA 1WCIA 2REQB 1ZUHA 1SQ0A 4KO2S 1PJTA 3WRXC 5CPFA 3KNZA 1ZSPA 1YASA 4IKOA 1G6OA 2IU4A 3U3RA 4EG5A 4BKUA 4CQMB 1M8GA 4RHUA 3ND7A 4KZPA 5JAIA 5JRDS 1L5WA 3Q2KA 3DVSX 3AR6A 2WT8A 4KRXA 3NBZC 2ZBUA 2OFXA 4KO4S 5IYZF 4PFKA 5WRFA 4AM8A 4YCLA 4C7KA 2UYHA 3PRHA 3DV0A 2Y66A 4G67A 4BVEA 2NOAA 2ZQ5A 2B8EA 1L0NH 2JZCA 3ZRXA 1XMXA 4LBYA 4DIOA 5JHHB 3A0HZ 3JZDA 3M6VA 4NZNA 5BXQC 4HBGA 1BWRA 2NO4A 3W5UA 4ZJPA 5HXUA 1CRQA 3PE4A 3S8EA 3HM2A 4TMWA 4NHOA 2EJVA 3CUWA 1L4UA 2QTZA 2ZUFA 3EGIA 3SZOA 2QBYA 4Y6GB 4DA6A 1Z6QA 5CCDA 3HLKA 3VI3B 4GL2A 1J8MF 4ZYXA 2N47A 1ICIA 4MJXA 2Q6KA 1MXFA 2CVFA 5I5EA 3HDVA 1FDTA 4LR3A 1Y3BE 2GLZA 1G20A 2EU8A 2Q3LA 1VMEA 3DE4X 3R40A 4N5HX 2ZR3A 5IDYA 3OEEG 5F23A 1NYRA 5JQGA 1JIJA 1VMAA 2VVTA 2ERYA 2ZJ8A 3HR7A 4PGGA 2W2VA 5FV7A 3LDTA 1UBSB 2SKCA 3KX2A 3C97A 1JFTA 3HBNA 2HQBA 4GRAA 2R6JA 2Q1SA 1AURA 1Y6QA 4DWVA 4IRUB 5ABPA 2I7CA 4WUTA 3VYTB 1EHYA 3IRUA 3K72B 4M1QA 4O4IA 1MEEA 3VZQA 4ARUA 5GIPE 2A5DA 1C7RA 1LX6A 1GOTA 3C3EA 3EQ6A 4GQIA 3GHHA 5DP2A 4P5EA 2P6PA 3CC7V 1V3QE 2JJ2D 4JLOA 2BCGY 5JXIA 2Q9UA 4IMRA 1D2HA 3OWOA 3K9FC 4KOEC 3E9CA 3WJ7A 4DLLA 4IJ5A 5C18A 4YS6A 5CXQA 5K0BA 1HRDA 4J16C 1OXTA 3ABSB 2WSSD 4R69A 1PDVA 1DO2A 1JU4A 4GZ5A 4R41A 2WPDA 4XVHA 3QKTA 2OHJA 5CXSA 1YUMA 1FVHA 1VPTA 2QL7A 3GGDA 3PIRA 3ILXA 4M0PA 4X00A 5AI6A 3UK7A 3ZU2A 1BCSA 1OTHA 1VGVA 2I62A 5DB4A 5HQ3B 4O02B 3PP8A 3KKZA 3OTIA 2HCRA 4MSWC 3GV0A 2VAPA 5AK0A 1QV9A 2ZS7A 1Y5LA 1VARA 3NKFA 2XUDA 3LSSA 1Y67A 2NTJA 3DV9A 3VDRA 1QYCA 1HE3A 5EY5B 4JQOA 2C4KA 4WBNB 1CUDA 2JRLA 1RD4A 1WKVA 3B1KA 3ZVRA 1USVA 1YHYA 4HFRA 1HBJA 2FWBA 4GX1A 2HNAA 4IYRA 5IT9N 1DKUA 3VMMA 3B77A 4B3SB 1UOQA 1W5SA 1ZEMA 3FE2A 2JHAA 3GEEA 1I7PA 4BQFA 1L1FA 4AG3A 3VR0A 3CE9A 1JS1X 4RPCA 1T8PA 3RHZA 1FYFA 1Q43A 1IBLO 2JHGA 2QP3A 2R8YA 3PPIA 4IH4A 3IKMB 1AUVA 1JXMA 3D6JA 3RS5A 2ZZNA 1BVYF 4LFBO 1NR5A 5BNIA 1CDDA 5B1AC 1IJKA 4R1OA 1ZCZA 2J6IA 4ZHQF 4S04A 2XH8A 4IS2A 2PXHA 1P7CA 3S55A 5BN1A 4RHXA 1LXCA 4M37A 1Z47A 1VJ0A 2PKQP 1I3CA 4S1TA 5K0CA 4TUYF 3ZQUA 1H3EA 4HGZA 1Q0QA 3LYBA 2VCYA 2WWXA 4N7RA 3GGPA 3WOHA 3RVYA 2I4OA 4F21A 1H23A 2PLFA 3IEQA 2AN4A 1H8HD 4FYWA 3JZMA 2NVBA 1ZNYA 4ZZ3A 1U9IA 1EFDN 1E69A 2ONKA 1RQXA 4PC7A 3HBJA 4QYWA 2WF7A 4AS1A 4F4HA 2JJYA 2WJ6A 2WU1A 3A9TA 3NOVA 4QEKA 3PLAE 1JJBA 4PQGA 5DE3A 1MB2A 3CLUC 3FYUA 2ETXA 4E21A 1VQ1A 1ETUA 3LVQE 4H6PA 2FW7A 3M6IA 5ENDA 3S2UA 4BJ3A 4G28B 2H1CA 4P86A 3WLHA 4F5YA 2QLMA 2CL7X 2Z1DA 3C3AA 3JVDA 4ZAXA 3BCCH 1E77A 4TL7A 1DV1A 4OLBA 3EXG2 3PFIA 5JAOA 1PF5A 5BSHA 3JVEA 2P6NA 4HDKA 4RSHA 3GD5A 2DTDA 2DR3A 1IK4A 1QE3A 1TZKA 3I2IA 5JEDA 1QHSA 2CH7A 2JVKA 1R74A 4MI3A 2EKQA 5EGNA 2I4NA 5EIWA 2HK6A 3OCYA 2GPBA 2XB9A 1W35A 1Z0DA 2OZEA 3F6MA 1IV3A 1KPIA 2X8BA 4RK6A 1TZCA 2QKAA 1ZIXA 2YQZA 3BRWD 4N39A 2FP3A 4F86A 3BAAA 5FWNA 1TM2A 5FUBA 4M89A 4NZ9A 4GU5A 2RARA 3ZP4A 1A2OA 2ONZA 4JYYA 2Z08A 1Z0AA 3IC5A 5KU1A 1P4GA 1SVWA 3TD4A 1QU7A 2EX4A 2GAAA 3OICA 1M3SA 3KQLA 3Q7EA 1NJ8A 1H48A 2GJ8A 3N3AC 1UC5B 2NU8B 1TEZA 1N5KA 1U94A 3T4ZA 1A77A 3OY7A 1TECE 4FLZA 1I3MA 2EGGA 2CTWA 2PR7A 2YRWA 2F8LA 1CRLA 2RI1A 2EJRA 1QJCA 2HMAA 3CW8X 4BNLA 2OL4A 4CV2A 5BV7A 5JUWA 1LDMA 3DMGA 1FYWA 3MBOA 3D8UA 5J2UF 3AFOA 4R40B 1Z2DA 2QDKA 1T0PA 2DG2A 2WD8A 3AI3A 1QKKA 1GRCA 1PFVA 3A0RA 3GVXA 4YHBA 5KDOA 4GLFA 4TSFA 1OJHA 2CV1A 2ZUEA 2I99A 2ZYUX 4MUIA 1K8QA 5FADA 1VQOV 5K05A 3KAKA 3C41J 3KT6A 2R6GA 3AGKA 3OPYB 4UM9D 5K3EA 1JAIA 2IKSA 1M1UA 3KR0A 2XUQA 3OIVA 1UBMS 5A0VA 2WMOB 1F23A 3PQFA 3EXHA 5E1OA 4YXWG 1BU8A 2VBCA 3CURA 3ZDCA 1V55C 1LNSA 4BVBA 2A58A 1ZW6A 1QQ6A 1NQ5A 1GKFA 2JI4A 3W90A 4BAGA 1V7QA 1SBIA 3LQ4A 4J91A 4O4LF 5AVZA 1WLEA 2P2NA 4X88A 2I33A 4LZZA 3SNKA 1P5JA 6NULA 1Y6FA 3HA3A 4NECA 2UZ0A 2O7QA 3H2KA 4H44B 2Y1OA 4RJLA 1F17A 1WXGA 1WXWA 2XAJA 4DJJA 3CUVA 1EK1A 3F46A 5IKPA 4IILA 3WYCA 5B4VA 2FN4A 2J0UA 3JSLA 4PG4A 3SC4A 4LHWA 2W6JA 1ZONA 1QF7A 3LHDA 3IAYA 2A9FA 2Q6IA 2HRUA 3REQB 5EB0A 1WW3A 2KWIA 2P2SA 2Y0BA 1T36B 3H0CA 4TRMA 4A15A 5EIHA 3IB3A 1AVMA 4OKNA 5EXSA 3H1IH 2GN8A 3ABTA 2YY5A 4L2IA 1V11A 2GSMB 4CTOA 3EPRA 3D02A 3ZHTA 4DV4B 3TAHA 4BFWA 2PSDA 3QMPA 4LRTB 4CLRB 3S2EA 4YRFA 4BMYA 3KOWA 3EISA 5AIBA 1BD4A 3BORA 2V8OA 4HP8A 4I4TB 2FSSA 4GLBA 4ZWNA 4BLUA 2RJZA 1RKXA 1X1EA 1P9LA 1OBVA 4ONEA 1FXUA 3GY0A 3I52A 1DQSA 4DGQA 1EDEA 1CJTC 1GNQA 2OAP1 2AOUA 2QRLA 3GJ7A 4J9UE 3K8YA 2Z4RA 1Z06A 3GJSA 3W05A 3R5XA 2FI1A 4YDSA 4JL5A 1WY7A 1RFYA 3NANA 4IHQA 2AUMA 1XJ5A 2V9YA 3HH8A 3MCAA 4EF4A 1Q92A 4K6MA 3CVUA 4KUHA 4V3CA 3SHQA 2A0FA 4PD4F 2CN1A 3BPZA 2FKXA 4OPHA 5B1BB 4EYGA 2AE1A 1E2BA 4DR6O 2QX7A 5BYBA 1QWSA 5JT1A 4RNCA 5SZJA 1JR2A 1KVTA 3JAKB 1U2GC 4PE5B 1HFWA 4H1TA 4WK2B 4C6TB 1S7CA 2WOJA 4UBJA 3AETB 1AKRA 1J8VA 1ZEJA 4D9GA 1SG9A 1NSTA 1BFKA 4US1R 3A1TA 3EZ7A 4I99A 1ORTA 3WE7A 1JMKC 3TB4A 2X19A 4FLWA 5CT8A 5IZ4A 1XYYA 2H4JA 1VL0A 2O14A 1IN6A 4HNGA 2IE8A 1EGVB 4F4UA 4CS4A 1QGUA 1CD5A 4XIGS 4MO9A 3VC7A 1KAHA 2HF9A 3QVXA 3JAMA 3LPDA 3D4NA 4TT8A 4WY2A 3NDJA 3ZCSA 3FFTA 1NU6A 4A8PA 4LE2A 1OAOC 2C9MA 4LF6O 3ORHA 4IMIB 1S6YA 2CB9A 4FZ3A 4M2LA 4R9SA 2NMUA 2XUHA 3OWHA 4ZVSA 5B12A 1VSTA 1N36B 3CG6A 4DUYO 2QTBA 4F2GA 2D2XA 1E9VA 3CWCA 1V95A 1HLDA 1OXMA 3O03A 4M1YA 4X97A 4FW8A 5A4FS 2ZRQA 5FOSA 4R6WA 2I65A 4IH1A 4A0QA 3CCLV 1RT9A 4MGKR 5DULA 5KNCH 1WCIB 2REQA 2PZ8A 1TKRA 2QRNA 1AGYA 2HREA 3ETNA 2WOOA 3SC6A 4BMNA 1CR1A 2YVQA 1VHLA 3SVLA 3T38A 4N41A 1C0EA 3II6X 3SDBA 1TCBA 4PQEA 2WJHA 3BIOA 3IP7A 4JSRA 5JC8A 5DOZA 4KXMA 1T9ZA 4X9XA 3LPCA 2GB4A 2OP0A 4MVOA 1NQOA 2ZT8A 2O8DB 5JDIC 2C1ZA 1VI2A 4H7EA 4WXEA 3SYMA 2ZW9A 3FZNA 3VQVA 1LBIA 1N2EA 5EHXA 3PQCA 1RKQA 1H94A 2NU7A 2D1SA 2PXXA 3HWRA 2ZJ1A 4WZBA 3RYHB 4RQEA 3VOBA 2HVYD 2ATIA 3U48A 4A6XA 1ZITA 5LZ5A 3RUEA 4Y7DA 5HQ3A 3DYBA 3VDNB 4TMFA 1C7QA 1PSWA 5EMLA 4UHHA 3TOCA 1SBZA 4B2YA 5D3MB 4EQ6B 1P8AA 1NDQA 2FSUA 2PRIA 2VUIB 3I32A 2OORA 4QICA 5FTLA 4AIRA 1MG5A 2BFFB 4LW8A 4OHXA 4ZAZA 2Y9MB 2QP9X 3QA9A 1XMQO 1K66A 3CF2A 5IDWA 5DNUA 3TE6A 4ZPXA 2IHNA 1YO6A 4DR2O 3SEAA 4FZVA 1CFZA 2GBIA 2W6IA 2GRJA 3ZN1A 1DGQA 3GMTA 2ORVA 3LQRA 2NADA 2G1PA 3N2IA 2PBZA 2WVJA 3P9CA 2ZDGA 4NPHA 4WLVA 3WL4A 5HKOA 4PNHA 5LMUO 1M0WA 2QX6A 3U09A 2Q07A 2KI5A 3W8EA 4UUBA 4ICGA 2K6GA 4M0UA 1CG6A 1T9DA 3HKEB 1TO2E 4P2GA 4Y2VA 5D85A 3IKEA 3AEKA 3AKDA 2VA8A 3ZIAD 2WTMA 2OFFA 1SXGA 2C57A 1ZJWA 5KNBA 1RAAA 2EBWA 4R6ZA 2F8MA 2OV3A 3V7UA 2JGFA 1SIOA 4RHEA 2PMEA 1BXZA 3NKLA 2G72A 3PJGA 1DQYA 1X80A 3A6KA 2NO1A 4I8XA 1LQTA 3MJRA 2VSQA 3L4SO 1HMYA 3PXDA 2K7FA 2AZ0A 1BGWA 1JJIA 3LCMA 4IEFB 4Q4JA 5DNVA 5HOQA 2ZU6A 5IJ9B 1WUYA 1DAHA 4J8PA 1JHRA 2NN4A 1E6EA 4C5CA 1DC6A 2G28A 3NTLA 4KQ2A 2OHHA 1B8OA 5JNTA 4LTDA 2AKEA 1FX1A 3KKKA 3RREA 4ZCTA 1L8XA 4ZJUA 4NBTA 1I3NA 4CW7A 4JV5B 3I9MA 1PR4A 4AKHA 1SUWA 3WMGA 2FKNA 2A3QA 5J2UA 1XHZA 1DBIA 1U28A 2OBFA 2YFHA 1PPJH 1EFLA 1QYDA 3UCEA 4KP4A 3ACBA 4OI1A 3VX4A 3BCSA 4AZSA 2W8BC 1JEAA 4E22A 3L4JA 4D2IA 4QJ3A 1GA4A 1DTSA 4HRVA 2POQX 1EFVA 3IAEA 3ZI4A 5JWOA 4L7QA 4WFJA 1DJMA 2OENG 2QTAA 3HZOA 4R2KA 4MUHA 3SHOA 3TI9A 2EDAA 2GNAA 4R9NA 5CLQA 5FOWA 1P4JA 1N8RW 3O4VA 1TT5B 4IMJB 2TYSB 3V7YA 5IYBO 2QN8A 2W7TA 3N0XA 3K5HA 1UEJA 2BY4A 5CB8A 1ID8A 2GYUA 3E8FA 3A8TA 1NZ6A 2DYYA 1JDJA 3DEYX 4RYDA 3IDOA 5JROA 4BQPA 1ZOLA 4KKVA 4OCZA 1HOXA 1YMQA 1CZKA 1DX9A 2E6KA 3WJ1A 3L7IA 3IKJA 3L05A 1PF7E 3THSA 3U13A 1VIMA 1L5HB 2PLNA 4NTXA 2IEZA 2GBGA 2EXXA 2O2YA 1DDGA 4WVFA 3HVRA 121PA 4P2BA 4XVQA 5JMOA 5AICA 1UL1X 2XAGA 3ELCA 3MINB 4HVTA 3UGTA 3HJWC 2OEPA 5E4JA 1Z6PA 1V7ZA 1F8GA 2DH5A 3QWFA 2CSUA 5JS6A 3KEGA 5EFZA 1RFLA 3P5BA 2AX3A 2Q5ZA 1HYEA 1XTBA 3L5KA 1WW2A 2JFUA 1EK0A 1U9ZA 1Z22A 3NT2A 1UDCA 4S0ZA 3RS2A 4RV4A 4O5OA 1S5PA 5I51A 3GFTA 3NHLA 4RBNA 2J9FA 4RXMA 5AMXA 3E8GA 5GVSA 3IFSA 3ZV3A 1QG2A 2D54A 3H2JA 1N6NA 3WDMA 1DKMA 5JV5A 3GWOA 4TRJA 5EKDA 1K8AW 1USKA 4HV4A 5LLTA 1V8BA 4RULA 5AP9A 1E9CA 4DLZA 4R1NA 1XKLA 1GCGA 2I2FA 2B6NA 2CH7B 1VRVA 2QJFA 3PF9A 1HNZB 2KYRA 3C1OA 3AP1A 2JCBA 3NVMB 1O6FA 2NSHA 2IYZA 4FK8A 4K6FA 4QUAA 3ZTTA 4DIEA 4MYDA 2MSDB 4FHZA 1CETA 4JQSA 4DLSA 2I6TA 5JPCA 4DR4B 4TVBA 4X8HA 3RK0A 4WKNA 2XVZA 4MR8A 1FFDA 1AKTA 3HCBA 1U3VA 5E7QA 2O5RA 1R6BX 3H9QA 2G9IA 3IIIA 1SPXA 3QKUA 4G1BA 4MUBA 1ODKA 2JEYA 1ATZA 4RX1A 2WA4A 2R1VA 5DYWA 1FS6A 1XKQA 1YDXA 1UT6A 5HZHA 1WR8A 4LS3A 1H2XA 1RJ9B 4NYMQ 3LMKA 3OJ0A 1MGOA 4HY3A 1J0EA 1R9MA 1C8LA 1CUBA 4LBZA 5DSXA 2AOTB 2FY8A 1SESA 3D59A 4CLRA 3D6MA 1G8GA 3C6XA 4N8EA 1D2CA 3TLCA 1XXHE 3ZJYA 3HJNA 4FYYA 1FDWA 3ZGVA 1GTVA 4RFVA 2JGMA 3SGLA 4MB6A 1VZ2A 3DWFA 2YIMA 3K73O 1HC7A 5C7IO 3FD9A 3RVMA 2G9NA 1IZYA 3D8HA 1UXKA 1ENZA 3MS2A 3BEDA 1MJ5A 1GZSA 2I6SA 3OSZA 4BLRA 5KHIA 1QCYA 4KQIA 3K9QO 2IAFA 4ZQHA 1H8EA 4MI9A 3VSBA 3ZCQA 4RADA 3N3BC 1PEYA 4X1YB 1LF0A 1FXKB 4B3JA 3EGDA 3FPCA 1YRLA 2PRKA 1SU6A 2BGLA 3KLMX 3COJA 3QF4A 1TTQB 1A2QA 4N6GA 2QR5A 1GADO 3BHIA 3CF4A 1I7SB 5LNK6 1P81A 1OFVA 4E0BA 4QVIA 2G1KA 3TRDA 2V9ZA 3K5PA 1GARA 5T4HA 4EAAA 1YIJV 5HM6A 1J8FA 1ZN2A 4URFA 5EJ8A 5KNCA 2WWVD 5GGYA 1MNAA 1XVTA 3CNNA 2WLMA 3IB6A 3X2FA 1YQ9A 5E9AA 3EVCA 1VJDA 5KWVA 3DL7A 4ZO9A 2GN6A 4NJEB 2VAXA 2R79A 1Y74A 1DTWB 2XWBF 2GVNA 1NE2A 4MCAA 4WW0A 3GGSA 3O26A 4QTUB 4WLFA 4EJSB 2Z98A 3MRSA 1IHXA 3RAEC 3HVKA 3HWUA 1A9SA 1MORA 1QO0A 2DBZA 2FXVA 1PS9A 2QPLA 4QYMA 3DAOA 5B7GA 1J2UA 1UIMA 1D1PA 2I6QA 2ZVPX 4YAOA 4CPDA 3A0UA 4RZQA 4YJ2F 1CYEA 2JGJA 1GLNA 1KQGA 3NBQA 1ORQC 2AXTZ 1E79A 3E1SA 4N65A 1Z18A 2GKSA 4ZT7A 1S77D 3C5CA 4IJMA 4A0HA 3A2FA 3WLRA 2Q1XA 4OBEA 5JMTA 4ZHQB 2FE1A 3VYTC 2BDTA 4YMSA 1UZLA 2C03A 4CDRA 1GUZA 4ND6A 5ARDA 4GKAA 2P4SA 1G6Q1 2Y1CA 1E2EA 2P0AA 3N05A 4XCQA 3MAQA 1T34A 4I9GA 4UQOA 5JAMA 4YT2A 1P2UA 8AT1A 2AXEA 3KALA 3IELA 4K9SA 5A9TA 1HKHA 3CRNA 1Y7LA 2O8VA 2UYOA 3ICVA 5FLEX 3PEWA 3WPWA 1SD1A 1Z08A 4DMUB 1ZJJA 3ABZA 2Q1UA 2CDYA 4Z2WA 1Q7CA 1G9XA 1TM5E 1Z4OA 2WLTA 3C45A 3LDDA 3PJEA 3UHFA 3MAAC 3E1GA 2I6DA 4Q6BA 4PYIA 5ED0A 4KLRA 4M9QA 4MVJH 1M7BA 1MP0A 1EK2A 1HT0A 3AETA 1LQ2A 3NC0C 1HPLA 5LBUA 2HIGA 1XUOA 1IEXA 2W4MA 1AI6A 4LZOA 3AK4A 5CR9A 5K3CA 4AZWA 1U6IA 3JVHA 3IHKA 4NR0A 2BGUA 4HUQA 3RJ5A 4CR6A 1SUEA 5GONA 2GERA 5A2QA 3PC7A 5FPKA 1KP2A 4E33A 1M4UA 4FU0A 4LOAA 1ABFA 2UVQA 5CVDA 1E2PA 5TQVA 5IUNC 5HP4A 4ZDJA 1F2DA 1JMVA 1MR3F 2J31A 3I73A 1ECBA 2OGSA 1G0OA 1PL7A 1TA8A 2Z6VA 4IZ6A 1W5FA 5JJEB 4WFQA 2NO9A 2OXIA 1XTRA 1ZJZA 2FF7A 4ER0A 4QPPA 4JBHA 2V4DA 1OF1A 1K06A 1XRJA 3QOYA 4DMHA 2CMGA 3PQ2A 2R1ZA 2UZIR 2WWWA 4NSNA 1NXVA 3ZDZB 1PS8A 2XMSA 4CKCB 2V9CA 4GFDA 3F6RA 1VECA 4IO1A 5F1OA 1BGYH 2DQZA 3G5UA 2YHUA 5J1TB 4CKEB 5TISZ 4QQKA 4BNTA 4GWGA 2B3DA 1M5TA 1GRQA 4HGQA 4L8WB 4ER3A 1W9HA 2V65A 2UYPA 1TVCA 4W4TA 3I4CA 2DTEA 2OB1A 3MRXA 3W5CA 2XZLA 4ZEMA 2A94A 2ZBGA 1P9NA 1VHTA 2B83A 4YRKA 3OF2A 4WK6A 3F0GA 3ZRSA 2C29D 4ZI2A 5BSEA 1K6XA 2AV6A 3ECAA 4U5QA 1OYOA 3LXMA 4OJQA 3QUSA 2IEBA 3NCTA 2QTHA 1YJWF 4FILA 4XR9A 4P35A 2IIPA 1JEOA 2AHYA 1XTKA 3MVEA 4IDPA 1K7SN 1O77A 4B3XA 1ZJ6A 2IW5A 4XYMA 4P0TA 4L8LA 3OX1A 3O21A 5T4EA 2J9GA 4FMCB 3L84A 1F51E 1EX1A 1TFRA 1L4GA 2GESA 3LOQA 2Z09A 4AXXA 3OURA 2CFTA 4G2NA 3TW8B 4DXHA 3MLAA 2Q2QA 1YAJA 1NQTA 3KS9A 3LU1A