3WGNA

Staphylococcus aureus ftsz bound with gtp-gamma-s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
molecule tags Cell cycle
source organism Staphylococcus aureus
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
total genus 106
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgnA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgnA01
2VXYA 4U3JB 5JH7A 4TV8B 5JVDA 4IHJB 4LNUA 4O4LB 4ZHQA 3R4VA 5MN4A 3HKCB 5KMGA 3JAKB 3RYFB 5IJ0B 1RLUA 5GONA 3HKEA 3JATB 3JARB 4XCQA 3ZBPA 5LYJB 2R751 5LYJA 4FFBA 1SA0A 3JARA 2Q1XA 2BTQB 4O4HA 4O4IA 4X20A 2RHHA 4X20B 4I4TB 2BTQA 3UT5A 3HKCA 3WGJA 3WGMA 3ZBQA 4EB6B 3RYCB 4O4LA 4TUYA 3JATA 5IYZA 2BTOA 3V3TA 4EI8A 5J2TA 3WGNA 3VOBA 4M8IA 3RYHA 4IHJA 4LNUB 2Q1YA 1W5AA 4TV8A 5FNVA 5LXTA 5BMVA 5KX5B 4X1YB 3VPAA 5IYZB 1JFFA 5LP6C 4X1IA 5EIBC 4ZI7A 4B46A 5MN6A 5LP6B 3JASA 5ITZA 3HKDB 2VAWA 4IIJB 4ZI7B 4O4IB 4TV9A 3JALA 3RYIA 5M7EA 5LA6B 3VOAA 4I55B 3WGKA 5LXTB 5CA0B 3JAKA 3RYFA 5IJ0A 3VO9A 4I55A 5KMGB 2VAMA 4DXDA 5EZYB 5C8YA 2GVIA 4F6RA 1RQ2A 5J2TB 5LOVA 3HKBB 4TV9B 3RYIB 3WGLA 3HKDA 5JCOC 4I50A 5GONB 3E22B 1RQ7A 4I4TA 1W5BA 4O2BA 4YJ2A 4U39A 5EYPA 5BMVB 4X1KB 4O2BB 5KX5A 5LOVB 4WBNA 4F6RB 3HKEB 4KWEA 1TUBA 2R6R1 4DRXA 2RHJA 3N2GB 4ZHQB 1W581 5EIBD 5JVDB 1Z5WA 4EB6A 3RYCA 4X1KA 4U3JA 5JH7B 1Z5VA 4YJ2B 2RHLA 5CA1B 1TUBB 5MN5A 5CA1A 4YJ3B 1SA0B 4O4JB 5J2UA 4O2AA 5CB4B 3C8LA 5C8YB 3HKBA 4O2AB 5CB4A 5FNVB 3E22A 3N2KB 5IJ9B 4X1IB 1JFFB 3M89A 3CB2A 5CA0A 4X1YA 4HNAA 4ZOLA 3VO8A 5JQGA 3RB8A 4TUYB 5EZYA 5JCOA 3RYHB 4HNAB 1OFUA 1TVKB 3N2GA 2VAPA 4ZOLB 3JALB 5JQGB 3M8KA 4EI7A 4IIJA 1FSZA 4DRXB 2RHOA 5LA6A 2XKAA 1W5FA 5IJ9A 3N2KA 1FFXB 3JAWA 4O4HB 4WBNB 1W5EA 1FFXA 3JAWB 5EYPB 4B45A 3UT5B 2XKBA 4O4JA 5J2UB 3JASB 5ITZB 5LP6A 4YJ3A 3ZIDA 1W59A 4I50B 1TVKA 4EI9A 4FFBB 4E6EA
chains in the Genus database with same CATH superfamily
2VXYA 1CZNA 4H6VA 3LHSA 3T34A 3PGA1 3E0XA 5DW3A 3ZTTA 2C8LA 3EEIA 5C4MA 2VZLA 5E38A 2FAXA 4GKJB 2PH3A 2LCAA 3MB8A 4N0MA 4YMGA 1FL9A 2IGTA 2N46A 1PL8A 5F7ZA 2XBLA 4KGVA 5FJJA 2H48A 1M34E 5CLJA 1XGKA 1U81A 2NXEA 2QZSA 2WWFA 4B3XA 2YN0A 2QSYA 4XWKA 1Y8QA 2YWFA 4ASUA 2VCEA 4MRRA 2GCGA 3KL4A 4LE0A 4ARZB 4R1TA 4PYNA 1UPFA 1WX1A 3UMCA 3NOQA 4G0PA 3AFMA 3PWKA 1QGYA 1PL7A 3LD9A 1KD1H 1YL7A 4FLMA 3EPRA 3FSEA 4G09A 1B6GA 3ESBA 1T5OA 1BAPA 4JITA 2CXUA 3MS4A 5AI9A 3QE2A 4ZO7A 3IL2A 3SIUA 2QTRA 1TFRA 3IOYA 4PBRA 2FN7A 5EJGA 4C22A 2C1XA 2Q1WA 1IY2A 2NSDA 4ISCA 4X7PA 1PT7A 2F7SA 4Q21A 5EHIA 1KSGA 3SBOA 4R3WA 1QMGA 4NUTA 2AVDA 2QM0A 2ZR7A 1U9JA 5IK2A 4KPEC 3GRRA 5JI2E 4CF5A 3RYIA 1U3PA 2EGUA 4ZCMA 1X7YA 2GNOA 4MRMB 4ESOA 4YUZA 5BWNA 3HM9A 3PI6A 2VBIA 2AB0A 4JEIA 4R40B 2PUAA 5GJCA 2EP7A 1O4VA 4S35A 1PFWA 3DGFC 3AY0A 2DFTA 5DX1A 2O8BA 2RBEA 3LFHA 1YKGA 4KDEA 1PJBA 4U8HA 1R66A 1Z6YA 4IXWA 3F5SA 4MVYA 3KXKA 4CUJA 5KYXB 3OX4A 4TMFA 5KTSA 3T4XA 1PFVA 3BK2A 3PQCA 3ZI7A 3ZU4A 3L7NA 4RTRA 1PKEA 1M54A 1PQYA 1T2VA 2CSXA 3P52A 1CV2A 3MTBA 3PCRB 3ZGZA 4U39A 3D6AA 5A3JA 5KSYA 1E2LA 3VMFB 1H48A 1E1KA 1VCIA 1JB9A 1SY7A 1GQYA 1C3JA 3I45A 3BZWA 4ZVOA 4E2ZA 1OBHA 3UA4A 1PR5A 1GKUB 2PMWB 3DOFA 1UPUA 4X00A 4CM9D 1DINA 4DG9A 4EL5A 4ER7A 1L7XA 2HGZA 2EBFX 4EJFA 1XTSA 1PL6A 1U9ZA 3BHJA 3AF6A 2OGTA 5IABA 5ULLA 1Y8RB 5DI3A 2OC9A 1NTOA 3GIDA 2CLIB 4EHFA 1UH5A 2H59A 3GZJA 3DHWC 1GZ7A 1H66A 1XPUA 2W2NA 4GVLA 1U3FA 4ERXA 1I4TD 1MB2A 4LZOA 4XX0A 4LNAA 4HT3B 5KREA 1QVRA 4H4DA 4I4IA 3OKPA 2FW6A 2I6DA 2PIAA 3QX9A 2H63A 3JD4A 2FEKA 4D4GA 1F4LA 3LP5A 1SO8A 3HVJA 2ZTMA 4Q7QA 3JQCA 2FEAA 4JDPA 5EKUA 4WL0A 1M6VB 1GIAA 1GUYA 2G5PA 1UIMA 4HATA 4YMVA 5CEJA 5IHPA 5K5EA 1WXDA 2PS9A 4DILA 5D3KA 4DQLA 3CZCA 3L8FA 4CKYA 1RYBA 2CNNA 2VUSA 3ND8A 4BCBA 2XGSA 3A27A 1SKBA 3LK7A 3JPYA 2ZM5A 1XV5A 3C3BA 5CYFA 4DDWA 5U4XA 3Q3HA 4RU1A 4WHMA 2CMFA 4RK7A 4WT7A 4Z2AA 1X1RA 3OZSA 5CR9A 2EKDA 4MVJE 3SDZA 2QROA 4WVFA 2V3WA 4TS3A 4WA7A 4F5ZA 5IHXA 3ISTA 1D2CA 1OXKB 2P8SA 4QC2A 3UAOA 3SM9A 2Z2YA 4CM9A 1AO0A 3KQSA 1IAVA 2WF6A 2Y9MB 4G0QA 5BVGA 5KYGA 2NYRA 5JI3E 4MV0A 4OU5A 2DQSA 3H5VA 3FWKA 4KVAA 2JNBA 1RAIA 4K7JA 4DGQA 5F21A 5HXZA 4N48A 3QWBA 1YITF 3P9ZA 3CH6A 3F6RA 4B6QA 3P2EA 3VR1A 2VAWA 5ALMA 4CGYA 1ZVMA 1JWLA 1KU6A 2KLBA 3NCHA 4M46A 1R4MA 5BR7A 3I52A 4KIFA 5CFMA 1XZEA 4OK6A 4UNSA 3THRA 4ER0A 4UM7A 4EW6A 4TWJA 4ZZ0A 1DBQA 3L43A 5KMGB 2QHXA 2IQ5A 2OAGA 5AK6A 1EHIA 1N57A 1ZISA 2Q2VA 4H4CA 4RZQA 2I1LA 5DNDA 4GOLD 3AYXB 1M8FA 1ZUNB 2ZYGA 1AN0A 3Q40A 4GX1A 4HGOA 4QLAA 1QG4A 4V03A 1NU6A 3VU1A 4ARBA 5BOSB 4G4YA 4DEXA 1F0KA 5AXAA 1OPXA 4J1TA 2ZM6B 1I94B 1TQ8A 4LDNA 3PRYA 3LX8A 4IXDA 3LT4A 1E2GA 4REMA 3ZWXA 4C4XA 1ZM7A 3BH6A 2J0QA 2Q5FA 3B8HA 3VVCA 3ZCTA 4CLXA 1G2PA 4P3KA 5BSRA 4KH0A 2V4MA 1ONIA 2GWRA 3CLTD 5FP0A 1XZCA 4NYIQ 3LCJA 1I5RA 2OL4A 1PJTA 2G9UA 3AEZA 3KLOA 3O4JA 5DX8A 1TYEB 1XCBA 3EULA 1CX9B 1PS8A 1GPAA 1VLQA 1VTKA 3A9CA 4YS6A 3NK6A 4X3LA 5FTNA 5JOQA 1QQBA 4OH7A 1LF5A 3OEYA 1PT9A 2XUQA 3WIBA 3AKZA 1RTKA 1BVYF 3VZCA 1KSFX 5C4GB 1DEAA 2GVDC 3GJ0A 1OF1A 3WHKA 5TF0A 2JVIA 5F9FA 3Q2IA 4FX2A 3TQHA 5CXXA 2B61A 1JE1A 4C3UA 4DIOA 2YWDA 2CJWB 1I3LA 2QA5A 2POQX 1I9GA 2F3RA 3T0FA 5DCLA 1TVEA 3LVFO 1LDBA 1JHYA 1D6NA 4AZWA 2AN4A 2VEDA 5CXUA 1W1UA 5B7GA 4GD3Q 1NF8A 3ROKA 1E5XA 5EPEA 4ALLA 1OAOA 4PXAA 2Q3BA 1I3OA 5SY6A 5C46F 3PQ7A 3ABIA 1KZHA 2HWWA 5AFSA 1Z9BA 2XUOA 5DYWA 4Z0NA 3DMGA 3VIUA 4IAOA 5D8DA 5EMMA 5DBOA 2M6KA 2MSEB 1LWOA 2BMFA 2D2VA 1DKRA 2ZB2A 5CVJA 3S5JA 3S2GA 1FP7A 3FPIA 5KCZA 2JKZA 3C5VA 4AYXA 3I5YA 3UT0A 2G67A 1IWOA 4XD2A 1YFZA 3Q11A 4B31A 1C3VA 1KRHA 1WUIS 4BVGA 4BWYA 1O54A 5DNVA 4B75A 5CGZA 4YRGA 4MKIA 3GLTA 1HO3A 4M7WA 4BN4A 4N7MA 4YDRA 1JT2A 2R7AA 3O03A 4FFLA 4MJ7A 4QGAA 2I7CA 3GJRA 3ET5A 4R68A 2P9CA 4HYEA 5EXEA 1V1JA 4IIBA 4LG1A 3COYA 2FZLA 3PZBA 2WNHA 2ZVJA 5HQTA 4TROA 5DSZA 3DV0B 3I73A 4LVNA 4QU5A 3WQQA 1VQ4F 3ELYA 3H1GA 3OLWA 1RWOA 1INLA 3IAS1 5D85A 5H83A 1TMKA 1UP7A 4RK1A 3VJLA 1ZJ4A 4K40A 3H1BA 1U02A 3ONEA 4ECEA 4EENA 4NQ3A 1GFWA 1U0JA 2ZU6A 2JLZA 1E6UA 4KZKA 1SRRA 5T8KA 3KX2A 2MYTA 2DJ5A 3ZXSA 3QU4A 3HM2A 5KWSA 1R88A 2NVOA 3DXFA 1Z22A 3L6BA 3LHIA 5THXA 2PKWA 4X8MA 4XASA 3ITDA 2V9YA 1XN4A 1VE5A 2OCLA 1U7PA 1JLSA 4KMRA 1A77A 3KE9A 1XC7A 3VOAA 1ULZA 3NKLA 3V8QA 4CM4B 2AXNA 3FYUA 3BXHA 4QVKA 4DA9A 3M1IA 2Q8NA 3BBPA 3OZWA 1NVAA 5FL7A 3NTXA 2FUCA 2ODAA 1E18A 2X9VA 3GDFA 4URZR 1B23P 3FCOA 2QDXA 1Z62A 3KYCB 2JLYA 3SU8A 4NEQA 2QL5A 4Z5XA 4C05A 1FFGA 2VN8A 1FYVA 2M1XA 5E4JA 5AVQA 2P9JA 4JL6A 3QUSA 4IKPA 4XEUA 4WOPA 4DV7B 1LBTA 1TUGA 2HK9A 3V9PA 4E11A 1O97C 5HVNA 3G2LA 2HF2A 3GT3A 3HN6A 2D2FA 2GF9A 5HIKA 4W5OA 4KKXB 4MIKA 1NBWB 1XEWX 3BDIA 3L01A 2XGOA 3NYWA 3P27A 1LPNA 1TIPA 3PWSA 4QULA 4V3CA 4EY5A 3RTBA 2D0DA 1U2ZA 2IXDA 4BJHB 1YGPA 3I0MA 4PZYA 4BQRA 3VNQA 4DQKA 1K1EA 5TMBA 4DIEA 1GL7A 4C0HA 5IFLA 4D4LA 4HQ6A 5IAKA 1U8YA 4PQYA 4EOGA 3PIRA 2JH9A 1FMCA 3EXFB 3OZTA 3GFTA 1P60A 3N3AC 4J7CA 5BY2A 1VYUA 3WBBA 5HM6A 3DBRA 4EJSC 2CL5A 4RY2A 4GPTA 3EVGA 6CHYA 3OKCA 3RUFA 1L8OA 2D5IA 1G5QA 4LJ4A 3KP1A 1P73A 3RHSA 1IJEA 1LPMA 3EGEA 6GPBA 1ORDA 2JASA 1BW9B 2P0AA 5CPBA 2HTFA 4L74A 3F7OA 2WKSA 4EYEA 1ZSYA 3C87A 4M8KA 4XI9A 3K0EA 2ZYHA 4BO3A 3JAWA 2C94A 2HRZA 1U28A 3V4DA 2P2YA 4PONA 3RCBA 4YPVA 3JAWB 5JFGA 4BIIA 4CTOA 1W25A 2IKSA 1Z2DA 2OCYC 4LZAA 1BW9A 3VJKA 3AOEA 4P35A 4OCZA 3PLRA 3ZWYA 4L9RA 1G5RA 4WZBA 1SCNE 2OTMA 4NJMB 1NV9A 1Q74A 1YULA 3JVHA 2C7VA 2NO9A 2PKQO 4D97A 1AKTA 2X2PA 3CXRA 2CXHA 3OLVA 1PJZA 3DQQA 3R7AA 4M9CA 3SK0A 4A5OA 3SQXA 4FEGA 1UP4A 4CLDA 5E2BA 2B9VA 4KWCA 4AIRA 4YUYA 2W6ZA 3RS8A 3WE7A 2YJ6A 3NBFA 5A7FA 4AMZA 8OHMA 2AZXA 3GJ3A 5AT1A 4MLDA 2BMWA 4IGAA 4OXIA 1SBQA 2P77A 1JMKC 3WGZA 1ZRSA 1Q0HA 5BV1A 4EA6A 2V6JA 5BN3A 1M5TA 1GITA 3TI7A 5DYTA 3THXB 2BTOA 3DTVB 1TEHA 4MV3A 4NICA 2CGEA 3GMIA 1QFMA 1OA1A 4Y0VA 1N6NA 1KI3A 4QYXA 3UT6A 3TNJA 2K4MA 2Q5OA 2WM3A 2MDTA 3IV9A 3MCVA 1M5UA 5B7QA 1XJ0A 3K8OE 1CNFA 5AIAA 3ZW9A 4MVJM 1SGWA 3PICA 1YCHA 2J4FA 2HWXA 2KWIA 2VEOA 1B8OA 3KHSA 2WYWA 2WABA 3FWHA 4IIUA 2YCLA 5EZ5A 4KLAA 1J24A 3I30X 1NNUA 1P0CA 2G1UA 3SQWA 1H2ZA 3OH8A 4M0MA 4DJDC 1OFGA 1BQ4A 3OCCA 2HHJA 4G8BA 4HNQA 3H8VA 3RVPA 5AVTA 1KKMA 2P1DA 1F48A 2IBTA 1DAGA 2HMAA 2P9HA 3FZYA 2AOUB 3I9MA 5GMOA 3NG1A 4KPFC 2UUAB 1XROA 5B1SA 5EZYB 4Z8YA 1SURA 1W5TA 4K6HA 2Z95A 1FTYA 2NUAB 5LOVA 1BS1A 3H19A 4XD7D 5EZSA 4FDLA 1SCAA 2IUUA 4DBVO 1V0JA 2ZJOA 3PT9A 4JLMA 4M0CA 2VZEA 3QLJA 5DV9A 4Q4HB 3RE1A 3TOZA 5I7FA 1KL7A 2G4CA 3D2LA 3PQ6A 3CYPB 4PYJA 2KBFA 3C24A 2B8WA 1YC5A 1QV7A 4YIHA 4QYSA 2PKQP 3F0GA 3DPSA 1EVLA 2C3PA 3PWTA 4OB8A 1JJFA 2F67A 2QG6A 4AJNA 4HRVA 5EIFA 1IK6A 3JQRA 2UVPB 2W00A 1MOZA 4K2AA 4Y2YA 3DV0A 4HLQB 1EJ6A 4MTLA 3B89A 4L6CA 4RC9A 1OYOA 2Z4TA 4TRNA 1V8OA 2AN1A 4LFBB 3D2AA 2HU8A 1C0IA 5FUBA 4KAJA 1SQGA 4M98A 3SMQA 5J4LA 5E6UA 1P2DA 3DBHB 1RRGA 3TQQA 2HLPA 2C7PA 4KNYA 2PTGA 2MINA 2WJJA 1ODKA 1VLZA 2X9QA 3D59A 4HPXB 1QRAA 3EX7C 4NECA 1PX2A 1UXGA 2B2XA 2NWQA 1WZEA 1G9TA 2GQ0A 2BGUA 3ESYA 3H2JA 5FADA 2O7VA 1W85B 1Z5UA 5AKHA 2BAGA 1RP7A 3IUQA 2XWSA 2O8FB 2JFVA 1FQOA 4AK9A 4B3DA 3LC0A 1DC3A 2V0NA 4B3JA 4EMBA 1TYCA 5EWRA 3VI6A 3CCLF 1PK9A 5FL3A 4XYLA 2PQ6A 3G9UA 1YASA 5IK2D 1VLMA 4FM9A 1NI5A 3LUPA 4U7GA 2ZVDA 2QRZA 1OZAA 1E4OA 1XLUA 2PJRA 3N74A 5LDGA 1PK8A 1JDZA 3QY0A 4ZV7A 1ZR2A 3I4CA 1W9MA 4PSUA 5KYYA 2OGSA 4RCYA 2FSPA 4QXRA 1WJGA 4E3WA 2XE8A 4FN5A 1P62B 2OYRA 3EGIA 3RAPR 1TM2A 1ZMXA 2Q2QA 3D01A 3VYSC 3OD1A 4GOKA 4F2GA 3RADC 5AR1A 3VHXA 1WD7A 3P9IA 3H5RA 1OFIA 4QDZA 5BN3B 1KIMA 2H1OA 3L0BA 4CKEB 1GNSA 2RCYA 4FZJA 1JZQA 4MUAA 3RRXA 4EFMA 5I7EA 4LRXA 2E4VA 1D7OA 2RHBA 3ABZA 4JEUA 5AJVB 5CFNA 5GM2A 2BFWA 1A9YA 1H94A 5CDFA 1YQNA 4JP3A 3VSEA 2CNKA 2NTVA 2EJTA 3BFXA 3GFVA 4HH3C 3RJZA 4PC1A 4KXNA 1UXIA 5IAGA 3TO5A 3UK1A 3UA3A 4I6JA 4OI1A 1UMDB 3U3MA 4ZYUA 5FORA 4HPWA 5LMZA 1C29B 2J41A 3JWJA 4J1TC 2X86A 2FZGA 3CBQA 5LBIA 2IYPA 1HMYA 2ZB3A 2HI0A 2XVXA 1BKYA 4ZOAA 4YYEA 1HOTA 1SR8A 4WY2A 1TU0A 2VF7A 3BE8A 4FOTA 3JD3A 2Y1XA 1OBOA 3OBBA 4IJ5A 3EYWA 1JDTA 4OQDA 4P93A 5KYWB 1QAMA 1R0RE 4RGVA 5EWMA 3WMFA 1LNSA 3ZHUA 5B8FA 3I09A 2H16A 1KJJA 1R9JA 3KB6A 3SJUA 2PH5A 1XMIA 2ODWA 2QAJA 4OP3A 4Q7LA 3GBVA 3HA3A 1T1EA 3BRWD 3GF4A 2BLNA 2JGAA 2VP6A 4FFSA 3VO9A 3QWAA 4NBLA 4BCDA 4F0JA 5DGCA 2ODTX 5J2TB 4DLTA 2NP6A 1MEJA 4V24A 2YOHA 3FHLA 2FEPA 1YOBA 5HDQA 2AN9A 2RHMA 4G4VA 3ZV3A 5EJ7A 3A1NA 4K9NA 5C9ZA 1EZ1A 3DPUA 1Z15A 4CG1A 1I13A 2CZGA 2QB5A 4M87A 1U0TA 3GWGA 4NP6A 3OZVA 5KNDH 2PCLA 4XVUA 2FMFA 1BMQA 3W05A 1TUBA 1GSOA 2QYSA 3H9QA 1T0IA 1MNQA 4DMUB 3JD1A 1Y48E 2O05A 2PFGA 3WTCA 2Q5QA 4CV3A 2A1TR 2P9TA 2Y99A 3TRFA 2G5CA 2X7XA 4U3JA 1K08A 5TGZA 3C1AA 3L0PA 4X54A 5HIAA 2X8JB 5BQ5A 1AF4A 3LWNA 1VI2A 3U7IA 3MQ4A 1GNRA 1QE5A 1TKBA 2WZQA 4FHZA 3QM1A 4H7KA 3RSSA 5JJLA 3ETEA 3K2XA 2YV3A 3N87A 2AMJA 3QVXA 2CXPA 2JGKA 1CEEA 2HLDA 2VSOA 1DRUA 1UKEA 1UUFA 1EK6A 1PYDA 5CA0A 1ZNWA 1G2OA 2V5UA 3K16A 2ZJ3A 3K3PA 2G1PA 2O54A 3JQGB 2E1RA 2YQ4A 3NATA 4TTPA 1NRIA 2ZVYA 3VI3B 2RHOA 1UMBA 3COVA 4U02A 1C8LA 3LJKA 3U0VA 5M04A 5ECGC 4R5HA 4BO8A 2ORYA 2PKCA 2V7GA 2R11A 3C3JA 5ABPA 3OPXA 5BN5B 4ZYVA 1GGKA 5DEIA 3JW8A 2ZRJA 4IF6A 3RUDA 3TZLA 1DT5A 2V45A 4O1IA 4NAUA 2Q6OA 4C87A 3DAOA 3PNMA 2LCQA 5B4TA 1LNZA 1UC5B 1TT5B 3BMOA 3MCUA 4H1TA 4CRWB 2XT0A 3BMNB 3B6NA 3LSTA 1LV7A 4B2LA 4WECA 3KOXA 1QH9A 5JVDF 3K70D 4REQB 2QTVB 1LPPA 4UAUA 1T9GR 4ACBA 1VYTA 3V8NA 3F78A 3DOUA 1IHXA 3PEEA 4F4FA 1PGPA 5HWEA 3NETA 2FHSA 5TQ0B 2NPFA 5KKCA 3EMDA 5H8WA 3CEPB 1IRXA 1Z5ZA 2XB9A 5LUBA 4UEQA 4RL6A 2JLUA 1YR6A 3OX2A 2AOXA 2E9SA 3NC1C 2HWKA 2Q3JA 2SICE 3D4NA 4V0ME 1KWKA 2F4VB 4MA5A 2IP1A 3MXTA 1YUNA 5JXHA 5ALRA 1ESCA 3KZNA 2XUDA 3B60A 3K8ZA 4DARA 3GAAA 5EP3A 4BQOA 4JXXA 1I14A 3GGPA 5EHXA 3OPNA 4JI7B 2PWAA 3CTPA 1TC2A 5DYGA 2WOJA 3NO4A 3PYLA 4EG4A 1E5QA 2AOTB 4O63O 3E1YA 3N2NA 2VRBA 1CDEA 1Y1SA 2WHXA 4OXKA 4BLPA 1R0SA 4MIYA 2JEOA 2LIPA 4HLCA 2SCUA 4UU1A 4Y2GA 5DHRA 3USCS 8ADHA 4Q01A 4PC2A 2WKQA 1IFXA 3ROMA 1NXQA 1FFWA 1HC7A 4P31A 1TZ2A 4NHEA 3GHHA 3UG7A 5CG2A 1K66A 2H57A 1E7RA 3TKLA 1K5PA 3VPDA 3K5HA 5DN6D 4LTNA 4K6GA 2E5LB 4I5FA 3D3KA 4FX5A 2I2WA 2OV2A 4DW8A 2WOOA 2VAXA 4ICIA 5INTA 3IELA 1COZA 4JLOA 4Q37A 2QVCA 4EO9A 4LVOA 3ZTWA 1GGVA 2B20A 3M5WA 1EXVA 2Y2VA 3F3KA 4JYAB 1E3QA 2PSHA 4QX6A 3D54A 1SUCA 2AJLI 1RWPA 2BFAA 1GFSA 2WHQA 2FGJA 3RBAA 1FB5A 4CU5A 1VBFA 3K94A 5LWHA 4FINA 3L79A 3HCDA 2TRSB 2AOWA 5CLHA 3RO7A 4F3TA 1C9JA 3TUJC 1QZZA 3LOPA 4QDOA 3BIWA 2R4TA 1GDDA 3AY3A 2XECA 5KNBH 3BL8A 4JR1A 5KSWB 1VGQA 2YDYA 2GKGA 4FBLA 3X3HA 3E2MA 3I6ZA 4NE7A 3CG4A 3L41A 1HT3A 2A9PA 2QTLA 4ZT7A 3DLIA 3U4IA 2YVLA 1IUNA 3A2MA 4NCHA 1V7PC 3K9GA 2QJOA 4D3FA 5EIEA 1YHZA 3KM0A 1E3TA 3DP9A 2WT4A 1JZTA 2J08A 3SAJA 1C0KA 4AQYB 4Y0NA 1G8GA 3KOWA 1ZVVA 1PJ3A 2OV8A 2DAPA 2Q3DA 4J7UA 1KZ9A 4JT8A 4Y1EA 1I32A 1N7IA 4MW6A 4A03A 3H4TA 1DBVO 1TT7A 1X15A 3ND6A 3TFQA 3ZUPA 4CV1A 1JDBB 2O5EA 1VSQA 2ZDQA 4AY3A 1P77A 1T5BA 4MPTA 4AFNA 5A9SB 4XFDA 4MW5A 4YMWA 1K89A 5A9SA 4FBGA 1NMXA 4H2DA 1FDRA 3TSZA 4J0EA 4OPMA 2HQBA 5K0GA 2WT8A 2DQKA 1IQUA 4K46A 2HDOA 2YUIA 1L1FA 3V42A 5C51B 1QKJA 1V5GA 2RJNA 3PS9A 4K6OA 2R5FA 3ZUGA 1FXUA 2JI6A 4L72A 4IQ4A 1Q3KA 4D9IA 1E69A 3R1IA 5NULA 3ML1A 4R6XA 1JA0A 3CUUA 4ER5A 5IM4F 4PSKA 3VTFA 2RDMA 3DEJA 5LFAA 1RVV1 5ELXA 5A3RA 4B3SB 2B25A 2QR2A 4BQNA 3UUWA 4DABA 1UFRA 2BEVA 2WVAA 4F21A 3L6OO 4E2WA 3LCVB 3N0WA 1S7GA 3FYDA 3UJNA 1GSHA 2BFMA 3M49A 1V95A 4PWYA 6PFKA 5J3JA 3SKVA 4PS0A 1SM4A 4Y2PA 1VFNA 4YBRA 3K2BA 1FDTA 3HE3A 4AS2A 4DV2B 3Q88A 3RIYA 3T5GA 3ZIAA 3MHTA 1FEZA 2AQIA 2ATIA 1RRMA 3EXEA 4AXXA 4F11A 3KZXA 3ZJTA 3M1XA 2EGGA 2ZI6A 2ZJZA 5CIQA 1XRMA 3D1VA 4MW1A 2JVKA 3OM9A 1ZGAA 2CWDA 1NASA 2XVAA 3LX6A 1A8HA 4DCGA 4EEZA 1T4CB 1V4NA 4ID9A 1DELA 2I6FA 2Y3IA 5C37A 2IUTA 2DX7A 2PJUA 2GXUA 3A70A 4N0PA 1XJQA 2G4LA 4UHDA 1G5HA 5IZCA 1Z0KA 1KJ9A 2A3NA 5IVIA 2LBTA 1KSHA 1WO8A 2BVNA 4MK4A 5AVOA 2BGNA 4G4WA 3R5HA 4HNUA 3K6SB 1JPVA 1S0UA 1CE8B 2ODQA 4AI6A 3G7SA 1MN6A 4B76A 1ECFA 1JLRA 4UBLA 2G7ZA 1NR1A 3P0HA 1XTIA 3C6MA 1YQUA 1GT6A 4UDNA 3COJA 4AP5A 2PMBA 3NFYA 3BX1A 4GMDA 5K7SA 1GG8A 3L84A 1K0UA 3GGSA 1K4MA 1W5BA 2Z4RA 4M22A 1D0SA 4RPLA 3X1WA 1QE3A 5IKMA 3BD7A 1M83A 1CK4A 3A3NA 5EEHA 2MQEA 5JNSA 1MIOB 2ISQA 3IVCA 3TLCA 4CIAA 2AX3A 3TR6A 5KSZA 1LFAA 2XF2A 3HP4A 4R2HA 4YUXA 5FUQA 5JMWA 5BSFA 5EA2A 5LQUA 3IEVA 1Z4OA 5BV7A 3KJKA 3BCRA 3H7AA 4LKRA 5L3SA 5JH7B 2A9OA 1U3UA 2BFEB 3OOSA 5L7YA 1A8PA 1NX9A 4TKUA 1F7VA 3L8EA 5CA1A 1XBTA 4G1EB 3WBJA 2OHIA 1V3TA 1VBNA 1NJFA 3KYJB 1YBVA 4XDYA 1J7JA 1WU7A 3DDCA 3D5EA 1I4DD 1B7GO 3FMFA 5TQ2B 3S7TA 3ESAA 2OHGA 3FHOA 1H0HA 4JYZA 3KAPA 4IVPA 4J1QA 5LQRA 4IJMA 5EOVA 1AKQA 4XZ3A 2BJHA 1VQPF 2UKDA 4K6MA 4BVBA 1RYZA 4QFMA 1E64A 1GKKA 2VDKB 1Y1QA 1VCNA 2DG2A 3K35A 4BEJA 3LY5A 1DV1A 3AKYA 3CIFA 1UT8A 2GNPA 2I7VA 2QNBA 2X5JO 4MRMA 3T3NA 2HYDA 4JI0B 3G5AA 4CKWB 1YA4A 5IUJC 1PT6A 1YQWA 4BWFB 3CF4A 2GKOA 4B6SA 3RK0A 3WXMB 1KZ4A 2P68A 4YAWA 4RQOA 1BTOA 1VQ1A 4FQ8A 4HXGA 3T35A 5EYPB 1FFXA 2IDKA 1H0RA 3UT5B 4KXLA 4DGSA 1U80A 3L5OA 4PG7A 5T41A 4X7BA 3EXEB 3AI3A 3U40A 3WJAA 3FUWA 4IM7A 4BO4A 5CIYA 4YAEA 4LOKA 2ZRAA 3TEFA 3KPJA 4TL8A 3VR6H 3HJTA 3W4JA 3NZEA 1DOZA 2Z3WA 3JQAB 4P3NA 2CVLA 3W5CA 1EUYA 4UBOA 4QBFA 4E1VA 2FF7A 2MSDB 2B1RA 2WZBA 3QVJA 3IKEA 2FPPA 2R48A 2VBFA 4GSLA 4R5MA 4W82A 2DXIA 3L02A 1HDCA 3ZE9A 1AK2A 3QEMB 1N6IA 1U2DA 5ALHA 1XDWA 2QE6A 3L0CA 1TMYA 3A3YA 4QBTA 3TD5A 1GRRA 1CRQA 2O1XA 1JSRA 3QUWA 3DL2A 2GEDA 3GAFA 3K6KA 3L5KA 4HAWA 4NK4A 1FPQA 3ZHQA 4B81A 3GJQA 1NUUA 3TNFA 3HFRA 4QATA 5AXCA 3LQQA 1L5HB 3TQRA 4Q7EA 5DYYA 1NVMB 3NBUA 3CCFA 5ES4B 2WHPA 1E3DA 1XG5A 3ZP4A 2JAOA 3CE6A 3T3EA 4R31A 1TO6A 4BRSA 1KETA 1TEXA 3ZZNA 3RVSA 2NYVA 3R7DA 1DWUA 1KAGA 4O02B 4P4NA 1LEHA 1EXNA 4W8GA 1U8TA 5FPHA 3W8EA 4BW0B 3CRVA 3K73O 1ZGGA 3CM0A 2FKAA 1LTKA 1IJBA 1BHSA 1JP7A 2Q07A 2JIBA 1GZ6A 5D6OA 4ND2A 2PRZA 1V9SA 4JR2A 2HHHB 2JA2A 1BGWA 2OO5C 4Y2VA 1E7SA 1GKYA 1QIEA 4MVJA 3AOEC 3DEYX 3HDGA 3P9NA 4E6PA 3NMUC 3NCTA 4MQEB 3Q8XB 2OB1A 4L5YA 3ETNA 2XT9A 1YU9A 2IL1A 4H77A 2NVUB 3MWDA 3W2HA 2GASA 2QLMA 2XH8A 3QU9A 3NHBA 4LYHA 3PWZA 3RTAA 3ZOKA 4YJ2A 2H9YA 3F2IA 4LDRA 1T15A 5E7QA 4FFVA 5EQTA 1G8YA 4KO8A 2FE1A 1FVXA 2CJYA 3WXMA 4KPUA 3QSYA 3FTDA 3CRW1 3L0IB 3A10A 2A57A 1OWNA 3QTTA 4BNMA 3N8DA 8ABPA 3FOEC 3IEQA 4TLMB 1HXHA 1ZUHA 2IZOA 4RLQA 4Q9LA 2Q6LA 1HYGA 2R85A 4BV2A 4FIZA 2VS1A 3EG9A 4IIEA 4DOMA 2B1IA 2V7TA 4FYYA 2ZREA 4Y1RA 2FVYA 1DLIA 5DSTA 2FK8A 2PRYA 1QVFF 2ZF8A 3GN1A 4Q3KA 4QQNA 2LXNA 4GLBA 3WX0A 1JU4A 1UZAA 2ZBDA 5HFAA 4CCYB 4EPWA 4D4IA 1BXGB 3SSMA 4N01A 1CEXA 4Q1EA 1YCGA 3HWRA 1DTWA 3EXG2 1DBFA 3D6FA 1LB1B 3PC8A 4BMSA 3A26A 1YAJA 2FEOA 3E35A 3MNFA 4IEFB 1T5LA 5JQGA 1H6AA 4RVSA 3I23A 4CMEA 1KS9A 2ZUVA 1LK0A 2AJDA 4TWRA 4C3ZA 4ZQBA 1VSUA 1NP6A 3ADKA 2VHQA 3G2KA 1YJNF 2VBGA 3DHYA 4B47A 1E2DA 2BCGY 3LYUA 4UOEA 3NAQA 4JJZA 2IWHA 4Q4JA 3TMAA 4CM8A 1MHTA 3LO8A 4H9GA 1BXRB 2Z9BA 4WGFA 2G9RA 1LPAB 4WLUA 5FRDA 4BP3A 1BH2A 4E5UA 2G9IA 1D8TA 1P0MA 3W2IA 4DR6B 4TYQA 3KJJA 3LT2A 4KQMA 4UU7A 3JTEA 3QKIA 1W4AA 4Y6QA 1FDWA 2I6RA 3UKDA 4E6EA 1T8TA 3Q6NA 5JAZA 4TWBA 4Y2UA 3B9PA 4TV8B 2DETA 5LYJF 1QG6A 3HV2A 3I83A 4XJXA 1Q1AA 1RHJA 4IXTA 9GPBA 3G2PA 3QUCA 2DYYA 2M2IA 1E5DA 5GONF 3MBIA 3JAKB 2HC9A 1H4TA 4RACA 3TPZA 2DHQA 5G4UC 5EKSA 5LNK1 3NRJA 3P2MA 1SBHA 1U11A 2JVJA 3IV7A 3ZLUA 2XBMA 1GPDG 1Q1ZA 3HJHA 4LJ5A 4C4PA 1BFUA 5B6PA 2QDKA 3NBZC 3RTCA 3S1AA 1BE8A 1TECE 4M1YA 4WMLA 4DF3A 4RTJA 2R2AA 1PFGA 2Y71A 3I2YX 3RUPA 4ZRNA 3WG9A 3ZE1B 3PR2B 4AJ4A 1UQTA 1W75A 221PA 3BSFA 2RHWA 4RUKA 5CK5A 5CPFA 3QF4A 4GI1A 4AJKA 3GOHA 4RXMA 1GM5A 3AI1A 3AK4A 4RTMA 3DOCA 5DNUA 5A9TA 1Z29A 3IO5A 1FP4B 4HO1X 4ND5A 3HGTA 1VGVA 2WUWE 4OUDA 5IYZB 5TS2A 3KKKA 3NDPA 1FBTA 3SF8B 1KMIY 2WFZA 1EXDA 3UICA 1XZKA 2VZ8A 1UDAA 2Z9DA 1F8GA 4L76A 2AQKA 3OEHD 4YJGA 4IIJB 1YJAA 1REQB 4LMAA 4O4IB 3BD9A 4S0XA 3N6XA 5L3VA 2PKYX 3HRKA 2FMIA 3TD2A 2DBYA 4C29A 3B5EA 4JQYA 2ODNA 4D9FA 1OVMA 5CA0B 2HBZA 3ABSB 2XNDD 1NFRA 3OFJA 2X9GA 5EERA 1KEKA 4Q5IA 1GPJA 1E9VA 5H3HA 2V7XA 3R0PA 1ZVKA 2ABWA 3RASA 4JBGA 2FFRA 3L92A 3WVNA 1HE8B 4MNTA 3ZV7A 1U7TA 3L4JA 4QYMA 1XF1A 2PSJA 2VK8A 2QYTA 4G85A 2GHQA 2NN3C 3LECA 1C30B 1VLLA 1VRCA 2CFCA 3I8XA 2P9YA 5G53C 1G1MA 5CVVA 4I50A 3LBYA 3HFGA 3JY6A 1E1RA 1VHDA 4J43A 5C7OO 1U7HA 1ZMBA 2XX3A 3DZDA 3QEMA 4UDXX 5ALUA 4NCAA 4DCOA 5AHXA 3C98A 3RC8A 4Q19A 1VDZA 3OI7A 2PBFA 2CJPA 5IX8A 1IY1A 2XOKD 4L02A 1PSDA 3HCRA 1N2XA 2P9ZA 1MRSA 3LWZA 3G2MA 3P9XA 1JR3D 5FTLA 2FMXA 4B7CA 1N1DA 5BRAA 1V96A 1RABA 1W0CA 3IT2A 2YOFA 2GD0A 4PPNA 16PKA 5EKXA 5TT1A 2OCXA 3WAKA 2GD6A 2Y1GA 1VMDA 4CZ2A 2DPGA 3DE6X 3JVDA 1J2EA 3T3GA 3ZE2B 4Z51A 3MMPA 1ZIPA 1VK3A 3B82A 4XVQA 4M0DA 2KLHA 4BT4A 1HI9A 4JQOA 2J0EA 4WAUA 3G89A 1PSZA 1U6KA 4D6PA 2ZJ5A 3PE6A 3ESJA 1VKHA 2IP2A 3PHLA 2XXJA 1YR8A 3EXG1 1X77A 3WJRA 1J06A 1WMEA 1MR3F 3U4QB 4FFRA 3FWNA 3SHTA 4YCJA 2Z8YM 2FQXA 4EARA 3V2IA 3EPLA 4RWEA 1NONA 3IUBA 1DBPA 3K0CA 2XMQA 4Q9KA 4QQFA 4ZRMA 4ABYA 4W9NC 2JB9A 2CK3A 3DWIA 1IHDA 4YC7A 5G4VC 2EXXA 3K1YA 2GAFA 3ZIDA 2W70A 1JG1A 3DOJA 2I3ZA 1U0NA 1W46A 3FAKA 2G3YA 2J3DA 3I4LA 1J56A 3QWFA 5A9RA 1GO1A 5CFPA 2K7FA 2GX6A 1WXGA 4BKUA 1O95C 1J90A 2CY0A 1PJCA 3OW2F 2A1IA 1L5ZA 1PBNA 2PSDA 2QW0X 3NALA 4RV4A 2QT0A 4UQOA 1KPHA 3DEKA 4OLHA 2VCHA 3ANYB 4FS3A 4UTNA 1WVIA 1UFVA 2WTUA 1LLDA 2CVFA 1WZIA 4KAXA 5KNCA 1BS2A 1X52A 1ZI6A 3QE3A 1VL1A 4EB3A 1Q6YA 1EBUA 4EYSA 4CT0A 5IAOA 4B3TB 2RHHA 5AVRA 3KQHA 3FFAA 2OAP1 1JXAA 4H15A 3WNVA 3CVVA 5JNRA 2VUHB 4KW7A 1NDQA 4BYMA 1ECPA 4DA8A 5TEWA 4MPJA 1Q22A 2FDXA 1JIXA 1KI4A 2AV6A 2VDNB 1XHOA 3F74A 1FSGA 4ZRDA 1IVNA 3BILA 2HQ1A 2UZ1A 4UFOA 2KGWA 2Z30A 3D1LA 4AP9A 1TIKA 3LDHA 1YS4A 3O8NA 1GQRA 4B8YA 1GRNA 4CCYA 2JLCA 3FR8A 4LWZA 4EM6A 1SU6A 1K3UB 2DJIA 2I87A 2RK4A 3SVZA 1T6ZA 3T4PA 1Z5OA 1T4CA 3IBSA 3VTAA 3D6NB 1XMXA 3EMVA 3TG8A 2XMDA 2D3TA 4JLBA 3SC4A 3U60B 2Q62A 3G7NA 4DBLC 1X7OA 3U19A 2PZMA 3MTJA 1C9YA 3TBHA 4BN0A 1B8UA 3R09A 2XKJE 2WP8J 3WNCA 1DAIA 1L7NA 2HJ9A 1FX1A 2GN4A 1DJNA 2V7QA 4IV5A 1SIUA 3NMUF 2R9VA 5CK4A 2Q21A 1GFZA 2AFRA 4OGGA 4NBNA 4DXDA 5DM0A 5JSQA 1G7SA 1HQDA 4LNHA 1OFUX 2ID9A 1AY0A 2V55B 3T9AA 3NAMA 4CLEA 2HU2A 4S0ZA 4WADA 2ICAA 3FY4A 3T5DA 2HA4A 1JKFA 2FWJA 2MIIA 4I4TA 3ADOA 2XE7A 3TH5A 4OHYA 2R5WA 1T25A 2QRQA 3AIOA 3GT0A 3IA7A 3KT0A 4P4GA 4TT3A 5EWJB 5EUBA 2J5QA 1T26A 1VMKA 2EYQA 3PFIA 1U8CB 2X2OA 5D5QA 1OX4A 1WB4A 4P0TA 1NSFA 2IXBA 4E2YA 2CLOB 3ZNPA 2B5OA 4YFYA 1S3IA 1HE5A 3EWIA 4G97A 4HDKA 4RD4A 4LY6A 1R7RA 2A92A 2VI5A 4HMQA 4TLLB 4WBNF 5CYOA 4BJ1A 4YAJA 4CFSA 2PH1A 1E2FA 3UAGA 4GYKA 4WN9B 1KPIA 2UU9B 4AG5A 2PD3A 4IMJB 4QPPA 3LKBA 3BH7A 2WIDA 3LXRA 4WDRA 5HCNA 4CEJA 1BMFD 2CYBA 3B6IA 1SXJA 4IIDA 1O0BA 2G63A 3COSA 3W7VA 2UUOA 4HKTA 3HO8A 1A7JA 1XVTA 5ALZA 2F1OA 5FI5A 1ZYUA 5AK5A 2OENG 3CRZA 2IYWA 3I9LA 3LK6A 3NV9A 4LEIA 4BB0A 4IOLA 3ZI4A 3OY7A 1W73A 2Q5LA 2HK7A 4DRXB 3NIBA 4NESA 2GEVA 1I2BA 4H0NA 3HYTA 3OIUA 4PGFA 1SXJC 1BS9A 1DO0A 3QVUA 1V3VA 4PHTA 2G40A 3OKFA 4Z7NB 1D09A 3TDMA 4LJ9A 1VE6A 3KQOA 1RBZA 3IP5A 4G2NA 2QL6A 4BFYA 5JSKA 1L7OA 2WAXA 3VSBA 1HNNA 2COKA 5G0VA 1GA4A 1M2KA 5LDHA 3ENVA 1EFHA 3ZY6A 4PFSA 4YPOA 1YOVB 4R7GA 4ECAA 1M34A 2JFYA 4F9FA 3BICA 1CRWG 1T9KA 3BJMA 4L51A 3GPDG 1JHVA 1CY2A 1G3MA 3TL2A 1Z7GA 4ENQA 4D8YA 3FMVA 2AW5A 2FW8A 1V1RA 2PR2A 1CYDA 1DEKA 1SQ6A 3B13B 4NJEB 3B7GA 4TM8A 3ZYZA 3UMBA 4YMUA 5GIPE 3JARA 3O47A 3KJZA 5CLGA 4EQ6B 1CP2A 1WDKA 1USVA 3RTGA 1YR3A 2J5BA 3RYCB 1WUJS 4TL6A 5CX1A 4GUDA 4OHVA 2HRUA 4B09A 3K53A 3AFIA 3TPCA 4PZDA 2BKLA 3T9FA 4CQNA 2Y68A 1L5VA 3BIXA 4YMTA 2IELA 1GPYA 1SCKA 1KDPA 2V6BA 2Q6TA 1KZ1A 1AKWA 4H7EA 3SX2A 1DHTA 4JFRA 2PUGA 4DPKA 2ZRFA 2QP9X 5CUQA 1STOA 5HY1A 2AWOA 3FDIA 3HSSA 1HYQA 5AM4A 1IAQA 1K0FA 4NX2A 1M6EX 4AG3A 4BFSA 5K4GA 5CITA 2NU7B 4JT4A 5JAQA 3ANXA 1KHTA 5D86A 3NU1A 3GLFA 2HB6A 5ETJA 2PX4A 3QG5A 1UXJA 4HB2A 4I2VA 3ZU2A 4ZVSA 1RLGA 5I9BA 3V7QA 5CVTA 3K9QO 1KXJA 4Q4AA 2O2IA 5CA1F 4H60A 1FLAA 1IK4A 2QX8A 4C0JA 2J6IA 4E1AA 2JJQA 3GYBA 5CTJA 3KB1A 3W9SA 2QD4A 2YIVX 4HTFA 1TD9A 2VYVD 2WU8A 4MQ5A 4ZVKA 1KTIA 2C29D 2XT6A 2FOLA 3E22B 2G1AA 3TXYA 3D0KA 3WFZA 3LL7A 1P7WA 4D0GA 4PHHA 2C57A 3QPCA 1RXSA 4UCQA 4DVJA 4ZJUA 1LPBB 1NKSA 1ML4A 2X0RA 2XE6A 4QQRA 3M4NA 3LPDA 2IPNA 5BVGB 1B3RA 1TA4A 2WZDA 4QNNA 1MX3A 2XB6A 5JBIA 4E07A 3R7SA 1IDN1 4AZ3A 1RRPA 5B36A 1TYZA 2YQ5A 2W71A 5CEFA 2VK4A 3FGPA 4FUTA 3UMYA 3D8BA 3CCEF 3NI2A 3U49A 2E82A 2NO5A 4L95C 5DFAA 4HDCA 1LJ8A 2IUSA 3O3MB 1KJQA 4RKQA 4EFNA 4KXVA 4ZOCA 3ECSA 4C7KA 2H2WA 2WWTA 4LUCA 4BQEA 4QHYA 4JWTA 1Z63A 1RRFA 1IB0A 1W52X 4BO2A 4HLNA 3EPPA 4DCMA 2R84A 5C7LO 3NHKA 3F5FA 3TS1A 1QLWA 2PBZA 2V7EA 3I42A 1IXRC 4MB6A 3EEOA 1OOEA 1L7EA 2Z1DA 3AI2A 2QTWB 4NMLA 1RAFA 2HX1A 2Z43A 1H3EA 1PWXA 3SF8A 1M2VA 2XDQB 4R7TA 1OKKA 3K9HA 3G0IA 1ADJA 4A27A 1ZGCA 5L53A 3ZDAA 1APBA 4JBIA 1EG7A 3M6MD 3B7PA 1WV1A 3NRBA 5IVDA 3R75A 4N5NA 3UGJA 1NXPA 4G0YA 1C0LA 4W1PA 1X19A 3TOXA 1CEQA 4RHTA 2EW8A 3PQ4A 2XITA 4QPJC 2QUHA 4GBMA 4BUZA 1I7DA 3TMKA 1FVFA 3LP6A 4OHBA 3FDJA 4X3CA 3R8CA 4ZZ1A 4V1CB 3HDVA 5LZ2A 1JR4A 4MGKR 2EBUA 3HJBA 1NVTA 1P4GA 1T9ZA 2X13A 2IZ7A 3EFEA 2GZSA 3P4XA 3U4CA 3ZZUA 2I3GA 5AVXA 4BZWA 1QHHA 1VYHA 4I3GA 4ZA2A 2M32A 3EAFA 3L6RA 4X45A 5A7GA 5TB5A 5MFPA 1M6HA 4R0NA 5BT9A 2QLTA 3QMVA 4FR0A 3WK8A 5M5BA 3THOA 3TD9A 4WH0A 1NJ6A 3V3KA 3R3YA 2VVTA 1DB3A 2JS7A 2YNMC 3VR5A 2UYKA 2FXIA 3S03A 3T0GA 1W47A 1B6TA 2BR5A 2B94A 3M6XA 5SYNA 5KTPA 5FL7D 3JQ8B 4ZC8A 1U0BB 2IH4A 4XOUA 3IUYA 3EWAA 2BYTA 1REQA 2BSQA 3ZPXA 3A6GA 4NYMR 2Q5EA 1P2FA 1Q6ZA 1M1ZA 2VSFA 1JMYA 3QFHA 3NHSA 2FFJA 3R9KA 4EG0A 4ALMA 3EARA 3GJSA 2WB4A 1AKMA 1XU9A 4KODA 4KWHA 3VBEA 4G1VA 3TVDA 1P2TA 2ZT6A 3UMVA 4DCSA 1C7RA 4QG3A 2JAWA 2PZAA 3VSDA 2P2DA 3S7ZA 3P10A 1RRCA 4WASA 4X7RA 4F12A 4K1XA 3RYIB 4GXTA 2QV0A 1JJ2F 4TM7A 2Q4OA 4N5IX 2QVBA 2RSLA 4ROSA 3OVMA 2FPIA 3EDQA 2Z09A 4ND1A 2VHCA 3S1AB 2PN1A 4RF2A 1KYYA 3DMYA 3T3IA 3KKQA 4O2BB 4L8GA 3BTVA 5CXSA 3AUSA 5E7IA 1TE2A 3S02A 3C3EA 5CDYA 1HWYA 5LDDC 3SSNA 2QENA 3N2GB 3LPLA 4WOBA 3R9XB 2XDAA 2CWWA 1L8QA 3PHGA 2OHOA 5ICEA 2EKZA 4U0JA 3V8EA 3WK5A 5REQA 3N4ZA 4YJ2B 3GPIA 3OJWA 1NVFA 5DCYA 5K2OA 1Z0SA 4QM7A 1GG9A 4ID3A 4JLKA 1CEYA 3I5MA 1TU4A 3H97A 2QUJA 4LDAA 4IH4A 3AF3A 4C0SA 3O91A 1KNXA 1PS9A 4O4LF 1R15A 3BWYA 4OAOA 1I6LA 1R37A 1NMEA 1Y80A 1ZOPA 2HF7A 1S3GA 1WSWA 2QRGA 3ABRB 3MVEA 4QDXA 1JG6A 4JZYA 5F5LA 3RRMA 1TJ5A 5L3QB 1CUBA 1G42A 1UC9A 5ESWA 1K75A 2XYVA 5EWLA 1G16A 4F1JA 2X8AA 5DLQC 3PGLA 3Q0TA 1XU4A 3A4VA 1B26A 4CVNA 3V4RA 3HNOA 3KBBA 4FYHA 1QGUB 1PLKA 3OLCX 5EB1B 3VFDA 3I2HA 4D1YA 2H0QA 2EC5A 3DMDA 3F46A 3B1XA 1AQ6A 1YVUA 4N8EA 1R6UA 5CB6A 4B44A 1MENA 2IODA 5CJPA 3NHZA 3FDZB 1M90H 3T3OA 3E6AA 5C5CA 1DWOA 2X2EA 3PYXA 4OBWA 5BRJA 1G8JA 4Q1BA 1TZMA 1TO2E 1GUAA 3EW7A 4W8OA 1CVRA 4CMEC 1MRNA 3VX3A 1ZD8A 2CF6A 3NHRA 1Z2OX 1OYVA 1JL3A 3N7AA 3IAAA 3UGTA 4N8DA 4DSOA 2UYJA 2Q7XA 3IP6A 2P41A 1Z6ZA 1WZ2A 5ECYA 4F4JA 3TQFA 5BN5A 3TFOA 2H1HA 3UMFA 5GANK 1NATA 4H7DA 4REOA 1NMQA 1YZFA 2ALJA 3EAQA 2JI8A 3MTGA 3MS7A 4KTVE 3T15A 2ESRA 4DIBA 2ECPA 3UGQA 3ETHA 4MV4A 1GHTA 3ZOZA 3UCXA 4YMSA 4BC1A 3WHPA 3IQWA 3ZJYA 2BR4A 2ST1A 1XYGA 3QE4A 4GUAA 1E3IA 3INYA 3WLLA 3OMWA 1PCXA 5AVWA 1GY8A 4IFIA 1RWWA 4QOGA 3V8MA 2AN3A 3AU8A 2VHVA 4Y1GA 2C4NA 3ELUA 4PO9A 3CCRF 4WY5A 1Q21A 4PEVA 3S55A 3Q7QA 4E7OA 1ISPA 1H1LA 1V7QA 1XDDA 4FDMA 1FNKA 4URUR 1QSGA 3FCAA 5A62A 5NLLA 2R62A 2HPHA 1XB2A 4QFCA 2I2XB 1WW8A 3AETB 3EZXA 1JB1A 1EVYA 4RYLA 3BC1A 4WNIA 5ICSA 1A2BA 2GCOB 2ZUUA 1FRNA 2R00C 2QLBA 4H18A 2A5LA 1NP7A 2O5RA 2QPOA 4NC9A 4A1OA 4G0UA 3I32A 4L0MA 2NX2A 1E2JA 1L4BA 3S2UA 4TTVA 1V71A 2C8VA 3NGXA 1Z2AA 4ARVA 2UZ4A 4YAOA 1E1NA 3AIIA 2BEWB 1CB0A 1K7YA 3C8ZA 4WPGA 3WWPA 4GR5A 1WHSB 1NLYA 2Y1EA 4QUIA 2PUHA 3FYUC 3L0ZA 2V58A 4JY7A 1Z12A 4XM1A 5BQXA 2CVPA 3KTAA 1U3CA 4EJ6A 1U94A 1JH8A 3GT4A 4JLNA 421PA 1GUFA 4RVUA 4GZLA 1IYZA 2PUJA 3JQ8A 3EPKA 2X9LA 2B92A 2EU8A 3DP7A 3GA7A 3U3OA 4URVR 5BWBA 4UMDA 3K2QA 1AK1A 2ZR8A 4R84A 5DHFA 3U39A 4FGSA 1R1MA 2C00A 2ZKIA 1U8AA 4O2BF 4OQQA 2HX0A 1KVTA 3IUJA 4KQ6A 2Q50A 5D1NA 5C5DA 2G0TA 5TQ0A 1ODLA 2Z0MA 1GILA 5DB4A 3FN4A 4F60A 2DLNA 4MGYR 4ZHVA 4HQKA 2JGDB 4DG8A 2EERA 2H2DA 3FI9A 4M8SA 3T3PB 1G66A 1I6MA 2WF7A 1EFDN 3VTZA 4AIIA 4KREA 3SDBA 2V6GA 4ZGBA 2EOAA 3OECA 3PA6A 6YASA 2BZ1A 1XZFA 2LP4Y 1U4SA 2JFGA 4I1OA 4DYDA 3CUKA 4DUYB 1MMFB 3PA8A 2GZMA 2C96A 1QK3A 1K5GA 2CNBA 2WTEA 3A1VA 3FNBA 3TB4A 5AM0A 4B6FA 3HK2A 3EJ6A 4I5EA 5C7YA 2QLNA 4CIYA 5A0VA 2P2NA 4G86A 1VE9A 1U28C 3IR6A 5ENZA 3PHBE 3Q3EA 5DHUA 3EXFA 4PHCA 1E89A 4BFLA 1XCGB 4BNKA 1VE7A 2AI3A 1LI7A 3I9V1 1CUEA 2D4HA 1Q0PA 1QAOA 3A9WA 1XAGA 3CUEF 3P26A 3OKAA 5DBHX 1AE1A 3AMVA 4BVAA 3PPVA 1QH0A 3O2NA 4II7A 3HVUA 1TIBA 1E0DA 3ONDA 3WWOA 4TLAA 1IY9A 2AXQA 1T8UA 3PQ5A 4E5PA 1GGMA 1U0LA 2QUAA 5L3SB 1GAXA 5J5CA 2H1FA 1N7GA 3ESCA 2XAAA 3KUCA 3GP5A 5C3UA 1EFPB 2XI4A 4B79A 3VZDA 1GNLA 2XLCA 5FOVA 4HXEB 4UZFA 4TT3D 5HKLA 3U9TA 1NV8A 3CLRD 3CNBA 3SCZA 1ZU4A 2JLSA 1LVGA 5DTQA 3PKIA 3UPUA 5AI0A 1L6IA 2B4YA 4QAJA 5IAJA 3LVRE 2AG0A 1ZI8A 2OCDA 2QTCA 3CO0S 2GJAA 3FNHA 4UTXA 4QG7A 5C31A 4Q7JB 1H2YA 3RS5A 4V1CA 1D0VA 4LF4B 3VOBA 1G0NA 1JT9A 2VDQB 4KVZA 3TL3A 4JB8A 3JXEA 4RK5A 1P33A 2DLDA 2RD2A 4GPIB 4V0LA 3E18A 3WDSA 3OG9A 1NG9A 2FC3A 1GT91 1JTVA 5AKJA 1UZUA 1XXHA 2N47A 3O3OB 1V3QE 3RSFA 1TADA 4JKYA 1L5NA 3TZ6A 2OV4A 2W0MA 3B3FA 5K0LA 3AF0A 3VV2A 5ITZA 3RDPA 3C9UA 2EV9A 4HTFB 2F9LA 5CA0F 2H00A 4L4UA 1YNOA 5FBWB 3KPVA 3LH5A 1K73H 1H4VB 1DRJA 3CLRC 3BOSA 4MCAA 1KERA 2YBEA 5IJ0A 1Y37A 4NDAA 3CR7A 3NWBA 3WL8A 1MLDA 4AU1A 4B84A 1N8TA 1NOKA 3OIWA 2RC5A 2C4WA 4RJTA 1J0CA 3BK7A 1I2ZA 1P45A 4NKRA 3T3DA 2GHTA 1XD9A 1ZCAA 3QBVA 4XLTA 2GJSA 2W42A 2WG1A 3MCAB 1U2GC 3RV3A 1VOTA 2HA7A 4F3RA 2RGRA 5LOVB 5E6SA 1X7DA 4Y6GB 4AKIA 3QVVA 5BSHA 2H51A 1J0XO 1E59A 1KBOA 1T3HA 4ABTA 3I2JA 2OMKA 2ODPA 1VG8A 5A6SB 3VGJA 2ZOSA 3DEHA 3E9RA 2RGBA 3KE1A 3ZLJA 2A1UB 4PX5A 4MRAA 3DHNA 3MUFA 5HTOA 2IEDA 3NWJA 4XB6B 1A5ZA 1UMDA 2CUZA 3DV2A 1P4AA 4KPYA 3H87A 1NLUA 2JK1A 1LGYA 3I72A 5GZ6A 1E63A 1FP2A 2AVNA 1DO8A 2NZ2A 1MC1A 2X1VA 3B6JA 1CY7A 3BFJA 4EHLA 1ZKDA 1K2VN 1PGOA 2VTEA 1A4IA 4PFQA 4G36A 3TOCA 3OU7A 2CHQA 1AMNA 2J85A 3AP1A 2W6MA 1Q7CA 4UUNA 4KHPB 2WPDD 2UXBB 5GTDA 3C1UA 5IAAA 1EM8A 1RWXA 1UR5A 1N9GB 2RAUA 1FDOA 2VHTA 4JS0A 4LOLA 3KYIB 4MVJH 3URMA 4L5AA 1BJRE 1UINA 2A0FA 2JDIA 3A04A 2GYVA 3F8SA 5CCEA 2EJCA 4BX3A 5B37A 2IQQA 4UOZA 5A06A 4RY0A 4OHZA 4HHEA 3BGSA 1G5PA 3DZFA 4LMRA 4Y9SA 1BXZA 4V0RA 2HWYA 3CEJA 1QPGA 4HAZA 1GCAA 4RY8A 3S29A 5KHOC 4ZCSA 4Y1RB 3SICE 1XQ1A 2QA4F 4Z9BA 3UQYS 1E4YA 4YRJA 5A2QM 2B1GA 1UAAA 2WP0A 4I4TF 5C8ZA 3OOJA 4HWTA 4WQMA 2JGNA 4ZT5A 2I4NA 2D1FA 3MT0A 5KTYA 1GNTA 3DT6A 4O4LB 2CMGA 3E2IA 1H69A 4PZ0A 3C4QA 1LDYA 2W6PA 2Q4BA 2RH9B 3WGOA 1P9WA 2ZJ8A 5A4JA 4RTSA 2CLKB 3CMAF 1O89A 3IAUA 3VZQA 1KDZA 2ZUWA 2I8CA 3X0DA 3QOXA 4DUGD 3GLGE 3PXEA 1QB7A 4HYQA 4UHBA 4UOQA 3NNSA 1FFHA 3R7WB 5J4HA 4RVFA 4MQMA 5BVHB 2AG1A 3EFHA 4MUFA 4HAIA 4XTCS 3WRVA 4FYVA 3F8WA 4Y2HA 3K0SA 4WKOA 2BHRA 3MMXA 1JYFA 4KDFA 3ZCUA 2JLRA 3IHWA 3PPXA 4MW9A 1WL8A 4FKBA 3REGA 1VB5A 2B98A 1E4VA 1U8FO 2O8NA 2WYVA 4LYEA 5J59A 3KSBC 2C58A 5SZHB 4DV5B 1OYYA 1Y5LA 3AINA 2AZDA 5I7SA 1X8LA 1SUSA 2O2ZA 1SWVA 3WGIA 2PXAA 4I46A 3UGKA 1GDTA 3OCJA 4RQBA 1JXQA 2E37A 4HGPA 4QEZA 3DEAA 3IEXA 4QEKA 1WKCA 4QVGA 1J9ZA 4DHWA 5DNYB 2HYIC 1F51E 5JY6A 3I37X 4UVDA 3R2JA 3IIIA 2CHFA 4X93A 1FA9A 4OD0A 2B33A 4ITUA 1ZUIA 4FBMA 4Q9HA 3FMPB 3AZQA 3RPEA 4BMZA 5C8YA 1ZJ5A 3TBFA 1O8CA 1JSZA 1C5KA 5CRIA 5DM4A 3ZGLA 1U1IA 4BBAA 2AJBA 3VQTA 3ZC3A 2C61A 2PK3A 5CDGA 3RQSA 3DM9B 1P9NA 4ZEOA 3VCZA 2C9YA 4WFIA 4D25A 3WRXC 3CZ4A 4NZYA 2MTBA 1FFAA 4N82A 4YUVA 3WI7A 1YH3A 4EB8A 3FTPA 1EFPA 1WF3A 1XRSB 2OZBA 2C3YA 4L07A 2W2LA 3BT7A 2OSBA 3ZS9A 2DUWA 4ISBA 3GZNB 2QVLA 2CKMA 1G64A 1QR6A 1XCJA 3EC1A 2ZS9A 1PBTA 3PC4A 4GQBA 4KL8S 1NU8A 3TINA 3EK2A 1GL6A 1CIJA 1NUTA 3KR9A 1J5XA 1NNI1 1NR7A 2FFHA 2P6NA 4HDKB 4NBRA 1WXQA 3ZHRA 2XCSB 3IT3A 1FUUA 2BBTA 2ECFA 3DCNA 5D84A 1EU1A 2HFJA 5LZ4A 1ZBDA 2HF9A 4W1SA 3SFZA 1NVEA 1R5BA 1RAHA 2J6HA 3PC3A 4E1BA 4EITA 3NRCA 3IAEA 3S0YA 1NLMA 2DFDA 1II8A 3K4QA 4RENA 5F23A 1UK9A 4PAQA 4JJFA 3B1ZA 3DMRA 2FOIA 2PH7A 4RKEA 4UUPA 4V02A 3E4DA 1FS5A 2JLAA 4Y1FA 2VPWA 2ZTSA 1YTUA 3E7PA 4WWHA 3QOYA 3DBLB 4DDHA 3PP8A 4WBSA 4GM0A 3GZNA 2QJWA 4Q1FA 4Z9AA 1K06A 5A05A 1CC1S 1F1JA 3BB1A 3IRVA 5ITWA 1YBMA 3L1VA 2P3LA 4MEJA 3ZIAD 4BNZA 1RCTE 2QOEA 4V0MA 2XMZA 4LFAB 1XMOB 1D2GA 1NAHA 3B20A 3HSYA 4AVYA 4EVSA 1F8XA 2ATVA 2GJ4A 4U6QA 4AQDA 2BV3A 1NQUA 2W58A 4B3BA 3DWGA 4DLAA 5IPFA 5AUOB 1ULSA 1KFJB 1IEWA 2R00A 3CU5A 4RFLA 5F1YA 1L5MA 3BWBA 3V8VA 5LR6A 4UUQA 5JVDA 1EFVB 3ORRA 1JF8A 3F71A 3ZKAA 3ZWOA 2O6HA 3E1KA 1RD4A 3PFBA 4I9HA 4D6YA 3UJHA 3RYFB 1M2FA 4QUJA 2Q8PA 1CPYA 3AM4A 4MKHA 3ZXIA 2PHZA 4N5LA 5E4TA 5JRZA 4O8CA 5EMNA 3L9WA 3A6HA 5F52A 5KTOA 5CH5A 1NQ5A 5BP7A 4Q3AA 2F1JA 4OVKA 1HFEL 1JSXA 4FQ5A 4TVBA 3B9RA 2YYZA 4TLEA 4OMDA 3U7QA 3FB1A 4H1UA 3WGYA 1DPFA 3FSGA 3H4MA 1OQAA 3LUHA 3NYRA 5CDSA 2ZCJA 4BVSA 1M7HA 2VT6A 1C2YA 2YJ3A 1E58A 4RE5A 2ZDHA 3DAFA 3G85A 3N70A 1BXGA 1J2YA 4MV8A 3NDIA 1W9HA 2A5YB 3PL5A 4JH0A 4MGHA 4K3VA 5FOUA 3T7TA 3VNBA 5L4LA 3RSQA 1NJSA 4BWVA 2NSHA 2DFPA 2NMVA 1JILA 1L7MA 1HG0A 1XZQA 3TLAA 4QECA 1J2JA 1Z83A 3K9NA 4KMMA 1L7DA 2KE5A 4LC0A 4M60A 1XTUA 2CDNA 1SD1A 1KO1A 5KINB 3ETCA 5CVEA 1JQLB 3VH4A 3E5HA 2IS4A 3DWEX 4LRYA 5CM2Z 4TS4A 2UYPA 1H1TA 5JJBA 2O8FA 1I3KA 1PVDA 4YJ3F 1IZZA 2C5AA 4RSHA 3SYNA 4ENSA 1T9DA 3GLVA 4A8JC 5ADWA 1QWOA 4JAVC 4Z99A 1P61B 1VPEA 1I8TA 3TGLA 1AK9A 1JFVA 2J45A 2GZLA 4E2FA 4IDNA 3E7DA 5T7BA 3F7TA 3JZFA 4XX1A 2A86A 3ZV6A 1GPUA 1SKMA 1YDEA 2NVUA 1A4RA 1Z0UA 1U9CA 3A4LA 2HMVA 3I6IA 3L6UA 4NG5A 1FP4A 5HTKA 1Y1LA 5KI6A 3RKUA 1A5TA 4C4YA 1FRVA 1QMPA 1BD4A 4DLYA 3KE8A 3WLAA 3FGNA 3DONA 1J0EA 1LQUA 4TSKA 4KBYA 1YOVA 821PA 3OCZA 1L5RA 4YQFA 3N5KA 1SG6A 2GA8A 4EGCB 5IJWA 1TQHA 4RCVA 5EGSA 2VJBA 2HXSA 1TTQB 1U98A 4KLZA 3ZCQA 2DWQA 2SNIE 3LGXA 2AR9A 1KMNA 1N0VC 1PR3A 3QW2A 3V8PA 4BKPA 1CLEA 4N76A 5TF4A 1C7FA 4CKXA 2Y27A 5J1SB 1ZNXA 3B3GA 4M1WA 4TVKA 3MD0A 2QQEA 4D0LB 1DX9A 4FWIB 4MSUA 3RREA 4JZKA 5IUKC 5AW7A 3ZDRA 5BMVF 4PAOA 4CU2A 3SLKA 4FEYA 1HV8A 3O82A 1ZD2P 5C8YB 1Z73A 1RMTA 3QJ5A 4GNKA 1VIMA 1AD2A 2YVQA 4PG6A 4EA9A 3G6WA 3WHLA 5A6SA 5FAKA 4U6NA 1JIUA 2LBXA 2V96A 3PNPA 1Y1KE 3HB5X 3I5AA 1H2HA 4MXDA 3JX9A 1VCOA 5CNMA 3DNMA 2QLJA 4O4JA 2Q1UA 3MG9A 3QBDA 4ZP1A 1RBMA 4PRYA 5EHGA 3TYXA 4AF8A 3S8YA 1M1XB 1HDRA 1J33A 2BFCB 1VQKF 2W2MA 4OX9B 1PJAA 2YIMA 1OJLA 1PZGA 3FYTA 3QLVA 2IS1A 1P7YA 2ROQA 1Z88A 1F20A 4DMLA 1JD1A 1P0QA 3RE3A 1JDVA 2JFZA 5HZMA 2V3CC 1RS0A 5BSUA 1CJKC 3L04A 3W6OA 1WKBA 3AVPA 4WNYA 2AIFA 1PR1A 3QK7A 1VCHA 3MCZA 4QFBA 2H4JA 3TXAA 4NABA 4ITVA 4V38A 3O21A 5EEGA 4F7WA 1FLVA 3G9ZA 2FPIB 3QITA 3TLBA 2XA2A 5MGBA 4ADSG 1DKOA 1TEVA 1IH8A 1VPVA 1U0FA 2D8AA 2CB0A 1W4LA 3NT5A 4NPAA 1JMVA 4ZQIA 1M1YE 2OMEA 4UC0A 5EFOA 4ZDIA 4ZYYA 1JIIA 3DL7A 3GGDA 2X5NA 5DIFA 3UAYA 4G5RA 3VJMA 1O6CA 2VJYA 1B0ZA 1GFIA 2II6A 4TV8A 1ZOSA 2QUZA 5G0UA 1Z18A 2DFNA 3AYZB 5E4YA 1V8ZA 2Q2NA 1SXQA 2JAHA 3BZBA 4AMYA 4Q3CA 2AOTA 3H5LA 3N5CA 4ZJPA 3TEJA 2O7SA 2LCIA 4ZI7A 4HH4A 4JLPA 3VRHA 2IX9A 4A0RA 1KAMA 4IXMA 2GCPA 4L4XA 2P3OA 2UZ0A 4U7FA 4YQEA 1TL7C 2FPSA 2AFIB 3AL3A 3K96A 2WLSA 4LE2A 3D9QX 3F3SA 4G1UC 1KJYA 4GOXA 5DGHA 4LF5B 4RF5A 1ST2A 2CFOA 4ZI7F 4OHCA 2GUWA 3CEAA 1KQOA 3GJTA 1M2HA 2O2CA 3ISVA 4QNRA 4WCDA 1QYXA 1GTMA 4GDMA 4IVNA 4M1ZA 2I4RA 5JECA 2V59A 3EB9A 3MF4A 2OHWA 1XYYA 1EGHA 4HYTA 3HCFA 1WMBA 5JO0A 3Q8HA 1OZ0A 3OPMA 1JVNA 3IA2A 3NTQA 3PQ8A 4LSGA 1ORRA 2OAQ1 5EAIA 4C7OB 3OCUA 4HAVA 1CJVC 1ECJA 1F12A 1OREA 1K7FB 3CJQA 1NJ2A 4N49A 1QM5A 1EP9A 2GZ1A 2VHWA 1B41A 3AHEA 4LDQA 3SC2A 4DSUA 2R6R1 1KP3A 3TTWA 3O1IC 3UWOA 1ISSA 2BMVA 3GUZA 4TSFD 5IZ4A 4TMWA 1WB9A 5JVDB 1EFVA 1H42A 4DG5A 2P9QA 4HDMA 2ZG6A 2AKYA 4JUCA 4NL4H 3T3HA 1UBFA 2XGGA 2PR7A 5T3UA 2QMYA 1A97A 4IFBA 1HLGA 5BNIA 3QXJA 2F3TA 1Z2EA 2JIRA 4RAOA 2Z1UA 3ZJ4A 3K31A 2X58A 1P2VA 1Y9EA 3ADPA 1IC6A 2AFHA 4K03A 1XRGA 5J47A 3QTYA 1ZN9A 3IILA 2EKPA 1GG2A 4JBHA 4C4AA 4E31A 1BVUA 3OIGA 4WXYB 3JQAA 3KZKA 3K32A 1QBGA 2YVKA 3MWLA 4U5XA 2YXPX 5JMPA 2E7ZA 1YJBA 1M73E 3H5IA 4YT5A 3QRWA 1AV7A 3SWWA 2BFBA 3UC9A 4E09A 3UYLA 4IH9A 2YC2C 1X39A 2YS6A 5LQKA 2BM8A 2IYXA 1A9QA 4GMFA 1I01A 2JHPA 3VU3A 4DZTA 5AW2A 3VUFA 4NARA 1JEEA 3ZCPA 1P3JA 2I22A 4XYBA 2OFPA 5B4VA 3HY3A 2X3YA 3TX6A 4BAZA 4LYAA 4IMRA 4RK0A 4JYCA 2X6TA 1J7KA 1ZN7A 3ZV4A 4BASA 3AP2A 1KYWA 3C15C 3KTAB 3OJEA 3ZDFA 4HUQA 4CUZA 6LDHA 1AS0A 2UZAA 4UM9B 3CB4A 1TU3A 1BMDA 3LI2A 3L82B 4DIFA 1UDRA 3VR5H 4GMKA 3ZI0A 3LX4A 1PFKA 4FS8A 4G1FA 2FPUA 1U0HC 3F7NA 3K0AA 4BLTA 4WKPA 1TRHA 3KLMX 5TQ2A 1QZXA 2ETXA 1HOXA 1IZYA 3S2IA 4D8XA 3D0RA 4FDVA 4LRSB 1V9LA 4XTRA 4A1FA 2FDCA 1E62A 3DE2X 1BXKA 3QA3E 1OLUB 2F3QA 3CJTA 3UC5A 2FPPB 1HDZA 1RYMA 4ZAYA 3M4XA 1S8OA 2C5LA 4I1SA 1JR2A 3BJIC 4LXQA 2W22A 1YFLA 3PF8A 3Q7RA 4PCUA 1HY3A 1Z45A 1XLTC 3M9LA 3LUFA 4G9BA 3TSYA 1S5PA 2A6PA 3V4ZA 3V4LA 1JDJA 1DIGA 2AFIE 1PHPA 3WV4A 2PGJA 3OIDA 2V1UA 4BKOA 1V43A 2QI2A 5EUQB 2AYYA 1V25A 3IAS6 2WPDA 4QHTA 5IJXA 3OONA 4ZV4A 5HJEA 2SKCA 5H59A 5ESXA 2Y1OA 1DJQA 4KFUA 3O26A 3W5AA 5KPDA 3NM6B 2GR9A 2J3MA 3LCRA 3NR2A 5IVHA 1CE8A 3N53A 1AKEA 2HHCA 4RE6A 4PV7A 1N2CB 2FW1A 2X77A 4NZ9A 5JLAA 1FIUA 2AZ4A 1BZYA 2JLBA 2XUPA 5C34B 1CQJB 2WIGA 3RLIA 3T12A 3TM4A 1OBCA 2IHBA 4UHJA 5HEKA 1ZWLA 2QXYA 3T8YA 3HUFA 3MLEA 4GEKA 3NUZA 4UBJA 5L3RA 2NZVG 1ADCA 3A1TA 3OC0A 1O5TA 4PIMA 1BN7A 4EIWA 1G20E 4C0XA 4GMXA 1JAHA 2F55A 1JTFA 5BSGA 1D2AA 2IH5A 1PEKE 1CUYA 1RLIA 3QKTA 2PL3A 4YP0A 2UYNB 3AHIA 2VH5R 1COMA 2QMHA 4WEOA 3TTTA 3A31A 5EUMA 2QT9A 4KIJA 1YI0A 2IPXA 3VA7A 3BB3A 2WHYA 4E4TA 4JYBA 5TNXA 3Q7EA 4JA2A 2OYCA 2OV3A 1V6SA 1NUQA 1Q1GA 1P4JA 1TVCA 2BD0A 2O8VA 4UTOA 4YRQA 2ZUFA 4GE3A 1D8AA 2HNAA 1SBNE 2IZ5A 4OO3A 4BYGA 1L1QA 1FTSA 4TMYA 3FUVA 3DO5A 1CY0A 1O94C 5MDHA 4XR9A 3I34X 4BT7A 3A28A 5IARA 2EJUA 2POCA 4E5MA 2O2DA 1OBVA 2QU8A 4N4AA 4NU6A 1UT6A 1KOLA 3QQ5A 2VJOA 1Y5IA 3H0EA 4IQFA 1XZHA 3PLAC 1Y7TA 1DTWB 5K8TA 5B3LA 3UOGA 1O97D 1IEQA 3ENZA 2C9MA 4P83A 4CM1A 4F72A 3M9XA 2FR1A 1VKRA 2QP4A 4WN9A 3RVRA 1GEEA 4UEKA 3O3NB 1OLSA 5GP1A 4KYVA 1N0UA 1SULA 1CJTC 3W9BA 1GPBA 3LL4A 4M7RA 1KRWA 3JRXA 4FLFA 1VRWA 3ENWA 3VR6A 1A96A 2QTHA 2ZYAA 1YRQA 4FZVA 13PKA 4NZPA 4UUAA 3RU7A 1H1LB 2O1SA 4AJLA 3AVQA 5IASA 2PUTA 2MSNA 4ILEA 2VPIA 5KS2A 2B5VA 4HVTA 3MB5A 3ZJ5A 2ADOA 2ACKA 5E1MA 3HLKA 4D3DA 1TC1A 3EUEA 4IX1A 2PVPA 4D0RA 1FYEA 1CUCA 2XCOA 2XMSA 3MGAA 4UBNA 2FZ5A 2ZVPX 4ZHQF 4UNRA 1YRYE 4IOJA 4UASA 1F2VA 4L75A 4PGHA 3HJFA 4OHMA 1F60A 1Z2CA 5AK0A 3PXCX 2HN9A 3EHEA 5ALNA 4ARUA 4E5SA 2A4MA 4J0CA 4WINA 4C30A 3LM8A 4BCCA 3NASA 1V39A 4NZZA 1GUBA 4XWTA 3SBDA 3HXOA 2DQ4A 2WTBA 1AHHA 1II0A 4QGFA 2VWHA 4CL3A 1M6NA 1KFEB 1QQTA 3W3AH 1RBQA 4W9NA 5DCUA 3UUEA 3HXLA 1G38A 3ICVA 2G7MC 5B1EA 5AKKA 3SYRA 2LWIA 3QYPA 4B46A 2OHVA 3DF7A 4N54A 2AL7A 5E1DA 3U6BA 2AEJA 2OFXA 4LHWA 3Q9UA 3WLJA 5TVKA 2WE7A 2FUG1 1SVIA 3O9ZA 2RGGA 3KWJA 4C2UA 3W7BA 4X7MA 1X74A 5JAUA 1WETA 3FBTA 2QKYA 2R8RA 1DKPA 1PTJA 1Q86H 4G4XA 4PSAA 1PG5A 1XWFA 4GI2A 1TQDA 5E1BA 5GIPC 1KC3A 5JYCA 1HA3A 1VLHA 2VP5A 1GDHA 2I6XA 3QNWA 1IPAA 5ARCA 1Y9ZA 1EXMA 3FGZA 4MVCA 1E92A 2ZYWX 3R6GA 5H02A 5J1TB 1HK7A 2WSLA 3K12A 1DKUA 2DFKB 4B62A 3C0KA 3C7TA 1R5OA 4XKJA 5HKBA 1CF4A 3PEUA 3A1EA 3M6UA 3HXPA 2PGLA 3R0JA 5IEBA 5A0FA 4P22A 5FJIA 2VOJA 2X0NA 2BEUA 1B73A 2AWNA 4HN9A 3O9VA 4N1AA 2O2YA 1M33A 3BDAA 4NCBA 2Q4EA 4TTTS 3E82A 5DTIA 4C81A 5JNVA 1RXEA 3AILA 4NZNA 5CNIA 1K6IA 2R8BA 2OG2A 1KQSF 4GNRA 4BRWA 1T1JA 2YV5A 3UXYA 1W5SA 3WR5A 4BB6A 3ERNA 4CLOA 4II3A 1WXHA 4HXYA 4IV8A 2IPLA 4AWBA 4RHXA 3NUGA 3ESDA 4Q0MA 4J0IA 2VF8A 1H85A 5TQVA 3UCEA 5K0JA 4CEHA 1QTQA 1DKNA 4DLLA 1W8DA 4LAFA 3EDOA 2QN7A 5JS6A 1XCPA 2PGXA 1ADGA 3NBMA 4BHTA 4M6WB 5KYXA 2J9FB 3V7YA 3CVXA 1E61A 1KYTA 4R8SA 2OBMA 4PLPA 1TT5A 4XCXA 5CAEA 3RHZA 1BJTA 3CXCF 4QAQA 1MH1A 2J3HA 4HEQA 4M8LA 3LAWA 2JLWA 4DMMA 1CQJA 1PR6A 4KO4S 2WIFA 4IF4A 4PR3A 1NC1A 5BORA 2V54A 3WYNA 4EI7A 4JT2A 1E5VA 2FPOA 3MC1A 1Q12A 2I67A 3C8MA 4GVXA 1Q95A 4PLHA 4OQZA 3WLEA 3OJOA 4KE7A 1RCUA 1LUAA 4YRAA 4G0WA 1YQTA 4RTNA 2GLUA 2OHJA 1YB7A 2R1VA 4RH0A 3HPQA 4M89A 4Z9FA 1N33B 5DI3B 1U5CA 3AGKA 4HG2A 1NYTA 4BOYA 1J7HA 2G0NA 2O2SA 5AO9A 1TUIA 4HEA1 4JN6B 2O7RA 1U2DC 1OC4A 2HREA 4AKEA 4AS3A 2EQAA 4ATNA 2GZHA 1ND6A 2D5CA 2XMCA 4OK3A 1V26A 4URWR 4F04A 5JH7A 4ZU1X 4F8JA 1P1RA 3D64A 3WFIA 3PGJA 4ND4A 1UPCA 5C1IA 3PXDA 4NENB 5DNAA 2PQ2A 1K3FA 1KRXA 3DLHA 5BSVA 5ECDA 4D4JA 1A69A 1A5SB 1G4HA 1MO4A 1QYRA 2W2QA 3PITA 1BRMA 4O3MA 1WW3A 5COQA 4QJ3A 5AJTA 2FPRA 4F46A 1Y3HA 3QBEA 1N2GA 3FYUB 4P08A 2Q99A 2VLIA 5JCXA 2OO7A 1LSJA 5EHQA 1NHWA 1N2ZA 1I7PA 3V00A 1OGIA 3WLTA 3WMWA 3OO1A 2BF4A 3SS8A 7YASA 4QYTA 1M8GA 5ADHA 2YY7A 2QAGB 4Q7MB 3IQGX 4R8VA 3R20A 2XWJI 2YZGA 3KQPA 4EY8A 5MN6A 3PEVA 2I2AA 4YCDA 3PC8C 4NBSA 4OY3A 1WR8A 3HRIA 4AZTA 5T6MA 5KSOA 3QXCA 3L18A 3Q8MA 4EMTA 3QA9A 2C42A 4EGFA 2A0YA 1Y8ZA 1MA0A 2XNHA 4H6WA 2DKFA 5DK6A 1HYBA 5DGDA 3G8YA 1QYVA 1VIYA 3AZOA 3JQGA 5FBHA 1PEAA 4LC1A 2IDJA 2KJQA 2HFKA 1E66A 4K3UA 3WIEA 3L8CA 2CKDA 1NM5C 2O06A 3U4DA 2IHTA 1AHIA 5CFQA 4IIFA 4IWXA 3BXZA 4RK4A 1R8YA 1D2NA 2CNLA 3PEWA 1NY6A 2FW0A 1W40A 5D7BA 2VQDA 1P9RA 4GZ5A 2XYRA 4KXUA 1T5SA 1QQ5A 3IT1A 4F06A 1EUQA 3LQ2A 4NXMB 2ET6A 1R27A 2J3LA 4P8RA 1PWYE 4O4IF 2QL7A 3Q8KA 4ZTZB 4Q47A 4RHUA 2BGGA 1XMPA 4DIMA 1C4XA 1MXFA 3BRQA 4GZ6A 4RVOA 3MS2A 1Z35A 3NC4A 1W581 4NNJA 2D7JA 3A8TA 5L7TA 2R8OA 3MRSA 3OIFA 4ME6A 2XAUA 2P6YA 4J49A 5AJYA 3NIGB 1L5GB 4DQXA 3AJRA 2W9XA 2GETA 4TSRA 4YAGA 2YWCA 2J48A 2R68A 1Z4JA 3IJPA 3COWA 1OLSB 1DI0A 4Z4EA 1RXCA 4KSBA 3OJXA 1GTG1 4QZVA 4YRDA 2R4QA 4MUGA 2GFIA 3ZDYB 3GEBA 5ALPA 4B3HA 1F14A 4D44A 3K9FC 4CEJB 2XD9A 4ED9A 1PJRA 3S3TA 2C9ZA 1L5FA 1ZOOA 3KTFA 3R3VA 4EZIA 5J4YA 2BHTA 3FBWA 1SCUB 4EKIA 2BY4A 2ZIZA 4CLRB 2ZRDA 4HSEA 4HQFA 2Q3HA 3ELBA 4OEHA 3UBTA 3EAGA 1VIDA 1NDHA 3RWMB 4XJVA 1X7PA 3A9VA 5EIAA 4BUJA 5JZVA 1SXPA 3BB4A 1YXMA 1N4AA 3I76A 5DO9A 2YV2A 1Z6AA 2AEFA 4DLKA 4S1VA 4J94A 3KXLA 5E2AA 3DE4X 4BKRA 4E4YA 4IW3B 4PBTA 4S1NA 1VQLF 1G59A 3G1TA 4LZWA 4NULA 4TMVA 4B73A 4HGZA 4MPPA 3P9YA 3PC6A 4GP9A 5LVAA 2B6NA 2YFQA 3PAFA 1XFDA 2I54A 2C9OA 2L42A 1USIA 2A1UA 2IYZA 1O5IA 4PYMA 3NP9A 3H8SA 4N5DA 3SYMA 4LNUA 3MUEA 2R87A 4P0PB 1LSUA 1ORHA 1W4BA 2TECE 4G4ZA 2P91A 3OZGA 4NOJA 4EHNA 1I36A 3JQDA 2XCUA 4LHSA 1CULC 3E9CA 2NTYC 1EQ2A 1TQ2A 1PR2A 1ZD4A 1VQ8F 4O5AA 4R2KA 5FF9A 3I58A 2AMLA 3RANA 3TLMA 5HYVA 5KQMA 3WLQA 4AX8A 4YJFB 4EQ6A 2W5UA 3F6EX 1ELOA 2IXAA 2Z1MA 3FKQA 2NUBA 5DGTA 3K5IA 5F77A 2E4YA 2P4UA 4YNBA 4WA8A 3WA7A 1QPZA 1Q84A 2E6UX 4RM3A 4XWYA 4Y7DA 3MK31 1NVUQ 5BWMA 2XZTA 1D1TA 1GRCA 1W93A 4ZVQA 3FLMA 1DHRA 4OB6A 2IVFA 4L16A