4TUYB

Tubulin-rhizoxin complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
424
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 171
structure length 424
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tuyB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tuyB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tuyB01
5EYPA 3E22A 3JAWA 2BTQA 5C8YB 1FFXB 4DXDA 5EIBC 2XKBA 5CA0A 2VAPA 4O2AB 5LYJB 5M7EA 5LXTB 3M89A 4TV8A 4X1IB 5JCOA 3RB8A 5JQGA 1OFUA 3JARB 5KMGB 4X1KB 3VOAA 1TVKB 4U39A 5MN4A 3WGLA 3JASB 4ZHQA 3ZBPA 4O4JB 5CB4B 1W5BA 4EI7A 5J2UA 1JFFB 4ZI7B 4TV9B 4ZOLA 3JAWB 2BTQB 4DRXA 5JVDB 3RYIA 2Q1YA 4O4HB 5IJ0A 1SA0A 3VO8A 1Z5WA 3V3TA 5LP6A 4I4TB 4I50B 4TUYA 5IYZA 4HNAA 4IIJA 5J2TB 4O4IB 4EB6A 4ZHQB 1TUBB 3JATB 3C8LA 3UT5A 4M8IA 3RYFA 2BTOA 4E6EA 4ZOLB 4X20A 3N2GB 5LOVB 4DRXB 3RYHB 5IJ9A 3RYIB 4X1YA 5JH7A 3VO9A 1RQ7A 2VAMA 3RYCA 4I55A 4ZI7A 4LNUA 4O2BA 4XCQA 3WGJA 3N2KA 5MN6A 4U3JA 3HKEB 5CA1A 1FSZA 5EYPB 5LP6B 3E22B 4TUYB 5ITZA 2RHLA 3WGMA 5GONA 5EIBD 4IIJB 4YJ2A 5CA0B 3VOBA 3WGNA 3HKCA 5FNVA 4KWEA 4FFBA 3JAKA 4TV8B 3UT5B 3RYFB 5JQGB 3ZIDA 5LA6A 4X20B 2VAWA 4X1YB 5KX5A 3CB2A 5BMVA 4O2BB 3HKBA 2VXYA 4O2AA 5LYJA 5J2UB 4EI9A 4U3JB 5CA1B 4WBNA 3HKDA 4O4LA 4EI8A 4X1IA 5GONB 4B46A 5MN5A 4YJ2B 3JALA 1W581 5IJ0B 1W5AA 1SA0B 3JARA 5KMGA 4B45A 1W5EA 3R4VA 4FFBB 4F6RA 2XKAA 4YJ3A 4O4JA 2R6R1 1W59A 5IYZB 2RHHA 4HNAB 5KX5B 2GVIA 4TV9A 5BMVB 4EB6B 4IHJA 5JVDA 2R751 3HKBB 4O4HA 3ZBQA 5EZYA 2Q1XA 4WBNB 3HKDB 4O4LB 5LP6C 5IJ9B 5JH7B 5C8YA 3JALB 3RYCB 4I4TA 4I50A 4I55B 4LNUB 1FFXA 3WGKA 5J2TA 1RQ2A 2RHOA 4O4IA 3VPAA 3N2KB 4F6RB 5JCOC 5LXTA 4YJ3B 1TUBA 3JATA 2RHJA 5ITZB 3M8KA 3N2GA 5LOVA 3RYHA 4IHJB 4X1KA 3HKCB 1TVKA 5FNVB 1W5FA 3JAKB 5EZYB 1RLUA 3JASA 5LA6B 5CB4A 1Z5VA 1JFFA 3HKEA
chains in the Genus database with same CATH superfamily
3NOOA 2VJNA 3UF0A 1YZNA 3WRYA 4X1KB 1QP0A 5AJWA 2XZLA 2OA0A 1DIGA 1S6YA 4M49A 2VJPA 4RABA 4DN6A 4X7RA 3KEQA 3RVQA 2G80A 2EVWX 2IYAA 2A9KA 2AFHB 5CP8A 3CEPB 1GSHA 3RVKA 1YZTA 4LBVA 4JXXA 2DR2A 1AR4A 5GAPK 3RIGA 1CVLA 3AEUB 1IHPA 1JSXA 1JSZA 4IDQA 2ZAGA 4RSRA 2I6RA 2FU5C 3T9CA 4RAOA 1PR9A 4GP9A 2C2ZA 3TSWA 1CDOA 1TAHA 1QGYA 1IN6A 3U3RA 4Y2YA 1O58A 3GGDA 3D3QA 2KE5A 3ZLJA 3EGCA 4NCJA 2OWEA 1K75A 2QAJA 2KKWA 3A06A 2P5SA 3GJ0A 1U3UA 3NALA 1D5NA 4KIFA 3IVCA 2QRVA 4Z7QB 4WF9V 3UPDA 3QYPA 3WLKX 1QH8B 1RQXA 1K4DC 1X7YB 3UJ3X 1XTKA 3V1UA 3RGWS 1KFEB 3SYAA 2PX8A 5HMMA 3TG2A 3D7KA 4FEEA 1E89A 4ITUA 5KSPA 4TLMB 4IIGA 2GCPA 4ZO7A 1EM6A 3WGQA 3UWMA 1MOSA 2OORC 3VYWA 1V0JA 2CHEA 2JIPA 1X9IA 1CUYA 2EX4A 4ALNA 4GM1A 4BVTA 8ABPA 1GZ4A 5EIBD 2R62A 4ZQBA 3A3PA 3UXYA 5EWRA 4PIMA 1E6KA 3THYA 2ES4A 3CXUA 1UUFA 4R2KA 1CQIA 1EU1A 3AP3A 1KS9A 5K6AA 3HO1A 3RRNA 3EXHC 2ZU6A 2R7NA 1EE9A 2YC2C 4XQ0A 4AZ0B 3RJTA 2ZE5A 5C0OE 4Z2WA 3AJ9A 1K4YA 3UH1A 2K6GA 2I4RA 4ILKA 1EUDB 3QNMA 1P6XA 1O6FA 3PRYA 4B3TO 5JJNB 1VQ8V 4NK4A 3M4NA 2QWQB 1R5NA 2E21A 5H82A 1ZRSA 1E3IA 4RZIA 1E4OA 3EOZA 2C4VA 4PLHA 3CLVA 3N28A 3TKAA 2XIJA 2IBMA 4FWBA 4AC9A 3NONA 4OU4A 1IN7A 4RACA 2GM4A 5FHQA 1OX6A 1E2HA 3DFZA 3LYAA 1XZAA 4XARA 4TLEA 2LBTA 1K88A 3IVMA 4XD7D 4MICA 4JI6O 1VPVA 4WPGA 1LFAA 3JPYA 2VDRB 4I6EA 1SCBA 3LUKA 4J91A 1N2JA 1PT8A 3LWPC 2DYSB 1YXBA 4ECEA 3QPUA 4L8WB 2JGUA 2V7EA 4BPBA 3KP1A 3H0CA 4E5PA 5IVPA 2VTEA 4HXYA 2IVZA 3AM4A 5C8YA 2HK7A 4P81A 3X2QB 1BFUA 2O0LA 1NBME 2C77A 3V8BA 3OMAB 3Q8MA 2B5OA 4QE3A 1F5SA 1DS6A 2Y9MB 2C4KA 4YDRA 1XU4A 3ABRB 4U2KA 2BGJA 4AN0A 3PPWA 2N48A 1QONA 3LFOA 5F5XA 1QZ3A 3WJ7A 1YV9A 1G8MA 4OHWA 3TGLA 1FDIA 3GEDA 5KVAA 4LQCA 3V2HA 2P3OA 5KQGA 3KJEA 1T5HX 2IW1A 5JSZA 2WMNB 4KQXA 2EULA 2YY7A 2X76A 5CA3A 3GEPA 2H51A 3U4QB 4OKIA 2V1UA 5KAFZ 3HTXA 4JLJA 2GN9A 1QS0B 3UMSA 4I7ZB 1AR1B 3UAZA 2LO1A 3EDOA 2QI9F 3BM5A 3FETA 5ICMA 4HSGA 2C5EA 1WDWB 1QH0A 2A57A 3FPKA 2D3TA 5IDYA 4IMIB 1AT1A 3HBNA 3OZEA 3C16C 4R7TA 3RUCA 1K3FA 5CVTA 1DX6A 1AXGA 3F3MA 5BSEA 1RC0A 1UXOA 5B1AB 3TI7A 3HV2A 1W48A 5KSWB 4C14A 5DCWA 3SSNA 1KXZA 1ZN7A 3T99A 4TZ6A 1SG6A 1ZVKA 2ZYRA 4DVGA 4JLDA 4BO8A 5JY6A 4DJFC 3WWOA 2CB0A 5J40A 5ALFA 3QV1A 1CJMA 4R01A 1OU4A 5DRTA 3Q5EA 1XCPA 3KR9A 1ESZA 2COKA 3QWHA 4JI2B 4QPNA 5HXAA 3NMUC 5L6MB 2WJWA 2IS4A 5DBHX 3B13B 4PFQA 5EUMA 4OHBA 3SC2B 4U2CA 1JNYA 2PX4A 1RYYA 4L15A 4PYOA 3A9TA 4ABMA 5KKAA 3D5QA 1W36B 3RROA 2LTAA 3Q3IA 2FRDC 3T95A 1O8BA 2W6ID 1U2EA 1RZ3A 3CGWA 3STHA 2JBHA 4H4CA 3S7ZA 3KQUA 4TV8A 3FUWA 1Z88A 4ZOEA 4BP3A 3I83A 1LU9A 4ND7A 3B1WA 2FEAA 2C0QA 1RXYA 3I73A 1SWVA 3I6IA 2GWRA 2J0UB 3JVHA 1KYZA 3BCRA 2CLHB 1FP1D 4EOGA 2AEMA 3MFQA 1XWFA 1J90A 2RHLA 5G4UC 5AW4A 2P4QA 2RMKB 3HWSA 4LY0A 2NUAB 4GX0A 3LY7A 5KCMA 1G55A 2XB6A 4U6NA 2RN9A 3RJ9A 2Q7XA 2G1PA 2QE6A 2ZRAA 4RSMA 3RHSA 4N0PA 1J2EA 3IMKA 3H75A 4D9KA 3KJZA 4QDUA 3N4ZA 1KDOA 3IESA 2IIVA 3P52A 2VP2A 5CYGA 5DYIA 4DY4A 2CH7A 2CXSA 3IQFA 1YBAA 1KECA 3IIKA 1SBCA 4JBYA 4MO2A 3KQVA 521PA 3PJEA 5DNWA 1OX5A 1QZTA 2I6DA 1JSLA 5JU6A 5LQNA 1U4SA 4P0TA 4JLBA 1PYDA 1UKVY 5ALOA 4ENPA 3GGOA 1R6VA 5AVKA 2C97A 2CHGA 4IIJF 3H2SA 1JKJA 1AB6A 1YBMA 2G08A 2OK7A 1AB5A 4R2MA 5AO9A 1SIOA 4YT8A 2LR0A 2H08A 4J8PA 1E5VA 2OSVA 3P0RA 4GR4A 3Q8KA 3OOSA 3RRMA 3ZLTA 4MCAA 3A28A 5ERXA 2R1UA 1T3SA 3OOWA 1M1KW 2CT8A 1TTQB 2FW1A 2EX3A 4N8EA 2OB1A 4IMJB 3BEDA 4MRRA 5LMNB 2OORA 1M57C 3DXRA 4DV7B 2BMFA 3B6KA 1ZWZA 2X0RA 1BA2A 3N8KA 4M9RA 3UXHA 2RHRA 3DBRA 3PNKA 1UQRA 1GPYA 4XZ3A 1SQSA 4BQNA 1WW8A 5BOVA 3CISA 2YWBA 3ZR4B 2GN0A 5BPHA 1XUQA 4EPYA 2OD7A 2WSSG 4UB8Z 3NHRA 4JU8A 5AVXA 1XTUA 3V4FA 1RQLA 4KJXA 3EIOA 1ORRA 2X9NA 1Q0TA 2GCEA 1DQRA 4G41A 4RO0A 3IFXA 1P2GA 3H42B 2AUTA 1AK2A 1X25A 3G0CA 2ZJ5A 2YJ5A 3ZVMA 1TJYA 4TWAA 5KOHA 2RK6A 4DLUA 2JGAA 3AZQA 5IDXA 3KPYA 3GLFB 2PJUA 5IZ4A 1WB6A 1KU9A 3U1BA 2ZSDA 3H11B 4C8GA 4TXNA 2FDXA 5JSQA 1SXJD 2ZRMA 1U2RA 2VWHA 3DYIA 4M1OA 4WNIA 4A0SA 3E9MA 3ZWXA 1CS0A 4WZBE 3JVDA 1RPZA 1ZOSA 5L45A 3FPIA 1AA9A 1TC1A 1G41A 4YMTA 2NU8B 3B09A 4NONA 2MSWA 3EMBA 4EZBA 1XMIA 3D6TB 3Q1LA 2WTXA 4UBNA 1KKUA 1JIQA 3IP3A 3V4OA 2EL7A 1YJAA 2BOCC 1J1UA 3DNMA 4ZGBA 1NH2D 1AQNA 3WX0A 1YUMA 1SUIA 2IS2A 1NPTO 1Z6YA 2FW9A 4TQDA 2NSJA 4ZO4A 2JC3A 1ZR4A 4AO8A 2ZIOA 2BISA 2Q5OA 5KYXA 5ES4B 4Y1EA 4AZ3B 4Q3AA 2PA3A 2FKXA 1VHQA 1UPXA 4DMFA 4Y1GA 4P7BA 1T10A 1F2TA 2YUAA 3IBYA 5C5CA 3HCWA 3PRJA 2QTSA 4BB5A 2PUDA 2IAFA 1OPRA 4ESHA 2Z9DA 4Y6RA 4EFKA 1YACA 3R66A 3H5RA 3H1KH 1W2GA 5LZ8A 4OJQA 4ESEA 5K6TA 1S01A 4U8GA 1ZUNB 2FNAA 4DK0A 3UGTA 4JUAA 1LW6E 4KXMA 2EEZA 1G4YB 3L70H 4EJFA 3VKWA 5LLDA 4YRQA 3CZ9A 3ETJA 3AK2A 1LF5A 5FLXN 5D87A 4A0QA 3QXGA 2CXQA 2NYVA 2GB4A 2Q50A 3GJYA 2R1VA 1DFGA 3LLMA 3O03A 4MQEA 3OWOA 3DVQX 5EE5B 4CM8A 5KNCH 2AZMA 3GUVA 1PJRA 5CJPA 1E69A 4YWHA 4R2WA 1TECE 1LRJA 3FG9A 1M67A 4KO4S 3S70A 2PE5A 4C07A 2VK8A 1MJHA 1EFLA 1NX9A 5KYYA 1OAKA 3QM1A 3L04A 4BIUA 2Z6VA 2ZQ5A 4FYJA 3PWKA 3H1EA 3O65A 2G76A 2JATA 3SFTA 2GVDC 1T6XA 1PQPA 5F77A 4EKIA 4JR2A 2YN2A 1WLEA 4LHSA 3ZWVA 4K26A 5EL0A 1Q1ZA 3SY8A 3KKZA 2AOUA 4KLAA 1ICIA 1OOEA 3RD5A 5IY5B 4WEOA 1T9HA 3QLJA 1M0WA 1V1JA 2I55A 3ZWMA 2Q8PA 2IOYA 2M6LA 2ODPA 3EK2A 1VIBA 2FRDA 4WNAB 4M2LA 3AQ4A 1UT6A 3DUWA 4BTEA 3JV7A 4GSKA 5H16A 1DCKA 1MNQA 5CLGA 1XQ6A 4X44A 4BNFA 3LZCA 2J6CA 3I3SR 1RU3A 2NXWA 4C0LA 2A0FA 2YN4A 4XWAA 3EN0A 5CH3A 4P36A 4U7GA 1FD9A 5ALYA 2QHXA 3KXIA 4COOA 3KZOA 2QTLA 2R47A 3L82B 3BD9A 3WGKA 4QYWA 3RC3A 2YUIA 3SMQA 3I5AA 4UD6A 4JH0A 2C03A 2QUAA 4RIFA 3H1JH 3H4TA 3DKIA 4M87A 4ZOBA 1A9SA 1XI1A 5B64A 1EE1A 4LC9A 1I14A 1WZNA 1T4CB 2Q3BA 2PH5A 3VTAA 4KKXB 4PXYA 4IHAA 3BFPA 2QM0A 2JFYA 4J7KA 5F78A 4GC9A 5IYZA 3CUTA 1E7SA 1JCHA 4EECA 3QBTA 5AVYA 2CEKA 1DX9A 1RACA 2IW5A 2GA9A 3DDUA 4Y2RA 1OVMA 4Z86A 1D5CA 3C4VA 4P9OA 1RBQA 2Q9CA 2XTMA 2V74B 1OASA 3VOBA 2VZEA 2B25A 4UUPA 3ZIDA 5AJVB 1KZ9A 3Q7PA 1EEXB 1U9CA 2AN9A 2VO1A 3TLEA 4LBEC 4ZT3A 1LI5A 1PO7A 2R1ZA 4EY7A 1IV1A 3PNQA 1DCMA 3BXHA 2IHBA 3LCCA 1RRPA 2CWJA 2EJVA 1IMOA 4FZ5A 4QJ4A 3R1IA 1N5LA 1OWMA 3ILYA 3FD8A 4QYIB 1JEQB 5JH7B 3CE9A 4DIBA 2NQ8A 5ALKA 1Y8QA 3K2EA 3VX4A 4C7KA 1K4KA 1HQYE 2OHWA 1BHAA 1BWPA 5LA6B 2GBIA 2V7QD 3ZGVA 2IK8A 2M6KA 4RBNA 3WP1B 1IY2A 4ZTZB 3H5OA 4FR2A 4A6DA 2OPBA 3G9QA 2BMAA 2CXPA 3BS4A 3VC1A 1OD6A 3E7FA 3CCSF 1JUDA 4URHA 3WRXC 2CNDA 4B1FA 1CUCA 2GLUA 1NULA 3PDWA 3CZQA 2ZJAA 4YR9A 3FCEA 1XHXA 4NVRA 4QM7A 1J7JA 3OQPA 2BE7A 2TSYB 4E08A 2EWMA 4F12A 1ABFA 1RWVA 4QREA 5FTMA 2XTJA 1N8RH 3UUWA 2QUZA 1H2KA 1YA8A 1B8NA 3FDIA 3OJEA 4CL8A 4AX4A 2CUTA 2ZJ3A 2MYPA 1JGTA 2P2YA 1ZS9A 4UB6Z 4GOXA 1BOFA 1SUCA 3N6RA 5TMPA 2DULA 3WA6A 4G4IA 1SCUA 1KVTA 2P5TB 3PFHA 2P2CA 2PSEA 5F4ZA 3OEED 5ULLA 2AC7A 4B7XA 1UPBA 1T2NA 4Z51A 3T7AA 4I08A 3QG5A 1EIWA 2FF7A 1UBJS 5E4TA 2QLJA 3ORFA 3MWKA 3VYUB 4P4SA 1T5LA 721PA 3J81k 2QRPA 2L0XA 1FUEA 1YRHA 3DW3X 5HCIA 1PD3A 2GNPA 1GZ5A 1VP3A 3WGTA 5SYMA 4RD6A 5BY2A 3T7CA 2VYCA 2I1VB 3HP4A 2KG4A 2JVDA 3OTWA 4CQMA 3M49A 3I1JA 1P3JA 1GTL1 1WP9A 4N3AA 2GNAA 5LL6P 2J09A 4W8HA 5GONF 5C4MA 3A70A 4A10A 4HVCA 4W5RA 1Y7LA 3H9QA 2EIJC 4BO1A 3LVFO 1YHYA 2Z6UA 3ETEA 2XGMA 2H0AA 2QGNA 2VK4A 2QJRA 2DRIA 2OO5C 3EC7A 5EZ5A 4BB6A 2XQFA 4JC5A 1JQ0A 1SOMA 3UM9A 3HVHA 4DJTA 2G06A 1CRZA 2F1JA 2YYZA 3UMMA 2HIHA 2JBAB 4D8WA 3PC7A 2EF0A 2IYYA 4NOJA 2O8DB 2NVOA 2BEUA 2CSLA 3I62A 2NN3C 1GK9A 3NPMA 4OP1A 1NVVQ 4B5CA 4C82A 2VOEA 3KZCA 3O4FA 3VC2A 2ERYA 2AHZA 1M7HA 3AF4A 1PZEA 1J70A 1EQUA 5K8IA 1Z5PA 5LGUA 4MPDA 3S68A 1WAZA 3L1JA 1EFRD 4HPXB 3ACDA 3NBAA 2WICA 3O5AA 1GL3A 5SYNA 3IKVA 2OWDA 1LK0A 3OZTA 1EDDA 1RCFA 4IXNA 1F2UB 5DM0A 3X3HA 4BL5A 5DSXA 4XUGB 1Z0DA 5F1OA 4KR6A 1YRAA 5DLYA 2Y9PB 4IFIA 3P9ZA 3L9XA 1V96A 3THWB 1AI4A 1EM8A 3HJUA 5GTIZ 4WZBA 1VB3A 3KCYA 5FWXA 4Y1RA 3DLHA 5A3QA 1SOVA 3ISTA 4JLVA 4B31A 3TRJA 4V24A 5AI0A 3JRXA 2AYZA 3RABA 5DCLA 3BQNB 5CA1A 3QPAA 4G81A 4AKSA 1KYXA 3OJCA 4MWDA 1U31A 3TTVA 4RHEA 3RU7A 3GB7C 2IXBA 1P6UA 1SHUX 3RRBA 1E2KA 4DA7A 4PPQA 5J43A 2J7PD 4N21A 4C0HA 2F9ZC 2F1RA 5LNK1 2IL1A 2RAFA 1Q22A 1DG1G 2LQTA 1MNAA 1OYVA 2XUPA 3OZFA 3WJ1A 5AM0A 3KCQA 2MINA 4R8RA 2GDZA 3E82A 1XNQB 2OYSA 5JNWA 4CF7A 1OKKD 3KJJA 5DK6A 4IOJA 4GZ6A 2QBYB 1W75A 3C3TA 4RE6A 4OAQA 2EGHA 1AJNA 2JASA 1PLKA 1IBSA 1TOAA 4JUBA 1SU7A 2QN3A 2F1HA 3D3NA 1TEVA 3WZLA 2TRSB 4CIDA 1DQSA 1U7WA 3E2EA 4Q3OA 2A9HA 3G71F 3ABMB 1WV1A 2CVOA 3KM0A 3QYJA 1U1GA 1U2ZA 1D2RA 5ERGB 3DUFA 4YYZA 4GKJO 3E8SA 4K9PA 1JDSA 1T9AA 1SEPA 1CUGA 2QTHA 1F7UA 5D5QA 3DBLB 1RVDA 1K8ZB 3L0SA 5GP1A 1IPHA 1N2HA 4ICIA 3STXA 2BE3A 4NMWA 4Z0TA 1MEJA 2X9LA 2O14A 4XFJA 3NU1A 3BA1A 2DSNA 2BMEA 1IVNA 3ZDCA 3L7BA 2VPQA 3QFSA 3BZUA 4D7SA 4RA6A 1QGAA 2O2DA 4IY1A 1U3GA 5IDQA 5K0SA 1UJ5A 1VBMA 5IZCC 3EVNA 3M83A 4DLVA 2JAWA 2Q4RA 2VTVA 1OR8A 1HY3A 4RV5A 2GD2A 1ZCFA 3IAM1 2VJMB 2ZTHA 3LF1A 4LNAA 2W71A 1BGWA 5A0VA 1YC5A 4XJSA 1B4DA 3ABKC 1UZLA 3NDPA 4JP3A 1BXKA 3ZNQA 4I19A 3T3DA 4E03A 5G0TA 3P2MA 3KOXA 3UMJA 3AGKA 4DMHA 3LS2A 5I8PA 1T4BA 1ARZA 2W2LA 4HDNB 3UANA 4UTRA 1G21B 3WK6A 5MN5A 4DB2A 1X7ZB 1NVUQ 5EJ8A 3KSZO 1XHOA 4XH9B 4OQYA 4NZZA 4MR7B 3QJ5A 4BEJA 4KQJA 4FW9A 3WRXA 3ELUA 1E8NA 5JEEA 4KW7A 4EHNA 3DLBA 5LZ2A 3SJZA 3ZPXA 3E3LA 2LDXA 1ATIA 2PGJA 5FO1A 3NHLA 1U90A 3PLAE 3BKWA 1E96A 1LZLA 4M89A 4MJ7A 4ZCQA 2PH3A 5EJAA 1N2ZA 1XMJA 4HDOB 5U4QA 2QQ0A 1E0KA 4W7HA 4EM6A 5HE9A 1M1NA 5SZIA 4OKNA 3OW2F 4GZLA 1A72A 1XEWX 3TCXB 2VGMA 4DY6A 2ZNIA 2UYQA 1ORTA 1DEHA 1OREA 1K6EA 3KE8A 4ALMA 1A1SA 4I9FA 1TCCA 1UFRA 1VJGA 3WIVA 4MWCA 4HYQA 4OP3A 2OZLB 2VK2A 2QTWB 1DGQA 4FP9A 5JAMA 2EZ4A 3E81A 3DP9A 3FYUB 4S1WA 4D79A 2W8BC 4YCCA 4RCVA 3AIIA 2B33A 1IWPB 2HF2A 1NN1A 2OFXA 4KVGA 2W48A 3ZBTA 3SSMA 1GV0A 3KKKA 3CHYA 2ILTA 1Z17A 3B1YA 3D3JA 2WF8A 2ZT9B 4KH1A 1TZ2A 1YHQV 1IZ9A 2BTUA 1Y9AA 3BULA 3SC3A 5FTKA 2PUFA 4BO2A 3RSHA 1JR3E 5EHIA 1JG4A 3DS8A 5J4YA 3Q6NA 4ZAWA 1OXSC 4YHHO 1Z25A 4QTUB 4BQPA 3B8NA 1VIYA 2AVNA 3VSCA 3LQYA 4EYOA 2POQX 3P19A 3O9ZA 3VU3A 4PLFA 4I5SA 1SMKA 2OO5A 5TE9A 3GPIA 4AN4A 3HWUA 4BRZA 3NATA 1XTSA 2QR3A 3RH0A 3ZWCA 4E46A 3FPFA 2C31A 5JY1A 3SZ3A 1FFCA 4ED9A 2L6LA 1JT2A 3ABZA 3KYDB 5LYJA 4MJLA 1VQ7F 3UJ7A 3MRXA 3PN1A 2BONA 4A5OA 1CQWA 2OG2A 3HJTA 1ESNA 4F38A 4WJLA 2PSDA 1L5VA 3E23A 3IO3A 2YVAA 1LY1A 4D80A 4LJ8A 2IITA 5LMZA 3BGIA 4N23A 2WZDA 3CUWA 5I7SA 3B2QA 5B2FA 4M9ZA 1RFLA 1M1XB 2UYOA 5FLXA 3F5QA 1F9AA 4PC2A 1TMGE 3Q3HA 2GM9A 3IKJA 1T1SA 3CC8A 5B66Z 2WMYA 3HA5A 3KZNA 4WHMA 2AKYA 3LM8A 5JZMA 5JS1A 1I0ZA 2IKQA 2G9VA 1A69A 2XTZA 1P7ZA 2CLEB 2J41A 3HJRA 5IT5A 4ZIBA 5JAQA 3ZV3A 4UMDA 2YS7A 3A4TA 3N74A 3RFFA 3K9FC 4B3SB 4MS4A 3UICA 1JKXA 2WOOA 1E5TA 2QTFA 4LRWA 3RAJA 2FR1A 3DMHA 2XUOA 2IOQA 1L5QA 3F98A 3HKDB 2I6SA 1V4BA 1JIJA 2FSPA 1BS3A 2VRCA 2A33A 2XMDA 2V8BA 3OE7D 1COWA 5B6JA 2ZREA 1M7GA 3SKVA 3W6UA 2BLNA 2OBXA 2J5BA 4D0NA 1H93A 1UM8A 2DH6A 2ZZMA 1E3DA 1PJ4A 3DTVD 3WV4A 3ENQA 3QUSA 2CHVA 3WNQA 3S02A 3OEHA 5I3CA 4XVQA 1BMFG 3H2HA 4PC6A 1QJCA 4IZ6A 4OGGA 1XOIA 4JJ7A 1JRLA 1KJQA 3B1VA 1YJNV 1I7FA 5ELXA 3SN6A 3PDIA 5KQLA 4R8KA 2W4MA 2ZP1A 1PKEA 2JD0A 5EYPB 3AEQA 3C6QA 2GPWA 1SBQA 1YZKA 1V1RA 2F8LA 5J59A 2PKXA 4UAUA 4KJZA 2UXXA 4O4LA 2W2KB 3EVGA 4G0XA 5LQDA 4MS1A 3DNFA 1SHJA 4ERHA 5BWMA 4DDHA 1PL8A 5IBQA 2G5GX 3K0EA 1UFKA 3O21A 2X9QA 3T4DA 3R0PA 5GINC 1ZNZA 4FZ0A 1K68A 1DV1A 4HAWA 3NHSA 4I8XA 4HEJA 3NBFA 4MSWC 4RQUA 3AVYA 1KYWA 5CR9A 3AWIA 1SUPA 2WFLA 1NVDA 1YQ9A 3BB1A 1WXWA 1I0LA 1TM4E 4Q7KA 1PHRA 2H5JA 4JXJA 2VIIA 1DO8A 3DE3X 3HB3B 4DXWA 2FSFA 1Z12A 1NQOA 2P40A 1KU6A 2W0MA 3K32A 4GM0A 4MHOA 3WLSA 1ZGBA 1SQBH 1ZX1A 3QA3E 4DEYA 1T43A 2Q4PA 3V1NA 3G6KA 3HUDA 3C5EA 2ZXWC 5IZCA 1LTHR 2WAMA 3U80A 4HFJA 1BA3A 5IKEA 3DZGA 1UMCB 4EAAA 6Q21A 3F9IA 3O4VA 2H1SA 3AVPA 1C9JA 3LUFA 1JB9A 1UP6A 2BP7B 3DD1A 4HEA1 3S27A 2DT8A 5IPFA 2HDOA 5GWXA 5DV9A 3C5HA 3TLYA 1KI6A 3IQWA 3KD2A 3VZCA 2G0NA 3BXFA 4IM7A 3DL2A 1JPXA 1JJVA 4G0WA 4DBLC 1RFGE 2I5PO 3P9PA 1DKRA 4J03A 3QVSA 4H7KA 1XQVA 3TAHA 3M84A 3LT5A 2W6IG 4RAIA 2FW7A 4HR7A 5JE8A 3GEHA 4EBFA 4XB6B 3VO8A 3UPTA 3ME5A 3C7DB 3LOUA 3DEFA 4W5JA 2LGJA 5K8TA 3L4BC 4Y6GB 5LKAA 1NXSA 5EMJA 4J1TC 3S0YA 1SQVH 3E83A 3O83A 2AF3C 3G6EF 1KAHA 1ZICA 1H2ZA 1F0NA 3JYQA 4LWPA 1X1QA 3BVPA 3A9SA 3VTZA 2I4NA 2JJ8A 3OJOA 4LF8O 2HP0A 3SBEA 1YQTA 4KXWA 4A2CA 1UDBA 2R9RB 4XKJA 2GD1O 1MBZA 1T2VA 2H6LA 3T3HA 2IHNA 4D3ZA 3B12A 2P30A 5LZ5A 2V7PA 4RYLA 4NWOB 4B7EA 3LNMB 2ZWMA 3ZW8A 1ORIA 2Q7EA 4N3GA 3N59A 2Y4NA 4EY6A 1GYQA 2DQ4A 5B3LA 3KT3A 2PAAA 1C3OA 1WB8A 2NVBA 3SZMA 1GU1A 3AYXB 2W8BA 2H31A 4UEKA 4B47A 1Z6XA 1XNJA 2YMLA 3CH7A 4N18A 3X1YA 6YASA 2I67A 4PYRA 4XWYA 4WOBA 3OM1A 3GYBA 2DH5A 5KDDA 2VQEO 4DYHA 1AUQA 2REQA 4JY7A 4LZJA 1WJGA 4MCJA 4Z0PA 4X3LA 2AD1A 2ODNA 4PQEA 2AUMA 1J42A 4ZHVA 2IYSA 2PXXA 4MINA 4C0XA 3IGFA 4NOMA 4R81A 3AHEA 3UJBA 5FNVF 5CBPA 2G9IA 3QLEA 2VDLB 4RF4A 2YIBA 3RFVA 5AW0A 3INGA 4DSOA 1JKMA 4YRAA 1QAOA 3RRJA 1I7PA 3GWOA 3ZD7A 2X6QA 4IHJB 3KQMA 2IH4A 4CS2A 3RVPA 4X3PA 5H8WA 4G9EA 2PSFA 4UTPA 2SKDA 4S0XA 2GSWA 2O8BB 4JU9A 3C3SA 1Z5ZA 1C3EA 4GKKB 1YH3A 4MVRA 1MCZA 4N41A 3OIDA 1PJQA 2YS8A 1HYBA 3IIMA 3OM8A 4PPFA 3AKEA 1LS6A 3LLUA 3S7TA 4K6MA 1AMNA 1L5WA 4GXQA 1E1CB 1ABBA 4NWIA 5FFFA 1YRWA 4I9GA 1CIPA 1DB3A 4BNUA 2HU8A 4QPZA 4KR2A 2ZLBA 3KOUA 2YBEA 1Y5NA 3N8DA 3DR5A 4QNNA 3AVXA 2WKQA 1IYZA 1XRRA 2C5SA 1Q0RA 5IF9A 3SYTA 4RHCA 2XCOA 2VXCA 2GT1A 5E6UB 1N9KA 2WD7B 4ZANA 3U3DA 5K0FA 3IDSA 1O54A 1ZHFA 3MCQA 3ZU6A 3LC1O 3KBBA 1EDBA 2DBZA 4M6WA 1XDUA 3SYKA 4V0KA 3JQ6A 2DPXA 4GPBA 4OHVA 4RD2A 3RHFA 1S5LZ 3VPSA 4RVDA 2Y0EA 3KAQA 3PLNA 4YAEA 1GN3A 1BAPA 4LFCO 4G07A 5ECWA 2CNOA 3S03A 1XTIA 3BBPA 3LPNA 2PMFA 1N33O 2HADA 4AICA 4CE6A 5JCOA 1JR3A 3B48A 1IHXA 1SFRA 1UM9A 1VL2A 5M5BA 3GROA 2XBUA 2AEEA 1P5FA 3FB5C 4YJKA 1N9GB 5G0WA 5K2OA 4QJ3A 5IWCA 4GVPA 4PA7A 3ELWA 5JPDA 2XYRA 2WU0A 2AR7A 4JMLA 2EINC 3RCBA 1JILA 1PK8A 4ZAXA 1X77A 3MD0A 3LOPA 4YMLA 2YV2A 5IUJC 2OGTA 4B76A 1F12A 3HKEB 1LRKA 2DT5A 2YXNA 1OXXK 1YD7A 2H4FA 2PGNA 2AMYA 5J5AA 5DYGA 2JFGA 2QTVB 2XRFA 4K8XA 4ENRA 1OHHD 3F74A 1SH7A 1TW3A 4R8VA 2QN2A 4AJEA 3I7TA 4HC4A 4RVSA 4PO9A 4UNIA 5HY0A 3TR0A 2V7WA 3TX2A 4FC7A 1WXEA 5TPZA 1PEYA 1XHZA 4FLFA 5ER6A 2OQIA 1OH7A 1EVLA 2WUWE 1VJRA 3IIIA 1NDQA 4KN5A 1S2NA 2PUVA 2PPVA 2Y6UA 4QUDA 4TSKA 4CM6A 1VQ6V 5CPFA 4KE8A 1OYYA 2EP8A 4MVUA 3AW8A 3ZH9B 3SR0A 4FMTA 3G7SA 3LBYA 4WXEA 2UDPA 5BNIA 5DSZA 3LY9A 3CCVF 4P92A 4F8JA 1XEWY 4DM4A 3QKUA 1B7GO 3SHTA 2W4QA 4IWXA 3IR6A 4FI3F 1TJNA 1B0ZA 5AI5A 4ANFA 4AJLA 4CM4B 5JW6A 3I56V 2YHBA 2QRNA 4DW8A 2ZT5A 3JAMN 1PCXA 4XGIA 3U4AA 4XJXA 1HOXA 2UUPA 1M5TA 2X0LA 2FFHA 3FB6C 1X1CA 1M90W 3BGDA 1YS1X 1M5UA 3P2OA 2CNBA 2X0FA 1I33A 3M34A 3CSXA 4AP9A 3QHPA 5AW6A 2R9IA 4AYTA 5JPIA 3ELYA 2IZ5A 3A9WA 3A36A 3NDJA 2HYIC 4YPOA 2L82A 3K5IA 4IYHA 4JN6B 4KIGA 1D04A 3CX7A 2HR1A 3X2EA 4BCDA 1BIFA 1XZ8A 1D2HA 1XOUA 1J09A 3VNUA 1S2LA 421PA 3N8GA 3EULA 1P3DA 4ADSG 4Z2AA 4QODA 3TNJA 2FZGA 1SPBS 5FBQB 3L8MA 4B85A 4OSEA 5AIAA 3PQCA 4PDRA 1XQ9A 2Q4BA 3B5EA 5IULC 1ECFA 1EMDA 3G02A 2B7BA 2PMKA 1LF0A 1XP8A 1XZQA 4URZR 4C7BA 3AFNA 1ACLA 1XU7A 2V0CA 3MA0A 3NJ8A 1CUHA 1SAYA 1UJBA 5FUVA 2BL4A 3HDVA 3WYNA 5JUWA 1W25A 1IURA 1T36A 4GQAA 4LHVA 4TZKA 1KTVA 1Y8CA 3IKMB 2ZUUA 3L4BA 4KVFA 3A3KA 4EKWA 3MMZA 3QNUA 1PNKA 1PJ8A 3OCYA 4J1TA 4C89A 3DEZA 1QJ4A 1M73E 8MHTA 2ZUVA 2ZAUA 4O2AB 3LUHA 4NTZA 4KWTA 5KSZA 3AJAA 3K5WA 2CTWA 4R40B 2E4VA 2O6LA 2O9JA 2AJCA 3CCLF 5SY4A 1R64A 3SDBA 1PFQA 4OH1A 5A4DA 1ZOPA 4DCGA 1GZVA 2APJA 3RM3A 4OYYA 1KXJA 2PZSA 3GELA 3WGMA 3KS9A 1B8UA 3BMXA 4RTRA 3BVOA 1ID8A 4NZYA 3RBVA 4JTDB 4E4EA 3IQDB 3KVNA 1H22A 1Z2DA 5FUMA 2Q5FA 3ITDA 4JAAA 1RI5A 3CZRA 4WN9A 4WCFB 3EXFB 2JVJA 2QTMA 2QZPA 3D6VA 3MELA 4P35A 3EIFA 2PD3A 5EZQA 1DADA 4LI3X 5LL6Y 5EESA 5FLYA 3M7MX 1H23A 2ZS7A 3P2YA 1CUJA 5LXTB 1JEDA 3IPAA 3OFNA 3T9EA 4K6FA 3PC2A 1XG5A 4TLDA 1VQOF 3L07A 1AKQA 4TXMA 2V7QG 2ATIA 4N7BA 5HWSA 2HKOA 1BOOA 2A35A 1A7AA 3ZVLA 1AQUA 4BNDA 3CNBA 4EA9A 3DE5X 1BMTA 3DE0X 1IJBA 2E4WA 3NWEA 3KHNA 1TM1E 1XVVA 3P9NA 2P0AA 2QE7D 2PZKA 4BMCA 3E4DA 3NM5A 4C1BA 2ODWA 3CYPB 4RPHA 2RH4A 1KI9A 4OK3A 4FD3A 2OHGA 3KB1A 4LWZA 1KHTA 3W0LB 2CFIA 4PG6A 2A5LA 1Y1SA 1YCIA 2ZIXA 2L42A 1Y8ZA 1MNGA 3O4IA 1LQTA 2ZYWX 2GPAA 5CK5A 1TLLA 1R0YA 1QE0A 5FPKA 5AYVA 4XI9A 1TAEA 3GRVA 4B82A 1H2SB 2EWVA 2JFBA 2P6YA 5AW2A 3C39A 3FZQA 2HWYA 3TETA 1L4KA 4XYBA 3K70D 1E1QD 2XB9A 3R0VA 4MUEA 3L1VA 1M1YB 3INTA 2RE8A 1QWOA 3N76A 5TDHA 4BDSA 1HT3A 2N0SA 3X2QC 1QIEA 5FOQA 2JW5A 3ECCA 1OTXA 3QEMA 4A0HA 3ZS9A 1WF3A 4Q1EA 3R41A 5BN1A 4FM9A 3KO8A 4ZN6A 4AUMA 2QW1A 1QG6A 4RC9A 2CCKA 1HURA 2DBRA 2EV9A 2JLXA 1Y5IA 3QYFA 3U9SA 4OATA 3OCCA 3SMVA 2ZRKA 1EWVA 1WZEA 1UFQA 2WWGA 2A0YA 2PRJA 5CNJA 1XD9A 4W4LA 1JU3A 1OGYA 3OTOB 1C4KA 2I3ZA 3O8DA 1Y1RA 1S0UA 3D0OA 2OBNA 2FETA 4IVNA 1JEOA 1RRGA 3GCWA 2HN9A 2CTPA 2I7TA 4ES6A 3E6AA 1UXKA 1T9BA 4HV4A 1NN3A 2O2ZA 1KA9H 2BC9A 3G5UA 2DHRA 4QDKA 3CC2V 1U9JA 3H9JA 4F2GA 2IU6A 4PLPA 4D5EA 3KHKA 3DHYA 4JI5O 1VECA 1ZEJA 2G9UA 4S1OA 5FBWB 2O48X 3Q40A 3S6JA 2VF5X 3EZFA 1BT8A 3IA7A 5JNRA 4NOLA 2FSUA 2UYHA 5B1AC 1PBNA 1ZG3A 2QRZA 1XZNA 5F7JA 1J0XO 1O9BA 1GM9A 4Q3EA 4KHPO 1EFRG 2BFBB 2OT5A 5INTA 3OTQA 3Q2OA 4RUKA 4BVGA 1Y4SA 4YCDA 1ETUA 1XWWA 1AKVA 1YZFA 2EJCA 1N7GA 1MVNA 1SHTX 3KPVA 3DONA 3KWJA 2OXRA 1M8GA 4DIOA 3JTEA 1QYVA 1TB4A 4FMPA 3OQVA 4QTXA 1Z28A 4RGQA 2QZ9A 4MRVA 1N6PA 4BW9A 1OIVA 4Y9RA 4WXHA 5F51A 5H2FZ 4BYGA 3CC7V 3K35A 3QBVA 2GARA 1PG0A 4UCTA 2IUSA 4U9UA 1XZGA 1GM5A 3KZKA 4K86A 1THGA 3ZDDA 3CPWF 4PAQA 2VYNA 4U7TB 4B5KA 4INJA 4PI2A 1CF9A 4TTQA 2HHLA 4QAJA 4Q9IA 2DYKA 1XWIA 3LD9A 2BFFB 4H6XA 1R6UA 1WHSB 4JEHA 4L50A 2DLCX 4X1KA 1S1CA 3HRHA 2ZJ1A 5JFGA 4QX6A 5B53A 3DF7A 3EXHA 4X5OA 5DTQA 4ZGWA 4X90A 3EZ9A 4X94A 4HDMB 1PZFA 3NIFB 1TVKB 5LOVF 4HJXA 4BMSA 2DY0A 1AJPA 1YS7A 1P80A 1XJ0A 3DAPA 3M3HA 1TZCA 2Q41A 1W40A 2AHOA 3AEUA 3IJ5A 3QH4A 3ICXA 2JBWA 4C3UA 4BNYA 4ND8B 3I8OA 2OCBA 3IAS6 2VSYA 3GEGA 2WSIA 1KYVA 3R6WA 1NAIA 5CIWA 3GLFE 1TEHA 5I47A 1ZJYA 2Q28A 2C96A 4L22A 3O84A 4IOMA 4NJMA 2VJOA 2VI5A 1NRJB 3B9PA 5AJTA 2G8NA 4HB4A 2B1IA 2J9ZB 3HVUA 3LHFA 1HE4A 2N42A 3G80A 4H44B 4V0RA 4HFRA 1QH8A 3KYCA 4WKBA 2YIDA 1X7YA 3LP5A 3WSWA 1M72A 3COZA 1KNJA 4PGHA 2CE2X 5DP2A 2G63A 1DRUA 3ICVA 2PGDA 1BS2A 4Y2JA 3MTQA 1YIOA 4GR5A 3MMXA 1N0VC 2HRZA 2E49A 4OHYA 4LOJA 2FJPA 1N5IA 4LHEA 5LCXA 4G5OA 1E8MA 1GV1A 2ZRQA 3X2FA 3UT6A 4TUYF 4GGOA 4OM7A 4J7XA 4RFVA 2O8CB 2O19A 4I1RA 3QPWA 1SD2A 1G5TA 3GBSA 1I3LA 3GAFA 2ID4A 2C5HA 3RQIA 5HGXA 4EYGA 1KI3A 4X1YB 2VWPA 2J67A 1WCYA 5FAXA 5I9TA 2W2TA 2H16A 3UB4A 1NT2A 2ZRFA 2ZKLA 1KZYC 2WIJA 4QJ5A 4RPIA 4OPHA 1EUDA 2FFQA 2DPLA 2WNHA 1OPXA 2IHJA 4UDNA 4OQMA 3IVGA 1Z36A 4OXKA 4I50A 4F9GA 4WFKA 4QUBA 4Q24A 1KO8A 4LWOA 1XL1A 4PA3A 3BE6A 3USES 3BRSA 4ASUA 1N32B 5AI4A 2GVNA 1P29A 5IVKA 3W77A 2ZCJA 2CJYA 3CCFA 3RSFA 3QFTA 3R8XA 4E09A 4HNSA 2WSBA 2B4TO 4YFYA 1VQ4F 1DKPA 3N2YA 3KSAC 1LGYA 5DHTA 5A5DA 3VDRA 3EVBA 1FRZA 3FGPA 4CLOA 5ICCA 1B8VA 1RQ7A 4H4DA 1IQRA 1G8JA 1ZRHA 3ZOKA 3WISA 3ZQKA 1RWOA 2Y93A 3EPLA 3P4EA 3C7KA 2A5YB 1KMMA 4MKIA 4RKFA 2I62A 1J5EB 2O4CA 2AMLA 2WC1A 3DE6X 3ANTA 2AE1A 2DPHA 4UFNA 2QZJA 4N0EA 4MNTA 1ORDA 4PNPA 2WJJA 4IQ4A 3GDOA 5KREA 2VSNA 3AIOA 1UP7A 2YJTD 3VI4B 5AK0A 3VR6A 3OESA 2G5TA 2P4HX 1W4LA 3NBZC 2MCFA 1GA4A 1Z0UA 1ML4A 2C2WA 4GI1A 1JU9A 3ER8A 2JEZA 2P0YA 3Q10A 2CHSA 3DAOA 1VK3A 2SKCA 2G6BA 2HA3A 2J3KA 1GTJ1 1C8VB 2VTKA 3GNTA 4WLEA 1H8HA 5J63A 1HNXB 1BVRA 4Q3NA 1SUWA 5EKDA 3LSTA 1EH5A 4MDHA 1FXUA 5C8VA 2P27A 5AVZA 4KTTE 4WGGA 2ZINA 3EUEA 2QM4A 1KEPA 3KJIA 2A67A 4O4JA 2PJDA 4OJTA 3GI1A 4I1UA 5FBVB 3NIBA 4CF3A 1YBFA 4WVFA 2RHGB 3OQMA 2QF7A 2D8AA 3L0PA 3FNBA 1KQPA 3S5UA 1S4MA 1COZA 3VI6A 4B3RB 1NHWA 1JXOA 4R1NA 3DPIA 1TGVA 4Z9AA 2FV8A 4BGEA 2RDMA 1SXPA 1MB9A 1SVIA 1LS1A 4US0R 1L5HB 5EVJA 2MWMA 1EFTA 2FC3A 1N25A 4M8NE 3ACCA 2KTVA 2ZBEA 3MOGA 4E2XA 3D1VA 4IIUA 1VE1A 2Z2ZA 2Q9UA 3PEWA 1VSBA 4TLAA 2HCRA 3IAHA 3OSUA 1MORA 3MLBA 4IYJA 3FJOA 1I7SB 5K0NA 1F38A 3R77A 2B69A 5IVHA 3DBVO 3L7OA 3SPGA 2E0IA 4OSPA 1PP9H 3IS3A 1Z8FA 3CMEF 4AKEA 3FHOA 1Q7EA 5GY7A 3B6ZA 5EGNA 4UUBA 3CZ5A 1Y8RB 5BW4A 5IY5C 1CY4A 4EUKA 3UKDA 3G67A 4LXGA 3S0WA 4FX5A 5TVGA 2MTBA 4B7KA 5GJVC 3BERA 1WUHS 4TQUS 4YP1A 4DA4A 4TKLA 2GNOA 4C87A 1L3IA 3K0FB 3M4YA 3SKYA 2RGGA 4HFMA 3TZKA 3SGLA 2F3QA 1KJWA 1XUOA 1CNEA 1NL3A 1M56B 2XWPA 1MUUA 5KHAA 4KRFA 3WHPA 4R9RA 3X43A 5DEOA 3O3MB 4GLOA 2B82A 3OE7G 3ASVA 4MW9A 3GGPA 3CNNA 5L4NA 1N36O 3CUSA 3CBQA 3CF4G 3ZP4A 2LJ2A 5HP4A 5CB4F 4Y0VA 5LU9A 1RBMA 4UEWA 4IYIA 1Z0FA 1B73A 1FF9A 4ZEOA 3TVYA 3JQRA 3K0AB 4TT3A 1YUBA 5EAZA 4M0DA 2DBQA 3SXUB 3WLAA 3QFFA 4PQGA 1H2YA 3ONWA 5AM2A 5JXIA 2H1VA 1PW5A 2HNKA 4HLUC 3IKEA 2CUKA 3VVBA 2ODAA 4FYYA 2NYRA 3H5TA 2WG0A 3R4VA 1SXIA 2GEJA 1O8CA 2JHFA 5J47A 1U0NA 2YIAA 4X8AA 1K73H 2GTIA 5CG1A 3ANMA 2YV5A 5AH0A 5FUBA 3PV0A 3U7IA 4ZI3A 1WKVA 3GBPA 1PBTA 4JLMA 4RENA 3W90A 5AKLA 3FPLA 2GJ4A 1IY8A 3B6IA 3FOEC 2FH5B 3GRKA 1W0JD 5FUWA 2EQBA 1KOJA 1LSOA 4MUJA 2B8JA 2J5XA 2Z1DA 1Z7EA 3R7WB 4YRRA 1ZK0A 4EF5A 2AGAA 1VSQA 3GY0A 5DGIA 2IS6A 4C7VA 3JQDA 3K72B 4AMBA 4GPD1 4ZIRB 3L8DA 1KHHA 2ZJZA 4LJAA 1SBYA 2PX5A 1AXEA 3OWXA 3V7YA 4L3WA 2L26A 2LNDA 3BBLA 3TUZC 2NVUB 2Y1KA 1RLOA 5F2KA 4F84A 1DKUA 1Z6TA 4ZRDA 2AR9A 2DSTA 1UXHA 4INOA 4LYJA 1EBUA 4GECA 4EUFA 4L76A 4TKZA 1UK7A 3OGIB 1TVCA 3AG2B 4C7OB 3QVOA 3E8FA 2XQIA 3KFVA 1VKOA 2ZRIA 2HS4A 2LV8A 3HGQA 1V1MA 4MW7A 2CW4A 5HOQA 2G72A 2RAVA 4U7WA 3HVIA 4RK5A 3GLQA 1SKVA 1B74A 3DZKA 2ZIMA 2WAOA 5IXJA 1B06A 3DZCA 5B1DA 5AXDA 4CM3A 4RK0A 1NR5A 3V33A 4C5CA 4W1RA 4HX2A 2XWJI 4F11A 5ALXA 3AUKA 2RGRA 2HHHB 2JCYA 3AHGA 3DSRA 3GLFA 1V7ZA 2IPLA 2M6RA 1CLIA 1AGRA 1CQXA 1V7QA 3S5JA 3H11A 4DAEA 3E2IA 5DYWA 4FGWA 2IV2X 3VYUC 4XQGA 1Y9EA 2AN5A 2Q5LA 4Q4HB 2BGMA 2QMZA 1PYOA 5EMKA 1PDVA 3U3KA 1CUWA 2VRBA 3OLZA 5DW0A 3HEAA 4YIHA 5B58C 3Q9LA 2FG6C 3RUDA 3WJRA 1KZ4A 3FDJA 4BX2A 1YTFD 4OXYA 4TV9F 1Z29A 1RCUA 1XHFA 3A4VA 3OUFA 5TRTA 1T2DA 3E3NA 3HV0A 2FX5A 4LCKA 1YE8A 2ABWA 1EVJA 5EI5A 1D09A 4OQXA 4M0EA 2X23A 1PZHA 3GVIA 5J5VA 2B8EA 1K8QA 2HS0A 4KSBA 3RF7A 3NNSA 3ICCA 2QSAA 2JI6A 1PIWA 2VP4A 3R9XB 3O2NA 1XKTA 2I7XA 2Q27A 4JJ4A 3OJLA 3V7FA 3HDQA 1BFDA 3P4XA 3HXOA 4JSRA 3AMVA 2IYUA 4QEDA 3AETB 2WILA 1LA2A 1L7NA 4M9CA 3JQAB 1E9FA 2XBLA 5HP8A 2D2XA 3LHKA 4MUMA 1H66A 2QL6A 3AUFA 5ALPA 3MTAA 3FIUA 2VJLA 1ZAUA 2RBKA 5K3DA 2KBFA 1SZTA 4HHEA 3S99A 4JBHA 4C76A 3LI2A 4DSZA 1BC5A 3A6EA 4M0FA 5DTMA 4E22A 4JYPA 5D3MB 2WY2D 3R6TA 2VYFA 5CVCA 4ID3A 1IC6A 3S2EA 3JAWB 1M6NA 3C5CA 1B76A 1Y5MA 3NEJA 4LTNA 5GM1A 2BO1A 3STZC 2ZRPA 1CT9A 1N2SA 4HJRA 2PWZA 3UMVA 3CCRV 2E5FA 3L2OB 3GXBA 3UUFA 4F2PA 2NTVA 2CD7A 2IGTA 1L0BA 2Y05A 3SS7X 1N34B 2JDID 4JAVC 3VX3A 4BNLA 4B6PA 1ODJA 5DXAA 3QO5A 1LPOA 4AU1A 4K8OA 2P5YA 3RBAA 4FMCB 4RV4A 1OBCA 4G1UC 1FS0G 2B2NA 2JCBA 3T5BA 3K1JA 1SVWA 5DU2A 2JB9A 3R0ZA 2GMWA 1X87A 2GCOA 2OFFA 5IEBA 4LX8A 3QKSB 3GYGA 1A9PA 4UOQA 3QLTA 3R09A 2M6SA 1R4MB 2HRRA 2TYSB 3P94A 2BFCB 1W52X 1PKXA 3FE2A 5AJHA 1Z68A 2PR2A 4G5YA 1YEWA 4QECA 2RKBA 3HMKA 4DPMA 2YYSA 3H5LA 3ZXYA 4WNAA 4RJKA 1RXUA 5F23A 1VPDA 5DT9A 1GZUA 3ZQ4A 1E61A 3K2BA 1SBZA 4Y3UA 2FWJA 3LPMA 3F7MA 1OJLA 2H57A 3ADKA 5C3MA 2FFRA 3PVCA 1E2JA 1NW9B 1SZQA 2B8WA 1V8FA 3AV0B 2RNBA 1C50A 1F0KA 1XDCA 2GD0A 4IH4A 2MYNA 3ZCRA 2XMRA 4KOEC 3ABMC 2WKSA 4HPWA 3H87A 5KMGA 3RODA 4FNOA 4BDTA 2PF4E 2WJIA 1SXGA 1GZDA 2ZQZA 2OZBA 5IAOA 4NX2A 1OHHG 4UE6A 1MN6A 5J2TA 3WKDA 4F6RB 2QUHA 3L8GA 4NQZA 3SSAA 2C0CA 4CI0B 2WM3A 1EBFA 4XIJA 3BHJA 1AMOA 2HMYB 4L16A 4AJ4A 4HLUA 4MVSA 4R3UC 4BWVA 4NXNB 4G4SP 3DCIA 4U7FA 2XITA 4NU6A 4WKGA 1IL0A 2FN9A 4KP7A 3GLRA 2FSGA 1YMQA 2Q5QA 4FLYA 4UVGA 2YQ5A 3T1TA 4L0QA 1CEZA 2PFSA 1N2XA 2IIPA 5CT9A 4LGCA 1Y4UA 1KRWA 5IYDO 3OHMA 1C1HA 1EWQA 4JP5A 2HCJB 3GWGA 4KVZA 1SJ9A 4G4SO 1A77A 1WABA 2ORED 4UCSA 4N0MA 1U0JA 4L51A 5A9SB 3ONVA 4OL9A 3KZXA 5AQEA 4CM7A 4P32A 1BCRB 2B9EA 2XGGA 2WKPA 1K6XA 3ZE2B 5F9HA 3FB1A 5I4KA 1J1ZA 1AQIA 5IC6A 4BBPA 1PGQA 3G1WA 2XY4A 4LN1A 1X15A 4UZSA 2JL1A 1GNPA 1K06A 3LXMA 5LHHA 2B7LA 3QY0A 4YASA 1R2QA 1FA9A 2TS1A 2YUTA 4L9WA 4DIUA 4O4HB 3LFTA 4IDEA 1V5GA 3STLC 4PC3A 3ZKWB 1J0BA 2V1XA 1MX1A 3VPGA 2GKOA 1I32A 2KJQA 4DR7O 1LI4A 1WMFA 1J33A 5CXSA 4KQ2A 5FA5A 4I1SA 1QGED 2JGFA 3W7AA 4PI0A 3CH5A 2J5KA 4MPJA 3I9LA 3L1KA 3N53A 4BV3A 2A4MA 3V7UA 4BMZA 3I8SA 1DEKA 1NN0A 1V7PC 2L69A 4FYWA 1D6NA 3KL2A 1VKHA 3IP1A 3W3AH 5JROA 3EGIA 1T1GA 1Z06A 1VI6A 2DTEA 2JLBA 1JEAA 3GPBA 2EHDA 3I9V6 2RGBA 2OBLA 5TVKA 2BEKA 4G37A 4UBOA 4ECAA 3EEBA 4JL6A 1V47A 3DR3A 1DAPA 1S7CA 5M29A 1Y80A 1QFJA 1UMBA 3FYUC 2J46A 4GVXA 1RRCA 4DSAA 5GINE 4BV2A 2PZFA 3F6EX 4F86A 1LI7A 4WI1A 3I6ZA 4RTPA 3CSSA 2ZDGA 1WETA 2VNHA 1W93A 3RC1A 1PFVA 1MR3F 4JASB 4YIOA 3K3WA 1TAGA 2RIRA 4HNVA 3C15C 1F4VA 2YXBA 5FPPA 4GXRA 1P60A 3FVRA 3A0BZ 2W6JA 4Z9XA 2Q3FA 2W9XA 5DTJA 3NYWA 3E18A 1JYFA 3SDZA 3SHVA 3JQGB 2V3VA 1GA1A 3ND6A 3Q9SA 3ED5A 5JWHA 4DR5B 3DO6A 1F8GA 2OGSA 4HF7A 3M7IA 5D7BA 4AMYA 1MO3A 4BJHB 2A92A 3NBXX 4N0DA 2WSMA 2SICE 4MYDA 1KJ8A 2J08A 2O1WA 4MW0A 4B40A 2JBAA 4FFPA 4NG5A 5G3ZA 2H4JA 3IHLA 4ZGGA 1N8SA 3EXG2 2VQ6A 1RXSA 2ZE6A 4FMDB 4DBLE 3HUEA 2C7GA 2PWPA 2XUZA 3SC6A 5LDDC 1YDXA 3QNWA 1KIAA 4YCMA 1LTQA 3MWLA 3WIBA 1JQAA 2P6JA 2GDJA 3ORQA 5BN5A 1T5EA 3FWNA 1RAAA 2B2XA 2ZYGA 2FZCA 4YAUA 2ZSIA 3TLKA 4H15A 2AMTA 2QTZA 4JZKA 4G9BA 4MV5A 3DGFC 5CURA 4LPSA 1P75A 2GZ3A 3ZEIA 1F2UA 5CITA 3OMIB 3L1HA 3CRVA 5KNDH 3PTLA 4QJBA 1ADFA 3MJVA 2QE7G 3FSGA 4V0NA 2IELA 5LQCA 1ZMOA 2C61A 3FNQA 1X74A 1IBLB 3THWA 4C1NA 4J11A 1C3LA 1PR2A 2FZVA 3ROMA 4WACA 2P11A 2ORIA 2PX2A 2VEDA 2CLSA 2D1YA 3G85A 3N2GA 2HJSA 4BT2A 4JAVA 4A3SA 2CK3A 5H3CA 3R9WA 4I99A 5CX1B 1HFJA 5JYBA 3EG5A 3QVLA 4UFOA 4HGQA 2F62A 3IXQA 1PJZA 3AFMA 1HDOA 4JI3B 3E7DA 4GYWA 1PZXA 3DV0B 5C7OO 2BM1A 3AEXA 4W7SA 1O9HA 2PGIA 1E1QG 1YJ5A 2F9MA 1FCJA 2IZ1A 3W7TA 3DZHA 4V02A 1QCZA 1PK7A 1RZVA 3H1FA 3SYNA 2NVWA 2C3UA 1U2DC 2A78A 2IE0A 4LYEA 4YRJA 4W9NC 3F5WC 4LE1A 4WXPA 4BNKA 1ISHA 1LKZA 3QVTA 1DP4A 1AKMA 4QIWF 3F6MA 3PD7A 1FYWA 1Z5NA 2XWBF 1RRMA 4RVCA 4IMRA 3LSUA 2JLYA 2QBYA 1ZRMA 4HGZA 3F90A 4KWHA 1PT7A 1QYXA 1FX0B 3H17A 1Z45A 4NBRA 1LDYA 4GLXA 3P9CA 1Z5VA 4BLUA 4D4MA 4D9BA 1B16A 4G25A 1UJWB 2CUNA 2AXEA 2F90A 2HLDA 1DTWB 1ULSA 3QUBA 1YI0A 4J2TA 4AX8A 2BLLA 3ZCUA 1TM2A 4DQUA 4LVCA 1VCIA 5A7HA 3RIYA 3K8YA 3EVEA 2W8ZA 4BT3A 3EWAA 1K5PA 4AG5A 1WNFA 2IS1A 1NVMB 2NLJC 5HKOA 3TGPA 2L35A 3W5UA 3DKKA 3WLQA 5BVGA 3DBLA 1EE2A 1S72V 3QUTA 4C29A 3RUHA 1JB1A 5CFPA 1S2OA 1PL4A 2UYGA 3EIUA 4QUJA 4PPGA 1NC3A 3ND7A 5CD9A 3VH3A 1GQRA 4JB8A 5TSDA 3IX7A 4XIIA 2O7VA 2XUDA 4EH1A 4NPCA 4CR7A 5IHXA 2F43B 2GLZA 2O3TA 3ZZUA 1NYRA 1JPNA 1KEEA 4XPIA 5CEEA 4DC9A 2XUGA 2CTQA 2QYTA 2WTNA 2QJOA 3BJRA 4OGLA 1CG6A 3ENZA 2E76B 1KH3A 5DNYB 1H2WA 3I6QA 2VTBB 3PDJA 1Z5WA 4PNEA 1M2NA 1Q7RA 1GPNA 3A10A 1SQQH 3FPGA 2Y68A 4HDNA 1GN6A 1ZONA 3U26A 1JPVA 2HQSC 1GT91 2PBRA 1N5DA 1X7ZA 3FKSA 4RJJA 4QYMA 2A9QA 3MINA 3VYSB 4Q3BA 3VV3A 5JWOA 1YB2A 1OC4A 3PHHA 1Q44A 1KU0A 3E53A 4LE2A 3J81M 3EDYA 5HFAA 3VMFA 4WXYB 3SOZA 3WRWA 1CQJB 4IGEA 3S8YA 1F8XA 3UK0A 3RIMA 5ADWA 1A9XA 3RARA 3BHIA 2GTSA 2WZBA 1JT9A 1IEQA 3WSTA 1R3JC 4GLLA 3VPBA 3ZN2A 3DM9B 1TKBA 2GEVA 3CBGA 3I6BA 2YXLA 3L9WA 1W4CA 4OQLA 2QN9A 1HFKA 1G5QA 3D6FA 3KQKA 4GICA 2O3RA 2A5JA 3DFUA 4KDEA 4LSZA 1YITV 1I9CA 5KLVH 3CVXA 3TR5A 4DMUB 1X38A 3PITA 2B0CA 1QK5A 5HJ2A 4Q21A 1D7OA 5F2VO 3KNZA 3SZRA 3ZIAA 4HWRA 5EIFA 2XVZA 3O26A 1Y1QA 3K0DA 1PR4A 5TPWB 3FYUA 5F12A 4BEVA 1N0HA 1DZ3A 1RYDA 3SQOA 2DVMA 2R48A 3DSQA 5ED4A 1YR9A 2PHNA 3SR2C 2QX8A 4OA8A 1KZ7B 1IJKA 3VBCA 1WXQA 4MS3B 2ZW9A 1KO5A 2B92A 4Y2GA 2MJLA 4XYMA 2XDQB 1Y74B 1KJZA 4DV6B 1AV6A 5AUPB 4NBUA 4H16A 3N7UA 3EASA 1GILA 1ZEMA 4L27A 1ISJA 5FH9A 1EESA 1LUAA 2XUAA 1BCSB 5JQGF 1UBSB 1NVEA 3AF0A 2R11A 1N0WA 3OE4A 2HJFC 3KYDA 4NNJA 3HVRA 3LDEA 2D13A 4BO4A 3RSOA 2Z3VA 2NV2B 2IC5A 1IQPA 2FN4A 1N8RW 3AWDA 1ZY2A 1E7RA 2R6HA 4U3JB 4HDSB 1KWKA 2H8CA 1K08A 2QUJA 3HDJA 1QG2A 4NQRA 1HLDA 1PE0A 3V8RA 1MZPA 2YDEA 3AVWA 1RYNA 4Q6BA 2AFHE 3O4GA 1XTTA 4UM8B 1QYIA 3WHKA 1YOVA 4NU5A 3F0DA 3BAZA 2YXZA 2GPTA 1L4YA 3RYHA 3KXLA 2VQSA 2B21A 2BMVA 2ZVDA 2CHFA 4GOND 4RU1A 1FMTA 2JARA 5M7EA 1AKUA 5BT8A 4XLLA 4FYIA 3PT5A 4L8VA 4PHCA 3CLRC 1LUWA 2O8EB 1YF2A 4C4AA 1SA0A 1NMYA 1AKEA 2I2BA 3I3OA 4CH4A 4R3NA 4IMPA 1Q7BA 5D00A 4GKAA 4JYZA 3PZBA 4O2BF 5JDIC 2ZRHA 4F0JA 5CCBA 3TQFA 3U49A 2R44A 5J4HA 1RM3A 1HC7A 1XMSA 5IJWA 2XB4A 1KRHA 4GG1A 2CJWB 1JJAA 2OV4A 1UK6A 2CFRA 1TGOA 3HKDA 3EH1A 3AZPA 1ELOA 2WB2A 4R9SA 4KR7A 4HAOA 4AULA 1TTTA 3GOHA 2OCYC 3PD0A 2HEGA 4BMVA 1FTSA 4LPKA 2JIRA 2ISQA 3LSSA 2J9FB 3M4XA 5ITWA 3VVLA 4BY9E 4BKOA 3SHQA 3SF8A 3QY9A 3CO5A 4W9NA 3ZTYA 3NWPA 5ICSA 1E79A 1UPAA 5E1AC 1DLBA 3PI7A 1MOFA 1XRSB 4LQLA 3QKIA 4CT5A 1CK2A 3OUSA 2NR5A 5KYGA 1HYGA 2IA5A 4OAOA 4MJ3A 4DARA 3I52A 5I4BA 4JI8B 1L8LA 2QD3A 4E30A 3LLSA 5C80A 1RP7A 3PHIA 1Q74A 4CTMA 2W2KA 1U8YA 5LP6F 2J33A 3T1OA 4J6EA 3ZYCA 5JADA 2HHJA 1D9ZA 2XOEA 3IMEA 1FNNA 3UG6A 5MFZA 1NONA 1A9RA 1QGUA 1ZMBA 1KE2A 5HDBB 2MSKA 3ZS8C 1R6DA 3IQXA 3HCRA 1XMPA 3ZHZA 1Q6UA 1YXMA 2JI7A 5K1ZA 3CX8A 7GPBA 4WK4B 3MSCA 3ZX4A 5AXCA 1NF2A 5K99A 3EVAA 4IQFA 1N5OX 2VQDA 1T8UA 2X8LA 3NT4A 2OY0A 4C22A 2XNDA 3D64A 1KTIA 4HH1A 5J2UA 2XD4A 2RQ6A 5ERYA 2MSLA 1RBZA 2XUFA 2ZDHA 2BEVB 1ONBA 4PSKA 5I7HA 3RI3A 4YRZA 3U44B 3RE1A 1ZR2A 2JZCA 2VWKA 1UMCA 4C6TB 2D7JA 2XLCA 2BP7A 5J3JA 5ENVA 3L7LA 5CGQB 2F2TA 5IT9M 3GJ8A 8ADHA 1J9GA 2H00A 1WEKA 2X7XA 4HZIA 3GJ7A 5JS6A 3Q7RA 4N65A 4PLYA 3BDVA 1GAJA 1OT5A 1KYIA 1JEYB 1JAYA 4ZARA 3URMA 3HPLC 4O8ZA 3HEMA 2CF6A 2H63A 1Q0QA 3WYFA 2O7QA 4GGPA 2PPLA 4I4TA 5BSHA 1TCVA 5L3QA 4DPKA 4LHWA 3ZNNA 4BTVA 4DLKA 3AF3A 2VH1A 4IGAA 4ZAGA 4BNZA 2XE4A 1CE8B 1QCEA 4FYHA 2I6FA 3MQ2A 3UJNA 4ZTBA 1GN4A 2I1QA 2AZ4A 2VT6A 3D0QA 4AWXA 4FM0A 5AKJA 1D2EA 3MOIA 5K3AA 3KQWA 4AJOA 4ARIA 5JS2A 2CZCA 2GJ8A 3FUUA 5DM60 3OQBA 3TRHA 1XDSA 1G66A 3PEVA 2BUCA 1B26A 5TMBA 4LDRA 4UDOA 5CN0A 4A36A 5AW3A 3GRFA 3K3PA 4JWTA 1GUBA 2UAGA 2BR5A 3PWZA 1YDWA 4QOHA 1X9HA 1P74A 1N57A 3LVRE 4XQEA 2ANBA 1B1AA 1CJVC 1FS4A 4GMFA 2P35A 1O6GA 4X6XA 3A14A 3FAVB 2DYSC 4REQA 1XL4A 9MHTA 2JEUA 3U13A 3JCMM 1UPTA 1XLWA 3EOBI 3HKCB 2H1IA 1G7RA 1MFZA 1HMYA 2D0DA 2ET6A 3IQGX 3CX4A 3OEEG 3I28A 1Q17A 3EVZA 3T7IA 4IJVA 3K2QA 1H4SA 4BHTA 2AF4C 2JI4A 1EX7A 1M54A 1QHFA 3QPCA 4Q0MA 2Q1YA 3A2LA 3K12A 4AKTA 3KYBA 3SHFA 4C7MA 4MVJE 3F3SA 4WFBV 3CNEA 4DRXB 1D3AA 1TA4A 4Z8YA 4BVSA 3NUQA 3PSHA 1U2PA 1X7GA 4M9QA 4QPCA 1PV0A 2QEXF 3EXAA 1E2LA 5B7PA 2PBFA 4Z6KA 5T6MA 1RM1B 2LCAA 3GO4A 2UXDB 3AHIA 3I42A 1EJ2A 2NT3A 1G98A 4IHJA 2VHXA 3HFJA 2D00A 2JGDB 4TL6A 4WWHA 2RCVA 3HEBA 5BP7A 4FEYA 3O75A 5EINA 1Y7TA 1T6NA 1TD1A 5EXTA 3WR5A 3MJSA 3NDRA 1NMZA 3TSCA 3QEAZ 1NE2A 4XWGA 4BZZA 1ZVQA 2YZNA 1EAYA 1ZRNA 3CMCO 1PF5A 3PE4A 2PL5A 2XA9A 1EP1B 3B1XA 2H2DA 2OTJF 1TQ2A 1E1CA 3LO8A 3P96A 1TCUA 4W8OA 1J8DA 3VPCA 2Y48A 4BIMA 3SE7A 1V11A 3L0YA 3TPZA 4EGJA 3CT6A 4RY8A 4JBLA 4EF6A 1NOIA 4GWKA 1J2UA 2XZOA 2A0UA 4C0WA 5EB1B 4AF8A 1JA8A 2Y71A 1FOEB 3E03A 2WE7A 4H17A 2G83A 2Z2IA 3SEAA 4B9AA 3SDLA 2F64A 4CG0A 2WJHA 4N03A 1A4RA 4CDRA 1QFSA 4D9MA 5JDIA 2PUCA 2N3ZA 4K40A 1LK7A 2OPHA 2WFMA 4R2XA 3V8QA 2V7XA 4ND1A 2P1RA 1W36C 3F73A 1CBUA 4EGQA 4LF5B 3T1QA 2HSZA 1N9GA 1YJ8A 4J7AA 1ES9A 2XF2A 2GETA 4M0LA 4PRKA 4MARA 3VTFA 5DULA 2QQGA 2XAHA 4FSDA 4UCVA 3PC8C 4L4SA 1SIWA 4Q7MB 5JMTA 3T5DA 2UZIR 1VKZA 1Z08A 4WFHA 4ON9A 4MVYA 5EQTA 3JSXA 1I3CA 4ZOLB 1G9SA 4FE4A 1VGVA 1OI2A 5TARA 3G8YA 1AGPA 5FADA 3SS8A 3WYEA 1E1NA 4H3HB 3FBAA 2PAFA 3O8CA 2OV1A 1VRVA 2UXCO 1VJCA 2X5OA 1SD1A 1QR2A 3IPRA 1VE5A 1OUMA 3HLYA 3ZVNA 2ZAMA 5M04A 5AW9A 4V0OA 1JG1A 2P8SA 3CF0A 4MYCA 4K0KB 1QO7A 3JWIA 4AJIA 1N3IA 2YJ6A 2QP3A 3AERB 5EE1A 3N8IA 3DVAB 3P9IA 3KJXA 2AFHA 1ZU4A 1QCDA 1L5RA 4ITVA 2OC9A 4FILA 1WD7A 4KXVA 3FTPA 1T2EA 4W7IA 2B3DA 1G3RA 2R79A 1VIAA 1QV9A 3K94A 1K97A 5KJEA 4EKGA 4CM4A 1DAOA 1W1UA 3V1TC 1N6KA 2IBZH 3ZS8A 1E2FA 1WVGA 2BKVA 2AYYA 1RR6A 3NHWA 2FSSA 5FWNA 5I4CA 3B6EA 3G7NA 1KMIZ 3RW9A 4ISCA 4QOJA 4ZEXA 1ZUQA 1S3GA 3CMAV 2FPOA 4E1VA 1L7EA 4OBEA 1E1RA 2ZTUA 1M5IA 1Z4MA 4K0RA 1G5PA 4KQMA 5HZGA 4Q15A 2JLQA 3TQIA 1ZCZA 2Y69B 2JDIG 4A6PA 4YJ2F 3IDZA 1PS0A 1K7FB 4AUEA 2RHHA 4OH7A 3MVEA 1ODSA 1Q0ZA 3ZJVA 4DR1O 3NETA 3D7NA 4O0LA 2QS9A 1MQAA 3AG7A 4HNGA 1PTJC 4NYIR 3FYTA 1B42A 3L5OA 3C3PA 4IXTA 3CH6A 1LJUA 4MW2A 3H8SA 1NBMD 4C8IA 4I0WB 2PRYA 4F8YA 3NJRA 1KDYA 4MUFA 1C4XA 2Q29A 2NO9A 3UWDA 3H8JA 1M10A 1XAJA 3RSGA 4C0KA 1FIUA 1R9NA 1Y9DA 3JZFA 4XDGA 3LUBA 3RAPR 1MT3A 3UWOA 2HC9A 4CM9A 3IC9A 3R65A 2YI8A 1U81A 4B35A 2L2QA 3IDOA 1TD9A 3KR1A 3AGQA 3ZCTA 4AZ0A 2G70A 2ZOSA 2EBOA 4TTSA 4MMYB 3O85A 1VHLA 3HGTA 1JR9A 5EB0A 2CY0A 5GIPE 4LECA 4Q12A 2C3PA 2DWEC 4K5QA 3AX6A 5FYQA 1IUNA 1AVTA 4Q20A 2C9MA 3C8HA 4KFTA 4II2A 4RD3A 5I01A 2VDQB 2VHJA 1R3DA 3S2IA 2EZTA 3IP7A 4QO7A 1ADCA 5KKCA 3EFBA 1RD4A 2WJVA 4Q02A 4CDMA 2QJTA 4BZXA 4JI7B 2W6QA 4JLKA 1PJSA 3LVBA 3TD2A 1N1GA 4GZ3A 2YW9A 2YWHA 3C7CB 5GGXA 3NVDA 2NSYA 3I61A 1Y67A 3C1OA 4PRZA 5HJ5A 2E4ZA 1KIFA 5HF5A 1BXGB 3U5TA 4KG7A 4MRAA 4DILA 4IYRA 1P0CA 1BWQA 1UJMA 3FCUB 4NDNE 2MSEB 3GD7A 3D8HA 3Q7EA 821PA 5LD2B 3KK0A 1H38A 4FGLA 1W76A 4N8DA 3LYBA 1NC1A 4LF9B 3ESXA 1TI7A 2IM9A 2PK3A 4M1ZA 3RVDA 2KX7A 3R7AA 4B3MB 1LSJA 1B43A 4PRLA 4KI0A 4FOSA 4E31A 5C1DA 1PDWA 1SXHA 4FCCA 2O5VA 5HM8A 1CN7A 4HDCA 3ZU2A 3RA6A 4BFCA 2W0SA 3QMMA 1PV4A 4R2HA 3N0WA 3W7WA 4D8XA 3L92A 1WUYA 4H1TA 3UY4A 3EX7C 2HMAA 1A2KC 4I55B 3HYTA 4FHCA 3F2VA 4WKPA 5LXTA 5H7XA 5IAJA 4EAQA 1TT5B 3E27A 4ROTA 2B83A 3DVRX 3IE1A 1HEIA 1ZZGA 4POAA 3RS8A 3TW8B 5H4GA 2IGBA 1A5AB 2JZOA 2QNIA 1IG3A 2AXNA 4BP9A 3R3JA 4G5QA 5GIPC 3U4QA 4OF4A 2J59A 2KSDA 3MF4A 4M8KA 1GGVA 3TZHA 4YROA 4EG4A 1QS0A 2F93B 4B0PA 2BE9A 4XCVA 2YS6A 3OEWA 1DL5A 4DLPA 2Q6TA 1VDZA 5F52A 3U0BA 4Y0NA 2XYPA 3AKDA 3DC6A 1NYLA 4DW0A 1D0IA 1ENPA 4BASA 3FPJA 2IYVA 4X20B 5CH5A 4B71A 5FPRA 3GH3A 1XBIA 1U4NA 4CEJB 5CYOA 2PH7A 4YY3O 2QWXA 4R2JA 1N6HA 3RTDA 4PAGA 2QLLA 3F3KA 2ZSAA 1MEOA 4EA8A 3BZWA 1JN0A 3CCCA 3JAMA 5FI3A 2P5OA 3ZCQA 5CAEB 3W2HA 1IZ0A 3HR0A 4J41A 3WO0A 2H7VA 2NZ2A 1WN7A 1N77A 1IHOA 1RSZA 5KAPA 4G4ZA 5AWFC 4O5OA 4DV4O 5AESA 4Y2TA 2HRUA 2UZHA 4AJKA 3BL6A 4PZDA 4PQRA 5AVWA 1C2YA 5C1PA 3SC2A 1YJWV 1KE1A 2RAUA 1G5HA 3RG8A 5CBHA 1Q15A 1LLQA 3DL0A 4IPTA 1MJGA 3NCHA 2VYQA 4BFUA 1CJTC 3SIUA 2UKDA 1U65A 1MO6A 4MVJA 3TXQA 5FR1A 1MOPA 4UHFA 4ZU3A 4DGQA 1X0VA 1Q7TA 3OM0A 1M4UA 2XVMA 4BE9A 4LGMA 4CQMD 3JQBC 4PZEA 2WZQA 1QIGA 5T6BA 3PXUA 3PC8A 1UZUA 4DSTA 1HG0A 1PL0A 4MW4A 3SBOA 4UAJA 1U4OA 2GPJA 5IWAB 2J0UA 1ZUIA 2YW2A 3GP3A 2DY1A 3IBSA 2YMMA 3NBMA 3HTNA 5HY1A 3RU9A 4ETNA 2JIQA 2AMVA 3T7TA 3PZRA 1E4YA 5FA8A 1LNSA 1MVLA 4DCCA 4YAGA 1GARA 2RMKA 5FOXA 3H2GA 2GJSA 5KQRA 2NUAA 1Q0SA 3I34X 2EKPA 2V9ZA 5MGBA 3MJHA 2EYUA 3CGGA 2O20A 3EMDA 1XNRO 1STOA 2C07A 3O95A 4V1CB 1Y48E 3AR9A 3FMGA 4MQLA 4GO1A 3W9SA 2GH1A 5JZBA 3SYCA 3N0TA 5AP9A 3R24A 1XL6A 3TWOA 1OA0A 3RC7A 1KQFA 1QF9A 5CMUA 1OFIA 3FCSB 3MQFA 4HTFB 3UT5B 1B8OA 4W4KA 2QN6A 2XYGA 2Y1OA 2R2AA 4PM4A 2CMDA 4W5NA 2H4WA 1TA8A 3MAGA 5DOVA 3V48A 2OTLV 2QR4A 4G5HA 2BZ0A 1MA0A 4NBNA 1NJ8A 4GXNA 3VU8A 1DU4A 2EG9A 1YFZA 3C3WA 5CBGA 1AN0A 2HNBA 4IGFA 3K0TA 1JE1A 1LPAB 4P58A 4HD8A 1RWQA 1D1QA 1QYWA 3H9GA 1VGQA 2Q69A 2C57A 4CMIB 2YVKA 1S02A 5LMCA 2Q6AA 3O7MA 3WTBA 5CLFA 1OZ0A 2WHPB 1M56C 3K9WA 2VG8A 4BN4A 4E33A 3OX3A 1E63A 1P49A 1PTJA 3E7WA 4RIGA 1IWBB 4A8HA 1RDFA 1SN7A 3IV6A 3F1KA 1Z0SA 3A4MA 3E5MA 5IK2A 2I7CA 3WB2A 4Q66C 1GZ3A 1MJ5A 5A3RA 5CU7A 2N47A 5EJ9A 1BXRB 2ZATA 4D42A 3RT3C 2Q7GA 2KPOA 1XI2A 2YOHA 4KCGA 2DT4A 2NNWB 1B00A 3NM4A 1GGNA 2ZU0C 4NCHA 4W82A 4HDMA 4EG6A 4EDFA 1RVV1 1TVKA 2XRMA 2UYCA 4LY6A 4NU8X 3HZOA 3DAGA 2V59A 4YAJA 4KRXA 4J29A 2R25B 3B6NA 1N2OA 1C1XB 1KNXA 5C35A 1NYQA 4FNGA 3VBBA 5KQMA 4G5GA 1Z07A 3HCBA 4HGNA 4DG9A 3ZXSA 4DNXA 3THOA 3WWEA 1H69A 1UXGA 3IRVA 2ODMA 4P0PB 1IIBA 3R7SA 2W4IA 1Z0IA 2UVDA 4IX9A 4ZEVA 2NU8A 1E5DA 2GERA 4EG8A 2PVPA 4DNOA 4HLQB 3C14C 3RRZA 4QYTA 4JX8A 1R73A 1NLUA 3E70C 3C1AA 4YRGA 4FZ3A 3ML0A 4Q9KA 1QHIA 2P2LA 5AOCA 3ZE8A 1FRFS 2Z56A 3ZWOA 4G65A 1WBBA 1CRWG 3D6JA 1Q1EA 4F5WA 2PXAA 3PGVA 3T35A 3LWQC 4RZUA 4IDPA 2OGWA 4QPDA 1OFVA 1WXDA 4XM1A 4AZ3A 1KBOA 2FEXA 3CCJF 4G85A 1B3RA 1VQ9V 1GTSA 2QV7A 2ZR2A 2C99A 3VR4A 1AF4A 4DJEC 1RHKA 2DQKA 2VBCA 3CXHF 3QE9Y 3QXHA 1CERA 4EVQA 4X1YA 2FHPA 5AR1A 3SBDA 1VYUA 1XBTA 2A5DA 2UV8A 3HADA 4B32A 3WL7A 2C7RA 2W2LD 4PCAA 5F35A 1FNSA 4HO1X 3PHBE 1ZUNA 2C3MA 1PG2A 4IHQA 1YSCA 2YOFA 2BZSA 2NPFA 4H4EA 3C90A 1SQFA 1E3JA 4JMPA 5KYUB 4RA9B 3KKQA 2HU2A 4HUJA 4P8RA 1L7QA 1GGHA 2GPSA 1NTRA 5AJYA 3O8QB 2E6KA 3AVUA 3R7DA 2ZYAA 3ASUA 2Q07A 4B33A 3D36C 5LIRA 3BWDD 5JCJA 5EBWC 1JBQA 3R75A 3HSSA 3SX2A 4E5MA 5KOIA 1EG2A 2Y99A 4CODB 1YUNA 1IMJA 3VO2A 3G68A 4O4IB 3SIXA 5KEIA 3T9FA 1JXMA 4D3DA 3TIVA 2RB5A 2AG0A 5C5DA 5FLEX 3QENA 3GUUA 1RXWA 5DFAA 1UADA 5EPOA 1SO8A 3ORYA 1E3SA 4M55A 4URVR 3PIRA 3PVSA 4DLNA 4PXSA 3ANYB 3V3KA 5HCNA 1Y33E 3TOSA 3WGHA 4JVMA 5L3SB 2R7LA 2F4VB 3OQHA 1KAEA 2FG7C 3BRCA 3LNCA 4QWWA 3QU5A 4ISBA 2YKGA 1T91A 3AP1A 3R44A 2YIMA 5EJ4A 1BO6A 4TS3A 4X00A 4LXUA 2WPDA 1KSHA 2O4UX 2X3YA 5C8YF 3JQBA 1F8UA 2KG7B 3TMAA 4MRSA 1ODKA 1G21E 4GAEA 4MEAA 2GPBA 1GL6A 5HIIA 3CVJA 3GEBA 4MROA 4BE4A 4E5SA 5C46F 3ENWA 4AD8A 4EYKA 2CMGA 3GLGB 4AMZA 2PGXA 5CRIA 4J0JA 1WVMA 3FD6A 5FI1B 3SR4A 2C7QA 3K9HA 4XR9A 3QFRA 4ZOAA 2FMHA 4CM5A 4OB6A 5ELMA 3PEYA 1SQ5A 2WT4A 4ENTA 1K5HA 1U2SA 3KE1A 3TFWA 2VH2A 1Q95A 3I55V 4G24A 4WOKA 1T4CA 4BMYA 1WB7A 4IIFA 1PR5A 1ZD3A 3FUVA 1MABB 2YNMD 3GN2A 1VXRA 3RS7A 4Y9UA 4BVAA 3D6HA 1TMYA 1RM0A 5JYEA 2WM2A 5AFSA 1Z9BA 1L5HA 5EWLB 4FONA 3H8WA 3DC7A 1RLGA 3I72A 3FD9A 1V2HE 4H3KB 5E4JA 1COMA 5I7FA 1UK9A 3OY7A 4JOCA 2A1TS 1X8LA 1W8IA 4HZUB 3PYXA 2B3TA 5HKAA 2IH5A 3LDGA 2HBQA 2Q6VA 2BSAA 4QYIA 1CP2A 1JEQA 2OCXA 5JH7A 2GWHA 2DMXA 3PL5A 3H6GA 4ND3A 3SNKA 1XQYA 1D5AA 5LA6A 1W6UA 3TE6A 3VVCA 5TIIA 2D8MA 1L5ZA 1W41A 3K0FA 5B3SB 5EQFA 2COUA 4D1YA 4MKFA 4RFLA 5A2GA 5KQSA 1B1CA 3HKBB 3FYDA 2HX0A 1NVPD 4OOFA 2VRCD 3KUCA 2OBBA 4TWBA 1HT2E 2RHDA 1KOFA 4TKUB 1Z0KA 4YMSA 3ZN0A 2XQGA 2ZIVB 3SPIA 4QEZA 3CCBA 2BD0A 1GCIA 2P1ZA 5F1PA 3SFVA 3OEHD 2H8GA 1HGXA 5LVAA 4L9SA 1SC1A 4C2UA 1BE1A 3GLSA 1FNJA 4Q5IA 1ZESA 5KTSA 4JOQA 4TV8F 1OCOB 1NYTA 1XYYA 1JJ2U 3OA2A 1R0SA 4E6EA 3J80M 2D06A 5AJUA 3WAKA 3MYRA 4LSWA 1WA5A 4C2BA 3CS5A 1MHPA 1QHXA 1KAGA 1MC1A 4MSUA 5KZMB 3X1MA 5DEDA 5HZKA 3FTFA 4PZAA 4ARUA 4LJ4A 3EEYA 1XO1A 2HIGA 2IXGA 5B1SA 1S1MA 1OYWA 3U7HB 2IH3C 2R8YA 4DXAA 3IP6A 2FX3A 5KVSA 4B6GA 5GV7A 5BNTA 5ES3A 4XA8A 4LXHA 2PU7A 4AMGA 3PPIA 3IHTA 3R7WA 2CJFA 4AY2A 1XQXA 2FWRA 2OENG 1GNTA 2NO0A 4E2FA 3FFMA 5C1BA 2YMQA 1QRUA 2OE2A 4MUHA 2XJ4A 3PR1A 2EBHX 4D9EA 4X92A 3GJQA 1EBOA 3RADC 4N6OA 5HEKA 3CEIA 5DGDA 3C9TA 4YMWA 5F2NA 3AOEC 2NVUA 5MF6A 4CQLB 4UDYX 2FMXA 4KXUA 3G2QA 2HV9A 3V55A 4YAKA