4TUYB

Tubulin-rhizoxin complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
424
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 171
structure length 424
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tuyB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tuyB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tuyB01
5ITZB 1Z5VA 4EB6A 4TV9A 4TUYA 5EZYB 4I55B 3WGKA 4DXDA 4O4LB 4ZI7A 5MN6A 4EB6B 1TUBB 4TV9B 5IJ0A 4TUYB 3UT5A 3VOBA 5MN5A 4IHJA 4YJ2B 1W5EA 5JCOC 4DRXA 4ZI7B 5IJ0B 5LP6C 5LYJA 3UT5B 1Z5WA 3JAWA 4FFBA 4IHJB 2RHHA 5EYPB 4DRXB 1W59A 5FNVA 2VAMA 5BMVA 4LNUA 3ZBQA 3VO8A 5LYJB 3JAWB 3JASA 4FFBB 5JVDA 1JFFA 5FNVB 4M8IA 5BMVB 4LNUB 5CA0A 2RHJA 3JASB 4X20A 5JVDB 3HKCA 1JFFB 4I50B 5CA0B 5JQGA 3HKBA 3HKCB 4O4HB 5IJ9A 3V3TA 3ZIDA 5JCOA 4E6EA 5JQGB 5C8YA 5IJ9B 5LP6A 4XCQA 5C8YB 5LP6B 1FSZA 3CB2A 5J2TA 3RB8A 4KWEA 3VO9A 4O4IA 2R6R1 3WGNA 3HKDA 5J2TB 2RHOA 2VAPA 3JAKA 1W5BA 5KX5A 3HKDB 3RYCA 3JAKB 4F6RA 5CA1A 4O4JA 5KX5B 3RYCB 5KMGA 4X20B 5IYZA 4O2BA 4U39A 4F6RB 5CA1B 1RQ7A 4O4JB 1W5AA 5KMGB 3HKEA 5IYZB 3RYIA 4IIJA 4O2BB 3HKBB 3WGJA 2XKAA 3HKEB 5M7EA 5LOVA 4O2AA 4WBNA 4IIJB 5CB4A 2VXYA 3ZBPA 1RQ2A 5LOVB 4EI9A 4O2AB 4WBNB 5JH7A 5LXTA 5J2UA 2XKBA 3RYFA 2BTQA 5JH7B 1FFXA 5J2UB 5LXTB 4U3JA 1RLUA 4ZOLA 1TVKA 4O4IB 3RYFB 2BTQB 1FFXB 3C8LA 4U3JB 1OFUA 4O4LA 4ZOLB 1TVKB 4B45A 1TUBA 1W581 2GVIA 2RHLA 3M8KA 5EIBD 4YJ2A 4EI8A 5EIBC 4B46A 4I55A 5EYPA 3WGLA 3E22A 1SA0A 3RYHA 2R751 3VOAA 3JALA 3JARA 3RYIB 2VAWA 3E22B 3WGMA 1SA0B 5GONA 3RYHB 3M89A 5CB4B 3JALB 3JATA 3JARB 3N2KA 4X1YA 4X1IA 4ZHQA 2Q1YA 4I50A 4X1KA 4YJ3A 5MN4A 2Q1XA 3N2GA 5GONB 3R4VA 4EI7A 5LA6A 3JATB 3N2KB 4HNAA 1W5FA 4X1YB 4I4TA 4O4HA 4TV8A 4X1IB 4X1KB 2BTOA 4YJ3B 4ZHQB 3N2GB 5ITZA 3VPAA 5LA6B 4HNAB 5EZYA 4I4TB 4TV8B
chains in the Genus database with same CATH superfamily
2CVHA 4BO0A 1QHIA 2N05A 3BRSA 2LBTA 3CJHB 1HDRA 2CDNA 1ANKA 4X65O 4YPFA 4IM7A 4WFGA 5IKOA 5I8ZA 1VHTA 3PJDA 2G8LA 3WHIA 3H3JA 2PRYA 2AFVA 1V25A 2GXSA 5LU8A 4OFZA 5B3SB 3PR2B 5K0FA 1LSOA 1XQXA 4EPWA 4E3WA 2VDKB 1EWVA 1RI3A 2X6QA 5C8VA 3G0OA 3HNOA 1DDIA 4PIVA 2QQFA 1U02A 4TRRA 1RP1A 3FOEC 3HAXD 2IF2A 2VDUE 1KWKA 4DR6B 3C45A 1W85A 5K1XA 5IXJA 3RSZA 2QBYB 1L0NH 4TRJA 1AY0A 2YEVA 2I3DA 3LHIA 1SA0A 1JN1A 1VQ4F 2AOUA 3ILXA 4WUVA 4FX5A 3FAVA 1B0AA 2G0AA 4BBJA 1EE1A 1J90A 5JLAA 3DAYA 4ALMA 4XTRA 1JG4A 4YDRA 2J1LA 1E61A 4GC5A 4O2AF 2WB4A 5LMNO 2GKOA 1UIMA 1NN5A 3I1FA 2OECA 3OBYA 4WD3A 4DCNA 2JRCA 2V9ZA 3C41J 5JASA 3GLFB 4CH3A 3GO4A 3BCRA 5JNSA 3PEWA 1WO8A 1BS1A 3OCYA 3WNCA 2QE7D 4YACA 1FPQA 1HRKA 1WRBA 4WLUA 1P1RA 2FZKA 4P3YA 3L8FA 4J9UE 5DLPA 5C1PA 2R8EA 2K87A 2JIRA 1SCUA 1IBSA 3CX5F 1EWQA 2XF2A 1RZ3A 4L50A 2NSLA 3ASYA 2BHSA 4IQ0A 5GOZA 1RWXA 1NVDA 3RFRA 4NV0A 3GX1A 1UP4A 3CO5A 3KEMA 3LSSA 1BDHA 2JRIA 2H8KA 3ABOB 4H15A 4JJGA 3RSSA 1KMHB 1DO2A 2FPXA 3MGAA 4BWVA 5FJIA 2YS8A 1FTNA 3QY9A 2CUKA 3WWEA 3QHAA 2JI9A 2BEJA 2G4CA 4ECAA 1TKAA 3ZGNA 5KQSA 1CLUA 4PSDA 2IU3A 4D9EA 2CMDA 2GH1A 4YRNA 4CM4B 2VHEA 4HH1A 4EJ2A 4DV7B 1ZD3A 4KNWA 2FEOA 3CCLV 3DHWC 3HUFA 3F0DA 2ZFUA 3B6ZA 3WJ2A 1YHYA 2ZZNA 1BD4A 2NAFA 3AG2C 3CV3A 2H0AA 4FE7A 4EMTA 2FSHA 2PNFA 1ZKMA 1KZ9A 3NHUA 1OA1A 4LWQA 2IQIA 4LCEA 5L3EA 1B3QA 121PA 3D8UA 4D25A 1IZ8A 5C1DA 2H5JA 2WUDA 5U1PA 4J49A 4MUJA 3E9CA 1FFXA 3OEHA 2CHSA 3FLBA 2XAGA 2WWRA 2W7TA 3JS5A 3SYCA 1JEQB 5EJIA 2Q4TA 2QTVA 4UASA 3QOYA 1RWWA 2ZSAA 4P9OA 1YQUA 5CM9C 5F1OA 2ODMA 1QH1B 5LZ2A 4GKAA 3PFBA 4LDJA 1K7YA 1XIVA 1IPAA 4UCWA 2Q7HA 1NVMB 4B5CA 5FI5A 2HF9A 3WADA 2C4TA 3UMCA 3V8MA 2F1HA 2Q9LA 1WM1A 4AYTA 3QMMA 4FE3A 3FWHA 5LQMA 4DUZB 1FNBA 4URYR 2EV9A 3BB3A 1WCYA 1JW9B 1IK4A 1KR2A 2G77B 5AJZA 3IELA 3V1NA 1DBWA 1UC5B 3VR4D 4B62A 3O2NA 5JYBA 1W4CA 5FQNA 4LE0A 2IODA 4INOA 4RHAA 2AK2A 3CBQA 4HDMB 1PQ4A 2NWQA 4OPAA 5HUJA 4OL0A 3A1DA 2OCDA 4M9SA 3MGKA 1NVUQ 3P4XA 1FTSA 4PG5A 5CJ2A 4PGMA 4JVSB 4ENQA 2QUHA 1VJRA 4FDVA 2AHYA 3L7CA 2JEXA 1PTKA 3UOGA 1UXKA 3T06B 4IY1A 1L5RA 2C00A 1Z39A 1KZ7B 3HVRA 3LP5A 2CEAA 1U9ZA 4PG4A 3R5HA 2Y05A 3DDSA 4KE7A 4FQ7A 5KX5F 2ODPA 2OHFA 2HW8A 1DIRA 4LJ5A 2DJVA 5KOHA 4QIHA 2Y3IA 1P74A 1AK2A 1OVMA 2VSXA 5BY1A 3L7IA 1HI9A 1MNQA 4G5HA 5EZQA 2GZ1A 2I7CA 4FFBA 4YAWA 3LXRA 3M6IA 4K35A 5JFTA 3D01A 3V3TA 2YX1A 4JD5A 3RQIA 5LFAA 2BMJA 3WQHA 4Y2JA 4A92A 3JR3A 1X2BA 4MQFA 4NCKA 1PNTA 1RJEA 1U63A 2ZIFA 1N0VC 2H2WA 3VTKA 2RAPA 3H7AA 5HPYB 3HYSA 4C7MA 4BO6A 3PVZA 4R01A 5DNAA 4CKBA 4UREA 3ZHXA 1DTWA 2OV1A 1G8KA 4XPIB 4QPZA 1DJNA 5DWDA 2ORYA 1IBRA 5JI2E 3R41A 2P9ZA 3AUXA 4DIEA 4FGJA 2CVOA 4MKIA 1Q0ZA 3FUUA 3BABA 2XMQA 5B53A 2Z09A 2UXDO 5FO0A 4OQ4A 2HFKA 4FFRA 1T0PA 4B7UA 5A4IS 1Q3TA 2YXZA 4TT3A 2XUDA 4TV9B 1JKJB 2IELA 1T9ZA 3FHJA 1OR8A 1TM3E 1TUGA 1SH7A 1Z4QA 3U7IA 1S5LZ 4ND2A 2FTKE 3HBFA 1OV9A 3EGOA 4XSHA 3AFIA 5IJ9A 1L3BA 4YT5A 4BQRA 3BILA 4HYTA 3RT1A 1Q5OA 3VH2A 3PQFA 3A3NA 4XM1A 3JAKA 4E14A 4AO7A 3HB7A 1WE2A 1ECGA 4CXMA 3PX3A 4WN9A 4UUJC 4LJ8A 1G8AA 3FYCA 2PZGA 4P83A 2RAUA 3LW8A 2ONYA 3RUDA 1DS6A 2OO5A 5B2FA 1HT1E 1IRIA 3PQDA 4J16C 4GUAA 5KJFA 3CCLF 3F2IA 1XMXA 1KZ1A 2P62A 4AF8A 4UU7A 1U5AA 1G5PA 2NZXA 1GG5A 1NNLA 1CY6A 3FF1A 3CX7A 3LY9A 3IMPA 4R9NA 3ETLA 3SEAA 4L4SA 2HF8A 2ZM6B 4CMGA 1AM4D 5G4LA 1MAAA 2Q1SA 4GLJA 3SDZA 4EEZA 2Z3WA 2PUTA 1IXSB 4DRXB 1FZQA 3DCIA 1XRGA 3I8OA 1HX7A 1RLIA 1PT5A 1GAXA 4I50B 3OOYA 5AQEA 3WVNA 3CMEV 1BFUA 2EDCA 2H0QA 4ND8A 2WWWA 2QL6A 3CJRA 4K9MA 3HBMA 3B1FA 1DBRA 3ESRA 3LLCA 1U2EA 2VHWA 5G0UA 1HEYA 1XJQA 1ODJA 3PRJA 1RM0A 2J0EA 3K14A 4ZOAA 1XNRB 4O1HA 4RH1A 3RSCA 2YINC 1E79G 3R7WA 2EFDB 2PMPA 2G0TA 2PZMA 1F20A 1IN1A 4CLXA 5K0TA 2C42A 5EK0A 1HDZA 1DBPA 2XDAA 1UK8A 3CPQA 2D7JA 3HYTA 4GI7A 2PLAA 1S2LA 4RDIA 2AFIB 2G25A 2A7WA 2H1CA 2VSYA 1KI8A 3SC4A 5GONF 5EYPB 1W59A 1SBCA 1Q44A 3NNNA 1FL9A 4OU4A 2FJPA 3URKA 3H19A 2ZB2A 1GEEA 4KVZA 4GVLA 3RK1A 4DIKA 2XCQA 1BE8A 2WLHA 4L74A 1XPOA 1AGPA 1PJCA 4RVOA 3WYNA 1F8UA 2IYEA 1NL3A 1LW7A 3T95A 1W96A 1K9MH 1O6FA 2HFEC 1O9GA 2O8DB 1VYVA 3OH8A 3TL2A 4YAIA 2NU9B 4KZKA 4YFVA 2GCPA 3K0FA 1MCZA 1X1TA 1VCHA 1QIEA 3ZN0A 3OBWA 4DQKA 3MPOA 4UHHA 4OUDB 2YFHA 1NI4A 4C6RA 1R3KC 2B8EA 1SPXA 3HCRA 4HX5A 3UG6A 1I6WA 3LQ1A 2CJYA 4X92A 2IDMA 1OPXA 4B8YA 1BVHA 3RWRD 4KAJA 2RHGB 4AQYO 4EPTA 2JGKA 2IIQA 2WPNA 2H1WA 3IILA 3OEEA 5M2QA 2CLMB 1KI1A 2DQYA 1FXUA 1E98A 4ENUA 1QVAA 1XP5A 1OWMA 2JZOA 3NM5A 5FOUA 2V5UA 5F98A 1PWXA 4NJMA 3AFOA 4A2PA 4EKDA 2Q4RA 4YCCA 4LJLA 2B2XA 3SPCA 4P80A 3HXQA 2F3PA 2VCYA 1YHQV 4JI5B 1YRHA 3V97A 4ENVA 3TOSA 2ZJ0A 3TTYA 2O7QA 1G8HA 1G6HA 5DYYA 3I4CA 3LOQA 5K6AA 1N9ZA 3AG4C 2ZUBA 4EY3A 1OIWA 1RWQA 5IP5A 3UJNA 1T6BY 1D1QA 3STVA 2I34A 3EOBI 4F4IA 4WWHA 1Q91A 4HEA6 2VJAA 3OJEA 1IHOA 4RZ2A 3HMKA 1NW9B 4OI1A 2XWSA 1CZHA 3QKTA 4P30A 2GZ3A 3ZEIA 3Q88A 1OH7A 1MRSA 1N2CA 4WLEA 2RIRA 3K9LA 3SQLA 1L0BA 3AHEA 4MS4A 4HNAB 5HA5A 1DLIA 3ZNQA 1ATIA 4YH1A 3ZVNA 2VUIB 3HCEA 2F00A 2AX3A 2VBFA 5IY5C 2UVDA 2L82A 1OW3B 2F9ZC 3O8NA 1OZHA 3O65A 1WOMA 5IJAA 4P54A 2OFXA 1MIHA 2ETVA 1XNQO 2A1TR 3GDHA 4KKXB 1GNSA 2TS1A 5K0BA 3MCTA 3NHJA 3VZBA 4CKEB 4RZHA 3E3MA 3X1WA 2EILB 1Y3HA 4NQZA 3AM5A 4WZAE 4L5CA 1BMTA 4RMGA 2XAHA 4DYVA 2QN2A 2LCAA 4EJSB 1G5TA 3ONVA 2QN9A 3AFMA 4ZMBA 1N7HA 4WFEA 3RTBA 3UA3A 4KPEC 2B99A 3DT8A 2FPSA 2IYAA 3ZV5A 2G36A 1XDUA 3QVSA 2G5TA 2I6DA 3M6VA 5G1PA 2QN6A 3KK0A 4DW0A 4QFBA 4JB2A 5EZYA 1D6NA 2Q2OA 1CUFA 3T9BA 1DUIA 3V48A 3EGDB 1USGA 4OUKX 3ZRSA 3KC2A 1NKDA 3ZWXA 1E2DA 3I6MA 1V8DA 3DQZA 1T15A 5KYKA 1J39A 4P9PA 4B8ZA 3PNBA 2OB2A 1S0UA 5JEDA 5EHGA 4ZC8A 1ZIXA 1E2HA 4CMKA 4FCWA 1M2OA 3WYBA 4FHFA 3JQEA 3N75A 2ZXWB 3CCCA 1Q0PA 3BMNA 3MWEB 4QUIA 4RMNA 4ODIA 3ZZMA 4F4DA 1GUFA 4QNHB 1O3YA 2PYZA 4RL4A 2FN3A 1GPMA 2X58A 1E3MA 2QWNB 1J06A 4XASA 1OLUB 5CAEA 2JGAA 3VHXB 1IHUA 2OCBA 5CGZA 1H2HA 1MAVA 2FPGA 2DYKA 3CX8A 5HY0A 2IYWA 3GRRA 5F3RA 4MWDA 2IUFA 5AKEA 3AQIA 1GIAA 3U1VA 4C2TA 3DO8A 4U9HS 3IALA 5E1OA 2HCFA 4EW3A 1OROA 4BASA 1SKVA 1EUDB 2CJWA 5G3ZA 2WLMA 4D9KA 1OBHA 2YIDA 4KODA 2XXBA 2TMGA 1CR4A 1V7CA 2VH2A 4H4CA 2SCUB 3I9JA 4OV6B 3I73A 3IGFA 2HSZA 3BFVA 1W5BA 3MT0A 3BD6A 4FIPC 2Q07A 1KC3A 3GUCA 3CUVA 5B64A 2CZQA 1ZHFA 2KKWA 1J5EO 2PN1A 2W8BA 1ENZA 3LWNA 1TGYA 3PPIA 4KIGA 4F5ZA 4XUEA 3HGMA 3IP9A 5BRJA 3QWAA 4MV1A 3ECSA 3SG0A 2WVGA 4BNIA 1YHQF 3DLPX 2B9VA 3L7DA 3HA7A 3LL7A 3DBHB 1E4OA 5CW2A 5DK4A 3LDAA 4GZMA 4E7PA 3FMIA 2RIPA 3H9BA 1UFOA 2V7PA 5IZCC 1T1RA 1V54B 2G5CA 3Q5DA 3LPNA 4MHTA 4FXPA 2Q1WA 2YOFA 2C1XA 4B87A 4ZZIA 1M56B 2IL1A 4J0EA 4JROA 2ZT9B 1YC2A 3TIFA 4MYCA 4IXNA 3VTAA 2BFEA 4MRMB 4FOSA 3KLOA 2FZEA 1NLFA 3OIUA 5KNCH 4DNXA 2VF8A 2FUKA 4A03A 3W2EA 5JJLA 3GN2A 1JALA 2AW9A 3E5MA 2X8JA 1AQ6A 3NWEA 1OXTA 3VIUA 4XFJA 1I5RA 2IJIA 1P9LA 2Q9UA 4O33A 2I54A 1ND6A 1ZC3A 4NYMQ 3V55A 1U8UA 1EFLA 4B45A 2ZJAA 3AUYA 4EY8A 3MDOA 4PVDA 3NRCA 4UHBA 3GFGA 3COWA 5L7TA 3W8NA 3BA8A 2CFOA 1K66A 4BNYA 2HU8A 2ZVYA 1MAWA 2OWDA 4PC1A 5E6RB 2HRZA 3DPUA 3A9TA 2B5OA 1PS8A 2Y1CA 3ZD9A 2FWJA 2OHXA 5G0WA 4BGDA 3J80A 5IDQA 4S1NA 3G13A 3MYYA 1Q0SA 4TLMB 2O2ZA 2WYHA 1KS2A 1J0DA 3EB9A 4AL4A 1WN7A 1FSZA 4ZQFA 3ND8A 1KOFA 3Q12A 3QKSA 3GFPA 5THXA 4FDLA 2XTJA 1J2EA 4XTCS 1Y8ZA 3SBOA 3ZHBA 3M0EA 5K4GA 1C1YA 5CNIA 3SPXA 4W7HA 4MS3A 4BWAA 4IIEA 3HM9A 3F5TA 4CF6A 3C1TA 3HABA 2GTAA 1MJFA 3KOZA 1DELA 3KOOA 3UAOA 3PNMA 4XQ9A 1AGNA 4MW6A 5HY2A 5HBRA 1G4UR 4PNZA 5LR6A 4FEGA 2VQEB 4R2JA 1ACJA 2CB0A 3RW0A 1RRPA 3EXHA 3F8SA 1P81A 2PI5A 3UJ3X 2EZOA 1W88A 4UULA 5LYYA 4ZALA 5C1OA 1BTOA 1HV8A 5JDIA 5D85A 1MABA 2E4VA 2L19A 1QP7A 1I7NA 4CT4B 1W7AA 4PYOA 4IDGA 1Y9DA 2XRFA 5INTA 2CK3D 3GAFA 2QJRA 4E4YA 3DHEA 1WY7A 4M0DA 3DBRB 5IEJA 5EIWA 3QIVA 1HBJA 1XBIA 3O1LA 1W49A 2DETA 5GV8A 3PGMA 4RSMA 4DFDA 2W8ZA 3SZLA 1P2TA 4A5UB 2PS1A 3U7EB 2QX8A 3NGLA 1ZA2A 1ZESA 4GW3A 5HJ7A 4FGUA 1KWGA 3JVEA 1V55C 2YICA 1G21A 2IPXA 1B04A 4JBXA 2WAAA 1V95A 3A6LA 4ZHVA 1QQAA 2VKTA 4A8HA 3THSA 4BB9A 3ANMA 1JFVA 3JATB 2PZKA 3H9EO 1F51E 2GJ4A 3AXSA 2CNWA 1F6WA 2VL7A 3RSHA 3WL8A 5I7OA 3MBMA 2FMLA 1YS1X 3W2TA 3W34A 1E2QA 1PR5A 2PMWB 4DIMA 1JQAA 2HA4A 2CSXA 3PPVA 1TCBA 1WLSA 1TJ4A 5ECYA 1TK9A 2E3CA 3NAGA 3NT4A 1FMFA 1CEZA 2VRBA 1XXHB 3MLAA 3Q7SA 2YS6A 2ZTHA 1KQGA 2YC4C 4Q3KA 3B38A 4PZLA 4GGOA 4TZTA 5J63A 4M76B 4CLOA 4LSMA 3Q3HA 4C6TB 2FEKA 1GU0A 2AQIA 4IIXA 4GOLD 5E7IA 4HAMA 3GK3A 1PI3A 2HQSA 3TRKA 2J3JA 1P31A 4URFA 4E07A 4IVQA 3NRBA 3FIJA 3CLVA 3RJZA 4I4NA 4CM1A 1RHRA 3M3HA 4AUNA 1O6CA 1TCUA 2AIZP 2FPKA 1N0HA 1P4RA 5GY7A 3W78A 1A82A 3H83A 5GM2A 4DDHA 3GDWA 2ZI7A 3FFXA 3LUHA 8LDHA 2GZAA 4B6JA 1KVSA 1X25A 4HAWA 3CD6V 2PHZA 1GDHA 4XLZA 4X5OA 2HRDA 4YMVA 1XG5A 4DUPA 3MJHA 1TFRA 3UQYS 5JFGA 4MB2A 1YU6A 5C8YB 1N9GA 1X2EA 1C3VA 2PEYA 3OTFA 1LV7A 2J9FA 1NS1A 4RD1A 4TN1A 3DL2A 5L4LA 5I45A 4OO3A 2GPTA 1Q95A 1WTCA 1LXCA 1C1XA 3R7SA 3M6XA 1S3FA 3G7SA 1SU7A 3N70A 4JI0B 3OOSA 4ZOLA 5JSQA 5KAIZ 1AKYA 2RG1A 1ZIOA 5LP6F 2WTEA 3BWXA 3G0BA 1FRFS 4EGFA 2I6RA 4CH6A 4ZVPA 3DTNA 3SQNA 3PFKA 3H5OA 2XMCA 4BW5A 3ZDDA 4OF4A 1C14A 3NFYA 1RBZA 4CEHB 1Z34A 4Z7JA 3C3EA 2WIGA 5CFOA 3T7JA 3MAAC 1SU8A 3N74A 3ML0A 4ZRNA 4KH0A 2VSOA 3KUDA 3ZVMA 4K9OA 5FNVB 2NTNA 3FSGA 2C95A 2XBMA 1E0DA 4JGSA 5AW3A 3AK2A 2PT6A 1Y1LA 1JA0A 2BISA 3GXOA 4M1SA 4C22A 4G86A 4J43A 5HDQA 2QRVA 4C4PA 3OM0A 2JZNA 5E4JA 1T8SA 2BZ0A 3RD5A 5LDDC 1Z5OA 5BSRA 3ZRWA 1VF6A 1YTFB 5AHWA 1OIVA 4MV8A 1V7QA 2HADA 4Q0MA 4M0UA 3PC8C 4R0MA 4FZVA 1SQBH 1VJCA 4XDHA 2J3QA 2X86A 2B34A 4R84A 1T8WA 1KP2A 5F35A 4CE6A 4JHLA 3OIVA 4DR5O 3BBLA 1WXQA 1C7EA 4A8JB 2ASEA 3KL2A 1P29A 1PFUA 4OIFA 2C9DA 1ESZA 2BHTA 3BWCA 3ETQA 1J2UA 1Q6YA 3PKZA 3ZY4A 4C7JA 4W8HA 5H5JA 4NPHA 3WV5A 4JSYA 5EJ9A 1GOTA 2WLJA 2FFRA 1Y6FA 1R9NA 2DJIA 1AA9A 4FFSA 4M0LA 1NLMA 3UB2A 5AP9A 1K3TA 5AHRA 5IAKA 1CUGA 3FSRA 1B6QA 4XCVA 3EGXA 3WL3A 2PD4A 3DDCA 1YJWV 2W6QA 4DMCA 3EQ6A 3OCXA 2NTJA 1RXUA 3U4MA 1MX9A 5DX8A 4BT2A 2ERYA 2ZVQX 3P4UA 1Z28A 4X54A 4HAVA 1L6RA 5LZ8A 4YALA 3NQ41 3T1NA 2E55A 1BXRB 3TM4A 3UFBA 3EIFA 2H5IA 4BKOA 4JYYA 1XI1A 4UCSA 1V9LA 3O21A 1JSCA 2K2QB 2PGXA 2JLBA 4Q9IA 3C9SA 1N4DA 3KT8A 4K40A 2J67A 1LLUA 4ALLA 1SS3A 3QLVA 5ED4A 2ZWMA 5EMKA 1DZ3A 4Q66C 4FFNA 2C9OA 4X84A 2ZP1A 2C29D 4ILEA 4CCWA 4I5FA 2C2HA 2E6KA 3KUXA 5ALVA 3ON5A 3C6ZA 3JQGA 2I2BA 2OGZA 4QUHA 2FPWA 1NVPD 3JR7A 3DZKA 1P6UA 2OK8A 3AESB 3LPMA 1QCDA 3FHLA 2RHOA 1VMGA 4P0QB 5EIFA 4L8YA 2ZIWB 3WKCA 4IXMA 4MKZA 3Q2KA 4U2EA 5LU9A 3O6VA 4P22A 2ZNJA 2ZJOA 4F97A 3IYLW 3BJEA 1JJ7A 1RRVA 4WNIA 3EHDA 2ATCA 1C3JA 3D7LA 2DFTA 4ZQHA 5A1TA 3LT4A 2ZTMA 2OSVA 4P3KA 1YJBA 1F2TB 4UAUA 3CD6F 2IYTA 1FFGA 3BGIA 3BM5A 2CL7X 3IR6A 1GY8A 5C3MA 4F45A 3VR6H 2P5OA 3JARB 2WLKA 2V8BA 4K6GA 5LKAA 1NV9A 5HY4A 5DK6A 3GNLA 3ZCQA 2PX0A 2JGLA 1VI6A 4P92A 1V1MB 3L7LA 2R48A 1DB3A 3ORHA 3HVJA 4BXOB 1VBFA 2CDAA 2Q3JA 4GYKA 2K5UA 3AL0C 1THZA 3GVIA 3PXEA 3DFIA 3OZAA 5HKOA 3KYJB 3AFGA 3QTTA 4TTJA 1ZMXA 1HFEL 4EW2A 4RIGA 4RAOA 1S8FA 1ACMA 1G7SA 3T15A 4M4SA 2E3JA 3P2IA 2Q62A 4JC5A 3LUFA 2RK6A 5L3QB 3ESBA 1OWOA 1GZVA 1WDLA 1X13A 3DB2A 2EFJA 4H6WA 1L2TA 4C3VA 4NYMR 3ZXUB 3S7TA 4ARUA 4R2WA 1XMOO 3WS7A 1UBMS 2OO3A 2KMLA 4NF2A 2QX7A 4RBNA 2EIKB 1W2BU 3AHFA 3KWLA 1DGSA 1VPWA 2ZYHA 1EDZA 1RTKA 1ENVA 4MSWC 3YASA 3OG9A 1Q43A 5B1BC 4WLOA 4I55B 5J47A 3ZH2A 2N48A 3FOAA 5CHEA 1Y80A 2Y2UA 2YDXA 4AJ1A 3O2SB 1GPJA 5JJBA 1RVDA 3N0TA 2CNDA 2VDPB 2PT7A 3CWBH 2W2MA 4IV0A 3NJ4A 1Q6IA 4MW9A 4EVRA 1N7JA 1GFIA 5JYEA 3UKDA 5AOVA 2I67A 2GDJA 1ORDA 2P79A 1ZXLA 5B4UA 1ZN7A 2Y8EA 5EP3A 1WXGA 2C0CA 2VHTA 4JR1A 3TCKA 4RVCA 5KNBD 2HWYA 5AJWA 1WAZA 1CIVA 3P71T 3OAAD 5G4KB 4NEHB 1LC3A 3ZU2A 1UDCA 4ZCSA 1DEHA 4LHSA 3JD4A 3EF3A 4KVGA 3BMQA 2VBCA 2GF0A 1SVSA 3R23A 3OMLA 4RSRA 4KR3A 2DPLA 3WKBA 3U6BA 1OASA 4NENA 4LMPA 1XXLA 1YJWF 5BMOA 7YASA 1PJBA 2JBHA 4PDLA 1L7EA 5CJJA 5FP0A 4PSVA 5C4MA 5H3CA 2YVAA 3KTAA 3P0ZA 4CV2A 5L3RA 5EZSA 3AEQA 1Z6XA 3HZOA 4RGQA 2WF9A 6NULA 1Z8DA 3X3HA 3ND6A 1O6BA 3HN6A 3V32A 1JSRA 3V7QA 5HKLA 1RQ7A 2FDRA 3DVSX 4X97A 3GTZA 5EUBA 2ZCEA 3U39A 3I4FA 1UXHA 3SYOA 1BMQA 2WIKA 821PA 2AZXA 4UOZA 4AXBA 3AEUB 3PQ2A 2ZRGA 4KN6A 1B06A 4LF4O 4EUSA 1S2IA 1S72V 1MIOA 5B3KA 4FEYA 1N2HA 3FFQA 2E4YA 4WXMA 1O03A 1Y4UA 1Y1SA 2DY1A 4EUFA 1AJEA 2IV2X 2FNAA 2R00A 3PXCX 3ZOPA 3VZCA 4FS8A 1G3RA 4JOQA 3CWCA 4X20A 4TWRA 2RMKB 1ZK4A 2J6CA 2JLXA 3SZRA 3WB0A 1U7WA 3LW7A 1QG4A 2AKAB 3KSRA 2WMYA 1W1IA 4BVQA 2YWXA 2NXEA 1ZGZA 2R86A 2ZXUA 4P3NA 1FYVA 4GXRA 4DV3O 3ETEA 5FL7A 2GMWA 3IHLA 5A5DA 4J41A 2Y1XA 3I1YA 2UZ1A 4HGZA 5ARBA 5FPTA 1BE6A 4Z4QA 4DC0A 3UQ8A 2ZE7A 4KV7A 5ALXA 4WBNB 5JWHA 1SC3A 3D4OA 1QAMA 3KAPA 2IRWA 4ZQBA 2ZPAA 3E7WA 3FMVA 2FN9A 1DX4A 2Z6UA 2HJWA 4IL6Z 1NQWA 2YHSA 5T8KC 3H1HH 3CPSA 1FSGA 5ALYA 3WB9A 5JSFA 5KJ6A 2B4RO 4TMWA 5IDXA 2OXIA 5REQA 1LVHA 5L3FA 3GC6A 4YCJA 4C43A 4YAEA 1KQOA 3ROEA 3L0BA 4OMUA 1PG0A 4EUHA 4BT6A 1B0ZA 4CPDA 1PS0A 2CNNA 5CX1A 4EHFA 3M70A 2Y0CA 3BT7A 3ZY5A 1XLWA 2BCCH 1WXFA 3OKCA 5FUYA 2BR5A 1GNVA 1ZJ5A 3IEQA 5ULLA 3HDYA 2I8AA 3CCMF 3H9QA 2BOCC 3OPXA 3K31A 5IMBA 2RBGA 5K5EA 5K0CA 3AEYA 4JDPA 3OP1A 3PLNA 4U7WA 4UAGA 1BMFD 1IOZA 2XSZD 3M34A 3BQ9A 1I36A 4IFIA 4DQ0A 3R5TA 3WHLA 5AKIA 4CRWB 2DWOA 2XZTA 1XREA 1QGUA 3OW2F 1UBHS 2GEJA 4WNCA 2Q99A 3AM4A 2FFJA 3WLEA 3PAFA 2X2PA 3BIXA 1YRAA 1JRLA 3X2QC 3Q5EA 4EGJA 3HYNA 4I7EA 3OE4A 4EG3A 5BMVA 3LF1A 3MTIA 5B37A 3CRCA 2GHYA 4YP1A 4ZN6A 1VKRA 4NP6A 3WGQA 2P6JA 1UI9A 3K5IA 1FXVA 2PQ2A 3C87A 1QBZA 2AQHA 3Q40A 2BWJA 2CL0X 1G9TA 4WV3A 2B1RA 3MJTA 4FI3C 5H6QA 4CTOA 3LOPA 1LQUA 1RADA 1YFJA 4C4AA 1N6KA 3HBJA 2ZUSA 1TDJA 4NVRA 3GFSA 2ZRNA 4RKQA 2VWQA 2KM1A 3BKXA 9LDTA 4Y0NA 4I8DA 1CLIA 1E3QA 3H75A 5AI5A 2C2XA 2JH8A 4RCYA 3DKPA 2GCEA 5C31A 2QRZA 5KNDA 4S35A 1SZXA 3AG6A 2E89A 1DUSA 5KU7A 3DKKA 1T8UA 4GX2A 2NPIA 2Y0DA 1XDCA 3IRVA 1J25A 2J46A 2QG9A 1OBCA 1LSUA 1LY1A 2BFAA 3VKVA 4O0MA 1C0KA 3HBNA 4CN8A 4M98A 2GEFA 1BA3A 2WWXA 3AJRA 5F7ZA 3FNGA 3KDAA 3ZIUA 2GWRA 1BGYH 3WNZA 3TVDA 4DLRA 5LHHA 4TVKA 4PPNA 4EABA 3MIZA 1G41A 1S72F 3CEMA 4WFJA 1SXJE 4CMJA 3THYA 5CVDA 2AFHE 2F93B 1I1OA 1JHQA 3CN9A 4XUDA 4XYLA 1YUBA 2QJTA 4YRCA 3V7NA 3DTVA 4B6SA 4KIWA 4RA9B 4Y2VA 3QE3A 1Q1GA 1MGOA 1FC0A 4PO9A 4BNLA 1DJMA 4RF5A 3QXXA 1TPYA 1WSBA 3KYIB 5CLJA 3KG2A 2CDCA 5FJJA 1NVBA 2JI6A 2ZJ5A 2Z1FA 1I4EB 4GIBA 1GKUB 1E6WA 4AY6A 1NYLA 3OD4A 4YJFA 1MC8A 1HE4A 2YJ4A 1YQTA 2VP3A 2C61A 2P78A 2XQVA 3SEZA 5DP2A 2Z9BA 3BB1A 3O9MA 2NADA 1B3BA 2LKDA 1J8DA 1W0JA 2BFDA 1ORQC 2RE8A 2IX3A 2BEKA 4OHMA 3IEIA 2QTRA 4JASA 4UD2A 1HORA 2VCHA 2XH8A 2ZCUA 4GYWA 4IOJA 1YL5A 5BSFA 5KHOC 1BWQA 2F7SA 2YN0A 1NW3A 4FMCF 5AM3A 4WW0A 2HMYB 4ZRMA 2A4MA 4CI0B 3G8AA 4HYYA 4JA0A 4ERNA 4QLAA 4OB6A 1ETHA 3EXIB 5IKEA 5H1YA 4ZHYB 2YXEA 2UZ0A 3I53A 1XTPA 5B1AC 3RWMB 1XCJA 2JKZA 4DWWA 4WZAB 5DASA 1Q7YH 1I4DD 1LB1B 1REQA 4AKEA 3D81A 3SXUB 4KOAA 1ZL0A 3N0XA 4HAZA 4DC9A 1XDWA 2O20A 5H70A 1EG2A 2XNJA 4QTZA 2YWCA 3DFKA 3RBVA 3L0ZA 4YUZA 3QKRB 4BQQA 4EG8A 2CFCA 3GD5A 2I80A 1SKMA 1X7WA 1X14A 1LJLA 1D2MA 3UB4A 2YZGA 4PA4A 5JRDS 3RAEC 4GKJB 2VNKA 4LISA 5DHFA 2NR5A 4X63A 2X0FA 4XAQA 3U4GA 5CA1B 4P4UA 3D3QA 1JBKA 1VIYA 1QK4A 3ZE6A 1LTQA 5H2FZ 1H6BA 5TQJA 3W6UA 5AVRA 3RIEA 2JA1A 2OCPA 5JWOA 3AK1A 3KHUA 2QLBA 2JLZA 4D4MA 1W4BA 1ZBQA 3OUZA 3LWDA 1G8SA 4INPA 1HY3A 4XB6B 2YY6A 5K01A 3B9PA 2V6GA 2UYKA 3G9UA 3NS7A 2LDXA 3WHKA 2E4WA 1K4CC 4KK4A 1WIWA 4H1WA 1NE7A 1DG1G 2HNKA 2KYRA 2PYIA 2XB2A 1LC0A 4YFYA 3FAZA 4YXWD 2Z1EA 3T7KA 1MTOA 3DWIA 1RCTE 1JR4A 3TX6A 1G6KA 2HYIC 3K2BA 4PXYA 4PLWA 1PNKA 1K8AW 1D0VA 4L27A 3IAS6 4AKIA 4H2DA 1YQ9A 1L5OA 4W5RA 1L4UA 4F21A 2CTRA 2ZOVA 2EJBA 1L7BA 1V3UA 5DBHX 1SD5A 2C31A 3W1EA 3CVWA 1FP7A 2QZZA 3EYAA 3S44A 5J5CA 1IHXA 2C7BA 4N5NA 1VHWA 2GLTA 1A77A 2J85A 2G83A 3U7QB 2HO5A 1G291 4O4LA 5K3EA 3SM3A 1IFXA 3SVLA 1ZOOA 4U7OA 1E2NA 2VTVA 2FAXA 4MO9A 3SLGA 1IHPA 3KX2A 4TWKA 1Q86W 3U17A 3BDVA 3DC2A 2Q5JA 1RSOB 4ZXPA 2JH3A 2O1SA 5J1SB 5AVUA 1BX0A 1E3TA 3DC6A 3MCWA 1A8SA 4CF4A 5F1KA 4LXIA 4JLMA 2PRZA 4G84A 1KEZA 1OHHD 3RODA 4CF7A 4I4TF 4DSAA 3LMEA 3TD6A 1XZAA 3RCBA 1JEEA 3M84A 1Y42X 3NYQA 4OQDA 4AY3A 3JAMN 2Y6VA 3AKCA 2RJ3A 1MO4A 3MTJA 1ZJ6A 4URVR 1EXNA 2W58A 5LMUB 3KJIA 4D9CA 2L18A 1YMQA 2D0DA 1KDTA 3E86A 4L8JA 2EINB 3ZIAA 3ID6C 1CUHA 4Q1EA 1I94B 5DDIP 3ZJUA 3VNBA 3I5XA 1QO0A 3LD9A 1CEQA 2F8SA 1K7DA 1CG6A 4MVRA 4Q37A 4J9ZB 2MQEA 3QH4A 4UBLA 1XFAA 5GOTA 3KSBC 3GW8A 2D7DA 3L7KA 2V59A 4MR9A 4YRSA 4BFZA 3OU6A 4O8CA 3GHYA 4HDOB 1UFKA 4MMZB 2OC9A 1PN3A 1BC5A 1EWRA 4JI4O 4LGCA 1E5LA 1N3BA 2EJWA 3HADA 4I1YA 5AKLA 3NIDB 3N6RA 1YDMA 2ZNIA 4BJ3A 4R9RA 1CJMA 5CB8A 3BKWA 4RQEA 3K1JA 1QDLB 3PR1A 1G20A 4ZCRA 4G89A 2WJ4A 3ZZTA 1MZVA 1FSSA 5BOSA 3WFIA 3C3AA 1E6EA 5KHJA 3AV0B 1Z6TA 4KE8A 2B5UA 1D2CA 2GNAA 2F4NA 2O6HA 3KD3A 1RJDA 3QF4A 1CIPA 1E5DA 3OGIB 4ABMA 5JR3A 2UZAA 2SKCA 1RI4A 5K0GA 2O0LA 1YCDA 5FV4A 4DCMA 4MA0A 4RO0A 1JNYA 1VE5A 5DSZA 2GTIA 1K73W 1W581 3NGMA 4QUGA 1M7HA 3MG9A 5BR8B 5ES4B 3FPIA 1M1XB 3OZRA 5IEBA 1F4MA 2GK3A 3IIIA 1H8EG 3SJCC 4UM7A 2WA4A 2ZJ2A 4IIDA 1BKSB 1N1GA 5JANA 3TSCA 1M1ZA 2PQ0A 3WYDA 3M4SA 3HR8A 4TWZA 2H4WA 3T9CA 2CL5A 1HM5A 2XHZA 3E03A 3TQRA 3KP1A 5CLIA 3WDMA 1YH3A 2QG4A 3LAWA 3LLMA 1FP4A 3F73A 1U7ZA 3K30A 1XTUA 2FSPA 5CH8A 1VCMA 5B1DA 3UH0A 4RZ3A 5KKAA 4US1R 1K97A 2ZDIC 4MLCA 1UKVY 1Z7YA 3M6FA 2YXYA 4DR2O 4PX3A 1HK7A 4HC4A 4BIUA 4ZQCB 3UANA 4G4WA 2V0NA 3K6RA 5JMOA 3UXMA 4J0KA 3BHMA 1K6IA 3TX2A 4LMRA 3KZOA 4HFMA 3PUYA 2OOKA 1C3EA 1NUSA 3ORFA 2D4AA 2ZI6A 1Y34E 3QI7A 1ABFA 3IXMA 4LNUA 2BKVA 2NG1A 4DV5B 2O7NA 5JADA 2JHAA 3CM0A 3KKYA 5J58A 3ACDA 4IDAA 4TS1A 2ZBQA 4U4AA 1Y8QB 1U2ZA 1PX0A 1G2PA 4LKRA 1KK1A 2AHOA 2Q45A 1ZVVA 1MJ5A 4LF8O 1RYEA 1NWHA 4HMOA 5HWSA 3SPGA 4QHTA 1RPTA 3P9XA 1LWNA 5AHKA 2WSYB 2F48A 5LMNB 3M1AA 2QJFA 3WJAA 4ZK6A 3JALA 3RHSA 2FFAA 4UTOA 1EQ2A 1QFYA 3UWMA 1NP3A 1ONSA 1NHGA 4KQHA 1T34A 4E5KA 4LJ7A 1CUSA 5BN5B 1KJZA 2G70A 1E6UA 1Q84A 1HNWO 1ZGBA 1RXYA 1E9FA 2JFFA 4PA6A 3K5PA 3EOZA 3E8BA 4MIEA 2CXHA 1NGSA 4DMKA 3OT5A 5UKDA 1VHLA 1ZISA 4HUQB 2G09A 3F5SA 2CE4A 1SKBA 3UO2A 3FPBA 3R7AA 4V39A 1R8SA 1HNZO 4MPTA 4OXRA 3URMA 2I1VB 2YNMC 2LIVA 2RAFA 2PXHA 4R9SA 1QRAA 2AJDA 3HV2A 5CVTA 2J45A 3SSNA 2O7VA 3FR8A 4NE7A 4W5JA 4IEIA 3DBVO 2VFAA 1BRMA 1UFVA 3QMVA 1JEJA 4EDHA 4JYMA 3TECE 3NC0C 3E8GA 5BUSA 2IEZA 3B12A 4JYZA 5CFNA 2P2NA 3T8YA 2C0PA 4TMYA 4ZIRA 1EDOA 4LZJA 1S6YA 5AJUA 4LF9B 1UWVA 2GXUA 1PZNA 3REGA 3EVNA 3SQWA 3CU5A 1GEGA 1ULZA 3FDZB 1TVEA 1ISHA 1A88A 3HLTA 3PGVA 3ND9A 4Y18A 3C70A 5CU7A 3VHLB 3RIMA 4D8YA 1CQJA 4BO9A 4AILC 2R1VA 2ZR7A 1GZUA 4FBGA 5LM3A 3GMIA 3H9VA 1PR6A 1K4YA 2HWXA 3SIPA 1JFSA 3S2UA 5CT5A 4LY3A 2XPCA 1T25A 3P2MA 3RVZA 3TZBA 4MUBA 5ALPA 1H7MA 2Z5LA 5IYZA 1Z06A 4I19A 3QMWA 3F6PA 1K7XB 3EGIA 2X40A 4AZSA 1EUQA 2YMQA 4KXNA 2R2GA 1NKVA 3K0EA 3GF4A 4E5UA 2C1ZA 3JRNA 4NULA 5KKNB 4PLYA 4IILA 2CJFA 4YYEA 4J16A 3H1AA 1WL8A 1SZCA 4L5BA 2XMDA 5ILOA 4YP7A 4YUAA 2XTMA 4GU5A 2F3SA 5EQJB 2GYUA 1PWZA 2JDID 4FNMA 2VAVA 3OD1A 4AJOA 2C92A 2A5GA 5TF0A 3R0VA 3L79A 2IHBA 4I1SA 4QTUB 4LCBA 2F8MA 2HLPA 3M1YA 3ZTTA 3ORRA 4WE3A 4JZYA 1YZBA 1V9SA 1SBTA 2LP4Y 4B35A 2JKYA 1H42A 5CTAA 2XB4A 3AZQA 1Y81A 4DV1B 3H1GA 1QHNA 5KNLA 3ICQB 1QMPA 1ZAKA 1FXWA 2XDQA 1WSAA 2F17A 2V0CA 3HB5X 1VZ3A 2XYVA 1RXIA 5CCBA 3CMEF 5SZIA 1TUIA 4NMMA 1G8MA 3E9RA 2VDWB 1F48A 2AD5A 2ZSKA 1Z5PA 4TS3A 2JL1A 5DJ5A 2PX4A 2FQ1A 1QS0A 2Z2KA 3GZNB 1EMDA 4BW9A 4P4SB 1T0BA 4BKUA 1MEJA 5G1OA 4QA9A 2BEUA 3WOVA 1M1NB 1Z6PA 2RARA 4K3UA 5C8ZA 5ERGB 1QKKA 1U6JA 1Y5LA 4AY2A 2GEBA 2WA3A 2I9PA 1TTPB 2DPMA 2CLKB 3L4SO 2DUMA 3WP0A 3WZLA 3O8QA 4EFLA 1LQ2A 2F1RA 1D03A 5KTMA 5EI5A 5TIIA 3RK4A 4X8LA 3Q0TA 4Z1MD 4PN7A 4IOKA 3O1HB 4NVPA 3ENZA 4HFNA 2UXDB 3IDZA 2AN5A 3D5EA 3NVKE 3U4QA 1IYZA 3DL4A 1I51A 3GWKC 1QV6A 3EQZA 2Z0MA 4E5YA 3EUWA 3A4NA 1KYTA 2V7QA 4EFNA 3BE5A 4JJ6A 2QTWB 4F9GA 1XNGA 1POWA 3HY6A 4Z2YA 2R6DA 2XRMA 2H17A 2F95B 4X94A 4RYDA 3AOGA 3STWA 2C3YA 5BQ5A 3JVDA 2EZ9A 1SIOA 2XVZA 4H7HA 1ZUIA 1HKHA 4BO3A 3U4AA 2G5GX 3W5SA 2R79A 1QVGF 1PR3A 3PQ4A 3KD2A 2DT5A 2RB9A 2O8VA 4CODB 1Z17A 4P8RA 1Z63A 3NTUA 3VR3A 5EWMB 1A0OA 5DBIA 2AWOA 4M8SA 4ZU1X 4C0SA 3M5DA 5KSYA 2D3WA 4FFKA 3IPYA 3G6WA 1AJNA 3DMNA 4IEFB 1DLBA 2YSUB 1WZEA 2GO1A 2VJNA 3ELUA 1FY2A 3C3CA 1BWSA 2TRSB 2WD7B 2X0LA 3EWNA 3E8XA 4EJ0A 1VIBA 3AZPA 2RGNC 3ETDA 1E18A 4B5LA 3OUUA 3I23A 5GADl 2Z56A 4UB8Z 1CYDA 1E5VA 4UCRA 1G7CA 3FOCA 5I6DA 2ZSFA 1RNLA 5K20A 1JG7A 5LYJA 3B8HA 3ZHUA 3TB6A 3WPWA 5MHTA 2Q4OA 4MV7A 4WY8A 4F8EA 1QR2A 2CWDA 3QNMA 3HKBA 3WYEA 3ASNC 3S3WA 2ZRDA 4Y9RA 2OENG 3NANA 1P7PA 4ZTBA 4DGSA 4MVJD 1X7HA 1YTUA 1DF4A 3NNSA 4GO1A 1D7OA 3OCWA 4F0JA 2BFBA 3GGDA 5GIOC 3RARA 2UVPA 3WB1A 4Y98A 1J00A 3KKEA 2G63A 1ISJA 1I0HA 2QUJA 5ALFA 2Z1NA 4G28B 2NNUA 3Q4GA 1DC6A 5F9FA 4KHZA 4IG4A 2ODAA 2BYTA 4KBFA 4ARBA 4U8GA 4DEXA 4IPTA 4ALIA 2QTTA 3FFWA 1T2AA 2X5NA 3N8IA 5BPHA 2QGNA 3CSSA 3TXXA 3RGWS 4LMAA 2PUHA 3WLIA 4K81B 2WSSG 4G8BA 3TH5A 2WLLB 1BHQ1 1ACLA 2AXEA 2G71A 3CVJA 4RTMA 3NEJA 3QJYA 4V0RA 2H8EA 4URWR 3S2FA 2HLDG 3LNMB 5KDDA 1P60A 5E3IA 1QNMA 4UPEA 2Q50A 1IBCA 3ZKWA 3ITEA 1XYGA 2K9PA 3UCXA 3I1JA 4BCBA 2ZZMA 1ZAYA 4D6TH 4P7GA 4YCDA 3OQHA 1KBOA 1BDBA 1ISMA 3A2LA 1CUCA 1B1AA 1W9MA 4WESA 3O7MA 2QROA 4NZPA 4H17A 4XYGA 1POXA 5LGNA 3PCRB 2JPDA 5IXSA 1ODFA 4IL5A 1GQOA 3H8WA 4BEBA 2WPDG 5THKA 4BNJA 4WXHA 3LCVB 2OCXA 1TIKA 2ZUCA 1XLVA 3IOYA 5AJYA 1LDMA 4DRZA 5A4JA 1S4MA 3W79A 2H0RA 3BA9A 3ZR4B 1H2EA 4JA2A 1X0VA 4ZT6A 5TDHA 4QPCA 3FAKA 5IJWA 3T2MA 3EAQA 4S24A 2P30A 4EBFA 4LOHA 1NQTA 5EHNA 4AMGA 3WKAA 4ZDWA 2Z01A 3H17A 1X7XA 3B48A 1I2ZA 2QM3A 1V16A 2QTSA 4C4OA 2DPXA 4B2LA 2P69A 1XZEA 5ELXA 3G0GA 2QE7A 1FFWA 1PEAA 4GOND 4G4GA 4EI9A 3L1IA 5HCIA 4GMDA 2PKRA 5JH7B 3F7YC 4U5XA 3FKQA 1PJLA 1FAFA 2JCSA 1NHWA 5CMLA 2H4ZA 4OYHA 4JI1O 4A3SA 4I3GA 3DLTA 1TT7A 4DYDA 3TLJA 1XNQB 2Q2NA 3SZUA 5FOXA 4B44A 3PSHA 4D02A 1G8FA 1VLHA 5DI9A 1KKMA 4LVUA 2V8OA 3R77A 3D31A 4IFBA 3ZRXA 5IZCA 4B6OA 4V02A 6AT1A 2EWWA 2YHIB 2BGWA 1ZMTA 4CG2A 3HNPA 3E4DA 1Z6GA 4UMVA 4C21A 2JIZG 3Q4HB 1SY7A 4XEUA 4NH0A 4QOEA 3PIIA 3DP7A 1SXPA 2C4KA 4HAXA 3RYCB 1KQFA 4F06A 2G40A 3ECAA 3IR5A 5LB4A 3ENKA 2D4HA 3B3JA 1V8OA 5BWBA 2ZINA 1IDN1 2J3DA 3ZE0B 2IZ0A 4AMVA 3PHHA 1MX3A 3D3KA 4IIYA 3DWEX 3A1VA 4MW5A 2PVCA 8GPBA 2IYNA 3C3DA 3O4VA 4CMAA 5KA5A 1W4RA 4EFDA 2ZGVA 4Q18A 3FF4A 4KPGA 2QSYA 1JLMA 5ICSA 3L70H 3PCXA 1WTAA 3TSYA 1KJJA 3OX1A 4JBGA 4C5BA 1KQSF 3V2GA 1ABBA 1IXYA 4GMKA 3EG9B 4E2XA 3VAZA 3T1YO 1DWUA 3KLNA 3AEKB 2P41A 2UUAO 3PDHA 3OETA 1D6MA 2VJDA 1SQSA 5EJMA 1JJIA 4WFIA 4I08A 4H33A 2FEXA 3D00A 1JAIA 4D0LB 4OHPA 3ROTA 3KZKA 3B52X 1YIJV 3WY9A 4E1BA 3CE2A 1D5AA 4OGWA 4F6RB 2V6JA 4PA3A 3A4IA 2VQFO 2PBRA 1T5EA 2YN4A 3FWNA 3VR4A 2XKBA 3ZV7A 4QBHA 1NNSA 4G4SO 4GPTA 4JJFA 1OD6A 3K0DA 5CXXA 1T6NA 5DXAA 2YV3A 3FNFA 2D8AA 4OAQA 2UXCO 3D02A 5SYAA 4DCPA 1KNXA 2EBWA 2MOKA 4W8GA 2KG7B 1UL1X 2R8OA 5K8UA 4POOA 1PWHA 1UPGA 1XZ8A 2ZETA 1UMBB 4I9NA 1PLJA 2QXUA 1EHYA 2KWIA 1DHRA 3C5EA 3ROQA 4M0EA 1GO1A 3CVOA 1J5EB 3OOHA 1CIJA 3NUZA 3C7AA 3ESDA 1EUCA 3TS1A 1O7JA 4IF6A 2PX2A 1SJ9A 3DLIA 1R9GA 1Y3FE 1C8KA 3OJOA 5M29A 4OX9Y 3EEOA 3ZS8C 5GTDA 5I7WA 2DULA 4CEIA 2LXNA 4RVGA 4QEZA 2IXBA 1XU7A 3I04M 4J7ZA 1TEXA 3QBVA 2YJZA 5AOCA 4LY6A 1VIVA 3IT2A 3DGEC 4OA8A 1N6HA 1O08A 4V0OA 5FHRA 1RFYA 1DIGA 3BAFA 3HFRA 1JWLA 1HLDA 3BGWA 5AVYA 1GSAA 2P9CA 2WLIB 2ZCJA 1CJKC 2JNWA 3R2JA 2HZ7A 1M2NA 3QLTA 3MD0A 1IVSA 1U3VA 2X5OA 1B16A 1SXJB 3PRKE 1YNOA 3BEOA 2AFHB 1NUUA 4PR0A 4GX5A 2I65A 3UJ8A 3I72A 3V4FA 3O75A 4N76A 4MS2A 1QKJA 2CFSA 4XARA 4U5QA 3H4MA 4OX9B 2EEPA 5KHIA 3G5LA 2O50A 2PNJA 4ZVLA 1GUZA 2FV8A 1FJXA 5COBA 4JI3B 1N0WA 3JYLA 1N32B 5AI6A 4IHAA 5HRUA 2IOFA 3MTBA 3NP9A 1XEAA 1VJ0A 5LQNA 2PKQO 1GN4A 3O9OA 1DT3A 4G5GA 4XVUA 1XTRA 3ZYZA 2VPXA 4HDKA 1PNQA 1NY5A 3H7IA 4L51A 1IY0A 4LGVA 4JITA 2BKEA 2Y68A 1E4EB 1XLTC 5B4TA 1C3XA 3CVVA 1ISFA 2ZYRA 1DRKA 2VHVA 3H8VA 2UVQA 4ZYZA 1JJVA 3F7VC 5EXPA 4K1XA 1VIAA 2QRHA 2F67A 1BS2A 1INLA 1A76A 2DYSB 1I4TD 2HT6A 1Q6UA 3UGKA 2GERA 2HBQA 1P8AA 2O8BB 3IDFA 3IAEA 2EAUA 3E5RA 1PJSA 5ICMA 4PQYA 1MF7A 2I8LA 4B3TB 4DADA 4NAHA 1RJ9A 1ZN8A 1W36D 5B1OA 5EHZA 1Q7GA 3RS0A 1YRBA 4N0QA 2P4HX 2IY8A 4I7ZB 4GEGA 1R6TA 4FQ8A 3OCUA 4W5TA 2CN1A 3MAGA 4KG7A 3VI4B 3CMMA 4DBLE 2W4MA 1K6XA 1EM1A 3U37A 5ALSA 4XDLA 2X2EA 1EFUA 1OVGA 3FZGA 1Z08A 3TN7A 3WMFA 1JOYA 3VGJA 4J7JA 5A9RA 4E03A 2LW7A 2Q7EA 1F4VA 2FUG6 1AD2A 1ZIPA 3RVSA 4TM7A 4L95C 1Z4KA 1FFSA 2HD4A 4JGBA 2A86A 1KK3A 2GBPA 3IFSA 2CYAA 4LYGA 1Z2PX 1QHHA 3G49A 4CLEA 1EK5A 1UZUA 5AM4A 4KAXA 3LE8A 5FIUA 1K2WA 3WL5A 1EFPB 3EZYA 2XQFA 4KN8A 4ZODA 3S81A 2OHOA 2P75A 2PAFA 1AR5A 2WHYA 3H87A 1OU4A 5EXEA 4QDZA 4EA8A 1YIJF 4KP7A 2G7ZA 4TUYB 4NDZA 2VI5A 4EHAA 4Q02A 1G8JA 1JP7A 1DBFA 4IO1A 1BSMA 5HTOA 3ZQKA 4TXNA 3IRUA 3A0HZ 2IE0A 3O47A 3M1IA 5DXFA 2N3ZA 3C5HA 2WU0A 1WDMA 5IH3A 2QKSA 2D5IA 2QZPA 4RVNA 2WQZA 3Q72A 2WTNA 3T3NA 3A7EA 1CN7A 2E0IA 4IKPA 3SX2A 1YBMA 3L9XA 4BQEA 4W82A 4X3LA 3MQFA 3KR2A 1YF3A 2QLMA 3NHLA 1OPRA 3P9RA 4KH1A 3UT6A 1EM8B 5KCMA 4NCJA 5F77A 5IYCO 3PC8A 4G0NA 1C9KA 3VX4A 1VP3A 4PE5B 1L7RA 4R1PA 2PYJA 3GJSA 3ABMB 5CVJA 3RVKA 2ZXEA 2J9RA 4QPNA 1JQKA 4PZDA 2HJDA 4BUZA 3DTYA 4URXR 1CR6A 3E3AA 4FFVA 5BN4B 3AINA 1ATZA 1LTKA 1SHZA 4DF3A 2QIPA 4AN4A 1SO8A 2CTQA 2QNRA 1K9MW 2K1SA 1QB7A 4TZ0A 3G59A 4LBWA 3NM6B 3PUHA 1H65A 1GTOA 1OC2A 3EIWA 4PTZA 3W5HA 4DTIA 1GV1A 3G2HA 1UAAA 5EC8A 3GAZA 1C2YA 1MO5A 2AUMA 4HN9A 4DQDA 1EUZA 3FPAA 1MG1A 5C51B 3L7NA 4NESA 1JUDA 2AYZA 1EVYA 1TYCA 3NCTA 5CT9A 1I6KA 4P7FA 4BY9D 2WJIA 2WU1A 3HYRA 2OCHA 1A3CA 1ZUD1 3SFTA 2OPBA 4AZ3B 4RY2A 3FLEA 4H9GA 3V7UA 4DR1O 1VQ1A 4LXGA 3CKMA 1H47A 2P6YA 1LZKA 4B3JA 4P53A 4AZ0B 4CM8A 4TQDA 1R0KA 1CRZA 3GJ8A 1YS4A 1QAOA 4F93B 5FQOA 3TDNA 3IVCA 1UBTS 1C9NA 1IM5A 1QLHA 3FTCA 4LXUA 5DIZA 3VVMA 2YJ5A 4BNUA 2QAIA 2MMCA 3N5KA 4O2BA 1G19A 5HF8A 3WLMA 3RC2A 3CVYA 2QQGA 2TECE 1ID1A 4D79A 1FFDA 2XWQA 1XZBA 2FMHA 1CNFA 1UC4B 2L2QA 4B74A 5BXYA 2O8CB 4BP9A 1DQRA 1VA4A 4MV5A 2WP0A 1VJ5A 2BR4A 4JVNA 3BWEA 4WFQA 4H0CA 3ASOC 3F90A 3DPSA 5AM2A 2FR0A 4CQLA 4X7RA 3OLVA 1H9AA 2BFCB 4A5SA 4C5AA 4UM9D 4UPVA 2I4OA 1GN8A 1GUAA 4PFQA 1Q0UA 1HE8B 1EK2A 2ZAOA 4WOJA 4M7OA 4TV8F 1RD4A 1JXMA 1SZJG 3ASZA 1ZVJA 5IDJA 1SQFA 2YIJA 4ZI7F 1L7NA 2IU6A 5EHIA 2OZLB 4HG2A 2Z43A 3UK7A 2MMGA 2NU7A 4YCLA 2IXDA 1DJOA 3LT0A 1KEUA 2VT2A 2WDPA 2QMUA 3GP8A 1FVHA 5CNMA 5ALNA 4KFRA 3ABLB 1W0CA 1PG5A 2DY0A 2R4TA 4FLWA 2G5PA 1NG9A 3K1TA 1A4XA 2XOKG 2GILA 1X8LA 1SKYE 3F5WC 5KQRA 2EFCB 4EH1A 2BLLA 1NPYA 3QEMB 1R10A 4X1KB 2V55B 2BM1A 1NW7A 1YDWA 2X4GA 1EFRA 1RYYA 3IEUA 5TQ0A 1PR0A 3ZI4A 1DAFA 4BLWA 1XCBA 1WXEA 1EGVB 1BQ0A 4M3NA 1H2ZA 3F4KA 3HDVA 3K2QA 1QFSA 2EVWX 1D5CA 2PWZA 1KAHA 2RHDA 1UKZA 2ZIGA 3RABA 4B34A 2FMUA 4Y6PA 5FI3A 1ODKA 1DKOA 4PV1B 3MINA 3TD5A 1SB8A 4BJ5A 3RUHA 1CS0A 1P0CA 1SK9A 2DFNA 4DB4A 3TLCA 1E5XA 4GT1A 3I0ZA 2OGSA 5CVVA 3RU7A 1II9A 3A32A 5EBLC 4US0R 1NVWQ 1NZFA 3RQSA 1VHDA 3NVKI 1IXRC 3AVQA 4KZPA 4Y30A 3P1JA 2ZRHA 1F8XA 3AJ8A 2VDLB 2OILA 3AVPA 1GYQA 4R7CA 3DHYA 3QW2A 1MFPA 4X1IA 3LUAA 3W7SA 5DYTA 3MCVA 1YRQA 4B4KA 1JYEA 3LSYA 2GEDA 4GKVA 4OP3A 4OAPA 3U3JA 1OZAA 1R0YA 4BTLA 4JUCA 3E0XA 4JZGA 3PPYA 1DAOA 4ZYVA 4N47A 2G82A 3FRJA 3NBXX 3I6IA 1KU0A 1HURA 3QITA 4C4TA 5I7RA 2HJ9A 1ZWZA 4ISCA 3VC1A 1XVTA 1T9GR 2OSBA 1A1SA 3TO5A 3GRAA 4UUMA 4HWKA 2AOTB 3LYAA 4M99A 3RG8A 1XMQO 1ZVMA 2XRYA 3QEOA 1QF9A 3FTQA 5DYWA 1XRSB 3LI2A 1V7PC 4R50A 1NX9A 3HPLC 5AM1A 1Z36A 1PEYA 4IYIA 4OI2A 1M2GA 2HRBA 2CDRA 1CNMA 4PC3A 3T1OA 4C4XA 5EAIA 4H6VA 2XMGA 5ILQA 3KSZO 1KJWA 3RJ5A 4IDNA 2XW6A 4AJJA 2A1TS 4XIFA 4J8PA 3O3CA 3MUOA 1PJ2A 2GT1A 4BWGA 1QOPB 3TZQA 3EEFA 1WBJB 2L69A 3LUCA 2ZQZA 1YB6A 1TVCA 1JHMA 2W6ID 1H9CA 4Q4CA 5G2OA 3U0BA 3WYAA 3QG5A 4PV7A 3FA2A 1GL6A 2CMGA 4CGYA 4W5WA 5AXAA 1AMNA 1P1KA 1P3DA 5JVDB 3RGBA 4BLSA 1ZOLA 1HQYE 4PYJA 4COOA 4K88A 4E70A 4D96A 2PIDA 3A26A 5EUQB 4F6EA 1XMOB 2XEXA 1AI4A 3DH0A 1DXOA 4K9DA 3AQ4A 3D6NB 4WAUA 2BP7B 2C8KA 4EF4A 4E5MA 1HQDA 4O4JA 4XLLA 1EN4A 2HWKA 3E83A 2O1XA 3CRRA 3DE2X 3JD1A 3E7DA 4Y2TA 3T12A 3AP3A 3OMNB 3ABQB 1IJBA 2YHBA 2H48A 1GTL1 1T9DA 4XJSA 3TDMA 1Z6QA 1GCOA 1OZFA 1E6CA 4IWNA 1VQ7V 2RQ6A 3WLOA 4QOIA 5CCEA 4FPPA 5ECGC 2OV8A 4LIPD 3I9LA 1E1RD 2EFYA 3CUYA 3ILHA 4OHBA 1ZRNA 2AW5A 2BVNA 4JR2A 1LLDA 2LTAA 1A32A 4FYWA 1S2DA 3GJ0A 2JVIA 2AV6A 3CLKA 2FWIA 3O4HA 5T8KA 1DE0A 2PX6A 3RT9A 1XTBA 3ZOKA 4UEJA 2NO0A 3P96A 4FLTA 1U8XX 3BWDD 1SNYA 4P2GA 2WNIA 4J2OA 4B08A 2FETA 1KI3A 2HSDA 2C77A 2IJHA 4WSOA 1XRPA 2XDWA 1OBFO 1QNLA 5IT9A 5JJ5A 3AHDA 2CNLA 3MWFA 5DCYA 1RI2A 4R8LA 3A6PC 4GQAA 2QUZA 4DZRA 3FMOB 3ISVA 3HKEB 1DCMA 4MXDA 2CK3A 1BROA 4OM8A 4C6SA 2XE8A 4OTZA 2VDJA 1R4NA 4ZGBA 4KSYA 1XTTA 4U63A 3C7KA 3GV0A 3WLAA 5HS4A 5AW4A 4C0HA 4RHUA 1LLCA 1BKYA 1TL7C 3K6JA 1YQGA 1PL0A 1VL0A 4P86A 3V4PB 1U0FA 5C1IA 1FXKB 4XJXA 1JTVA 2OLKA 3BTOA 1ULTA 5E7MA 4JUAA 4HDAA 4E2YA 2BJVA 2D1FA 3JSLA 3KB6A 4ID3A 2A57A 3CNHA 3ZBQA 4HPWA 1H4SA 1AS3A 3PHLA 3IUJA 1Z0DA 2RGUA 2ZBGA 3HLYA 1BEEA 3V7FA 1KECA 1H94A 5KAMA 4DLLA 3UMSA 3AIIA 4KWHA 3PWZA 4KWCA 5G0SA 1MP0A 3LT2A 4RQFA 4OMFG 4A5OA 5KBYA 4CKCB 3HBLA 1M2HA 3V2UA 3AR5A 4MINA 1MJGA 2WBLC 3ND5A 2W2VA 4J1QA 4MGKR 3KTDA 1Q8IA 1RC8A 3EZ9A 4TTVA 1PJAA 3IMGA 1LKZA 4Q9NA 1G2OA 1XU4A 1IZZA 2WHXA 3SR2C 6PFKA 3H1LH 5J4VA 4YRLA 3UYLA 3LHFA 4CDRA 4E4EA 4IUYA 1I0ZA 3HR4A 2QN7A 1MV5A 3PDIA 2Y27A 3FI0A 4QXPA 3USZA 3FUCA 5AVZA 4JQCA 1LDBA 4BJHB 4MR7A 2LUOA 4IYHA 1QLJA 3HUUA 4RA6A 4E5VA 1M93A 1U90A 3UK2A 1M2VB 2GK7A 1YS6A 3REFA 5CXQA 3MTDA 1JDZA 4HSEA 1N3YA 5JCZA 1W36C 2J7PD 1TUBB 4YT2A 4LJKA 4G27B 3L7AA 2P4UA 3P3PA 3AWDA 3TMAA 3MUEA 3QUAA 1OJHA 4NJEB 4DJFC 2ADFA 4AJEA 2WMNB 5AUPB 4PBRA 1T2CA 3BHNA 3RIYA 3K9GA 4N7BA 1L4KA 1NR1A 1Y5IA 1UPAA 2QK4A 4HDSB 4OQMA 4RZSA 3I9NA 4JX8A 3CX4A 3QELA 4TV9F 5IAOA 1VK3A 2WSBA 3W5DA 2QSZA 3KETA 3QJ5A 3JTEA 1GITA 5DF1A 4Q3NA 1U0GA 2Q0XA 4PLHA 4QX6A 1M33A 1YRWA 4HXFB 3FPLA 2HJFC 4KYUA 5DHPA 2EG5A 2Y4NA 3GT3A 1XMSA 3TG8A 3JVUA 5BVGA 4BVKA 1C3LA 5FWXB 5KQGA 3NH9A 1K9VF 5HCUA 3TZKA 2B7BA 4WLFA 6CHYA 2BR3A 2VP0A 3L46A 1GQQA 2VT7A 1Y0BA 3SQMA 1DRJA 4Z7QB 1QSGA 1FDWA 3QVGA 1GNLA 1CUUA 4O1MA 3I32A 2R1ZA 4BT3A 3CUSA 3E1YA 2CXQA 2SKDA 3TOZA 2AF3C 4KC0A 2QTZA 1T5SA 1UR5A 2PEZA 2ODTX 5HVNA 3FD9A 3N87A 1MZEA 3THOA 1VQ7F 2W2QA 2WYWA 4DIDA 2CMHA 3LLSA 5FTMA 4E09A 1FD9A 3HP1A 4ZDJA 1BOOA 4LOIA 3QX7A 2X6BA 3RVMA 3AM1A 3ESJA 4ROTA 1QZTA 4HY3A 3CH6A 3HY3A 2G3YA 2A0FA 2QRGA 4J76A 4R05A 1YF2A 4RO2A 4LZWA 3KKPA 2J9XB 2PY5A 4E12A 2DB3A 1FVOA 3W04A 4LVCA 4YRZA 1B74A 3OF2A 3B1JA 3TZ6A 1XQYA 2YWJA 3GBSA 1BFDA 3S8EA 5BSKA 4WMLA 4W5OA 3G9ZA 4LF5O 4DG9A 3V4VB 4DVJA 3MJVA 2GPWA 4GRDA 4N9QA 1JS1X 4MMXB 2FWRA 1AMUA 3I3FA 3JQAD 1RPZA 3HFSA 4AURA 1SIWA 3HUTA 3NHWA 8AT1A 1IBLO 1T35A 2LVBA 4CCYA 4BMSA 2OCKA 1O0CA 3B3FA 1NT2B 5FR2A 2ISSD 4ILKA 4DCVA 2GF2A 5ELLA 2JH9A 5H68A 5CBFA 3WGNA 1VHJA 1K6EA 2IQ5A 4GFDA 3G7UA 4B73A 1WXXA 4GMGA 2DFKB 2VZ9A 1KY3A 1AUPA 2NZ8A 4D99A 5L51A 5CJPA 3D3NA 1RWNA 1TLTA 5KTTA 3UJDA 2NT4A 1PR1A 1DEXA 3LSQA 1IG0A 1EBFA 3B6KA 1ZQ9A 3KO8A 2RJOA 4IINA 3SAJA 4QUEA 5U4XA 3VTFA 4ZZ1A 3RYHB 2WFLB 3VQTA 5CFRA 3Q8HA 3ZV3A 3ZGVA 4RH3A 4L8GA 1JAXA 1KVUA 5JPCA 1GKKA 2QTCA 4NYJQ 3W3ZB 5BR7A 2H7CA 4QGAA 2ZIOA 1Q1BA 2QHXA 3ZE2B 4P93A 1I0IA 1WVGA 1HMPA 3C1AA 3A6ZA 4JIGA 1VQPV 2QWQB 4J0CA 1XAJA 2J09A 5B1EA 1A04A 3GT7A 1P44A 3BSWA 5BNFA 2XKKA 1CDZA 2IXGA 2JK1A 4I5IA 5KYWA 1AP6A 4JF3A 4TRNA 4X65B 5GWXA 1JIVA 4CI9A 4BEWA 3Q8KA 2W6CX 1T4MA 5JSYA 2O3SA 5CFPA 4N8SA 4S1PA 2WTMA 2IXTA 3CRNA 4MUEA 3EY9A 2E76B 1ZD1A 4JGGA 1YKSA 1ZJYA 1F06A 5C3UA 1XL4A 1AILA 2ET6A 3FCXA 1LRKA 3LWOC 1CUXA 3JQ8B 5TF4A 1U43A 1G6Q1 1E96A 1KYYA 3NLLA 2V4DA 1VGRA 1DAHA 5A4MS 1PZMA 1LPBB 3HRIA 4BZQA 4EARA 2X4IA 3OMWA 2Q6OA 3S55A 1QP8A 3TZHA 1J7KA 4HEQA 4UUPA 1Z4PX 4CEJA 3VISA 1XILA 3OY7A 1U0JA 4RXUA 3SSMA 5EXTA 2LRHA 4UB6Z 1QVRA 3USES 1UOOA 1QTIA 2VDVE 2ZUWA 5ERXA 2A5LA 2B8JA 4KW7A 3I76A 4BVHA 2WU8A 2I33A 5GZ6A 3NOOA 4RENA 2MSLA 1XL6A 1N2GA 3DOIA 3EXEB 1KOLA 1AHIA 3EDYA 3FJYA 3R9XA 4QBFA 1RXWA 2CFIA 2C59A 4GI5A 5JAZA 2C4HA 4KL8S 4MX8A 4QASA 1RHKA 4D7TA 3VR0A 3CE9A 2ZE6A 4C8EA 3WXMB 1CQZA 3DF7A 3DZCA 4B3RO 2INGX 2I9KA 4YUXA 4YWJA 5DECA 1A5TA 3ZXSA 2OHIA 4YRKA 3TZLA 1QGYA 1A9SA 3WSTA 1Y37A 2WUFA 3G2KA 1W4LA 1MW9X 1XAHA 4I0WB 5GINC 4IDDA 4BN5A 3JTMA 5GANK 4AIRA 2K6GA 3R0ZA 2H59A 1FNKA 1QCCA 3EVTA 3PV0A 1E32A 4BEVA 1O5OA 1UFYA 5CEEA 3IKTA 3DYIA 4JLNA 4UARA 1KAMA 4MUHA 1NTZH 5KNBA 3SYPA 3LXUX 3OAAA 1SCDA 2R8PA 5BXZA 3M81A 1UJMA 1NKSA 1WP8A 2Z8XA 3GEGA 4NKRA 1FLVA 2R0QC 1AK1A 4JKIA 5I9LA 5AOBA 2HWUA 4YIPA 4HEJA 3CF4A 4HZUA 2PX8A 2HB6A 3G71V 3ZXXA 2GZSA 4L76A 2VKQA 3NHFA 4F3RA 3SJCA 2YMMA 1PU2A 1Q20A 2NUPB 3DNMA 3U60B 2F43A 3P5BA 3FVRA 3FGNA 1KEEB 3ADCA 3D6VA 3GCWA 3PJFA 3OUFA 3CX6A 1U0SY 4YMHA 3B3AA 2A67A 1P73A 5J4LA 2HMVA 1ZIYA 4FYVA 4Y2XA 1PDVA 3BMXA 3SYRA 5F73A 1V5WA 4G26A 1ODIA 4ER5A 3M4JA 1B41A 2NTEA 4MEBA 4GLLA 3LVQE 1R50A 3H1TA 4BJ1A 2JD2A 5B8FA 4JBNA 2ZDIA 3CFYA 1F9AA 3V1YA 5AR1A 3JVVA 2DFVA 1VQPF 3SSOA 1ZRHA 2O2XA 5GONA 3QVMA 4MRAA 1ILEA 1A71A 2AG1A 4GE0A 3I3OA 4A1OA 2PUBA 2IHUA 3TLBA 2HIAA 1KFJB 1VPDA 3N6XA 3MWDA 4YJKA 1W2WB 1F14A 3I01M 5HGJA 2I22A 4IHJB 5FLXA 4MW8A 4HYEA 2BELA 3U7GA 1ISSA 1EJ6A 1UIRA 3WA6A 1WD5A 1DIHA 2DLCX 2R5NA 4A0RA 1DAMA 2ONJA 1TT5A 2XUFA 4Z4CA 2FN8A 4LYAA 2WZQA 1XYVA 5CDGA 4HZGA 4DJJA 2GPBA 2GBGA 4PZZA 3PBKA 2QXTA 3WP1B 1L4NA 4ND6A 1AS0A 4MW3A 2AD1A 1KYWA 2FN4A 1ZVKA 3KHSA 1FP1D 4JI4B 1EFVA 2R9VA 4OBWA 1TA4A 3I7TA 4RMIA 4BOYA 1TOAA 4YNBA 1VHAA 1Q1EA 4XYBA 3PVCA 2FE1A 2FW1A 4FDTA 4BNVA 5FBKA 3WO1A 3NYRA 3TD3A 5FLKA 3ADPA 5IFKA 4ESHA 2XITA 1KMIZ 3ELYA 1RP7A 2H2HA 3R20A 4RZXA 1Q1NA 4L9SA 3WGYA 4PWTA 5IBQA 3GBPA 1U5BA 2XWJI 2F4VO 4NMWA 1HKUA 1SIUA 3IMKA 4RTJA 3S8YA 3WHPA 1M57C 3P0HA 4EG0A 2WJPA 4JJKA 3ZDRA 2JZCA 1FU8A 3OM1A 2J0UB 1L5YA 1VL6A 3S3XA 1GLVA 1Y1KE 5JG7A 1TQ6A 2C8VA 1DX6A 5KQMA 1B15A 2HL6A 3DR3A 3TLGA 1QR9A 2NXCA 3Q3JB 3W2HA 2QRNA 2PZ8A 4BN4A 2YNMA 4ZP1A 4HQLA 2D1YA 1GA1A 3PTZA 4ND7A 3N9IA 1QU2A 2ZVPX 5FOTA 3SR3A 2OTJV 3N2LA 3MUNA 2VK8A 1BMFA 3WBBA 5JZMA 4MP6A 3WK9A 5B1YA 2PT9A 4BQOA 3H2ZA 2AC2A 1J22A 2MSEB 2WJJA 5K8VA 1NW6A 3CWQA 4C4SA 5I9MA 1U4SA 1CCWA 1I2AA 2PRJA 4TPKA 5FDFA 2WWYA 4EW6A 2NPFA 4Y6OA 4ZK2A 2EKLA 2XHEA 5LQRA 2JVKA 1NBMD 2FZGA 2QY9A 2OE2A 3HYCA 1KYOF 1CRWG 2CLFB 3MIIA 4RY9A 4A15A 1OXUA 1NDUA 4QT0A 4CF3A 3N53A 4RQBA 4ZREA 1VE1A 2I2WA 3AK3A 3C15C 1NC1A 5H59A 2YXHA 4O8ZA 5HZGA 3HPRA 5FLEX 3H04A 3ML1A 4QGPA 3KS9A 1A2BA 1Q1QA 4DA8A 1QTNA 3N58A 3KKNA 5GIPC 1R8QA 3LLUA 3G71F 1KI6A 4DR7O 3VXKA 5LLDA 3DVAB 1MT3A 4TTRA 2AI3A 4MDEA 4JLBA 2EF1A 4ARAA 4F86A 3GNSA 4WLNA 2VA8A 5PNTA 2A0XA 1FLNA 5I7EA 3PZBA 1QYDA 4GPEA 1BT8A 1XROA 4HWTA 3EIUA 5IKPA 2XT9A 3STXA 1RKUA 1GTG1 3KVNA 2EHDA 3CZPA 1G42A 5I8WA 4EFBA 2HQRA 1E3WB 2Z6QA 1SCAA 1UMCB 1HL7A 1MJNA 2Q1UA 1Z29A 1JIIA 1GLGA 1EKXA 1KEWA 4YXFA 1ST2A 2KTUA 1MA3A 5ADUS 3WR5A 1YS2X 1AGRA 4G07A 4WY2A 4D9NA 2PYLA 2ZJ8A 2ORWA 1YZKA 4H7DA 4FOLA 1NMYA 4F71A 2C5BA 3FGOA 1OTXA 3K15A 4NBKA 4L72A 4BCCA 2HQOA 1Y1PA 3DV0A 1H66A 3C3MA 1FRNA 3L05A 3LDGA 4IV8A 3GUVA 2HPZA 1N33O 4NDAA 5F7XA 4YA6A 1C7ZA 3HA2A 4Z4GA 3GLGE 3FYSA 1I33A 2IIVA 4B09A 3GRYA 1F8GA 1E1CB 3CCVV 1OOEA 1XQ9A 1M34A 4BLOA 2I8CA 3AV3A 4NEQA 3NTLA 1T3HA 4MO2A 4BVGA 2NQ2C 5K0SA 1CXZB 2CXOA 2R97A 4NYJR 3D4LA 3EORA 1ZK2A 2Q0AA 2WW8A 4HRVA 4Q4DA 5KNDH 2ZS9A 3KYCB 1ENYA 2DT4A 2H4HA 2FI1A 1TEHA 3AF5A 4TRMA 5I3ZA 1WPXA 5L3GA 3S68A 5H80A 3L6BA 1GX1A 3DXFA 3ZE1B 4AQYB 4BZPA 3ZHCA 5HKBA 4WCFC 2HXSA 3OZCA 3D6UA 3PI7A 5CA0F 5EESA 2JGDB 2MDTA 1L4FA 3SBEA 2DBZA 4I0XB 3H16A 3OUSA 3FJOA 3AOEC 3QXJA 4U7HA 3SXPA 1BW9B 4LYFA 3RU3A 3IJPA 3R5XA 1HFKA 5C8YF 4K6OA 3BMOA 5CDFE 3ESYA 4U7DA 3KR9A 5JNLA 2PCJA 3RYIB 1TW3A 1D2HA 2GBFA 3T7AA 5C2JB 1IY9A 3W2FA 1NM5C 1WS6A 5EWJB 1WETA 4RJLA 1OCRC 2P91A 3ND7A 3R44A 1XVIA 4AUEA 3GB7C 3OHPA 4URZR 3WJ7A 2I7TA 2W2TA 4M1QA 4EBBA 5EFZA 5B1IA 3B77A 2HX1A 4ZVTA 2IF0A 1K8XB 2F23A 4PS0A 1B3RA 3D8CA 3EFFK 2V9YA 4MTGA 2I6QA 2OTJF 5EN4A 4EKYA 1OQAA 1IDSA 2PMCA 2HBYA 1KJYA 1UMKA 3TPFA 3EXFB 4B40A 2ZIVB 4BIOA 4JJIA 4HTFA 3E18A 3O1IC 4HD8A 3R3ZA 2XWBF 1VCIA 1XA4A 1TLLA 1W93A 2A6PA 3LBHA 1U9IC 1QLNA 1ZCAA 1JR3D 1F2UB 2ZT6A 3KWMA 3OT7A 4Z4EA 5C52B 3D9QX 3FN4A 3PLAE 2JFYA 2XZOA 4J9YB 4X71A 1JQ0A 2VOEA 2A8YA 2O7SA 2HRYA 4UHCA 1QLEC 1Q7YW 4MEJA 5EFOA 1ZL8A 4MKGA 4FD3A 2FWPA 4NMHA 4CL0A 1PT9A 2GEKA 1SXHA 2RGNA 4MRRA 4IRMA 5LP6C 3OCJA 1ZH2A 4UTPA 1A98A 3U9TA 1ZUWA 2X8BA 4YP9A 3E61A 1Q0TA 4AJ4A 1A9XA 3TCNA 2CFRA 3PYMA 3P10A 2AGVA 1NI5A 1SKYB 4LS3A 3FFAA 2O2GA 3KZMA 4QVGA 2OR3A 5EJ4A 2Q8VA 4YXWA 4V2UA 3NHMA 2B3TA 4TOIA 1M3SA 3RAGA 4B79A 2H2GA 2IW3A 3GLQA 3DBOB 4UJ5A 2EKPA 2NUAB 5I9NA 3U80A 5LQAA 1N6LA 2BDTA 4ZTZB 1QBGA 5J9PC 3ED1A 5DN6D 4H7IA 4BNXA 2R47A 3B1WA 5IAEA 4DKJA 3KOYA 2O0HA 5EIBD 4XDZA 2CHQA 2DTEA 3QTBA 1ZGGA 3U13A 3OEHG 2NU6B 3MLBA 4AVYA 3Q9UA 2EQAA 2CXUA 3GLUA 1AQUA 1H0HA 5AW0A 5IAAA 2YASA 2G28A 4FSHA 1EDDA 4M89A 1NRIA 2UZHA 2EZPA 2R1TA 1MHTA 2OIGA 1JF8A 2UKDA 2VVTA 4EGQA 2HNBA 4KQJA 3NORA 2O1WA 1QAQA 2YMPA 5TJ9A 2P2DA 3EGWA 5FA6A 2R65A 5JNVA 1HETA 4IMJB 2JS5A 4OSPA 1V5IA 4KCGA 4J4TA 1WKCA 4XH9B 1Z82A 5C4IA 2JVDA 4MUYA 1NH2B 5B1NA 1R0ZA 3O1JC 3CCVF 2GXQA 4REMA 2I4NA 4GMHA 1JU9A 5TX7A 3K3WA 1GG8A 2BAGA 5LXTA 1QOQB 4XD7D 4BLQA 4C7VA 1UBFA 4FCVA 4UUQA 3N3BC 1T0UA 3GIDA 1GZ5A 1VH8A 3HZRA 3I4LA 4TMKA 3Q9NA 3PCTA 2QTOA 4QNMA 4ZPJA 1O8BA 1ST3A 2WHPA 3CZRA 2X23A 3KAKA 4J03A 1S77D 1PTJC 1U94A 4NB5A 1CR0A 1NXWA 5K8LA 3LY5A 1UXGA 4QULA 4MVUA 3N05A 3ZS9A 2KLBA 3I45A 4NECA 5F9HA 3H2IA 1Z4IA 2EW8A 3U9LA 4QU9A 4WOCA 4QREA 2RHJA 3TW8A 3GFTA 3A1UA 4XKJA 3LYHA 3K70D 3PGA1 1ZAUA 1R4ZA 3WYFA 2SHKA 3SFZA 2JFOA 1SRRA 2IEAA 2GOYA 1JAYA 4O02B 4PTLA 3C4QA 1S4QA 4ZAYA 2YCLA 1SCNE 4BR6A 3DV2A 4UBOA 4D9BA 3BHIA 3GLHA 1QGDA 2VT6A 1ZW1A 4LRSB 4N5MA 1XEXB 1CQWA 5FPSA 3B8MA 3E20B 1T9HA 4DXAA 2Z0AA 4WFBV 2APJA 3X1ZA 1PQPA 1HRDA 4G8JA 5JCJD 1LDNA 3SHVA 4FWTA 2WOOA 1TVKB 5LWHA 4BT5A 1W40A 1PSWA 4YHBA 2C2OA 1M6EX 3SWWA 1ZGAA 3NTXA 3VYUB 3RT7A 2VNIA 1KJIA 3DBLB 1XZCA 5D3KA 2ZR2A 1T4BA 3V7YA 2O48X 5IJ0B 4XM2A 2XUQA 3CZQA 4DSZA 1NG1A 3A6EA 1IBMO 1U2RA 4TT3G 2NO1A 3HKCA 2EQ5A 1K7EB 4G4SP 1PK7A 1D8AA 1CZOA 2WAYA 1N3LA 5T4BA 2ITCC 4IGKA 1GPNA 1NJ8A 4PGFA 4O4IA 2DH6A 3A06A 3BYQA 2ONZA 1OCZC 3F4BA 1BN6A 4OB8A 5SYNA 3CS5A 3QE4A 2BH2A 1EP2B 5BWLA 1JLKA 1EX1A 1TYZA 1RHJA 5EVJA 3KPJA 2M6YA 1Z26A 5K0NA 5BVHA 4AW9A 1W19A 2WG1A 1DUVG 2Z2ZA 2I1WA 4ASUG 3B82A 4G5YA 3W7VA 4X3PA 5FWAA 4QOJA 1ID8A 4PO3X 3IBGA 3UM9A 3QQPA 3H2SA 5ECDA 2A9RA 1II0A 2Z4SA 2J5BA 1PDWA 4MUKA 2Q7XA 2OZEA 1W0KD 1UF9A 3C5VA 1T36A 4AHCA 4HWSA 2WM9B 3MMXA 4FFWA 5CDHA 3TTXA 5BNZA 5B5SA 1RP3B 5DNUA 1JD1A 1NF9A 4JBIA 3OM8A 1T0KB 1P80A 2R7AA 3WWZA 1K8ZB 3COPA 4RE5A 4CV1A 2VYFA 5MGBA 4GSLA 5AYVA 1E2BA 1M54A 4BATA 3AG1C 2JI4A 2X7HA 1VP9A