4TUYB

Tubulin-rhizoxin complex
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
428
structure length
424
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 171
structure length 424
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tuyB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tuyB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tuyB01
5BMVB 2VAMA 3VPAA 2GVIA 3M89A 4I50B 5CB4B 4ZI7A 3N2KA 1TVKA 4IHJA 3RYIA 1FFXA 4YJ3A 2BTQB 4U3JB 3VOBA 5LOVA 4ZHQA 1Z5VA 4HNAB 2VAWA 4TV9B 4TUYB 4IIJB 5IYZA 4O2AA 4O4JB 2Q1YA 5MN6A 1W5BA 3E22B 3N2KB 1TVKB 4X20A 4ZI7B 4IHJB 3RYIB 5ITZA 1FFXB 4YJ3B 3RYHB 4YJ2A 2RHLA 3ZIDA 1TUBA 4HNAA 4TV8B 5KMGA 5LOVB 1RLUA 4IIJA 2BTOA 5EIBD 5IYZB 4O4JA 1JFFA 4O2AB 3VO8A 3UT5A 3JATA 3ZBQA 3HKBA 4B46A 3V3TA 3JALA 4O4IA 3HKEB 5EZYA 3E22A 1SA0B 5LA6A 4DRXA 2Q1XA 1W5FA 3RYHA 3RYCA 2R6R1 4X20B 5LP6A 4TV8A 5M7EA 5ITZB 1W5EA 4YJ2B 3RYFB 3JASA 3WGJA 4O4LB 4EI8A 1TUBB 4DXDA 4F6RA 5KMGB 4I55A 3HKCA 3VOAA 1W5AA 4EI7A 3WGMA 1JFFB 3ZBPA 3WGLA 3UT5B 1RQ2A 3HKEA 3JATB 1SA0A 4M8IA 4I4TB 3HKBB 4X1IA 5LP6C 5CA0B 3JALB 4O4IB 5EZYB 4DRXB 5LA6B 5LXTA 2VAPA 4X1KA 3RYFA 3RYCB 4O4LA 5LP6B 3WGNA 5JQGA 3JASB 5J2UA 2XKBA 3CB2A 1W581 4F6RB 3C8LA 5FNVA 5JH7B 4ZOLA 2RHHA 3VO9A 4I55B 5C8YA 5EYPA 4X1YA 5GONA 3HKCB 5JVDA 4I4TA 5CA0A 4EB6A 4X1IB 5LXTB 4O2BA 5MN5A 5MN4A 4X1KB 4LNUB 5JQGB 5J2UB 5JH7A 3N2GA 2VXYA 5FNVB 4ZOLB 4B45A 5C8YB 5EYPB 4X1YB 5GONB 5JVDB 4E6EA 3RB8A 5EIBC 4KWEA 5J2TA 5JCOA 5KX5B 4EB6B 5CA1B 4O2BB 1Z5WA 2RHJA 4LNUA 4U39A 3JAKA 4EI9A 3JAWA 4FFBA 4WBNA 5IJ0A 1RQ7A 3JARA 5LYJA 3N2GB 4O4HA 5JCOC 5KX5A 5CA1A 5J2TB 3M8KA 1W59A 3WGKA 3HKDA 5BMVA 5IJ9B 4I50A 5CB4A 3JAKB 3JAWB 4FFBB 4WBNB 5IJ0B 2RHOA 2BTQA 4U3JA 3JARB 5LYJB 1FSZA 2XKAA 4O4HB 4XCQA 2R751 4TV9A 4TUYA 4ZHQB 3R4VA 5IJ9A 3HKDB 1OFUA
chains in the Genus database with same CATH superfamily
2H7CA 4XAQA 4V2IA 4CTMA 2KS6A 1QQAA 2JARA 5IMSA 2QORA 5IH3A 3DUWA 5LGUA 4IRXA 3ICWA 4KDCA 2RH9B 1NAIA 2AW5A 5ESRA 3PVZA 2NO9A 4KMSA 4B3RB 4RMGA 3AM1A 4KOAA 2YYSA 1N1GA 3MHPA 3CZQA 2QN2A 4L50A 4CKBB 5DNDA 2IE0A 1N5OX 3I8OA 2FPKA 2IEBA 3PGLA 4OJMX 5E9AA 3EODA 5LL6Y 3P52A 1U5CA 5KWVA 4G0WA 5MN5A 1V8BA 4KIJA 5FA5A 1UCFA 1W2HA 5CVUA 1YA6A 5IXSA 4NL4H 4DLKA 2DFLA 4JGGA 2GZAA 4NWOB 4PF1A 1PD1A 1N5KA 5K0JA 1NVBA 1KYVA 1U1IA 1HZJA 3EUWA 3RVOA 2GDZA 4YJHA 4AN4A 1V25A 4N01A 2IZ5A 2V8BA 4Z0TA 3PICA 4UBNA 5T41A 1VECA 3A4NA 2HJRA 1A0OA 3GLRA 3AK1A 5IDJA 5ILQA 4YRNA 2ZT7A 3FD6A 3D2LA 2JBHA 3EDCA 3SNHA 2XVAA 4IZIA 3SJBA 1N5LA 5JARA 4PBRA 2RG7A 4DWJA 2CV0A 2QUBA 1HZZC 2GAOA 1M8JA 2KKWA 5EJ5A 3USZA 3MGBA 1WQ3A 1R1DA 3ZC3A 1EK2A 4DDHA 1QCEA 2G07A 3WK6A 5JU6A 3VC3A 4P0QB 4ZEVA 5I9MA 1UEXC 1FA9A 1W36C 3T3MB 2XOEA 3GFPA 3I1IA 4B43A 1F8UA 4M1TA 2IJGX 2DR3A 5TPZA 4J6EA 4Q6GA 1XEXA 4CC5A 3LF1A 3Q8LA 2JJ2D 1GTJ1 1KAQA 2GDJA 2G67A 3NHKA 3QI2A 4II2A 4IMIB 3CCSF 4M0FA 3ZG6A 3WK4A 3T9FA 2D74A 4DJJA 1JIXA 4N8EA 4V24A 3NGXA 4MZDA 3TTYA 5AT1A 1I3NA 3ABIA 3IKMB 3TLXA 2W2NA 3WLRA 2QA4V 1QLEC 2Q67A 2DAPA 1X7HA 3NKLA 4U3JB 3VC1A 1Q0LA 1I7LA 2FYTA 4J0QA 1TZJA 2YC2C 4FMTA 1QGDA 2WF8A 3WBBA 3OP1A 4Q4CA 2ZSIA 1YI2F 2BFNA 2WPDG 2N74A 4N47A 1NI3A 3CNEA 3H1GA 5AQEA 4P7GA 3UQ8A 1G1AA 1SETA 1I9GA 2WJHA 5F51A 5CBGA 5HM6A 1ZU5A 2B0JA 2B8EA 1YJAA 3EEBA 1RHRA 3W7TA 2A7WA 4HDSA 5FH9A 4OHXA 1IURA 2PKYX 4X3LA 1Z6TA 1PNMA 2XUHA 3DO5A 4NHEA 1E9CA 2GJSA 3IR6A 5BSKA 4CMHA 1G8PA 2J0UA 4EHAA 3TGWA 4CEHA 1TIBA 3MQ2A 2GK7A 3TB6A 4OXNA 1L5WA 4B3JA 2RAUA 2GZ2A 5B4VA 3D3JA 4BWYA 1QGYA 3P0HA 4FJ0A 2LGJA 5CDGA 1TM5E 5H5JA 5IULC 3RSGA 3ZZMA 2GEVA 5K1XA 2E49A 3RVZA 3V6MA 2PWAA 2GPAA 3DL4A 4F5EA 1HEYA 4YQYA 2ZPAA 3SQOA 1UK7A 3B2NA 2WE8A 3LT1A 4DBLC 2D06A 1HT1E 3PJEA 5BOVA 5DI3B 3ESRA 1QVFU 2NO7A 2FSFA 4NBKA 3BMCB 3PGKA 2O4CA 3O4RA 4TTJA 1VHQA 1WMSA 2ZYIA 1D5CA 3E9RA 1VLQA 3IMEA 4X1KB 4Y2QA 3DV9A 5IU6A 5EYPB 1E2BA 3H1AA 2EX4A 2V45A 1RLGA 4BO6A 3G23A 2AWNA 1FD9A 4JLVA 4G09A 3U62A 3DTUB 4GWGA 3DVRX 3AEIA 3LYHA 3RS8A 5KQRA 2ZW9A 1Y4UA 1FYVA 3PFGA 2R2GA 3TTUA 4TWJA 3ADCA 5TISZ 4HGZA 1AHHA 1TT5A 2XUFA 1XQYA 1XBTA 3PXUA 3DMYA 1ZOIA 1E0KA 1MJGA 1J70A 1LPNA 2YFYA 3JQFC 4D44A 3V8PA 3SIUA 4C14A 1R8QA 3VTKA 2VDLB 4LXGA 2XD9A 1BH2A 4D43A 4YN3A 4DE5A 3FCUB 2X7HA 1B2LA 5DM4A 4TS9A 2IKQA 3H4IA 2FW9A 3WGMA 2BC9A 3P97A 2HRUA 4MR9B 3EZ9A 3U3XA 3R8FA 2CE7A 3JVVA 4TWKA 1QAMA 3VHRA 3R9WA 3UWMA 3CKLA 4B9EA 4BFXA 1AGPA 1NVVQ 3O8OB 2IZ6A 5G0TA 2VSYA 1J5XA 2Y69B 4OFZA 1QRRA 3UUEA 1M2KA 1Q21A 2OHIA 2PUJA 1Y3HA 1ZZEA 4E1BA 5J5AA 1SC5B 3IBFA 4WKCA 1ATZA 2JD0A 2ZRQA 5JD6A 5LNK6 2J9XB 3EXHB 2F4VO 1RWOA 4Z99A 4ZVLA 1SEPA 4FIDA 2QWNB 3D00A 4ASUA 2B8TA 1ESEA 1J7KA 1UBSB 4PC1A 3WYDA 3WYNA 1V7PC 2DPLA 3NK6A 1QVFF 2BTQB 1NYTA 3V9PA 2QLBA 3O21A 4E5PA 1Q1AA 4ZVSA 5KWSA 1XK6A 2Z30A 2DQ0A 2E5LB 1Q22A 3C1OA 4M0UA 4ZI7B 3C3XA 4OYLA 3W6UA 1V45E 5JNRA 1XG5A 3VJRA 9GPBA 4IYJA 3KQVA 1XOIA 4P3NA 3ON1A 5JXHA 4HNUA 4M3NA 3AKZA 2YFHA 2ETNA 1TRHA 1OU4A 2OFFA 3ZCRA 3LDFA 2P77A 5DTMA 1ODJA 4TKLA 5CEEA 5J2UA 3IXQA 4CTNA 3OFND 2FYUH 3JQ6A 1EVKA 2PQMA 3UMGA 3VPHA 2B8WA 5F5XA 1LJ8A 5BWNA 2HUPA 4RV9A 3GJRA 1R4NA 3VH4A 4ALJA 5KVAA 4MTXA 1LI7A 2A9VA 3FB1A 4LY9A 3QJGA 1GDDA 3GLKA 2P6JA 1Q0ZA 5GV8A 2WT4A 4JROA 2W2XA 3R40A 3VHQA 1YAJA 2LBPA 1FRVA 4EGSA 1IQPA 3EULA 1OLUB 1ODLA 4A9AA 3DEYX 3KKEA 1K8YB 4YIOA 4P38A 2QMQA 2VL7A 1E7WA 5GZ3A 2F8LA 3IP6A 5EJ7A 2IHZA 4UTRA 2QVYX 3EGDB 1W85A 3X0DA 1JJ2F 4MMZB 1PHPA 3HGMA 3DBRA 3OQPA 1W0CA 1Q7YW 2NT3A 2QEXF 4ESEA 4QDTA 3KETA 1SUIA 2AX3A 2WFLA 3QQPA 1BKYA 1O94D 3TNFA 1NBMG 2BFMA 3DOIA 1NBME 3IGAC 3G6KA 4DA8A 3TKLA 5JH7A 3ND7A 1XI2A 1Z17A 1IY1A 1XL6A 4MIKA 1ACMA 1R6DA 3RAPR 4RFLA 5J1SB 3ZE7A 4JB3A 3CSSA 2MSDB 4AU1A 4E09A 5HM8A 3LNMB 4G0OA 4FLZA 2ROQA 3OSUA 2IU3A 2GHTA 1FYFA 4E5DA 3URKA 2VDVE 1ZIDA 3TRIA 4ND6A 1OV4A 4KJXA 4R69A 3V32A 5BNZA 2FFBA 1Z0UA 1RJFA 3ZU3A 4D92A 2Z5UA 4F3YA 4TV8B 2CMKA 2HG5C 1JAYA 3CLKA 4FEAA 1RFGE 4TRNA 1Z73A 1ZM2A 5EKDA 1T29A 3WB1A 5ITZB 1U2QA 1SK8A 2COKA 2YHBA 1TCCA 2PWBA 1INLA 2RGBA 4JUBA 3ZNQA 1CFZA 4JI1B 4ER6A 2C2OA 3KKOA 2YTZA 1KPIA 4V2UA 4D3ZA 1JEAA 1CEXA 1NUUA 4RSHA 3MCQA 1N25A 1UBNA 2G1PA 5JVDF 3DD5A 3FSGD 4BQNA 1VE5A 3G0CA 1N6LA 5EUBA 3KQKA 1XJQA 1FXWA 3W90A 1M2EA 1J6UA 3GEGA 2OOKA 3FCSB 4LV5B 1O8CA 1OXXK 1EFRG 3WQRA 4QOGA 4DR5B 3ZWQA 1OJLA 1WNTA 3K4QA 5EWMB 3LPLA 3LT5A 4JOQA 3ZDDA 1GX1A 4YI3A 3SS8A 2P78A 1FNMA 4D98A 4DCGA 3LYAA 1CY0A 3RS7A 1RPZA 4TLCA 4LI0A 1PR9A 1VMEA 2QTFA 3RS5A 1ZH2A 2ZI6A 4I8DA 5CVCA 4IGFA 5T6BA 2WKWA 1TUBB 2HQRA 2VJMA 4W5HA 2XNKA 3PNMA 3ZY5A 2R68A 4CKXA 4FM9A 1SIWA 4INJA 1D9ZA 4QWWA 1URPA 1QGZA 1ZYUA 3LLVA 5EIEA 5F73A 3KYCA 3K8QA 3QLUA 1CJUC 5B7GA 3JAMA 5L3QB 4G4YA 4ZI5A 4ECAA 4C7VA 1DU4A 3W7BA 1M6YA 1M6VA 2OQIA 4HGYA 3KJGA 4OK6A 2WTEA 3TOCA 4Q01A 2VDUE 2JHFA 4DV3O 5TT0A 2I76A 5L4NA 2WICA 2ZINA 2V6FA 2D1SA 1D1SA 3ZV5A 4HF7A 3CUEF 4YY3O 5BY1A 9MHTA 2C59A 1XQWA 1WUKS 1V71A 2GN8A 4MO2A 2NU7A 3KD3A 2Z5VA 3EMDA 1FU8A 4HQFA 2PY5A 2ZIAA 4MLCA 3GGCA 4BO2A 8ATCA 1PFQA 3A3PA 1JJBA 3ZBPA 4P92A 1R0RE 4EBFA 4HD8A 4DA0A 1IB0A 4LHSA 4FE3A 1TM2A 4MI9A 3C14C 4BMOB 3H3FA 3E8BA 2NX2A 2VWKA 1ZSYA 2DJIA 1WB9A 2E6UX 4QHSA 3ZWAA 5D7BA 1SDSA 2LW1A 2L2QA 1GK9A 3M82A 4C2AA 3EEQA 1S96A 1DINA 1V2HE 2X9LA 1DJPA 4Z9FA 1IM8A 3UWSA 1JE1A 1I4LD 1M7BA 3H2SA 4ANFA 3CZCA 1QKKA 1J9GA 3PD7A 4O2LA 4OBWA 3UHAA 2QLLA 3ZJZA 3F73A 4RLSA 3W2FA 3OI7A 2HRZA 5H16A 2BBSA 5K3FA 5H02A 4YJ3B 2UUCB 2YEVB 3ZDEA 4CIDA 1MOFA 2XXAB 4DZZA 2HD4A 3EGWA 2GZRA 4NXMB 1GCUA 3CU5A 2JA2A 4YMTA 1TJ3A 2XSZD 4QPJA 4KIGA 1NC1A 4KC0A 4B4KA 4C6TB 1PQUA 3VR3D 1D2GA 1HE1C 4RVHA 4ZV7A 4NTWA 2GKOA 1M2WA 2GFQA 3GX1A 2PUSA 1FEZA 2H7YA 1Y5RA 4MCAA 4CM1A 5IDQA 4OX9B 1N78A 3HYSA 1B15A 3HCFA 4BL5A 4MHSA 4YXFA 4Y2JA 1JIJA 1YRHA 2Q5ZA 2C9BA 1ZCAA 1J0BA 2ZKIA 3B60A 3ZQUA 3OZVA 7YASA 2OBFA 4G23A 4XB1A 4FCCA 4DDKA 1V7QA 5DLQC 1FNDA 4EEXA 1A9YA 3N2LA 4TZ6A 1SXJD 3G89A 3A7DA 3B3GA 2BEUA 2XZTA 2ZNJA 5TPWA 5EAIA 3QVTA 4ISCA 3UKJA 1YB4A 2PJUA 2RI1A 1S2IA 1HR0O 1G66A 5REQA 4GLLA 1V5EA 2P6UA 2D4AA 3KPUA 4WNIA 4BAGA 3E89A 4J0FA 1Y8RB 5CK4A 1MRNA 4DV4O 5LP6C 1W0JG 1P39A 2AXEA 1WMEA 2Z4RA 3CUSA 3BWVA 2BV3A 4RTRA 4RK5A 5GP1A 2VT3A 3P0RA 2VSXA 4XIYA 1Q0TA 1SBHA 2QTVB 3I2IA 2CV1A 2HMTA 5EKXA 1BE0A 1SVOA 3VNSA 3U11A 1WCV1 3LC7O 3PYLA 4QUGA 3ZWNA 2BCEA 3NMUF 3BVOA 2HF2A 5AFSA 4LISA 1UFQA 1Q74A 1R0BA 3UM9A 4L16A 2QM0A 3BXGA 1R5JA 4NYJQ 2QTPA 2QTHA 4Q19A 3IBTA 3BQMB 1UBTS 2MINA 1PZNA 5DM2A 4C20A 2O52A 1XELA 1DO2A 4UHJA 4AWBA 5JSQA 4PC6A 3KSMA 4G01B 4G5SA 2YIAA 1D1PA 3AIKA 1CY7A 5A6SB 3ROQA 2Q69A 1O96B 5JW6A 1DARA 3KL4A 4MINA 3EZLA 3RI3A 1E3EA 3D54D 4OSPA 1CE8B 5A4KA 2Y1FA 1XCOA 1M8GA 4CMBA 1GGJA 5H2FZ 1YXBA 3V1TC 5IVHA 1W94A 3MRVA 1EJ0A 4NATA 2BJHA 2GN2A 4OLJA 1J90A 1YTUA 1VKOA 5DXAA 4L74A 4X6YA 1J2EA 4HUTA 4NMXB 4U7TB 3D6AA 5CA1B 1VHTA 4NMHA 1EFLA 1M7HA 1QQ6A 4FFBA 3JARA 1KO4A 4F8JA 3MT8A 4MVZA 1C7FA 4XFDA 4RLQA 4E22A 1EFVA 4YJDA 3D5QA 3DAGA 1J20A 3SCZA 2ZODA 3MGGA 3P96A 5DWVA 4IV0A 1EXWA 4OOFA 3SZUA 3ZWKA 1IIRA 4R7TA 1T36B 2AN5A 1SB8A 1K3UB 5DRTA 4EG4A 1WSAA 2UUAB 4HPJB 1PT6A 4PPNA 1E9FA 1YJ9V 1NTOA 4L9RA 4EVQA 3KUXA 4ZTBA 3ZU5A 2F8MA 1YZVA 2PZJA 2QQ5A 4MVXA 3JR3A 3QF4A 1SZCA 3U2QA 2P06A 1Z08A 3CH4B 3H2KA 1QRSA 1MOSA 4KL8S 4JI7B 1DELA 3ZCQA 4ZARA 4Z49A 2OZVA 3U37A 5E1OA 1WBBA 4B48A 3TPFA 4M49A 1X9IA 3RRMA 2RDCA 1RXEA 3OZGA 2FEMA 1JTVA 2BWJA 4ZRDA 1B73A 2V98A 5HFAA 1DXQA 2BR3A 3R9IA 4EHJA 1USUA 1HYHA 2REXB 4DCOA 1Z7GA 2R11A 1ZL2A 1SAYA 1PGPA 4TYPA 2PZMA 3RR2A 1E1NA 2RHOA 3IQIX 1MPTA 4KQHA 4ZQGA 3AERB 3UKDA 1U99A 2JJ2G 5GJCA 4ZC1A 4YMVA 2PX4A 4YUXA 4RWZA 3HB1A 4UTXA 1NJFA 4OLAA 2YJ4A 4CHGA 4KGXA 3EZYA 1X4TA 3I5MA 2Q7EA 5E9QA 4PHFA 3QEKA 3ZXXA 1A27A 1VRWA 3KZIZ 1PWXA 2PH3A 3B6EA 3SZRA 1FNJA 2C9DA 1ZM7A 5EZYA 2JLVA 1ZL8A 3TE7A 3DYVA 4UE2A 3BXOA 3PCRB 4BO7A 3FDZA 1ZY2A 3GGGA 3K16A 1T4DA 3BGWA 4HGQA 1DBPA 4F4CA 2NQ2C 1KI8A 5EUCA 3ZN0A 3T99A 4HQ0A 3R3VA 3L72H 3AFGA 2C92A 1DAIA 1YXMA 3AP2A 4IVNA 1CNMA 4CV2A 4KPUA 5BSFA 2KG7A 2ZANA 3WB0A 2AI3A 4JSYA 1MUUA 4I0XB 1QE3A 1RKUA 1VA4A 3AFNA 4HR7A 4EKGA 4YO8A 3M5DA 2CMHA 2XIJA 2E2WA 1XHXA 3HKDA 3S8MA 1NVVR 2DWPA 4C43A 5DNCA 3BMXA 4AS1A 4GKKB 1XMXA 4ZPJA 3PWTA 2XCSB 4B79A 4FYXA 1C8VB 4F56A 3U39A 1S3SA 3QE4A 1FNNA 4MVQA 5H3LA 2LKCA 3R9XA 3QPDA 1P9NA 4TV9F 2XQVA 1KHTA 4TM8A 4B47A 2AMVA 4N5LA 5EFZA 1ISHA 1M1NB 4LXUA 3T0IA 2H92A 2CDCA 5IUNC 3RYHA 4V0KA 5FIUA 2VXBA 2V5AA 4ZHWA 3OU2A 5CGZA 4E5YA 3QU4A 5B66Z 3JCZA 3B4SA 4Q7LA 4WA8A 2OG2A 5EE0A 5LA6F 3LCCA 3QTLA 3IRVA 1GZVA 3G0GA 1UMBB 1CUWA 4N5IX 4PGHA 4KYUA 5BNFA 3GH3A 1R3IC 2DBQA 4PZPA 4UDOA 2HHHB 2MQEA 2FZ4A 5HP4A 4J9YB 3U4HA 1OHHG 2C9MA 3ZNOA 3NV7A 4AJ9A 4QHTA 3QFHA 3SFZA 1B8OA 4KRFA 4DQUA 2H4FA 4HX9A 2JW5A 4KRGA 2JI8A 4DC0A 2FMXA 4XRGA 3DHVA 4OU4A 3H13A 5IC4A 3TRJA 3LK7A 3NATA 3K0EA 2HRCA 3K9BA 1VQ9V 5AUNB 3OPQA 3RTDA 1SG9A 4XKJA 3MFQA 1MZPA 3OCCA 4N48A 1V1MB 2XV1A 3QTBA 3CGWA 5KWIA 4N3GA 3WE7A 4D0SA 2GERA 9LDBA 1VYVA 1BZKA 3QUSA 1NVFA 4KPFC 4P53A 5FBVB 2EAUA 4WJKB 1MA3A 1U31A 3A0RB 1DQZA 2WWWA 4UUOA 2WPDD 2EBFX 1Q6HA 1DF4A 3A1CA 5B1AB 4OMCA 1P72A 4BQFA 2QLFA 1PKXA 2HPVA 4DWVA 3AG2B 1NUPA 4E51A 4GPIB 5EJ8A 5CB4A 1CZLA 1A8UA 3T1NA 1J22A 5FL7G 5ARCA 2WB4A 5DNVA 2DYRC 1WBJB 4CUZA 1H6AA 1L4NA 5DBFA 3EIEA 3WR5A 3UCEA 2VPIA 3P4YA 3ZY4A 3BTOA 4AMGA 2PX5A 4H7JA 3IOBA 5BSWA 2ZR7A 2BF7A 4QLBA 1IJFA 4OXYA 2CXSA 4HO1X 5T5QA 1YR7A 1ID1A 2QWQB 4CIVA 1AQLA 3QKRA 3I9MA 5HNKA 2ZR8A 4E7OA 1RJ9B 4COKA 2GZ3A 1HDGO 2HR3A 5DHPA 1AKYA 2G4CA 3MUNA 3OM8A 3K72B 5EAZA 1J8DA 2P30A 4AZ3A 4E03A 5IKXA 4PA7A 2A5LA 4ZHYB 3PPVA 3R76A 2QSAA 2O7QA 2C7GA 4XDJA 3C98A 3NHLA 3Q88A 3QV2A 4S24A 2IH4A 5D3MA 4BNVA 2QKAA 1WN7A 3U7EB 1QG2A 1V43A 2EW8A 1UDAA 1NP6A 3RRNA 2FQWA 2GD6A 2Q5EA 3ZGNA 1JECA 2Q7GA 3N86A 4L1KA 4QT4A 1SK9A 5E0OA 3H1TA 4EF5A 2Z4TA 4KQ2A 3NS7A 1ISSA 3L4EA 4IM7A 1D6NA 3BK7A 4TSFA 2GDSA 1ZGHA 5KTKA 3G9TA 2XGJA 4BC1A 1L8LA 3GJXC 1SVNA 3F9RA 3DOHA 5A02A 1UFVA 1R66A 5B2ZA 4D4HA 4JVLA 1GAXA 3K15A 4H7KA 4CKCB 4CMEC 2HFJA 3UMRA 2HV8A 1AA6A 3T3EA 1IRXA 3QVJA 1CVLA 2Z8XA 1CUYA 3GEDA 3KJXA 4OHFA 4FE7A 3BJZA 2ZTSA 4M9CA 4ZEXA 1X1SA 5AXAA 1GAJA 4B4UA 2D0OB 3TLMA 4JJZA 2P4UA 3IB6A 4I36A 1NGSA 3D8RA 1JIIA 3T5BA 3NOQA 2RAPA 3K0KA 4LECA 3S81A 2QJFA 1U04A 3QFCA 3ITDA 3EJ6A 4DEXA 2ZTLA 1BXGA 1YZGA 1E89A 2PL3A 2YNMA 3LVFO 4F5ZA 3TLAA 2H2IA 2I4MA 4B5CA 3HI4A 3IAS1 5BQXA 2FWAA 3IC7A 1XZLA 3HCWA 2JK1A 3E3OA 3K94A 3CW8X 4GFDA 2GBIA 3ZDQA 3ZHYA 4YJ2A 3WVNA 3DSQA 3HVRA 5J63A 4LXTA 3GVCA 2I6QA 5LKRA 2X6QA 5EO3A 4AL4A 3G71F 2P9BA 3V46A 3BE8A 3UK0A 2O2CA 2ZIWB 3JD4A 2CAZC 3NO4A 3IE2A 3D2BA 3DOFA 4Y1RA 2NM0A 4R41A 2WAXA 2P6MA 1G60A 1N92A 1WA8A 4F1KA 1W42A 5IM4F 1OI7A 5AESA 3ZVRA 4OHVA 5E6SA 2I2CA 3LFTA 1TYZA 3LNTA 3LDUA 1PXWA 1W8IA 4QFBA 5IF3A 1KMQA 3KTAA 4O4HA 1BDJA 2GM4A 2N04A 3OF3A 1WZIA 4WN3A 3V33A 4DJFC 3F7TA 3KXLA 5C3MA 5HEKA 4YAOA 4XVRA 4HWSA 1EP3B 2OIGA 2V9CA 1QVRA 4PICA 1ZM4A 3M9XA 3C39A 4TUYB 2OXRA 5DO9A 2I1LA 1MQ9A 1PYOA 4KRYA 5DH9A 3WWZA 4FOPA 4DDWA 1P61B 2C7OA 3RFXA 2GV9A 5J5VA 3B8NA 1B6GA 2O0HA 2IQIA 4UVIA 1ORHA 4LP8A 4RF3A 3FG9A 3Q3CA 1H8EG 3K1AA 1FYEA 5CA0B 4JAUA 3FOBA 3WRXC 3EDOA 3BGVA 3QG5A 1TUGA 2X40A 3O4JA 1VE1A 2HK8A 2ZBEA 5IVPA 3JWHA 2IJIA 1U6JA 3G0OA 1V8ZA 1WSBA 4LHZA 3F6EX 1QR9A 5J40A 1QQ5A 2F1JA 1DIAA 3R65A 2O59A 3PPWA 4OF4A 1LPOA 3L40A 1K34A 2BI4A 1JEOA 4JAAA 4K8RB 1Z6XA 1X1AA 5EEGA 2PRSA 1NBMD 3EH2A 3UWOA 1NURA 1GYQA 5IBPA 1GGFA 4A7PA 2FW8A 4QGAA 1FPOA 4G26A 1TTPB 1RM5A 1JSZA 1W47A 4KVZA 1KJQA 4MS1A 2QL5A 1TEXA 4C4TA 4CM5A 1GKLA 5KQSA 1DMSA 4NEQA 1VOTA 3KBBA 1DAFA 1RM1C 2C00A 1O08A 3CPQA 2QNBA 3CE6A 5CLQA 2AJDA 4EVRA 4ZTZB 2YDXA 4AX8A 2DTEA 5G1PA 2M98A 1PWZA 5BSVA 1R5BA 3F7OA 2ZRMA 5KIAA 2W83A 3HR8A 2FMKA 4WH0A 1ORQC 1Z2CA 2J6BA 3DO8A 1U9ZA 4GKJO 4FLYA 3PGXA 4HRXA 2MT9A 2X22A 4R9VA 4E3ZA 1YULA 4RF2A 4QGPA 1U3LA 1FQWA 2PMBA 3CCMF 3PPIA 5BW6B 3QFFA 2W6IG 1K7YA 2HQSA 3PHCA 4R2JA 1BCRA 5AOAA 4FK5C 2ZCUA 4RHCA 4MWCA 4MA0A 1F9EA 2BFFA 2WJZB 4K0KO 4U7PB 4CR6A 3H1HH 1XTQA 4KO1S 1WTCA 4DREA 3S0JA 1WKVA 2JLBA 4NYJR 1KBHA 1M2NA 1L7AA 2HHCA 4H33A 1EFRD 4N03A 3H0EA 3ETEA 1KP2A 3H97A 4L85A 1LFAA 2YOFA 1SKQA 1DAOA 2C03A 4I0WB 3LYBA 5E9JA 1Q3HA 4XSGA 2F1IA 2FSVC 4CL8A 3AEKB 4AQ7A 3HSSA 1QHEA 1BS9A 2WHQA 1MAAA 4MICA 4BGEA 4XPIB 2GM5A 3B3QA 2OD9A 621PA 2FZGA 4V0OA 1VLHA 5IBRA 2FPIA 3W5AA 2WOOA 4B17A 1OCOC 4LGMA 3LJKA 3ZD9A 2EZ4A 2WKSA 3NUQA 5M29A 2OO5A 5AW0A 3GAAA 1QQ7A 5HTOA 2HA5A 3CNQS 4I50F 4WIAA 5FUWA 2Q4PA 3TQFA 5JXGA 4YCMA 2D8MA 1LPBB 3K96A 2V1DA 3EQ7A 1S8NA 4Q3NA 1ZN7A 1FDRA 1ZWLA 2SCUA 2CXNA 2WSSG 2XMRA 4YRRA 1GP2A 3BXPA 3FKSG 1EVYA 5KREA 4WCFA 1YJNF 4D97A 3I9NA 1SBIA 5K3SA 1F7VA 4UJ5A 1SXJE 2PUGA 1R12A 5K99A 1M72A 4BGUA 1GTVA 3DZ8A 2FVYA 3HXQA 1FYXA 3NC0C 4INPA 3Q0IA 1NQXA 3KR9A 3ROKA 1J1ZA 1CZKA 2R1VB 1XQ9A 4UOQA 3BFVA 2VBFA 3ELDA 2NLJC 1JA1A 1CLUA 3KKMA 1X1EA 2FFJA 1QIGA 2ACEA 2YVUA 1RP7A 3N70A 3R8XA 1FRFS 5DCYA 1RM0A 4OHOA 3HSKA 4ZVRA 1FFBA 3ZW9A 1U28A 1Q3TA 3TD3A 2RHLA 3ITKA 3KHTA 4DXHA 2RHBA 2DBZA 1RHKA 5THQA 3M4XA 3THSA 3GRAA 3OM1A 3AJ9A 2NU9B 2L26A 3KR0A 1WXDA 4BUZA 2A0LA 3SJAC 1GPYA 4KZKA 1CX9B 4BQEA 1YITF 4OHZA 4BEWA 5IPFA 2WYWA 3I0MA 5BRJA 1DAEA 4YRLA 4KEAA 1Y8QA 4JCCA 4KV9A 2NVUA 4K9RA 2RGGA 4QXPA 2BZ1A 3T7AA 2G77B 2W8BC 5GZ1A 1M93A 1NW4A 4IUDS 1E1RG 1PJ3A 4Y2RA 1L4LA 5A5FA 1ZK4A 3M6FA 3CH5A 5EIXA 1U2DA 2BM1A 3WLSA 1LK5A 3VYTB 2F66C 4B73A 4RL6A 2FN8A 4EY3A 4TRMA 1MJFA 4OP3A 4AILC 4G0VA 2ZXEA 1GV0A 1WUHS 3DDZX 3M1AA 5CRIA 4REOA 1GEGA 4PI0A 1CJVC 2NTYC 3FDIA 1XVIA 2BHSA 2HJWA 1P3DA 2I3DA 2OV2A 4CRWB 2AVNA 1ZD5A 2QP3A 4N82A 3C0KA 3O9VA 2X4LA 4F72A 4TRJA 4BLVA 1PW7A 3ZYZA 4GMDA 4O4IB 3F46A 2UXBB 1BDHA 5KOHB 5BORA 2BOBC 5EHIA 2PH5A 4E6PA 2AYYA 3DUFB 1QHTA 4RQTA 4N54A 2YXZA 2IXFA 2CNDA 2UUPA 1ZMXA 2OB1A 5JS1A 4BVQA 2R7LA 1W0JD 4AZ0A 2WHRA 1UOQA 1WU8A 4A03A 1OI2A 1SEVA 2CNLA 2HMVA 4BWFB 1EN5A 3I5XA 2XPCA 1OIXA 2RCNA 3ZW7A 2OBLA 2C2MA 3IBYA 2NUTA 1XLWA 2WSBA 1N6PA 3OTQA 1BAPA 5B1EA 1TYCA 2FAXA 1E2HA 1RYBA 4DNPA 1B8PA 1B23P 3ASUA 1B93A 4ZU3A 4BEJA 2VNSA 4H59A 1HNWB 1PEAA 1IYZA 4TROA 1D4ZA 1Q43A 5EGSA 4JJIA 3EMVA 1GIAA 1IV4A 4LZZA 1I24A 5FDFA 3EEYA 3SVTA 3DPSA 4LKOA 1ZD1A 4I4CA 4WLNA 4RIGA 3DLBA 2FUKA 4O2BA 4G63A 4ICIA 1VQOV 3FFMA 1CDEA 1HNZO 3W7UA 1VGQA 3VV3A 1L5LA 4IHAA 3H1IH 3ENWA 1IZ0A 3WKEA 4LQDA 3STWA 3HU5A 3MJHA 3WGKA 1K5QA 1OROA 1BH6A 1UIMA 4OKNA 2HCTA 5LYJB 1RI2A 4EZIA 8ADHA 1FXKC 1DL5A 2WK1A 2HPAA 3TIFA 4DIOA 1MEOA 1XT6A 2JZOA 1QBKC 1IWBB 4JC5A 3SF8B 3S02A 1LTHR 4XLLA 4AICA 3L8GA 4LYHA 1M1UA 2XNCA 3SFVA 1FZTA 1DQPA 4PA3A 1SCDA 4EW1A 5GAJA 1C3OB 2P9ZA 4L0CA 4X7PA 2IPOA 3ZMVA 3O84A 3ZHUA 1SOUA 2ZRPA 5EKUA 3RG8A 1XLTC 1SCBA 1YR9A 4HTAA 5D5HA 3ROZA 4IR7A 2ILMA 1AKMA 1W88B 5JMWA 1SCUA 2H4WA 2WY2D 1XEWY 1WO8A 4IO1A 1VQMV 1GRNA 3E83A 5EJ2A 3M3DA 4L8LA 4PIMA 3ZWDA 1Z4PX 1RBQA 1ULHA 2HT1A 1KAOA 4P82A 1E0DA 1ZEJA 2G38A 1UBJS 3OJLA 2FN4A 2EJBA 1EWQA 1PFYA 1ISIA 3CR7A 3FMFA 3DXXA 4MWOA 4DQ0A 4RJTA 2NGRA 4LK3A 4QTYA 1V5IA 4DYDA 1TCUA 1PF7E 1C3VA 3BILA 4MSUA 2MDTA 4LJ7A 2I71A 1NR5A 2ONKA 4YYZA 1UJWB 5B3SB 1ZESA 3ZOPA 4DW8A 2Y1CA 1T4BA 3VSAA 1AN0A 4G2TA 1E1LA 4TN5A 3EQ2A 5DI3A 3FFQA 3E9CA 2VAPA 2OHXA 3RTGA 4MYHA 5BUZA 1VQNF 1MEJA 3T4PA 5LP6F 2ORVA 1KRXA 1W581 2Q5QA 4FOLA 1FDWA 4DM4A 4XYLA 3BMCA 2AGAA 2E4VA 3TEJA 3ZHXA 3WLFA 3GGSA 1A9QA 4LNUB 4YRIA 3DBLA 4NYMQ 3CZ5A 1UXGA 3WP1B 4ZTUB 5JYCA 3QYAA 2VJYA 3R44A 3P9KA 1VQPF 2VZ0A 3A0UA 3MTEA 3SJQC 2X3YA 3AVXA 3CR3C 2WSYB 3C41J 3R3HA 3R3SA 2CGNA 4KG7A 5K20A 3MILA 1N4DA 3UOGA 4AYWA 3FGOA 4DV0O 1XWWA 1U0GA 2FEAA 2W2LA 2AB0A 3Q41A 3Q7QA 2Q7OE 5EIAA 3UOAB 3A2NA 2Q5OA 1U0EA 1KZHA 4X8HA 3GEBA 2YXYA 2YJ5A 1EX1A 1H38A 3OM0A 4W1QA 2J4DA 4CIBA 1MAHA 4H77A 3IOMA 4C6SA 2Y6UA 3K6RA 2XNJA 3HEMA 1N2IA 3DV2A 4U6SA 1X7PA 2X0DA 4BRWA 4I3GA 1XA3A 1E3SA 3CLSD 3O8OA 5C8YF 1UBHS 5IVIA 4J3FA 5E2IA 4UHEA 3LWDA 3UW3A 1YIJF 1T5OA 1C9YA 5LD2B 4R81A 1SZQA 4JI4O 2JFUA 3RH0A 3H65A 1UP6A 3N07A 2B6HA 4R2HA 1LBIA 1JG7A 1Q7YH 1GU7A 3Q9LA 4QNRA 1NVTA 3TAHA 3JQEA 1L7OA 2QYOA 2XMCA 2J6HA 3EIXA 2ZRAA 4YQFA 4QYIB 4ETNA 1F14A 3CMMA 1OHHD 3L02A 4UMEA 5IRCD 3VHXA 2Z6VA 2FUNB 1TVKB 2XOKG 4ZT6A 3ZDRA 1NBMA 4PYRA 3K35A 2N1MA 2RJ3A 1ZD2P 4ZMBA 1Y3FE 4LHWA 2JNWA 3Q8HA 3DLPX 2HF8A 1DEAA 4KDFA 7AT1A 4QNNA 1CD5A 5GY7A 1XLVA 1U0LA 2B7CA 1V41E 4XTCS 4M8IA 4OAPA 1DPGA 3UUWA 4YCSA 4XA8A 1WD5A 1KVSA 3AM5A 1V1JA 4B9AA 1TM1E 3H3JA 2O07A 4YRQA 4JYAO 3ETCA 4GD3Q 1UBMS 2IUSA 5KJ1A 1BQEA 3P0EA 1T2NA 1FVXA 4LRYA 2TMDA 2FXVA 1CTQA 4TMKA 2AG1A 3EB9A 2BFAA 2BZSA 1TMKA 2VT7A 2F1OA 2YC0A 2QNIA 3A6EA 5AHRA 3FPLA 4OHKA 1X9HA 2VDRB 1PSDA 4DSZA 3ZZ1A 5EJGA 3GJSA 3LXMA 2ONCA 4PZYA 1VE6A 5FL7D 1HV8A 3GCZA 1RYMA 2VTVA 3RSSA 2YY7A 4I9UA 1VI6A 1SCNE 2Q3BA 5E1AC 3I53A 6REQB 1FC0A 3VOAA 2CXXA 1JJ2U 2TMKA 3FHTA 3KAQA 3M49A 4RVGA 2PL5A 1R2QA 1FDTA 4ZCTA 2N0SA 3BVPA 4M1WA 4FK8A 2FHSA 5TC4A 4DLXA 4YPVA 1H2MA 1FX0B 4JVNA 3ZXUB 3MFYA 3DC5A 3FVWA 3CO5A 1LNSA 2XTZA 1AP6A 3MGAA 1CQXA 1OXVA 2GEUA 3CX7A 4R1UA 3F4LA 5DTJA 1G5HA 2OO7A 5L45A 1R15A 2QG6A 3DEHA 3EASA 3DHNA 2HLNA 1TB4A 1QLJA 1OH8A 4FS8A 1Z7WA 1SXPA 2B2XA 3RVLA 4RZXA 2CH7A 4FHFA 4RTSA 4B3SB 3REGA 5TS3A 3R5TA 2QNRA 5G2OA 3ND5A 1J8FA 1ZC3A 1YFJA 2VP9A 3LY9A 1HYBA 3AB3A 2CDBA 4YCJA 3CPEA 3KSRA 4BNGA 1MW8X 4TV8A 1T6XA 4AQYB 5JPDA 2CSLA 2Q9CA 3R0JA 3KVYA 4KXYA 1P7VA 3JQBA 1J2TA 3FTDA 1CXZB 5J1TB 3SYQA 1KYQA 5IFKA 3DF7A 4HQOA 1YMVA 2BR5A 3AESB 3T12A 3X2EA 1QH8A 3R7BA 4L8JA 3DZBA 3SWWA 2OTLV 2HRDA 4TXMA 2PO5A 4LHEA 1J5EO 1XNQB 2XB2A 4DK1A 2P5OA 2VF7A 3PVSA 2YXEA 1KI9A 3AR7A 1H9CA 4EGJA 2ZJ6A 1A82A 1NI8A 2DBYA 3JQ9A 1G2QA 2XH8A 5FUBA 4E3WA 3GJ4A 3KE1A 3LRXA 4BVFA 2DUUA 2J3DA 2FKXA 3AUFA 3NEJA 4Z0NA 1S3FA 1NMQA 2G9UA 1FP6A 2AJLI 3L7AA 2NN4A 3BFKA 3VU0A 4IJVA 4L3WA 2PUWA 3KWMA 4C4RA 4H1UA 1MHPA 4F3NA 1OW3B 1E6EA 4R2LA 3E61A 2J0VA 1G8GA 1UEIA 2NU8A 4EEZA 1PJ8A 1U8FO 3HNPA 5D5QA 1ZO8A 4X85A 3A9SA 3QXXA 4JZGA 5ALPA 4DXWA 3BKXA 3TB4A 2HWKA 1DOHA 1L7MA 4GE0A 3I23A 4OAQA 2YWEA 4C4SA 3HHEA 4L08A 4XM0A 2NNUA 3E20B 4RANA 2B2CA 5D85A 2E37A 1WY5A 3F9CA 1HUQA 1YH3A 2L18A 4EJ6A 1OZ0A 1DCTA 3BSSA 3VPAA 3LY8A 1JMKC 4X66B 5C52B 4J16C 1YS7A 1PL4A 1ELOA 4ZVPA 1DX4A 3RA6A 5DYWA 2H17A 4WCEV 2GPTA 1GN8A 1ND5A 5M5BA 4YT8A 4P32A 4W7IA 4QUHA 3MWLA 4HNVA 4R2MA 5I7OA 3ICVA 1A9RA 4MQLA 1VJTA 5D86A 3A6FA 3CUVA 4PS1A 3AMVA 4KX5A 4NZNA 1MO2A 4ZYZA 2AX4A 3UN1A 4I9FA 2ZI7A 2B1RA 1UKCA 2H29A 5CYOA 1K75A 2JCSA 1E2DA 1PR2A 4ZOLB 1KERA 1T24A 1NRJB 2QW0X 1P19A 3A6LA 3DFFA 2FOLA 4I9WA 1JQ0A 3HJGA 5KS2A 1H8ED 2P9CA 2QTLA 1EHIA 2IPLA 1EJ6A 4E5KA 1TK3A 3FKQA 4KN5A 1MMFB 5JUWA 4D9HA 1BSMA 4LRUA 3UC9A 1RFLA 1MU0A 3MJSA 2PJRA 3HGTA 4YT5A 1AY0A 5L6LB 3MXOA 2JK0A 2CTWA 1DGSA 1Z0KA 5HZGA 1JTFA 3ESAA 2VPTA 2PT9A 1X19A 1P7WA 4ARBA 3GC6A 2D1YA 5AW7A 1USGA 3LNCA 3CG6A 1PX2A 3WNVA 5AOCA 2YEVA 1I0LA 2E55A 4E46A 1NAHA 4I55A 1LSUA 5HOQA 1IZYA 4A0QA 2XZDA 2PVPA 3DAOA 2ITDC 3CSDA 5A1TA 3S3TA 1GPKA 3U9TA 1SBYA 3DV0A 1I3CA 4D5GA 1G3QA 3L6UA 4QYXA 1XALA 3GQVA 1T5IA 4OHUA 5KOJA 4PZCA 5F35A 3OZIA 3AY7A 3ZHVA 4XR4A 1Y9ZA 1QTRA 2VTBA 4NTXA 3FWNA 1WCXA 1MH1A 4BZXA 2ATKC 3CC4F 1ULZA 3P2OA 4NY1A 4H18A 4DV1B 2ZAIA 5AJYA 2CLKB 3S6JA 2PZLA 1XWIA 4H4CA 4CG3A 2F62A 5KPJA 4FZVA 4ZEOA 1YOVA 2ZE5A 5K7SA 3SXJA 3TZKA 1QNFA 2P2NA 3R6GA 1U80A 3SPXA 5ECWA 2BW0A 4RA6A 3NOOA 2W6NA 4D2IA 4UUNA 2HS4A 1VGVA 1Y4AE 3YASA 5B5EZ 5SY9A 1ZVKA 2W6ID 5FB3A 4FZ3A 3RBXA 1ORVA 1IV2A 3L7DA 3E1SA 1O6GA 2FR8A 5B3JC 1Q19A 1G4UR 4YMIA 2H3OA 1Y8RA 2PGLA 3U3KA 3IJPA 5B1BB 4OQPA 2G9NA 1LS1A 1IK4A 2PZSA 1Q5PA 2N47A 5IZCA 4L8FA 3NHUA 1TFRA 3BKWA 3I76A 4WXHA 2QTVA 1P0CA 1WD7A 2YJNA 1Y3IA 2HLHA 3U13A 3RFFA 2KE5A 2P5SA 3I1YA 4J75A 4Q37A 4ETWA 1AKRA 3LOQA 4FDAA 4BTEA 1LVHA 3A4VA 3QMMA 1KZ9A 3N28A 5BV8A 3JYLA 1OAOA 3TSOA 3OTOO 3TOZA 3O7MA 2IS6A 1XGKA 5BVHB 4ZHSA 2F93B 5HZMA 2OIEA 2OTMA 1QU3A 1R74A 4HLNA 4ARUA 2NTJA 3ABQB 2W2KB 5JY1A 3PD0A 3D7MA 1NVUQ 5C8DA 1I7SB 3FB7C 3DTYA 3LGSA 4MW9A 1DFIA 2Z3WA 4JB0A 1J33A 3RAEC 3MIIA 4KMRA 4YVFA 1QKJA 3WFIA 2JJ2A 1ADCA 2WSSD 1E1CB 1XRJA 2JLSA 1MO3A 1IDSA 3NCTA 4RD4A 1J2UA 1F2DA 4ZCRA 3FKSD 4CQLB 1A7KA 4BR6A 5B12A 2DT4A 1BDIA 3NH9A 1D2AA 5GM2A 1MA0A 5CA1A 1ANKA 4GP7A 2GSWA 2O2JA 3VR4H 4CG2A 1T9ZA 2IXAA 3NKVA 3R7NA 4GMHA 4RZ2A 1SCIA 4DIBA 3AVPA 3QSYA 2JKVA 1DIHA 4KNYA 1TK2A 3O38A 3E3MA 3CC7V 1T36A 1U7XA 3LXRA 4W6ZA 1HURA 4B7AA 3GLFB 2H2WA 1NQVA 3UT5B 2NXWA 1VYTA 3JQ7A 5GIPC 2Q73A 2V7QG 4EFKA 2XUZA 3QUTA 3RVBA 2PZGA 3HDHA 2KMLA 3N2EA 2RH5A 2YZNA 3THYB 1ISGA 1QHHB 3T7TA 3T0GA 1FMFA 2XAJA 4E21A 2J45A 3F0FA 1GJRA 2I1QA 3W2GA 5HS6A 1A9PA 4EJSC 4QLAA 4X6UA 3UJCA 1N0IA 1YS4A 3F67A 1CY6A 3ZBTA 1RWXA 1ZW1A 3I6MA 2ZFUA 3S3XA 4UZEA 3SHFA 4UTNA 4TT3G 3AHGA 1RLOA 4L78A 2LDBA 4NYMR 4JSTA 4GPZA 1E1RD 3FVRA 1U7OA 2LRHA 4YACA 1I5YA 3SN6A 1QFXA 3CD6V 2NZVG 3C6KA 1SC9A 3IPYA 3LP8A 5C0OE 3K8YA 4CUKA 2OECA 3O5AA 2DJVA 5DP1A 2IIQA 5AUPB 1EUDA 5HP8A 3ZRSA 4GMXA 4FYYA 1OA0A 3M1XA 2J9FA 3V2UA 1IY9A 4P1ZA 4N8DA 3O1LA 4R8VA 1KGDA 3UB4A 1Z7BA 5A4FS 1SWWA 3GYBA 5EZSA 2AF4C 2Q46A 2ZJAA 3EVAA 4CL2A 1WXWA 3I2KA 4ZV9A 3O31A 3CLRD 3FIJA 1O0SA 5EP1A 3RO7A 3TJTA 3BMQB 4AF7A 5KWJA 4JLSA 1RJEA 3ZD7A 1Z5PA 1EP2B 4TTPA 1IQRA 4UCFA 1IBSA 1RWNA 2QPAA 4ZYTA 3MZ0A 2XBMA 4ZHQB 1V47A 1FPMA 1NVEA 4B33A 2R6FA 1DV1A 4HJRA 5C80A 1J7JA 2DWUA 1NASA 2D5AA 5HW0A 1OB2A 1CRWG 3STZC 4HRVA 2UU9O 5AKIA 5LB2A 1KMHB 2GHIA 3SYAA 2DECA 3EBPA 3B6JA 1B6QA 3TETA 1JFFA 2NSYA 5LJLA 4B3MB 3E9DA 3QE2A 1U8CB 3RYCA 2A1UA 1K5PA 4H13B 3CR8A 1BIFA 3JRXA 2VQDA 3W2EA 2PBZA 2PRZA 2FPOA 1GA6A 3MA0A 3UQZA 3PD1A 5ADWA 3WSVA 3CPSA 1M1YB 3ONDA 2Y67A 2PMFA 2GZHA 3MBKA 1FJGO 1XNRB 5L3BA 2WTBA 5DN9A 1TYBE 4F45A 1QF7A 2WSIA 2I6SA 4OFXA 1XAGA 5HZHA 4YAJA 3BD7A 1PK9A 4AJIA 1E7RA 3LGAA 2Y0PA 2C3UA 2HGSA 3FX7A 1I3MA 5FBWB 1GWNA 3CKYA 3IR5A 1JKIA 4YJGB 4KXWA 4AULA 3RIYA 2D1TA 2JEXA 2VKTA 1QYXA 1RP3B 1SHLA 3OX1A 4E1AA 1US6A 1QIHA 2JVKA 1RBYA 3FYUB 4MWGA 2QJTA 2VQEO 3RC3A 3M6WA 4WBXC 4MK4A 3DOEA 3JSXA 1B1AA 3WA7A 3IBSA 1RBZA 3B77A 4K87A 5JS8A 1JQJC 4B0PA 2WFMA 3DCYA 2VPWA 5E2BA 3FZGA 3UJ6A 3I2FA 1XZJA 3OFNA 3QUWA 4J49A 3EVDA 1T1SA 1ZWZA 3RREA 2B78A 4Z7QB 2QKCA 3MRSA 5HP7A 1BJKA 4BJ5A 5JLAA 2C3PA 4LWSA 3A4IA 2ZG6A 4EJFA 4XX0A 2DH6A 3GA0A 5JDIC 4UKDA 4ZVVA 3FOCA 2YXBA 4YASA 5DT2A 1JDSA 1Y3DE 4CLOA 1RIIA 4C0JA 4DM7A 3K0FB 1J25A 3M7MX 1YUBA 2R65A 4L15A 5CVDA 1ESCA 4YI5A 3GWGA 2C98A 4PQEA 4DVJA 4U0KA 5AM3A 2JI4A 4URUR 2EQAA 3B6NA 4UEKA 2GKSA 1L3IA 5CT5A 2HB6A 4KZPA 1JKFA 4MA4A 3D4IA 5LIPA 3GLQA 1O0CA 1K8AW 2IYOA 4IXNA 1XNJA 5MN4A 1O94A 1P3Y1 1WXIA 2A3NA 1GZ7A 2GVDC 1YI8A 2C99A 2XBLA 1CP2A 4AAYA 5JJKA 1CVIA 2Q29A 4PAGA 2PPLA 3MUOA 3RIEA 2LGQA 3LUDA 3OCZA 2H5EA 4BO8A 5DZSA 3LA6A 4LJRA 4CDMA 1DTSA 1AIPA 2OEPA 4RVDA 3TEMA 3O85A 2D5IA 4HFJA 5AI4A 2RDMA 1SESA 4N3CA 2X4IA 3WQBA 4DR3O 1ZUNA 2HJFC 2HO5A 1E7YA 1ILWA 4HZIA 3GDFA 1JH9A 3IAAA 2Y1OA 1CVRA 1RQRA 2XTNA 4EARA 4J76A 4LJYA 3RU9A 4DT1B 3DH0A 1Z15A 2ZB7A 4RLFA 5CB0A 1RXCA 3OJFA 4UVAA 1KK3A 3LDDA 1J1IA 2RGRA 1TYAE 4I4TB 3PGA1 4GYYA 4DABA 3CQ9A 1GPJA 1UM8A 4E14A 6CHYA 5LZ9A 1MEEA 1CIVA 5EHQA 1YI1A 2G6TA 2C2KA 3MAJA 4BNKA 1BWRA 4RSRA 2EZUA 3FTQA 3OZTA 4ALKA 4MV0A 4S0XA 1R64A 5HQTA 3FSGA 2R1TA 4F1WA 3II6X 1B41A 4JT2A 4WKNA 4BMNA 1A8PA 3ZX4A 1UFKA 1VB3A 1XVTA 1L5VA 4W5QA 2WM9B 5HDBB 1O4WA 3DLCA 3KJNA 4YP9A 1BMQA 2J5BA 3C15C 1JKJB 1H8EA 3AHHA 4LFAB 2ODBA 1T9CA 3ZJTA 1U6IA 3AUSA 3SJBC 4RGYA 4RY9A 4Z1MD 1ZOOA 3RC8A 1JVMA 3ECCA 2ZR3A 3DMGA 3EFBA 2ZIMA 5FBHA 5ICFA 4JXXA 2PXAA 5EG5A 2EOAA 4JQSA 3ED1A 3BUSA 3OQIB 2EX3A 1GPMA 2W6ZA 2DLCX 3HFRA 3LBIA 1FIUA 2XOKD 1NI4B 3CPWU 3TAXA 1K4MA 4X1IB 4AURA 4CNQA 3I62A 4KR6A 2C7BA 1WVGA 2PGDA 3RRJA 4X1YB 4OXSA 2OM6A 4MPJA 4PLWA 3CCEF 1XYVA 3PUIA 3VH3A 3R7WA 4PBTA 4IFBA 2FX5A 2R9RB 5DHTA 2JRCA 2PEZA 3QP9A 4C7JA 3D3QA 2GUZA 2C2AA 2FSSA 1W1UA 1CY8A 4JJGA 2HFKA 4BLTA 1JFSA 1VQKV 3H8JA 2C57A 1LD3A 5DEIA 3KLOA 2UXDB 4I5FA 2N05A 3SYCA 1JHAA 4IIJB 3T9BA 3X3HA 5JAZA 2KI5A 1NHGA 3UUFA 4I6JA 3P2KA 2FWIA 3QITA 2OHHA 2W0FC 1AKNA 2XB4A 1NM5A 2A9RA 4X3CA 3ZJYA 1SU4A 3LUBA 2GH1A 2HRBA 3GRCA 1ZXBA 4OQZA 2NIPA 1WAZA 4NH0A 3K20A 3A4LA 1GRQA 4JGBA 2XUPA 3W1VA 4J0KA 1RXUA 1UM9A 4OH1A 3BCHA 4OI2A 4FLXA 3G8BA 4PFJA 3HJFA 5CA0A 1NLYA 2W6IA 2ZRBA 1B74A 3RE1A 3KKNA 3BDAA 4EHDA 3L05A 4LYEA 4P3YA 5KZMB 1BKDR 1WJGA 2GPJA 4FFNA 2ZB3A 5HGXA 5LZ4A 4W1RA 1HT0A 4R2KA 3NGMA 4MUAA 2DFKB 4LIPD 1P9RA 2IAFA 1ZUHA 5EQFA 1EH5A 1R4ZA 3J81N 2PI5A 2XXBA 1M5RA 3PLAC 5EKTA 1N1MA 2Y4UA 3U60B 1IDOA 5BW5A 1OOEA 4DG9A 3ZE2B 2RK3A 1ZOPA 3DG9A 1YF2A 3TQHA 2I2BA 4WFQA 4S12A 3JCUZ 5FPTA 1A7JA 2IH1C 1F2VA 3CPWF 2WIAA 4JL8A 1VFNA 4X20B 3VKHA 1Q95A 3C16C 4N18A 5CP8A 3KQUA 3PFNA 4RAOA 3WGUA 2J48A 2XSZA 1WF6A 2WHEA 4BKUA 1XZIA 4KVAA 1RA4A 2R25B 5GQSA 2BFEB 1SIBE 2W71A 4I1UA 2E1RA 1RZ3A 2FA9A 4CN9A 1P6UA 3VR3A 4U02A 4BVHA 3VYVA 2X0FA 3FMGA 1YHQV 4W7SA 5DM1A 4ZVMA 2WF6A 3GJTA 2W5UA 3K9AA 1ZWIC 3SLKA 5DSTA 2IH5A 2R8XA 3K1ZA 1GD1O 2HBQA 1Z0ZA 5IJWA 3UJHA 1UMCB 2WHPB 3K0BA 5GOTA 3WIEA 2VHUA 4D9IA 1ZCFA 4B84A 3C48A 4LF9O 1YKFA 2P2CA 1F2UB 1N2CB 3BJMA 4GZ3A 2EBUA 3LQKA 2BOCC 6NULA 4N7JA 3N2KA 4FMCB 3EG5A 1ZJZA 4KMMA 5F21A 4UPDA 4G27B 1SXJA 1Z0IA 3E7PA 3QZUA 3WFZA 1MDBA 2NADA 2IQQA 5E7JA 2H1IA 3OZUA 4NC9A 3IQWA 1JVNA 3SYNA 3NAGA 4LDQA 5AVKA 4XYBA 2NO4A 3INRA 2PKXA 4QRIA 2BDUA 3Q6NA 3ETHA 4KQEA 3W4KA 1M83A 1DGQA 2AOUB 2A3QA 1F6DA 5CW2A 2Z3YA 3AEKA 1POXA 3CFYA 4EK9A 2VWPA 1R0WA 4BNNA 4GQBA 3JAKA 3CUUA 5JBQA 3ENNA 4B4OA 4DUZO 3WDMA 4IDFA 3ZDBA 3R5KA 3DE5X 1RADA 1VLLA 5BMVF 2E74B 3FETA 3BWYA 4NVRA 4BX3A 2X0JA 2DWDC 1LQ2A 3EIUA 3B1KA 4BFWA 2XECA 3A1UA 3HFSA 3EC2A 4DCUA 1FFYA 2G09A 2F23A 3DE3X 2B99A 2VYND 2EF0A 5GTIZ 1CRLA 3SHQA 5B6JA 3CXHF 4LY3A 4RDXA 2WABA 4HGOA 3H2YA 3HDJA 3T9AA 2JVDA 3D54A 3OZCA 3M6UA 4N0MA 3HKCA 4CI0B 3QXJA 5DGXA 4DMMA 3HB0A 1NJIH 1JR3E 1KFCB 4EG3A 2IRWA 2DHEA 4XYMA 1RWWA 4LF4B 4F11A 4UNQA 4RKWA 4AP5A 1QHGA 2XJ4A 5CW1A 1R6UA 4B0OA 5D2CA 3RB8A 3F0GA 3HPLC 2PZBA 1OX4A 4BDTA 4F2HA 4JLAA 2P5YA 5BR8B 3WLQA 1JGTA 2HCRA 3TH5A 3FZQA 3F96A 4NE7A 4WHMA 1H6DA 3ZGLA 1STOA 1VLVA 4RK4A 1O7JA 5A2QN 2VWHA 2ZVYA 1UZLA 3IXLA 4MT8A 2PGAA 1MA1A 4YJKA 4G37A 3AEZA 8AT1A 4MW8A 2EXXA 3FAZA 5E1BA 4EBBA 1IHOA 4UCSA 3VO2A 3I04M 1HDIA 3KRTA 1ADFA 1SVWA 1AB6A 2O1SA 2WB2A 3TXXA 4NECA 4WKBA 5JFTA 2C3MA 3ZCPA 4I99A 3GU3A 3VJKA 3FHCB 3NYWA 3ESJA 2FDRA 3H5VA 1JS1X 2YQ5A 2VP5A 1HETA 2WV7A 4MB6A 1VPLA 1AJPA 1P9OA 1Q11A 2JGJA 2FP4B 2JCGA 5D8DA 3ADDA 2CLEB 4HNTA 3CCBA 3EFHA 4LNHA 1ZAYA 4GSKA 5SYMA 1MQSA 1CHDA 1N36O 3OU6A 1RDFA 2B1GA 5C1DA 3QBEA 1VJDA 3INNA 4H3KB 6ADHA 1Y8AA 1K1EA 2K6GA 5DGHA 1S2GA 3JWPA 3NFRA 4ZAGA 3BDIA 2FUG6 4AROA 1BWQA 2IGTA 4WNAB 1NATA 1UOOA 2PKCA 3C24A 3O8BA 4UV8A 1MC8A 3VYWA 2LJ2A 1TE2A 1PR1A 1UBFA 3S2GA 4UBJA 3WO1A 1DJLA 1FX1A 4REQB 2C83A 1IHXA 2EIJC 4AN1A 2ZBVA 1ZAUA 3WGNA 2OC4A 4R1SA 4NARA 2V7UA 4MKIA 3VQYA 2JFPA 1QCYA 1MP0A 2OFPA 3ZR4B 1EM8B 1G21B 3WMRA 2YOGA 3TUZC 3H9JA 4OB8A 3B12A 3WX0A 4OM7A 1K98A 2OTCA 1A9ZA 3W5SA 2OCBA 2ATIA 3DEKA 3Q15C 1H3NA 3HR4A 3PITA 5DTIA 2VUUA 2J32A 4G28B 3CLTD 2FPPA 5IJZA 3TXQA 3LK6A 5ENZA 4FVTA 3UZUA 1ZHFA 1KQSF 4JVMA 4UVHA 3PEFA 3LIPA 2QJ1A 1BMFG 4JR2A 3QELA 2YIMA 3DFUA 3AG1B 1W4RA 1DQNA 5DTEA 1Z75A 3GHHA 1E4VA 1W5BA 1GGKA 3IEKA 4G1BA 1DLBA 3FHOA 4HN2A 4E07A 2C7VA 1AC5A 2AEEA 4BNJA 5A4IS 1TVEA 3FPFA 4HLDA 3OEWA 3E18A 1JB1A 2IHTA 1BA3A 1OI3A 4YRJA 4YMHA 1RHMA 3QH4A 1HT2E 4QTXA 4ZJYA 1ECCA 3RIGA 5J5CA 4IMPA 1OAPA 2JGUA 1GG8A 5FNVF 3QW2A 4PG8A 2HEPA 1VLZA 2OP1A 2P67A 4JXJA 1R0SA 4PHZA 2PUTA 2X8JB 4X63A 2CLFB 4JT8A 3QLUC 3VTZA 2H59A 1A5BB 4YAEA 1IQ0A 5B37A 4ZOCA 1PUXA 1D7OA 2PVCA 1UT6A 4RE6A 5K8VA 2V7GA 5G3ZA 5H9WA 4PSKA 2VA8A 3LSSA 3CCFA 4QJFB 3QGMA 3ISJA 4P0TA 2WA2A 3LDCA 4Q3AA 3VMFB 1CNEA 4YR9A 1G21E 3A1WA 1GM8A 3EG9B 4N41A 3U0VA 4LFBB 3G13A 2IXDA 1Q7BA 1XD8A 3N7AA 3LVRE 2D7DA 3RM3A 4UAVA 2DMRA 4HH0A 4CKBA 4CBVA 3FBTA 1ZSNA 3CNNA 3M5CA 1EVJA 4J3JA 2ZXWB 3E7DA 4TLLB 3UBMA 1WXFA 3KKQA 4BRUA 2AMLA 5J3JA 1J2RA 1VHLA 1H9AA 4DTCA 5LQSA 4A2WA 4DMCA 3GOQA 3U17A 2FRDC 3IBGA 5CURA 4J11A 5D84A 2H4YA 5LSAA 4LRWA 3HA7A 2WJ6A 1Z37A 3QNMA 4JI5B 2WPDA 1I4OA 1Z5WA 1X8XA 5DU2A 3VZBA 2V7QD 3EC7A 1II0A 1TC2A 3FGNA 5ALQA 1M0TA 3U5ZB 2VPYA 1QQBA 4UC0A 4HNHA 1YR2A 3E15A 1RQLA 5T4HA 2GT1A 5KLVH 3COYA 4U5XA 2VUHB 4EQ6B 4Q4AB 2ILVA 5AVXA 4LWZA 1RPOA 4TT3D 4YP7A 4M9UA 1Y66A 3BY6A 4PAWA 5FJJA 5EIHA 3HL4A 3LMEA 4X9QA 3ZJ4A 1GTL1 5I4IA 3CJHB 4LE1A 2ZRKA 2O05A 1QIMA 2GN0A 3DEAA 4QPJC 1AJQA 4LSWA 4P93A 1TEHA 4PA6A 4GGPA 4X71A 3TCNA 1YAHA 4CCYB 2OCXA 5GGYA 4F8EA 3LHFA 4LNUA 3U0ZA 1W30A 4RVFA 5LBQA 3P9IA 4GM4A 1K2VN 3VU3A 1WF3A 4ZDJA 4KE7A 1NFQA 3F7NA 4U3JA 3BGOS 3V4OA 1WETA 4TVSA 1O95D 4Q47A 1EB8A 2WW8A 1DCKA 3TLZA 1NNI1 1ITZA 3WAGA 2QXYA 4ESVA 2J5QA 1N2SA 2C82A 3PKZA 1YQNA 2QZZA 2FPSA 4FYWA 2P27A 2GLUA 2GJ8A 2B6NA 2CLHB 2IVZA 3MF4A 1LA2A 4G9BA 2C2BA 1M1ZA 3S8EA 3AF6A 3JTEA 1E6CA 1HKHA 4ZQEA 4B87A 3WDSA 1TVMA 5DB4A 1VQ7V 5BRAA 4AECA 4PIVA 4OA5A 2Y4NA 3KVNA 4LXXA 3UMCA 2Y66A 2ZYTX 1E9BA 4JZ2A 3SYPA 3PDCA 3SYRA 4F71A 5T64A 4FIZA 4PFQA 3BXHA 1H69A 1Z63A 3OICA 4MR7B 5KX5B 1UKYA 5LL6P 2JD1A 3PJFA 3ID6C 4DG8A 5FAXA 1UBGA 3L49A 3GVXA 1PN3A 3OIFA 1X39A 1JILA 4AXXA 3REOA 2NXJA 5IJAA 4NCHA 3C90A 3F3YA 1RYZA 1QRDA 2YVQA 4KQWA 2GVIA 1FDSA 2NV0A 2VQFB 4HX5A 4BVAA 2RB9A 5TDHA 5B1HA 3Q2IA 3OUSA 5HXUA 3RE3A 3OIUA 1QE5A 3UKMA 3WGVA 3ORFA 3H2ZA 2YX1A 1AU9A 3A9TA 1WCWA 3C5EA 4EHBA 3CEAA 4X1KA 1PFWA 4Q21A 1BW9B 2ZJ7A 3VPXA 1SUCA 2XE8A 3JX9A 3K9HA 5LMUB 4DJEC 5EYPA 3SIPA 3KQOA 5M04A 2ZSFA 5E4TA 2EWWA 2F1HA 4D57A 5I4CA 3FVQA 4RZUA 2IYFA 2WIBA 3SAJA 5DASA 1KIAA 5EN4A 4YGXB 4IUCS 3HJNA 4LMBA 1V7CA 3GGJA 2JGLA 3W78A 3OONA 2CFOA 3SJCA 4X64B 3EEFA 3OZWA 5KUMA 5KOIA 2C5BA 3WLAA 3CVYA 1QNMA 4OIFA 1GTZA 4P0PB 3SDZA 1L7DA 4R8RA 3V4ZA 1NV9A 3R77A 3CCQF 3HYLA 5EIBD 2WWTA 4MR9A 3CRMA 2FLVA 4BMDA 2WT8A 1BEZA 3TD6A 3TLBA 2XT0A 5LPNA 2VUTA 4EI7A 3GQBB 5JC1A 5KNBD 4O5AA 3F78A 4KQ1A 4MW3A 2HA3A 5TMPA 3U7IA 4UXIA 1CUFA 4KQ6A 2QUHA 2IOYA 1T1JA 3MDSA 4Z1MG 5KQPA 4N1AA 3MTQA 4NTYA 3BSYA 3EXHA 2Y9PB 2O20A 2YN2A 3K9WA 4NCNA 1X8LA 4INAA 4I81A 1G5FA 4DR7O 2AZ4A 3U9LA 4A2CA 5IARA 2FQXA 2BTQA 1G1MA 2JFQA 3G0DA 3UTDA 5HKBA 2W2PA 5G53C 2PCLA 4U00A 3SMVA 5K0EA 4ZI7A 3WXMB 1JEQB 3Q4HB 4K2HA 2ID9A 4U39A 4QGGA 4U7WA 2ZITA 3IJ5A 3HG7A 4RTJA 1KMIZ 3ZGVA 3A0HZ 1DZ3A 2ZBQA 3CCCA 1FP1D 1YDFA 3C6XA 3QPVA 4F93B 1I3KA 1PP4A 2EP7A 5BQ3A 4S3MA 1CKEA 3A9WA 5GTHZ 1UOEA 4L8WB 1FNCA 2VYNA 4URYR 5ILGA 3WTBA 2AG0A 2BL4A 3KPJA 3R5XA 2GB4A 1CXZA 7MDHA 4LSZA 3TMAA 2LDXA 1SRYA 2IOQA 1GDTA 3AESA 1VKRA 5JZSA 1K4CC 3P20A 4AF8A 5FFFA 1AQNA 1SMKA 4JTCB 1E3TA 3O91A 4I1PA 2VRBA 1EE9A 3SR3A 1OLUA 2HM7A 3S70A 2O2GA 2P6NA 2ZSEA 3FUTA 3ENKA 5JZOA 2Q5JA 3EGDA 5CBHA 1OLXB 3E22B 1WZUA 1T4CB 2XQIA 1CERA 1ZX1A 1YZTA 1S5PA 4D0RA 4MA5A 1NKTA 3EBLA 4KO2S 2QGFA 1N34O 3LCUA 4NV0A 1EFRA 3HCDA 1YDHA 2PX2A 2ZB4A 2R7KA 4TQ9A 4DSTA 1BKSB 1KI6B 1Y1QA 3WLOA 3N0XA 3FYSA 1AF4A 1EA7A 1P0MA 2WG2A 3OD4A 2O23A 4IEEA 4M1SA 1L5NA 1D2CA 5FPOA 3CBQA 2B7LA 1L2TA 1OCEA 1EZVH 5E38A 2AG8A 1L4YA 1ULTA 1DIOB 2IYLD 5B1DA 3TSAA 2CLIB 5DKFA 3QY0A 4GLXA 1V8OA 2YI8A 1LTKA 3QPAA 1WBDA 4OX9Y 1ZNQO 4ENPA 1HNXB 3TLEA 5JATA 4KGDA 1L7VC 1E5TA 5ITZA 4IHJF 4QM6A 5GM1A 4Q4DA 2VWJA 2C2XA 2XGSA 2VJCA 4Z86A 4OJTA 3WGLA 4B81A 3JATB 5CDTA 4HG2A 2C07A 3HU3A 4TMFA 5DMHA 1OYVA 1Y3BE 3GCGA 1LR1A 4QOHA 5CTJA 4QEDA 2II6A 4V3BA 3QK7A 5F7JA 3GLUA 2QLNA 2JLQA 4WACA 4FYHA 3FNRA 2YCLA 4R01A 3L75H 2VI5A 1MF7A 4QUAA 5L7YA 3RS9A 2CB9A 5JTUA 3A3YA 1TGYA 4GH5A 5EWMA 4MAMA 1JHYA 4Y67A 5HHTA 1I8TA 3I1JA 2JGDB 3RCBA 4OMFG 4MTCA 4D8VA 4EX6A 4LH6A 1N7HA 1FFCA 3OT1B 5L53A 2QZSA 1H05A 1TUBA 1KHHA 5A9SB 5KSYA 1HE2A 4WKGA 3L92A 4J1SA 5KOYA 2CL7X 1F7YA 3WLKX 2FMUA 4OEHA 1YB5A 1AD2A 1UPUA 5T6MA 2HYIC 2RHHA 1CDZA 4BNWA 4A4DA 4G81A 1H8HG 3V1NA 2JEOA 3LWPC 5ICSA 5L3QA 1JQ3A 2XAAA 3OEHG 2CEAA 4MWTA 5CYGA 3LRTA 2HR1A 4LYYA 1ZD4A 3UFBA 2ST1A 5FA6A 3G0IA 4CIAA 2QVLA 5A05A 1IEQA 3C3YA 4UUAA 5IKPA 4C29A 2Y77A 3FDJA 2JLZA 2H1LA 1Q15A 4BOYA 5IJ0B 4F7WA 1SVSA 5ARBA 2Z0MA 3OD5A 5JCZA 5KU1A 2CJXA 1K7DA 2Q1SA 1XMSA 3DR5A 4A36A 3FUVA 1GCAA 4LDAA 1CQJB 2P1ZA 1BX0A 3KOWA 4BZPA 4RMHA 4GI1A 2IUUA 4F8YA 1CB0A 1A04A 5AO9A 5IHXA 4EO7A 3OIVA 2ZU6A 2IXTA 3RNLA 2D3OW 2PUCA 4L4YA 1VQ5F 4RTNA 1UDXA 1JQ5A 3N2YA 1YFZA 3KEFA 4UU1A 1JXMA 1HDOA 1PR3A 2SICE 3LC0A 4URWR 2FK8A 3IR7A 3P9YA 3CVUA 3KJEA 2J5RA 2CMFA 4AY6A 3L7NA 1TEZA 4UAGA 1AV6A 1U2TA 1OCZC 2JAHA 1V54B 3BMOB 4C30A 1TQ2A 4UBOA 1LTQA 2R8RA 3HC7A 4QJ4A 4TMWA 3U7RA 3BXEA 3L46A 4H1VA 3UMFA 1GTRA 2FB9A 1IEWA 1TTTA 3TTTA 3SXUB 1BHQ1 1W0JA 4FYJA 2M7WA 3IEXA 4S2EA 2DB3A 4NZ9A 3OUTA 4XARA 3HA3A 1ARZA 1KF0A 4W5RA 4RU1A 2ZR9A 3N3AC 3FI0A 2YNMC 2V55B 4C4XA 1VJ0A 3G5MA 1MMMA 4YJ3A 2XXAA 1WR8A 2V7QA 4CC6A 5A5DA 2VLIA 1I6WA 4CQJA 1SBCA 3O2NA 4BX8A 5EWJB 4EZBA 1CF4A 3CXCF 3PX2A 3KTDA 2YVAA 2QX8A 1H2KA 5JAUA 4RESA 4DMFA 3HAXD 4FFVA 1RR6A 4C6TA 4NR0A 5BVHA 5IE9A 5AXDA 5E4YA 1M2GA 2CWDA 1KJWA 2GBLA 3DKKA 4MDFA 1Y4SA 2X3UA 1T8WA 2GPYA 2RJNA 4FD3A 1W93A 5LQRA 2CVLA 4XUGB 5EC8A 3I42A 2XGOA 1M7GA 3UPUA 1R0XA 1W96A 2YH2A 4EDFA 2JLWA 1Q6ZA 1JR3D 4MIOA 3CBGA 4TL7A 1E1CA 5ALMA 1VQLF 2HVYD 4FZ0A 1Z4QA 4JEHA 4EW3A 2IBSA 3M8KA 5EQDA 4ZEWA 1G3MA 5HQJA 4CQLA 2I6TA 1BHSA 4RABA 3GI1A 4B6FA 4MW1A 3WKBA 5K3EA 3T5MA 4NE2A 1RW4A 1JT9A 2E4AA 1CS0B 2BM8A 5DM60 5EE5B 1C8KA 3M5WA 3C5CA 2ASVA 2HSEA 2PPVA 3SLGA 1JQKA 3VJLA 5AW1A 4TLAA 5CDFE 3KL2A 2HA2A 1P8AA 2FPXA 5BQPA 1XDGA 4YO7A 1K4DC 4C7KA 4IWYA 2E87A 2VYCA 3UWKA 4JX8A 3AF3A 3DW1X 2QP4A 4HVLA 2YWDA 1XKXA 4BNLA 4AC9A 4CG1A 1TUEB 3HTNA 1ZD3A 1NNEA 1PT8A 4AIIA 1KIMA 5H83A 3H2JA 3AHDA 5TS2A 1JXQA 2E7ZA 2X8AA 4ND3A 2PMWB 3THYA 2PR7A 2UYCA 3TDKA 1RYHA 3HCEA 5PNTA 3GMSA 4GOMD 4O6VA 4ECEA 4LX8A 2HEGA 3B38A 1BGYH 4FILA 4WBNB 5TQ0B 4GPD1 4D8UA 4L3OA 4EIWA 1EX6A 1AX9A 1EUZA 1VJ1A 5A6SA 5AKLA 2DUMA 5EEHA 1O96A 1NVKA 1D5NA 1JDPA 5KHJA 4O4JB 1CE8A 5AP9A 1XNHA 3WLNA 3R9KA 2AFHB 1H22A 2YYYA 4ZAZA 3K9SA 2HHLA 2C4WA 1XHLA 4RMJA 1TW3A 3ZIAG 1WG8A 4B3TB 1SBZA 2XF2A 3CE9A 4ENUA 2CCJA 1SZJG 2HIMA 1UFYA 4F9EA 3FTFA 5KDOA 1AG9A 4IDAA 4FCVA 3QUQA 4Z51A 2CYBA 5FO0A 1KEVA 1N0WA 3ZXYA 1UWVA 1MSDA 4TWRA 4RKFA 4J1TA 1WZCA 2HCJB 5FX2A 3VAZA 2AC7A 3TGLA 2A59A 3B6KA 4C8IA 3IEPA 3CF2A 2P75A 1I14A 2VDMB 3L8MA 1CR0A 4M9ZA 1K4KA 1D3AA 3RRYA 1Y42X 4G3XA 4DEVA 1IATA 1ZJ5A 5NLLA 1PEKE 4YEDA 1AKTA 1DRUA 2FHPA 2YN4A 2HFEC 2HQSC 4DLUA 2XLBA 4ZHQA 3U1BA 1UUFA 1E4OA 1KMCA 2AC4A 1RYFA 4ID9A 1RYEA 3OFSA 4UHDA 1UK9A 1SA0B 3PXGA 1BMFD 2MR5A 5AK6A 4PLFA 1HBJA 1M0WA 4N12A 2CTPA 3RKSA 2F95B 3AVVA 4RK0A 4KL1A 2R86A 1A4UA 1ABEA 2V97A 3N4YA 1YJ5A 4YAIA 2CFCA 3FCOA 1IM2A 4XJTA 4DJDC 3I1FA 2O7RA 2ENWA 4ZJUA 5J2UF 3IIIA 4ZK6A 2QN6A 3URMA 1IFXA 4GXTA 3LCRA 3AERA 4MJ7A 3LUPA 4YP5A 1F5SA 1QUEA 3VI4B 4WF9V 4KQJA 3NDIA 1JBKA 3U31A 2A79B 5COQA 4LWOA 3CRQA 5JHGB 1FVFA 2O48X 1Y4DE 4JP1A 2JAQA 1K8AH 2OO5C 1VHJA 3TD2A 3I09A 3V7FA 3IAXA 5ADHA 4MVRA 1OHHA 1Q5OA 2QZPA 1XL4A 4RPGA 2AS0A 2VF5X 4FFWA 1L6RA 2GXSA 4AM8A 4M83A 1QTIA 2IY8A 3W5CA 2QU7A 3FYUA 1BHAA 1YFLA 1H4VB 4QOSA 1D6JA 4I5GA 5G0VA 4NWIA 4E2FA 3K5OA 5EB0A 4RMNA 4WCFC 4E4EA 3GLFE 4OATA 3R5SA 4I0XA 2VNKA 3UM7A 1P9LA 2XTMA 5DLEA 2OCLA 4BMYA 2BI8A 1GUYA 3MB8A 4YROA 5JH7F 3OQ1A 5HJ2A 3KUUA 3I2JA 2J09A 1CUVA 3OLWA 2VP6A 4L0MA 3PDUA 3GYGA 1JWAB 1NSTA 1NY6A 1LUVA 2HIGA 1WY7A 3EIHA 5DGIA 1CUHA 1M1NA 3N0WA 2OCKA 4JS0A 5L7TA 4X8LA 4RCVA 3IDOA 4U4AA 1W3EX 1U90A 3KU4A 2Q9BA 4Q1CA 3IS3A 3TFOA 3K5MA 1Z68A 1SOMA 3OC6A 3KE8A 4JB8A 5FL7A 2GRUA 2BCJQ 1H2LA 3H1PA 3UY4A 4ONEA 3U48A 1RI3A 4DCSA 1PR0A 4D6PA 1X92A 4B3IA 1UMBA 4XUDA 3WGHA 2ZYSA 4JYCA 3WG7B 1WXEA 4HTFB 3C3CA 2XKBA 5GADl 3NDRA 3CB2A 4B7UA 3ODPA 4X95A 2VDOB 3KKZA 1J95A 2I67A 3N39C 1VIDA 1PFVA 2YMMA 3ZDAA 4CF5A 4BJHB 1EGAA 4MWZA 1UWKA 5IT9M 3ROMA 4P2ZA 4YALA 1H2EA 1AQIA 4B80A 4M87A 1E94E 1OXSC 4X62O 1KEEB 2Z1DA 2APJA 3BTVA 4MB2A 4CU5A 4JJEA 4U9UA 1IQUA 4NQ3A 2J3IA 1SBQA 1JG4A 2W2VA 4DSUA 2WMOB 1IBCA 4OJKA 3FTEA 5JISA 2GCNA 2ZD9A 1QWSA 1F60A 1FXWF 4DNOA 3HJTA 2GHQA 3D2CA 5ELLA 1V1MA 1GUZA 2NTNA 2P69A 4HNAB 2MR6A 3BIWA 1P4SA 4MKXA 1L5SA 1JNYA 3NVKI 4MEAA 3T5CA 3BPZA 2XX3A 1SXHA 3F7VC 4WFJA 3SX0A 2AMJA 3D7RA 2YIBD 4N7MA 1XRSB 1IEVA 3A0RA 4LJ5A 4B6OA 4Q1AA 3CWBH 3WJ7A 3C3AA 1P5RA 4I4TA 3ZLTA 2H9YA 3BOSA 2RAVA 3K12A 1RYYA 1NRXA 5K8JB 1E3DA 5CUQA 2HKOA 2R4UA 4R1TA 1Q2UA 1CEQA 1MB0A 2HUNA 1IN6A 3EDQA 5IFLA 2D7CA 5FOUA 1YZBA 2VHJA 2RSLA 3C70A 1EUQA 1QR2A 3CIFA 3NTOA 1M1YE 3GRVA 3L8FA 5EE1A 3CW9A 2ZQ5A 2JZCA 4GOXA 4NCAA 1IN8A 1LX7A 3SZMA 2R48A 1JPVA 3IVRA 3VSCA 4LZAA 1XMQO 2JI7A 2YQ4A 3PE3A 4F4HA 1RJ9A 1Y8CA 1WCIB 3KPVA 1MAUA 2ZSAA 3R6DA 4HDOB 2WJAA 3PQ8A 4BX0A 4IQ4A 5FPQA 1WB4A 2Q2WA 4I7EA 3DE4X 2A92A 3KALA 1F4PA 1F1JA 2XQKA 5KYXB 5HWEA 2D2IA 3ZOZA 1R1BA 4M9QA 3BCSA 1PZXA 4EHLA 5L3ZA 1IHYA 2ODWA 4Q4LA 1MN6A 1T3GA 1UBEA 1NUAA 1J8YF 3CTPA 3GDGA 1RTTA 4XYGA 3C7CB 2FPRA 4JHXA 4FFLA 4GI7A 1JZSA 1R0YA 4INZA 1DIBA 4M1QA 4R1PA 2JFBA 4DYVA 1CHNA 4G9EA 5JRDS 1YNSA 3FB5C 4QQFA 2N42A 4C0AC 2DSTA 1N3YA 2ZT5A 1WXXA 2L6LA 1R16A 1KEWA 1P4GA 2IIVA 4CKCA 1F06A 4XQEA 5KNCD 1DT5A 1UADA 5KCMA 1P73A 4IIJA 2Z3VA 4DS3A 2LWIA 2Q3DA 4Z2WA 3GPLA 2A4KA 4MW7A 1VQ4F 1KO5A 1QLWA 5JASA 1MB9A 2YS7A 2P8SA 1O77A 5KHGA 2O3RA 3CT4A 4F6RB 3P32A 3IOEA 1I0IA 3E9QA 4DLYA 1YRYE 1XHOA 2W22A 1E79G 5AVQA 3P19A 1ZN8A 3ANNA 3A1TA 4HDKB 5K6AA 3A6GA 2IYEA 2A2ZA 5IXYA 3R5HA 3DLHA 1T5DX 2UYPA 3EDRA 1ZONA 2HA6A 3GARA 5A9GA 3PXXA 3L1HA 2CD9A 3LSQA 4ZVUA 3IODA 2ZUTA 4I7ZB 2I5PO 3D7NA 4LOKA 1WHTB 4L8VA 1MO5A 4M76B 1JKXA 1XAIA 2Y1XA 1SPBS 4F9FA 4NG5A 1O9BA 1SCJA 1WB7A 1N6HA 1N5MA 1I08A 4CIWA 1ULSA 4Q3CA 4Z4QA 3HADA 5AVSA 2V74B 5K01A 1NN3A 1SC4A 4K1LA 2QT0A 2GETA 2CHGA 2VDWB 1Z4KA 2YICA 1QIIA 3LAWA 3CXRA 3JASB 4G2NA 3RSHA 4ALNA 3FNGA 2G70A 2XE7A 2YMLA 3K7EA 1XHZA 4OG2A 1KYZA 2HGZA 3CLHA 2O0MA 1O57A 4NCKA 2BFEA 4BC0A 4YHHO 4POOA 5H0IA 3V1MA 2WC1A 1I01A 2AK3A 2V1UA 3HCPA 3ZE9A 3TD5A 5TARA 1V55C 1N33O 3P2YA 1H2HA 4TQAA 1XJ0A 4RD6A 2NAPA 3RVPA 4B4WA 4UHFA 4JEUA 4TUYA 5ES3A 2IJHA 2GAAA 5C31A 2LIPA 1JR3A 3GRKA 4RXUA 4GECA 3GWZA 2G9VA 4XQ9A 2RH8A 5BNWA 3ESQA 4L7QA 3N4ZA 4NNOA 3B20A 2QV0A 1RJGA 5MN6A 4ZCQA 4JUAA 3GVMA 4QE3A 2J7PD 3WWEA 2UXNA 2QTCA 2UVDA 3X43A 3S4YA 4V03A 4AMVA 1SD2A 3AM4A 2D5CA 5JAHA 5FI5A 3J80M 3W8DA 4FKZA 3NWEA 4GL4A 1O6BA 1L1QA 2KB0A 3THXB 3A2FA 1COZA 1DEKA 5CD9A 3QA9A 5FWAA 2XJ9A 2KSDA 3WLTA 3C3PA 3BZWA 3IPXA 1GLNA 3HVJA 4X97A 2F8TA 5CK5A 3RVJA 5H4GA 4LOIA 3IA7A 2NQTA 4HAWA 3WOHA 4JQOA 2V7PA 1OH7A 3T4DA 3AI7A 2XHZA 2J3LA 1XN1A 3T7EA 2Z1UA 3OBYA 1V35A 1Y7LA 4Q1BA 5TXGA 5K0NA 2D2FA 1RAIA 5EESA 1P2BA 4KRXA 1AKUA 3IKVA 1U3CA 1QTQA 1KDZA 5HY4A 2VXCA 4O3FA 4I19A 4TS3A 1L4KA 1BWPA 3AL3A 5BV1A 2LNDA 3CCSV <