3WGNA

Staphylococcus aureus ftsz bound with gtp-gamma-s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 106
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgnA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgnA01
1JFFA 4B45A 5J2UA 1TUBA 4EB6A 4TUYB 3ZBQA 1FFXA 4WBNB 4O4LB 5JVDB 4TV8A 5LP6C 4O4JA 1TVKB 5LP6A 4HNAB 1W5AA 2BTOA 4U3JA 4ZI7B 4IIJA 1JFFB 2Q1XA 1W5BA 3N2GA 4TV9B 5LOVB 5CA0B 4KWEA 4EI8A 5EZYA 4I55B 5IYZB 4TV8B 4YJ2B 3RYIB 5ITZB 4O4IA 5LP6B 3HKDB 4U3JB 5LA6A 2GVIA 2BTQB 3VOAA 4I50B 2VAWA 5FNVA 3ZBPA 4F6RB 5C8YB 4EI7A 5KMGB 2RHHA 2XKAA 5M7EA 3JALA 4TUYA 4WBNA 4X20B 1TVKA 5FNVB 4HNAA 4ZOLB 4ZI7A 3RYFB 4TV9A 3M89A 3JARA 5JQGB 5LOVA 1W5EA 3JALB 5CA0A 5GONB 5JH7A 3V3TA 4I55A 3JAKB 5IYZA 4YJ2A 3RYIA 3VOBA 5ITZA 3JAWB 3HKDA 2VAMA 3HKCB 2BTQA 2RHJA 4I50A 3JARB 2VXYA 5EYPB 1RQ7A 2RHOA 1RQ2A 5C8YA 3HKEB 4DRXB 4M8IA 4F6RA 5JH7B 5KMGA 3HKBB 5EIBD 3VO9A 4B46A 5KX5B 4X1KB 3RYHB 4EI9A 4O2AB 4X20A 5J2TB 4O2BB 4DXDA 1FSZA 4ZOLA 5CB4B 3RYFA 3VO8A 5JQGA 3N2KB 2R751 5GONA 3WGLA 3JAKA 4I4TB 5IJ9B 3UT5B 3JAWA 3WGNA 3HKCA 4X1IB 5EYPA 5CA1B 5LYJB 4DRXA 3HKEA 3E22B 3HKBA 1OFUA 5KX5A 4X1KA 1SA0B 5JCOC 3RYHA 3VPAA 4O2AA 4FFBB 3M8KA 5J2TA 4O2BA 2Q1YA 5CB4A 3N2KA 1RLUA 1W581 3JASB 4I4TA 5IJ9A 3UT5A 5IJ0B 5MN4A 4YJ3B 3C8LA 4X1IA 1W5FA 3JATB 4ZHQB 5LYJA 3WGJA 4LNUB 5CA1A 3E22A 2RHLA 5MN5A 4O4HB 1W59A 1SA0A 5LXTB 4FFBA 5BMVB 4X1YB 4IHJA 5J2UB 2VAPA 1TUBB 4EB6B 1FFXB 3RYCA 1Z5VA 1Z5WA 3JASA 3CB2A 4O4JB 5JCOA 5MN6A 3R4VA 5IJ0A 4IIJB 4IHJB 3N2GB 4YJ3A 3RB8A 3JATA 4ZHQA 4LNUA 3WGKA 2R6R1 2XKBA 5EZYB 3RYCB 4U39A 4O4HA 4XCQA 4O4IB 3WGMA 4E6EA 4O4LA 5LA6B 5JVDA 5LXTA 5EIBC 5BMVA 4X1YA 3ZIDA
chains in the Genus database with same CATH superfamily
2FJPA 3IQGX 4JLOA 4KQ1A 3ITNA 5HY4A 1AQYA 1TJ4A 5ADUS 4N65A 2I8AA 5EJ8A 4H1HA 3O84A 2IUFA 2V6FA 1JJIA 4Y2GA 4G88A 3L4SO 2RHDA 3QVOA 1BNCA 2R7AA 4WUVA 5DHAA 3GCWA 3I72A 1XRPA 3B9QA 3Q88A 3RSZA 3ZGOA 5IT5A 4OQ4A 4DZRA 3L7OA 1QS0A 2CBXA 1EFPB 3FNRA 2Y1CA 1G20E 4PYMA 1QVGF 1N0UA 4TWJA 1XVUA 2Z2XA 1C30A 1GAXA 1KKLA 3M6IA 4E12A 2J9ZB 4P9NA 2EKQA 2R8OA 3ZHZA 5LWQA 1L4LA 4PG5A 5DN6D 3BE5A 4OJQA 2PM8A 1ODLA 4P32A 3VV3A 4NFYA 1ZEMA 2ZR8A 3IP6A 3P9RA 3LY7A 3IVCA 5I45A 1KO5A 1XN4A 2B7CA 5K0GA 5KNBA 4DR5B 5E9JA 3IMKA 2W8BA 2B0JA 1ECCA 1Z7WA 3DGFC 1BOFA 1TW3A 3GGGA 1E0DA 4JQZA 4LKOA 1NOIA 4DLLA 3UJBA 3BB4A 2VAMA 3A1NA 4KPUA 1V8PA 3JARB 1GRRA 1GZ4A 1SELA 2E7ZA 4EKNB 1QYCA 2DBZA 3ECSA 3THWB 1NXOA 1XJWA 4B6OA 1JU3A 3ETEA 2YICA 5TB5A 4YAGA 3G2OA 1JN1A 3H11B 4YAOA 1ZJYA 3G68A 2EFJA 4KK3A 4XUGB 4O2AB 3EXEA 3KVRA 4QBIA 2JH9A 3DO8A 4FONA 5CB4B 2WKQA 1V2HE 3T7TA 1PUXA 3CKYA 1I6LA 3PDJA 1E0AA 4ZOAA 4UNNA 1L1EA 3NIFB 4YYZA 5AQ1A 1QLHA 3KJXA 4Z49A 4D9EA 1IV4A 3GUZA 4EG7A 4ANFA 1DC7A 4JL6A 2Z09A 1W25A 2VTKA 3YASA 5F2NA 4C14A 4YV1A 5CX4A 1VJRA 5BV1A 3BXXA 3EMBA 2G5TA 3MSXA 3ULKA 2X5KO 2A7QA 4N0MA 4KO4S 3L7YA 5JAPA 3OE7D 1L7PA 2I2WA 3P27A 1E1CA 3VHRA 4AN0A 1Z2NX 1KI9A 2FWPA 5JD6A 2B30A 4AX8A 4LDJA 2QQEA 2P0EA 4B4VA 3T5PA 2ODAA 2XKJE 4HZUA 4P3KA 4A03A 3P0HA 1M74A 3JTEA 5I9SA 4JI8B 4X8HA 1XEXB 3C48A 3EN0A 2MYPA 2VRCD 3B3GA 3HS3A 2YYSA 3OQMA 1G60A 2C9MA 4J90A 1L8XA 1W5FA 4OD0A 4YFVA 1PGPA 2ZJZA 3N8IA 2YV3A 4I4IA 5A71A 1OYYA 2H2IA 2G76A 2BISA 1A4UA 5IPFA 1M73E 4NH4A 4NATA 3RU7A 4Q82A 3UKJA 9LDTA 4JBLA 5TSDA 1N6IA 4F3CA 1M8PA 1YJ9F 3HUTA 2XXBA 4V02A 5JAOA 5L3RA 1JHUA 2VPZA 3FD6A 2AMVA 4FEGA 2C2KA 3RRYA 3RRJA 3NNDA 2XGMA 1JF8A 4TTRA 1MB0A 3A9RA 1SH7A 2OMEA 5JHGB 1P44A 4V0LA 2DC1A 1ZD3A 4TXHA 1OH5A 1AK2A 1R2QA 4LE0A 4EJ2A 1PFGA 2OCXA 1XQYA 3OD1A 4DV5B 3TD3A 1X74A 3BH0A 3PNPA 4TYQA 5C5DA 3CKLA 2NUPB 3EFHA 4WVFA 2Y27A 1VIAA 2Q4BA 2HV9A 4BBPA 1QG2A 2VF5X 5KX5F 1X1TA 5LMZA 4MJXA 2PLNA 5AK6A 3SLKA 2APJA 4V0NA 3I09A 2D4HA 5HY2A 1MG5A 2PZEA 2V9CA 3NIBA 4DMGA 2FSVC 5C1OA 2D54A 3ZC3A 4JJAA 5JRDS 2QD5A 1NV8A 1G7CA 2WSBA 3EDMA 3PC7A 4FXOA 3HZRA 2VUSA 1NUAA 5ICEA 1K9VF 4V39A 2KTVA 5ALOA 1FBTA 1N2SA 1QCYA 3GUVA 3N2NA 1HDYA 1X52A 1RMYA 3H3JA 1JALA 5TMBA 3H04A 1PJCA 1DIHA 1RWKA 2AFRA 3M2PA 3PZRA 3UQZA 1JPVA 3AIKA 2FEAA 3IBFA 1JWAB 3G2NA 1G8MA 4I7EA 4BT5A 3N0TA 3KJFA 1FP4A 3ACDA 5DNVA 4ZARA 3WJ7A 4U8HA 1G3UA 3UAZA 4HRXA 1F12A 3VNQA 1I3NA 2Y0DA 1UR5A 1BU5A 3Q0EA 4LDRA 1LA2A 3LPCA 4MCIA 1SVOA 4EGSA 3UB3A 4YASA 2R1VB 1OAOC 2YZGA 2B3DA 4ZV7A 1AS0A 1V1RB 1WB5A 5JAHA 4FB4A 3GELA 2OBMA 3LC0A 3EF3A 3OKAA 4YRMA 1NPYA 1V9CA 4HWGA 4EA6A 1VPWA 1L1RA 1ULAA 1NQXA 5HP4A 1YFKA 1E9RA 3CR3C 4LX8A 3QVSA 2JGDA 4ZT7A 2QR3A 2R44A 4GXRA 2X8AA 2GEKA 1YVDA 4F4FA 3BWXA 1GSAA 3SYNA 5GANK 5HZMA 1X92A 4PICA 1AUOA 1B1CA 2BBOA 4GZ5A 2XYGA 3KR2A 1FRFS 4RTLA 3PNVA 1NBEA 2GD2A 1TVEA 1ULUA 1LW6E 1WDWB 4BNUA 3KAJA 3RLIA 2O4CA 2BGWA 3OJOA 4C0BA 2ZXEA 2RE8A 1J0DA 1RS0A 1ES9A 1OTYA 2ECPA 1BE6A 2WAOA 1QMGA 2L17A 5HX7A 5KYXB 2EHDA 4W5TA 3VR6H 1LS1A 3VO2A 1OWPA 2BKXA 1IPAA 2WNHA 4ENSA 5JOQA 3L77A 4TYNA 4FOPA 1WP9A 1ZM2A 1HMYA 1H0SA 1J6UA 1N1DA 1T2EA 1WV0A 2JFHA 2VDPB 3IPCA 4RKYA 3R7BA 1WXHA 3WWZA 1FSFA 4WK0B 3ELYA 4ZKDA 1YDGA 3AW9A 5A0TA 1UM9A 2GNPA 3T9EA 2O57A 1JTVA 1PEYA 3LWOC 2FGKA 3VBEA 5E9WA 2IZ5A 4Q02A 5FOXA 3HTXA 2JK0A 2MINB 4PG6A 3CJRA 3T7SA 4YJ3B 3OIVA 3T6KA 1BG6A 3WIOA 2NVWA 4HDKB 1YL6A 4YMLA 2WWRA 4NCHA 5HMLA 3G6WA 3UPDA 3VHXA 1TYDE 1CN7A 1VL0A 3LVBA 4M1OA 2YXNA 1UC9A 4G5QA 1PP4A 2RB9A 1CUGA 1VE1A 3HA3A 1ILWA 2CMKA 5J2UB 3LCCA 3LPDA 5IBCA 3ANSA 2ZSFA 4YH1A 1TUBB 4NENB 5C8ZA 1GLGA 4NNOA 3NEYA 5EWMA 3ZJTA 1M2WA 1NVXQ 4LXUA 3U37A 3W2IA 3AFGA 3IE2A 3MCZA 3PCTA 5DM70 4BNWA 3GMDA 3IRVA 5E6SA 1PT8A 4L22A 2CXHA 2J41A 3B2NA 1YA6A 5LQRA 4QWWA 4JHLA 2BJWA 4UMFA 4MA0A 4UQOA 4L2IA 4XIIA 3RT7A 4A8JA 4D9HA 2PWPA 3V7UA 4C06A 4O4LA 1E3DA 3AR7A 4TT3D 2R8BA 4YO7A 3WLTA 3U48A 3VQTA 2CNLA 3JWIA 3SIUA 3IEMA 1V7PC 1ZI8A 3L8ZA 4Y6RA 3A4TA 1H2HA 3OURA 4M49A 3RWBA 4YR7A 3L6UA 3T5AA 3Q7TA 4MAMA 2Y6UA 4C7VA 3O1IC 2ATVA 3V9PA 1LK0A 2FJUA 2CHTA 3KXKA 2XRZA 2GLXA 1ZK2A 2HH9A 4RPHA 4L95C 4KRFA 1CQJB 4DN6A 2OHVA 4HJXA 4PSVA 1MX5A 4LHWA 4CI9A 1IB6A 2GN0A 2Q6VA 1KZ9A 1QIJA 2W6MA 3DZFA 3HFSA 3RFFA 2WJJA 3KD3A 2QGZA 3T1OA 3IUQA 4FDTA 3TI9A 2P91A 1POWA 2R11A 3WLEA 4DRZA 2NV6A 3NBKA 2PMEA 3KQQA 4C8GA 3JWPA 3W7BA 4LWZA 4Q66C 5C35A 1Q1QA 4TLEA 2FPPB 3AF1A 2DHRA 3DV0B 3HB5X 3MTIA 5COQA 5IC5A 5B6PA 1QIKA 3NHUA 3U9LA 1J9GA 1QOPB 3LDUA 4RKWA 5CA0A 1S02A 3AL2A 3H16A 4YAEA 1IONA 4C5AA 1EBUA 1WU7A 4BV8A 3NBQA 2YN2A 4LOHA 2H8KA 3OETA 3ED5A 4N54A 1TQHA 1VSVA 2D2XA 2ZDGA 1SCNE 2YX1A 1U2TA 4KXYA 3HKEB 4OFZA 1U7XA 4BZXA 4MQ5A 4WD3A 4ZQCB 3D4IA 4NBTA 1IUOA 1HXHA 4OXNA 3SC2A 1B6SA 2WD9A 5IMBA 1DEAA 2B21A 1R3UA 3NXSA 4U7JA 4X24A 5T41A 3RI3A 4CQMB 5JFOA 3R0VA 5K0CA 4P6VF 4MVYA 4X93A 3G3EA 4AS1A 1G2IA 4JR0A 1FUUA 4HN2A 1DO2A 2XOKD 1A98A 4G0WA 3QXGA 4PLZA 4CL3A 3U7GA 4YQYA 3U3OA 4JSYA 1SZDA 4V0SA 1M72A 1E32A 4OUKX 3ANLA 4KQFA 4I08A 5ITWA 2C8JA 5IFKA 4D9JA 2JFOA 3B7WA 1WNFA 3L8DA 1S2LA 3QQ5A 4EIWA 1LJ8A 3LDGA 3UWDA 5HUQA 1RU3A 1HNNA 2ZBEA 4XB6B 1R15A 5G3ZA 1FFEA 3U4QB 1Z2PX 1SBHA 3MILA 3NVKE 2PQMA 4YDQA 3CUEF 3FWPA 4M9UA 5B3JA 2FVYA 5ELMA 3WNQA 1GT6A 4P0QB 3RT9A 3IMGA 1RKBA 2HWXA 3HJTA 2PGNA 3BMOA 1W48A 2HRZA 2QTAA 2UKDA 1E3TA 4NCXA 2P65A 4MPPA 5LDDC 1Z2OX 3FETA 2MSKA 1IY1A 1CULC 4GKVA 4HUQB 3AOEA 5LYJA 1N2EA 1YCDA 5FWYB 2Q3CA 1YQQA 1PV2A 3FAKA 4J4BA 4MDHA 4LF9B 3JQPA 1R64A 3OZBA 1V7ZA 3I01A 7REQA 3L0OA 4BKPA 4Y98A 1D4AA 1V4BA 4XWKA 4FD2A 2BR5A 1U1FA 1IN4A 3HV2A 1BD3A 2ZYUX 2ZI3A 3I1FA 3H5AA 3OICA 1Z0FA 1FFXB 2GGSA 3MBMA 7MHTA 2QIOA 4LJLA 1N1EA 4G1UC 2C92A 3ESZA 3J81M 3SN6A 4O0LA 4LQDA 4BDTA 5JLJA 4E94A 3M84A 1PD1A 1ZCAA 3K0AA 3PGKA 4RX1A 4PANA 2VNKA 2Y71A 1OW3B 1ISHA 1UIRA 4LJ8A 4QECA 1ZMTA 1IZ7A 2O7SA 1EAYA 5E38A 4KXFB 2JLRA 3OIUA 4ZVOA 4D0SA 1SXQA 3RVOA 3HGMA 3R3JA 5JH7F 1AKUA 5EIBC 1H8ED 3IKFA 1NN0A 1E6UA 3IQIX 4MIKA 3SG0A 2NSLA 2YVUA 4JBNA 3LT4A 3VPDA 5JPDA 3R9XA 2QJWA 5BV2P 3T41A 2A7XA 3AR8A 2PZFA 3KVYA 4G0QA 4NJOA 3V8QA 3DTVD 3L0PA 4AM8A 1JLHA 3D7KA 5DNCA 3KC2A 2R8RA 2GPTA 1MB9A 5CFRA 5EZYA 1XD9A 3OUTA 2RGYA 1ETUA 4FZ5A 3SGLA 1P7CA 3TQIA 4F3KA 1B23P 4NNJA 1ZOIA 4I5IA 4EITA 2QRPA 5KBYA 3OY2A 5ALRA 4FX2A 3OQNA 3FSGA 5BWNA 2HF9A 1AK1A 1C1DA 2WUWE 1JEOA 1QKIA 3TZQA 5M29A 1FMCA 2HK8A 3G2IA 3ZHSA 4ZQGA 3DE2X 5C1IA 3SIRA 2QGFA 3W0LB 4O3MA 4WBNA 4IIGA 1Y8AA 3ZK9A 2I76A 3CMMA 2PD6A 1F2UA 4EFMA 5A3QA 1CJSA 1OC4A 3R8FA 2HC9A 1JAZA 3DFMA 1SWVA 5TVKA 4B7CA 2EV9A 1VQ5F 3C6BA 3IHKA 2NACA 1U0HC 1P17A 3DH0A 2YHSA 3HKCB 1HE8B 4WCFC 1KJQA 4ZRMA 3NCTA 4M8IA 1ULSA 2DBVO 3GJXC 3I7TA 3GLHE 3OP4A 1KO7A 1LPBB 3GZTB 4RDCA 4NS1A 4MITA 3K0HA 4ROSA 4L8WB 4WCVA 5AKGA 2QUJA 1KH3A 1Z29A 3PHGA 2MYTA 2ZWVA 3HA7A 1RRGA 3E61A 2ZYHA 3EAFA 4WCFB 4DNPA 4L5JA 5FUMA 5CLGA 2BD0A 4KLNA 2LE0A 3PQ2A 1VLZA 4YT2A 4PLWA 3LO5A 1GAEO 2I78A 3AFIA 3EFEA 5EMHA 5EIXA 1DAHA 1AN0A 2DPLA 2Q9BA 4CQJA 1X9IA 1Y82A 3CLKA 3KR9A 3A27A 3QPVA 1Q17A 4X1KA 1J2RA 1Z6TA 1I33A 2CXQA 3KOOA 3MEQA 5GOTA 3HVJA 4AX4A 4BQPA 3RU2A 3ZU6A 3KQNA 3GRVA 1OZ0A 2NTJA 1W55A 2O2DA 2P0YA 1OZHA 1P5ZB 3LBNA 2YWJA 1O97D 1RC1A 3MGBA 4JX9A 2FUKA 1H3EA 4GH5A 3ZBUA 1U99A 3IUNA 5JTUA 3Q7PA 5D6OA 1JIUA 3KS9A 5G4UC 2HFKA 1XZQA 1KJJA 3K9LA 1QO0D 3EJWA 1ISJA 3H19A 5CCEA 3G2LA 2J5QA 4EG4A 4X6XA 3RKUA 2G5CA 5LQUA 1E7WA 1UMDA 3BWBA 4K3VA 3OLYA 2B82A 3ZLVA 1U8XX 3L49A 4L9RA 3DAHA 3RBZA 1VQMF 2GNOA 3G79A 3WIBA 3T3IA 3LCJA 4OXIA 16PKA 3MT7A 3KZMA 4P8RA 1EG7A 1UOOA 3LAWA 4GX0A 3WC4A 4BWYA 2QAGC 1ODCA 5JBNA 5F1OA 5G0WA 1NRIA 3ETDA 1O6CA 3MRSA 2Z5FA 3C6XA 4UOEA 4IIJB 1PG0A 2H7XA 2HCTA 2WHXA 3F7TA 3X3HA 2CLCX 2R87A 4NOLA 5AXDA 4WJLA 2B36A 2ORYA 1G7RA 3NWOA 1H2YA 2EP8A 2IU0A 3X2SA 4OP3A 1GPKA 2H65A 4LJKA 2JJQA 3ZDDA 2JFBA 1VDMA 3UN1A 4IJ5A 1F4VA 5CDSA 1SFRA 2WFMA 1C3OB 3AM4A 3GRPA 3BA1A 4DYDA 1NTOA 4XUEA 2WYIA 3V1UA 1OBOA 2ZANA 4UVHA 5LP6C 1VMIA 1Y9JA 3FUVA 4RU1A 4JKYA 2Q2QA 3WP0A 4A2PA 2QM8A 4X64B 3URMA 4KFCA 2JGJA 2F64A 2QP9X 3QHAA 1BU8A 2EJBA 2I2FA 4NY1A 4ZVKA 4C2AA 2C9ZA 2H4JA 1MKYA 1PHRA 2C2WA 2YMLA 4Y7CA 5GJBA 4DCSA 1ZJ6A 2AMYA 1VE7A 1MJFA 4Q16A 5LP6B 4JHXA 1CUEA 3GPIA 4XYGA 4P5DA 3KL4A 1XQXA 1ZSNA 3WL5A 4DIMA 2NSYA 1Q0TA 2R7NA 5I8PA 4MVXA 1OFTA 2HJHA 4F93B 1YOBA 2ZKLA 4LQCA 5AKYA 3TMYA 4CHTA 1MVLA 1M8GA 4Y0VA 4NZ9A 4YRKA 3C4VA 3EDQA 1H8HD 2I6GA 2X0NA 3AZOA 1J1IA 2X5XA 3LT2A 4I5FA 1N2HA 3DO6A 4BMXA 1CP2A 2Z4RA 5CFZA 2BFEA 1HKHA 2JAHA 2RK4A 1YBVA 2BBWA 1EFKA 2G7MC 3IAS1 3IP1A 1NNLA 4IZOA 1N25A 2RHJA 2VDVE 3OEHA 4MYRA 4QAJA 4UFOA 4TTAA 3W3AD 4YT4A 2IW3A 4JC5A 3DLCA 2FFJA 2YWCA 3W78A 4F96A 1R4NA 4B46A 1E3EA 1D9XA 3FTNA 4Y2RA 1H6BA 13PKA 3GFFA 4C4OA 5CCBA 4TTJA 2FE4A 3PD1A 4CM8B 2QV0A 4L50A 2C7OA 3N0VA 1IV2A 2X5OA 5DGCA 3ZD9A 4EO9A 3ZVMA 1JEYB 5BWOA 2GXQA 4QO7A 2R751 4HJRA 5EJ2A 1C9DB 2OYSA 2LRHA 3AL3A 4EVIA 3P9NA 3I30X 2VH1A 5LIRA 2BCJQ 1SIUA 1IH8A 1QIHA 5FPQA 5IHXA 2PZLA 4MW2A 3VFDA 3A6LA 1KYTA 3AI2A 4J0KA 3AINA 1JBEA 1QVRA 3K35A 1WV1A 3QY0A 1VE5A 4G5FA 5EXSA 3NBUA 1KE2A 4ZCMA 1XCGB 3PTLA 3AXSA 4PSUA 3NPAA 1BE1A 4AZ0B 2Q6OA 4H60A 2FFAA 2X0DA 2YY7A 3R5KA 2DHCA 2Z3WA 2XLCA 4LJAA 3DBLA 1R50A 2X2FA 3U5TA 4DWJA 4QXAA 1SXJC 3EMDA 4M87A 4JWKA 1WLSA 5FWNA 5MN4A 2EKZA 4ZI2A 5A3SA 6LDHA 1GCGA 3TWOA 1TD9A 1X9HA 4RM3A 4JGIA 4E3WA 1Y8QB 1F20A 1NW6A 5DHFA 4B6RA 1KXZA 4DR6B 5J58A 3F6SA 1B0UA 1XC7A 1UQTA 1Q0PA 4Y1EA 3K0FA 1KRXA 4FFBA 3ILSA 1U7ZA 4G1MB 4Q4HB 4RHYA 2FPXA 2YUTA 4RVFA 2BMEA 3B85A 4ZD6A 4C7OB 3RNLA 2Q5QA 3I45A 3GEBA 4K2HA 2QT1A 4MKRA 5I7HA 4BO9A 2BGJA 3D7NA 1S7CA 4W5HA 1QC5B 4ZT6A 4O4JB 1NULA 1CNFA 2PGIA 4LZPA 1P1BA 3A3KA 1NXSA 2HYIC 3TE6A 4DT1B 2R5FA 3OU6A 1F8FA 2YWHA 3MJ4A 1RAIA 1RC0A 2XKBA 1N2XA 3PAFA 1CB7A 1G8HA 3PDHA 3PE6A 4P7JA 4XCQA 2H0AA 2V9ZA 4ZYXA 1GZSA 3TRKA 1D5CA 4TS1A 1QQ6A 2CJYA 2JL1A 3PVSA 1I7LA 2CWJA 3LXXA 2J7PD 3K5HA 3CV3A 3DGEC 3GUUA 1CQWA 2C96A 5AOVA 1QGAA 2E4VA 2HIHA 4JLDA 4LF8B 3VR3D 4FEAA 5SYAA 5DHPA 2IEIA 3DQQA 3GLUA 4IJ6A 4ZOBA 3RKSA 1TM3E 5G1PA 4WGGA 3PE3A 2FF5A 3GCZA 3ZN2A 3ICEA 1THMA 3M1XA 5EO3A 2A1TS 3HKDB 4KACA 4S2EA 1YE5A 2R1ZA 4IKOA 3QNUA 3A3YA 4L4UA 4NBSA 5ARCA 2WWTA 3KDSE 1C2YA 3N39C 1HYQA 1TZBA 1Y6ZA 2Z2ZA 3U4DA 4WBXC 2ZIWB 1GNLA 1MMFB 1XDBA 2PYZA 3JALA 2B8NA 5CM9C 1E64A 4ZQFA 1E79A 1HFJA 5AI5A 3RSGA 5FX2A 1ZWZA 3O3NB 2R2GA 2QNIA 1K5GA 4KOEC 5DNEA 1WQ3A 2FWRA 3KSAC 1N75A 2BF4A 2XJ4A 7AT1A 4S35A 3SHWA 1U0SY 3REGA 3USCS 4X61A 4Q7KA 4AAYA 3IO5A 3H6HA 4DR7B 3AUYA 1VBMA 3KR0A 4L57A 5IG2A 2AJ8A 4MA4A 2OOKA 2DH5A 2OZEA 3CEPB 4OQDA 4RJ2A 5EVCA 1VQ6F 1HUQA 1V3UA 3PDIA 1TIBA 3KEGA 3IKTA 1QVZA 1ZMBA 1E9VA 3KOYA 1R8XA 3RCBA 1PIWA 2V8OA 1FTSA 3UJ6A 4F2DA 3QEOA 3HL0A 5F5XA 3CD6F 5TC4A 3CJTA 4PXSA 1RE0A 4BQEA 1U8AA 5K3CA 3OZVA 4A5SA 1X94A 3KHSA 4M1SA 2V7XA 1Y7LA 1ZD8A 1F5NA 2J4FA 2CXXA 1Y1TA 2OUIA 4H3HB 2AE1A 1PO7A 3M5WA 1NP6A 4EA9A 5EJEA 121PA 1KRWA 1ISMA 2HQBA 2IHVA 3E84A 5DLQC 1Y34E 2P2YA 2WM9B 3M9WA 4B6EA 3A9UA 2AN4A 5E1MA 4RQTA 5MHTA 5JWRA 3SMVA 1IK6A 3RADC 1M5RA 4BXOA 2A4MA 3PNSA 1XNJA 4JJ7A 4LZLA 2GVNA 3SIWA 2NU9A 2R6DA 5A2GA 3GT3A 3H2GA 4KU4A 1DBWA 4IO0A 5B58T 3QBTA 3M82A 3UGKA 2HZBA 2W2OA 2XNDD 3KJGA 1X13A 2AIRA 1J2TA 3HBMA 4NOMA 2W6IA 4W5JA 3RHSA 1N5JA 3SKVA 3VU3A 1XPOA 4LPSA 1KYWA 3RRBA 1FYFA 1QFZA 4EF6A 1YDEA 3WXMB 4H7EA 4INZA 1QHEA 1PGQA 2ZCUA 1DMSA 4Q1BA 1YNSA 3C0KA 5BWCA 4XLTA 3LDHA 3PE4A 4V0QA 4O8CA 2FPMA 1ZUIA 1U7UA 2XV1A 2DT4A 3KZCA 3KWJA 4K9QA 5FNVF 1M2KA 1V96A 5FH9A 2MQEA 3OZAA 3BE8A 2BMVA 3RS7A 1MAHA 2J9GA 1VKHA 1NWHA 1MUUA 2EHJA 1Q95A 3EXG2 3FJOA 1U3FA 3K5WA 3BTVA 3QPAA 4IJWA 1I4EB 5HGJA 5K8CA 3S28A 3T1TA 3GBVA 2BE9A 4K6MA 2P69A 1I4LD 3F8TA 3M6XA 3MINA 3S2GA 1TYEB 3GGDA 3KLNA 2CD9A 4FSDA 4L16A 4GLFA 4PYRA 5JO0A 1OLSA 4G8BA 1XPJA 4TSFD 1BVUA 2OHHA 4TX1A 3I61A 3QLJA 2MWMA 4BNMA 3TPCA 1CZLA 3UK1A 3WGVA 2Q6IA 3TCNA 2D1SA 2E6UX 4QICA 4EMBA 3ZH9B 1W44A 1NW7A 2AKAB 2GUGA 1T8TA 3R9WA 2BEUB 1EUCA 1QFJA 1BGWA 4UQPA 4YJFA 3LHDA 2F43A 5BW8A 1GA1A 4YCBA 2NUTA 3GRZA 1DPFA 1RMTA 1EWRA 1YHNA 2VIIA 1AXGA 2GCGA 1YQTA 4RVHA 1A96A 2Q27A 4EI2A 1TAUA 5T64A 3ITKA 1WUYA 4UHHA 3W9BA 1CLIA 4ZI7A 2PXCA 4CLDA 5IDQA 2YW9A 4EABA 1OT5A 3B6JA 4C0QC 4J0GA 4Z3KA 2I4RA 3BKWA 4JB8A 1FL9A 1PRYA 4Y3UA 5A02A 3BB3A 1IUNA 2VP2A 2YQZA 4YDRA 1YASA 2C20A 1ID1A 3BHIA 3GAZA 4JI5B 4RTSA 2MYNA 5JJIA 3GVIA 1DC4A 3N7UA 2QN3A 4UPVA 2HA3A 4DRXB 5HF9A 3R20A 1P9WA 4U0KA 3OZSA 5I7EA 2I34A 5KQGA 1RJ9B 2HO5A 4Q3NA 5JISA 4DMCA 4X20A 1X7ZB 3WAJA 4PQYA 2Q1WA 2V5VA 3ZDYB 4II2A 3CC7F 3G0HA 1YMVA 3Q3VA 3UV7A 2VYCA 4DLRA 3I32A 4EY3A 2IAFA 1TZCA 4LVCA 3IIKA 4DG8A 3ZX4A 2J3HA 4A23A 3L7MA 1X1DA 3W5SA 3FBGA 3UPTA 1H69A 3PHHA 2QE7D 1LTKA 5IHPA 1Z6AA 1EA7A 5JMWA 3QUSA 3VM6A 4FS3A 1AH2A 1SA0B 1K4YA 3NMUF 4WESA 2PCLA 4YMWA 1UBCA 3OAAD 1LFDB 1Y8RB 5DEIA 4AG3A 4C21A 3BZUA 1VYTA 2XVZA 5A4KA 3AEQB 1XV5A 1RFGE 1ZM7A 3JR3A 4P33A 4P2BA 3H1PA 5A4IS 5IP5A 3KXDA 1P4SA 1IM8A 3LPMA 1GGEA 4D4GA 1LBIA 4HQ0A 3WRXA 3H1FA 2CFRA 3DB2A 3FPFA 4KH0A 4R1NA 4RZUA 1EQUA 1IAQA 2SBTA 4MR9B 1YI8A 3E48A 4A8PA 5BUSA 1W6UA 2NXCA 1OSNA 2O3RA 2Z04A 2VLBA 3NHRA 1R8QA 4CM9A 1O0SA 3FNFA 1R0BA 4JYZA 2CC2A 2PBRA 3TAXA 3NHYA 3RJZA 2GLUA 1CSEE 1HLFA 3SZLA 4WASA 4OLFA 3CMAF 2AFIA 4Y9TA 2H63A 1MOSA 2Q6KA 3DOIA 5IVIA 2GF0A 3CW2A 1US8B 4F5YA 3TDNA 3M3PA 4KI7A 4B35A 2ZPTX 2FK8A 2F3RA 3NYIA 3I5UA 3PC8C 5IDVA 3PQ4A 5T8KC 1EIZA 3CX7A 4HZGA 5CGQB 3PQFA 3WOHA 1N6HA 4QTTB 2OO3A 1GCIA 4RELA 2ASEA 3ROKA 1QHIA 4I1YA 2A58A 3B6NA 5AKEA 5DEOA 4GGPA 2FCRA 3HVRA 4YMUA 4K9DA 4LVNA 2JEOA 5JIBA 2CZQA 1B0PA 2HGZA 2QA5A 2Y4OA 3LBYA 1NVVQ 4KNVA 3FI9A 4HS4A 3WO1A 5IKXA 3H2IA 3FM9A 2AUTA 1SZPA 1G66A 4YCDA 1RWWA 3DDSA 5LCXA 4EF4A 1QTIA 1H1LA 2C98A 2GTHA 1SG9A 3D6UA 4M1KA 5JJKA 3LY8A 4KWEA 3VVBA 1RZ3A 2J5XA 1X8XA 3B5IA 5AJYA 3WGYA 2JHAA 2GJ8A 1LSOA 4R71A 3BRWA 2IVFA 2R7KA 4OMCA 3V7WA 3T7DA 3JU3A 3DVRX 1ZNZA 1KY2A 3IT3A 2CDRA 1FYVA 2FSSA 2BGRA 2J59A 1XMVA 3WGUA 3CF4G 1EP2B 1TADA 1IK4A 1A5BB 4MAFA 5KQMA 2CXNA 4EKEA 1OI3A 5FF9A 2GESA 2EZUA 2GEBA 2J3LA 2QN1A 2WD7B 4ZHVA 3M7IA 1T43A 1VYVA 1ZIDA 3DPSA 3HJCA 4RF5A 1QP4A 1GFWA 4RTMA 1G7TA 5M5BA 5GPBA 1GIAA 2PKCA 2YHIA 2IEDA 3U31A 5HJ7A 1FS6A 1Y4UA 4GGOA 3GFPA 4H0CA 3WO0A 1A88A 4M0LA 3OSZA 4R9RA 4X3MA 4QTUB 4BFXA 3FMVA 1E4YA 4NI5A 3CLTC 4EKGA 1YDMA 3E35A 3OIWA 2D0DA 2YZ7A 1Z18A 3QWAA 4DRYA 2OKGA 5JDIA 3U7HB 1SQSA 1XLVA 1JH9A 4OHCA 2QLFA 2ZODA 1LLDA 1BX1A 1XD2A 4WFIA 4GICA 1H2XA 4RZ2A 1K5DA 2V7VA 3OQBA 3F8WA 4HEA6 4EG0A 1NVBA 3HSYA 5E2IA 4U9HS 1LC3A 1TGVA 2XMZA 5ES3A 1DX9A 5EIOA 3WJAA 5GONA 2A94A 4YY3B 5I9NA 5LMUB 1W4AA 1ZZEA 1YVEI 1COMA 3BMNB 4HYTA 1ZH6A 3QLEA 4HP8A 4D9FA 1CVLA 1FX1A 2W7TA 3TD9A 4PX3A 4K87A 1Z28A 1TK2A 2M2IA 2QRMA 1WA5A 3U0BA 1DIBA 5IUNC 2Z30A 5ER9A 4AVYA 1SBNE 1KQSF 3M8KA 3V7YA 3X2EA 5K09A 3IAAA 2WJHA 1CLUA 1YUMA 3E3MA 2ZROA 3E9YA 4DV0B 3EGIA 2BI4A 3QLVA 2GF9A 5HBRA 1UPXA 3VMFB 1GFIA 2P41A 2OV3A 3L9XA 3MS2A 3K1AB 1V35A 3LBFA 1RZRD 2K1SA 3F96A 4AROA 3QOWA 4LW8A 2GCNA 1NUHA 2EFHB 1ZX1A 2J3JA 2PT6A 3C1OA 3LFOA 1VFNA 4O2RA 2FUCA 1PSZA 1H65A 4YRAA 3G5TA 3M4ZA 4FHEA 3L5OA 4L1KA 3RC2A 1B0ZA 2OHJA 3SS8A 1FDVA 1ZGJA 1YGYA 5EWJB 1VHJA 4PYOA 1GITA 1ZICA 1RXUA 1Q7BA 3VU9B 4HAIA 4O8ZA 1WHSB 3VNRA 4DTIA 4UTZA 1QV6A 1YL5A 1NMXA 1MV8A 2OGSA 1KHHA 1DBIA 1M7GA 2WU1A 3E7PA 4RD0A 2OAGA 1NV9A 4ZAGA 5AVWA 3OJEA 4QPPA 2Z2YA 3RB8A 3X1JA 2WUFA 1T6YA 4ETNA 5DBIA 2J6BA 5JY6A 4OQFA 1EFDN 3A06A 4IHQA 2Y92A 1N6RA 2REQA 4EGJA 3KZOA 1A4RA 1IOVA 1ICIA 2BFCB 3Q1LA 3HVUA 4YT8A 2IYFA 2V55B 2WJYA 3QF4B 2FMIA 2HBRA 1ECJA 1EJ0A 2WAAA 2B2CA 1PTJA 3GYGA 1VC2A 1U1DA 5D7BA 3UMGA 3FOEC 1A9OA 3AIMA 4MW5A 4Z5XA 4GFDA 1JMVA 2PLFA 3UOGA 4JT2A 3WBFA 2BN4A 2X13A 2FW1A 4OX9Y 1J5XA 3BFPA 5TQ0A 2X58A 1YJBA 5HG0A 1XHOA 1SUIA 3QPBA 1ZSYA 3ENQA 3NB0A 1YT5A 1JR4A 3VH4A 4ACAA 1XG5A 4WZAB 4D6YA 2PMDA 4QGFA 3S99A 2O14A 5H59A 3I23A 4DR2B 1Z37A 4OUDA 2RKWA 3DF7A 5FL3A 2FZEA 1KYYA 5K3SA 2ZAIA 3SHOA 5C8YB 2QU8A 5C1DA 3T1YB 4FN4A 5DV9A 3SZMA 2O8EB 1R5JA 2PH7A 2ZRBA 1XTBA 3AVTA 4N3AA 5ALYA 5EP3A 2ZJ6A 5LYYA 1M34B 4C05A 1UWLA 1E96A 5HSGA 1A04A 2IYTA 5I3CA 1JEQB 2EX1A 1QQ7A 1DB3A 3LH5A 4DMFA 4LF4B 5E3HA 2ZJ7A 5HCNA 3ZDZB 2G71A 1YWGO 3MMXA 3B3QA 1OKKA 2EXXA 1BH2A 2DU8A 3UB4A 1V7CA 1EFPA 1I3MA 2V0NA 4OHZA 3LKVA 1JHRA 2XZTA 3LWBA 3GA0A 1J2EA 2C8KA 4NG5A 4QKQA 1Z5OA 1TMKA 1IUPA 4P3NA 1QGUB 1T25A 5FPYA 2JA1A 4O2BB 2KTUA 4YALA 1P18A 3HXPA 1UBMS 1UDRA 1UBUS 2BAGA 3NBFA 5L53A 1E89A 4GECA 3RANA 3VNUA 3NW9A 1SUFA 5C7YA 2YYAA 1XD8A 3FOBA 1VIDA 2Q28A 2XZPA 2ODPA 2C7GA 2CEAA 4G4VA 5CVDA 3V6LA 4NBUA 5AW2A 3ZV5A 4IWXA 4DTCA 1H85A 2HPVA 3I4FA 2CVHA 2P68A 3LYBA 3JZAA 3LX5A 4QWMA 1KPGA 3THWA 1N34B 5IVHA 4GYWA 2J9YB 2XWJI 3H11A 4XWOA 2ERCA 2X1VA 4X00A 1BFKA 1Y3AA 4O2AA 3AEZA 1Q0HA 3EMKA 4E6PA 2VQFB 2OCYC 4KN5A 5CB4A 1HOXA 3WDMA 4L7VA 4C5BA 3ON1A 1XZ8A 1S5PA 2BGKA 4H77A 4RY2A 4UM9B 4NICA 3AB7A 4X54A 3F7NA 2B5VA 4K3UA 1QBKC 2WVJA 2I87A 5EXXA 3WWEA 1VE3A 4EZEA 1P0CA 4FYXA 4OXYA 4YR9A 1N9ZA 1K7YA 2D1QA 3QXJA 4QDXA 4CETA 4ZHQB 3GRAA 5DH9A 5MN5A 2HP3A 1GZ0A 1Y81A 1E2JA 1GLNA 2VNJA 1W4BA 3PLAC 1JDNA 4HLCA 2VAXA 4L4RA 4O1HA 2PGDA 2YL2A 4YUZA 5BR8B 4QBHA 4JJIA 1ZJZA 4IZ6A 4QRDA 2MMCA 2G7ZA 1ENZA 3QVUA 1NHGA 1HBJA 3QENA 3I9KA 3WSVA 2LW7A 4MUHA 1OFGA 1ZM3A 4ZOLF 2J3EA 3D8HA 2AG8A 2ZIGA 4M22A 2ATEA 2TSYB 2XMPA 3QX7A 1NATA 4OQNA 1XEXA 3U60B 5LWHA 4W99A 1X8LA 1KNKA 4UE6A 1U2DA 4JH0A 4C8EA 4TVKA 2B4AA 4RLHA 5HIJA 4CKEB 5EJ9A 3R7DA 4MKHA 1KZ1A 4BVLA 1KDOA 4DABA 4D96A 1UEXC 3VZBA 4DLKA 5LA6B 2GJSA 2DLCX 3PHBE 5H81A 5K3BA 5JECA 4W1RA 2ZRPA 2MTBA 2XSZD 5T6MA 2EKPA 4K40A 4MQMA 4LOLA 1BW9B 1H2WA 4R6XA 4LRWA 4C20A 1DGQA 2KG4A 4UDNA 2Q4RA 4Q5IA 4CRWB 2J32A 3QWBA 2NO4A 4D2IA 4PWTA 3L0BA 5ENDA 3V33A 1W5AA 3NAQA 3UWPA 3E7DA 3QKRB 3ZCQA 4K9MA 4LX0A 1AIPA 4MRPA 5BMVF 1QZ3A 1X1SA 2HJSA 5CFMA 3ER9A 1KZYC 1MR3F 2ZUEA 3ABOB 5CVTA 2A4KA 4L6IA 3T3DA 4DNXA 2VJCA 3KXPA 4DQXA 1JQEA 5KU7A 3DJYA 2AOUA 1CNEA 1N8SA 2AD5A 3CGWA 1TJ3A 3M4YA 4OFXA 3BXOA 1BVHA 1Q16A 1SNYA 5H80A 1T2AA 1Q6ZA 1X9GA 1XJQA 3TJMA 1JG4A 2IELA 1SMKA 3II6X 3PF9A 4PONA 4F8YA 3AEYA 4DE5A 4WECA 2JGLA 3CRQA 1EWYA 2YYYA 3LUJA 2FSVA 4O3FA 1WXEA 3EOAI 4EJSC 3C3MA 3AP3A 5I8ZA 2NUAB 5J3JA 1M2FA 2JIRA 3KKOA 3JQQA 5H5JA 4CTOA 1G4UR 1KA9H 2WMNB 3M6LA 5HUHA 4JP8A 3RJTA 3GG9A 3A6DA 4CF7A 2CHSA 4GLBA 4HBZA 3C9SA 1R0LA 3M34A 4NV3A 4Y6OA 3PITA 2OR3A 3X1XA 1M9NA 2R1VA 3JSAA 4H3KB 4Q9DA 4PPNA 1AQIA 1V1RA 1XN1A 2QL6A 2VTEA 2XDQB 4QGAA 4WXEA 4BHTA 3WLRA 1TCAA 5J1TB 2WE7A 3KFXA 2CJWB 4JP2A 4LY0A 3FFMA 4ZCIA 2VNHA 3I28A 5H9VA 2QVYX 2PZAA 3O4GA 3ONDA 3HP7A 1OAOA 5HRCA 3T1HB 4NDAA 3MM4A 3I39X 3AR2A 3PGMA 1XU7A 5KVVA 2HAEA 3DONA 1E2UA 1FRNA 4E22A 5JCOC 2QRUA 2R96A 1PS8A 5AKKA 1N9GB 1XTIA 4BBJA 1V95A 1F2TB 1LVUA 2F3PA 3HBLA 1GNQA 3JYOA 3NFYA 1MW9X 1R0XA 1M10A 3Q3JB 3HLYA 4GG1A 221PA 1JB1A 4PFSA 4ZN6A 1IOWA 3EK2A 1I5EA 3U4AA 1KDPA 1EVIA 2H2AA 1CEQA 2QJTA 2A14A 3N0WA 3N74A 4JNKA 1TYZA 2Z1NA 3DE7X 4LSGA 4Z9XA 3ZVRA 4YPVA 4JOCA 4FKZA 3U4MA 5CB8A 3ONFA 5JD3A 4AICA 1RLJA 1AOXA 1QK3A 2QM0A 1XSEA 2VEOA 2HRCA 1GGFA 3GG2A 4P3OA 2I3AA 2H8GA 3LWQC 5AW1A 1V5WA 2X7HA 2XZLA 4QOIA 1YTLA 2W83A 3KYIB 4OP1A 4RLSA 1T24A 5AOCA 4OF4A 4TM7A 3WMWA 4DLZA 5CDTA 3ZLJA 4NYMR 2SCUB 4MWEA 3ZWDA 1V45E 3GP8A 1Z73A 1YR1A 2QTMA 4GR5A 1FUYB 5EAIA 1C8KA 2MINA 1WX1A 3B13B 1WDLA 3IHLA 3N2GB 2OO5C 4YJ3A 4U2BA 1T15A 1Z7BA 3S40A 4HDKA 2CEKA 5EFOA 3ZNPA 5KSZA 1I5RA 1ZRNA 1QFSA 1R5NA 2CFTA 2HRDA 4MUBA 2V7PA 3QVLA 1RHJA 2ZUWA 3Q11A 5J2UA 1ISIA 3BD8A 3GY0A 3TH5A 1TUBA 5IT9M 4NENA 3T34A 4JFRA 4GBJA 3KQPA 2DUNA 2P4SA 3GLTA 3R6WA 1W5TA 2V7EA 3DLAA 4KIWA 5L3QA 2QTPA 1Y63A 1YXMA 3AF0A 3HGQA 4XYBA 3UM9A 3USZA 1YZLA 3FFBA 3OCCA 2AG6A 3IEPA 3A0UA 3GHYA 3LECA 2W42A 4J07A 4FFOA 5KNCA 4L7QA 4LQLA 1A2QA 1F4PA 2XQKA 3FCOA 3AFHA 3EGOA 4RGVA 4LHEA 4JVOA 5A9TA 3C85A 2HY7A 3L1VA 3DE4X 4FQ5A 1ULZA 3NALA 2H85A 4URUR 3GZNB 2ZIXB 2IPNA 3AF3A 5B55A 3RTEA 5EXPA 3VH3A 5L8VA 3TZKA 3WDSA 2ZI4A 2CV0A 1G1AA 2N0SA 3V32A 1N4DA 3GP5A 1EPUA 4DLVA 3TNJA 4LHVA 3L8EA 6NULA 2Z57A 1KYIA 2DQKA 1AKVA 2O7NA 1FYWA 1RWVA 2QIPA 1E7QA 3DR3A 3DBHB 5KCZA 1CS4C 1X1RA 1MO6A 1ADBA 3FNHA 3QXHA 3ZHOA 4GC9A 4DARA 1FVFA 4LXXA 1O2DA 1TPYA 4ITVA 2QT0A 3RGWS 1IN5A 4DV2B 2FPPA 2C78A 1SPBS 1T4GA 3FCCA 5EA2A 2GK6A 2E5FA 3UXEA 3CR7A 1YRYE 4CLEA 1QTQA 2LCFA 1NJIH 3L4JA 4ZT2A 3ZWBA 4KAJA 1M33A 2FY8A 1G19A 3WLHA 1DXYA 4EJ0A 1TU3A 1QUEA 3PICA 4LOAA 4MROA 4U7PB 3RSSA 2GQ0A 3INYA 3H84A 2G1KA 5BN4A 1PNRA 1UBSB 5DO9A 4KPFC 1PJRA 5EESA 1Y33E 3HKEA 3BREA 5JR3A 1WD5A 4Q18A 4ZA2A 4KCGA 5F76A 3IBGA 3KPJA 1D7AA 4FQ7A 1OV4A 2SKEA 2VQEB 5EB1B 4LXHA 4IFIA 5TMPA 1YZFA 4E4RA 4J7AA 3OKFA 3LHKA 4TS9A 4B76A 1XMQB 4L5YA 4R1LA 3UVEA 4QFMA 2G1UA 2PRKA 2C3PA 3W9UA 5FA6A 3OWHA 1MDBA 2HK7A 2WINI 1KJZA 2EGHA 3INNA 4G8CA 1M1YB 1X14A 4R8KA 3CYFA 2JVKA 1EJ6A 2I7DA 3N2EA 4Y67A 5EVJA 5E1BA 1YRAA 1QGZA 4P31A 1UJ6A 2WIKA 4KXMA 4EHAA 4B2YA 3KKQA 5KB3A 3U4QA 1ZFNA 5A0FA 5SZJA 1GPYA 3OLWA 1K4MA 1VLJA 3FGNA 4A73A 4ND1A 1DO0A 4EFDA 3BWYA 3B1ZA 3H3XA 3V6MA 2XT6A 3HB7A 3UYLA 1U0TA 3EH2A 3REQB 1W4ZA 3DXFA 4LJ4A 5ALFA 1LV8A 5FLXM 5IASA 4MKFA 4WZZA 3IHWA 4HUQA 2ZE5A 5FWYA 2IXBA 1OCEA 1CUJA 1NF9A 4U39A 3EAQA 4D8YA 1W4RA 3IQXA 3OE7A 5AP9A 3RUHA 4F84A 3D3JA 4RAOA 4RA6B 2DWOA 5JD4A 5JXIA 4ID9A 5JAUA 1R8JA 3O73A 2KGWA 3TLAA 2GCPA 2HDWA 4ZEVA 2YOGA 1MA3A 1FFXA 4V24A 4CG2A 3KQLA 1HORA 2WP8J 2YJ6A 5KNBH 4UEOA 2PUTA 2D6FA 2VRCA 2HTFA 4RHUA 1P7WA 1PVOA 3OPQA 3WRVA 4BO7A 4H6PA 1ZJ5A 1O0CA 2FZKA 3GZ4A 5KYXA 4B74A 5DSTA 3BWMA 4C87A 2EIXA 4PE5B 4ZHWA 2WSLA 3L7JA 4GLOA 4YRTA 5CA1F 4FCCA 2P5UA 4G86A 3QSYA 4L5CA 5LJLA 5ICCA 4ZYYA 1Q2UA 3ZHRA 2XX3A 2VHYA 3L4KA 1H4TA 3V7NA 1HYHA 1QAMA 4F2GA 3O5AA 5DK6A 5ALLA 5KTOA 1G20B 3AC0A 1QIGA 3K9HA 1GYRA 4RW0A 4UNSA 2W2PA 2OUKA 2ZAGA 3I9V6 3KQHA 2CN1A 2B99A 3FYUA 3OCVA 4J0HA 5CEFA 2IH2A 2P1RA 2Z3ZA 5IVDA 1ESEA 1E9AA 1HDGO 4LTNA 3GLGE 1RKXA 2OD7A 5KYUB 1GG9A 1XP5A 3IJRA 2V96A 4BGDA 2HMSA 3L1UA 1HO3A 4LQ4A 3T5BA 1A0OA 4B73A 4EG1A 5KC9A 1L5ZA 3IAUA 3RH0A 4G0VA 1SU7A 1W19A 3BSWA 1IZYA 1E9SA 2E9SA 1VLQA 2IHUA 4LHZA 1JI0A 5T3YA 3T7JA 1GTJ1 3UA4A 3IOCA 5B6JA 2BGLA 1RLMA 5AUPB 2IF0A 4BT6A 2IU4A 4X3PA 2XBMA 3VNBA 1RQPA 5JNRA 3BF8A 1JDTA 1OXBB 4NYIQ 3RRFA 4BQSA 2PHZA 3VR1A 2OFXA 3F9RA 3PIIA 1RKUA 1H2AS 4PS1A 3R0QA 1LUAA 4G8JA 2O5EA 3ERCA 1WG8A 5EERA 5B5SA 3HB9A 2OWEA 3VC7A 3AVQA 3HKCA 1HR0B 1MOPA 4RDXA 5CRIA 5L45A 1UJ5A 4K46A 1T3GA 4QPZA 3NOOA 2W98A 3HB0A 4QXPA 5JADA 1GTSA 5FPKA 4RHCA 4XGRA 4Y6GB 4DJ5X 4Q7QA 4PZEA 3U3JA 4QXRA 2NXEA 3QUBA 1D2MA 4TUYF 4WCFA 4M8SA 2ZEJA 5JVDF 4AUMA 3L41A 4JS0A 3V8PA 1V9LA 1YIOA 4QJ3A 1C14A 3IELA 4RCYA 4IP0A 5C80A 3WZLA 1SCUB 1XNGA 3CE9A 1QYWA 3F7OA 1R0KA 1U0EA 3GEDA 3SSAA 1ZBDA 4EJFA 1VJ1A 3QE9Y 3N8NA 2PKXA 4TV8F 4FWBA 4RS4A 3KKLA 3SX4A 1XKLA 2IDMA 3WK5A 2C7VA 2WW8A 2EFEB 2QTHA 4YMTA 1P74A 1T9HA 2G0AA 5CH3A 1PR3A 1BE8A 1MAAA 4AY6A 3TN7A 2QMOA 1V1MB 4BUZA 4BIIA 1HA3A 4BNGA 5EUQB 4I5GA 1L3IA 5EJGA 2CXPA 3E5HA 4BLPA 4CJXA 4Y9SA 2PMPA 3HBJA 4HNUA 2FR0A 2NZYA 4MR8B 1EX6A 4LXIA 1LBHA 1TW2A 1GEGA 5FEUA 2PUAA 2GLTA 2EBFX 5JS7A 1Y6QA 5GY7A 3MCTA 1W2BF 3U49A 3NVIB 1VRVA 3IODA 3NHKA 3WGKA 1H6CA 2BWJA 5DRTA 3ZLTA 1QVAA 4NXMB 4EB8A 4U2GA 2E5WA 4CIBA 1XI2A 1XVVA 3NBYC 4A4DA 3PQDA 2N1MA 2CL5A 5JPCA 5DWQA 4URWR 1YDWA 5CPFA 1RACA 2JJ1A 4Y6LA 1Y3BE 1JXQA 1TL7C 2J8ZA 2WWWA 3S55A 4U2FA 1B8OA 3H9UA 4DUGD 5K6RA 1FBNA 1G18A 1XZMA 2G04A 2H7CA 2R62A 3QRWA 2FZVA 3Q7IA 4IIJA 1CR1A 2PMKA 5KHAA 3SY8A 4AQDA 3MJCA 3G88A 3P71T 4J03A 5REQB 4HLUA 3HZHA 2XQVA 2ORIA 2VJMB 2X9VA 4FEEA 2GH1A 4B5CA 1IBKB 4AI6A 3HWUA 2JFXA 3G9TA 2E48A 5H82A 3H1GA 4MDEA 3KSBC 3TLCA 4JGBA 1JHVA 1C3OA 1FS4A 5BQFA 1KI8A 2Y66A 2DTXA 4DCTA 5CJPA 1I14A 3DMHA 1IEVA 3OTQA 1FNNA 2MSDB 1RPTA 2Y67A 4QJ5A 5I51A 2VJBA 2ZYAA 1Z3IX 4XCVA 3NWPA 4JU8A 1HT3A 1M7HA 5BQXA 4RVGA 3FLMA 1ZN7A 1ZCJA 3LA6A 3TSOA 3F74A 2A59A 4TT3A 2Z1FA 5FTNA 4LY3A 2WPNA 2D7JA 1MH1A 1RXVA 2CVPA 2YFYA 4YI5A 2RG1A 1VGVA 1Z25A 1MD9A 1QDLB 2GPAA 3OZUA 4K6CA 1DAFA 4RVOA 4OM8A 4P22A 1A8IA 4IIVA 1SVSA 1N3YA 4OP2A 3NJRA 4UZEA 1FJHA 5KVQA 4F5DA 5BRJA 1PNQA 1X86B 1OH8A 3LFTA 3HRKA 3I1YA 2QRZA 3ENZA 1LRKA 2H3HA 2Y93A 3D0OA 4R5MA 3T5TA 4QU8A 1XA0A 2C1EA 2W6CX 3F2VA 3VYVA 1QG4A 1M5TA 5MFPA 4GXQA 2FDCA 3UWMA 4KV7A 3MQ4A 5GTDA 4MV1A 3JYNA 1U7HA 5AVJA 2DLDA 3PV0A 1L5WA 3DHWC 1PT7A 2ZSDA 1JAIA 2HSWA 1M0TA 2JIMA 2QR2A 3QMWA 4LRQA 1VP3A 4Y6SA 4HUJA 3R7AA 4HRVA 1K2WA 1E3QA 4CM8A 3Q3HA 4H27A 1OYVA 3CVWA 4R1UA 1N7GA 2CDNA 3S1AB 1TQ6A 3RRZA 2M1XA 2Y1GA 1LDMA 3ESAA 3QVJA 4XD2A 821PA 5IN4A 2IKSA 3JQRA 3W7VA 2AI1A 5FFNA 3PUJA 4MGZR 1DX4A 2POCA 4EARA 2UXBB 1Q14A 1MJNA 2B4RO 9ATCA 1X2EA 3JATB 2GYVA 2I6SA 2HB6A 2W0MA 2ZJ4A 4I9UA 5DTMA 4EX7A 5HKAA 5HW0A 4O29A 3WLIA 1A9XB 3DSRA 3OLZA 3ABQB 3QKWA 3O3OB 5ALIA 4AZ0A 2GK4A 4PYJA 1KDTA 2CMHA 2HWYA 4MQBA 2WTBA 4ZV4A 3FROA 3ZCPA 4DKXA 5LR6A 2P4EA 3CCFA 2YKGA 4RHXA 4YP7A 1KFJB 4WKNA 1OFHA 4IDFA 1L1FA 4AJ9A 4TVSA 2GTPA 2XOKA 4MXDA 4BCBA 4JT4A 1CX9B 1DAGA 4Q34A 2M6KA 1QZUA 1P2BA 3C7DB 3DG9A 3W34A 4D25A 3ACCA 2NP6A 3W6OA 4LPKA 1G64A 2ZI7A 1CETA 2ZTMA 1Y8QA 2IT1A 1U8YA 1ZU4A 3B36A 1PLJA 2VWQA 2CFSA 3OKPA 4RXUA 5AQEA 1IPHA 5CTAA 4RQOA 3W05A 4Q4HA 4CODB 5B57C 3HU3A 4C7OA 4EUFA 1V9SA 3AR4A 3FF1A 2I2DA 2ID8A 2P6PA 2YRFA 2HOQA 2HU5A 2Y8EA 1A9ZA 4ASUA 3FHLA 2HLDA 1H4VB 2Q5OA 4O4JA 1GDHA 2PSFA 2V7GA 3AOGA 5AKXA 2FSGA 1OMOA 4CMJA 4UNRA 1A9YA 1BN7A 2OHFA 4OA5A 5GQSA 4D4JA 1BDHA 4NBWA 1XAIA 5KOIA 4DT1A 2QVGA 3Q5DA 5CDHA 2Z6AA 1WUKS 1XRMA 4CCAA 4YUAA 2IP4A 2FFRA 2D1FA 3WFZA 1ZVKA 4WQMA 2EFDB 2Y9PB 3HYLA 4RXTA 4UUOA 2HBQA 1OU4A 1VPDA 2FSUA 2OCGA 3D3EA 3F97A 4KLRA 1M2OB 1CZOA 2B4KA 2ZF8A 3GRCA 3JQAD 5TARA 3CPQA 2I3GA 1H9BA 2G08A 2I67A 3C6MA 3ZX5A 3NVAA 3DFKA 3A37A 2Z6QA 4ID3A 3V4ZA 5A2QM 2C29D 1R9GA 2H4YA 2R79A 3ICPA 1QYVA 1Y9ZA 3FUTA 4YQZA 3PUIA 2QUIA 3R6TA 4ZVRA 4E0BA 4EUHA 5J4LA 2IIPA 1DIRA 2Y1EA 1TAGA 4N5NA 3HKDA 3PVZA 4XJSA 1H8EA 3ROXA 2MSEB 3S68A 3ST7A 1KEKA 1VLHA 3K0CA 1XT6A 1WW3A 3G9UA 1Z4JA 2I0FA 1ZNQO 1JHDA 3W9YA 3PWZA 5LQNA 2OD9A 3A9VA 1U0NA 4OQMA 2GM3A 2GOYA 5B53A 3TDMA 3CG4A 2ADMA 2WTUA 5C51B 1X7WA 1HE2A 1CY6A 3GMSA 5EY5B 2XI4A 3SBXA 4GDMA 1MORA 4C4SA 4RPLA 1FDSA 2COEA 3QVVA 3RGGA 4CMCA 4D92A 1D07A 2C82A 2UDPA 2ZJ0A 3VZDA 4D02A 4BVQA 1UPAA 1EHIA 2FVXA 3D6HA 3LKZA 4U7DA 3HM2A 2AR0A 1XDSA 1DL5A 1QANA 1BSVA 4KH1A 5D5QA 3UXMA 1C2TA 3VVLA 3NTOA 4ZODA 4ITRC 1J07A 5BSFA 2FPRA 1RWNA 1H0KA 5KVSA 5JXJA 3SR3A 4XSVA 1I2ZA 2F9LA 3A6FA 3DVQX 3DD5A 4P54A 3NHMA 5CURA 3E5RA 4JFAA 1L5LA 4DS3A 4J4HA 1ZOOA 3GQVA 3GU3A 5ED0A 5T5QA 2RGGA 2Q7OE 1KSGA 4JBXA 4G2TA 2HDOA 5AKHA 2WNSA 2A5YB 4FNAA 4G1EB 3NYWA 5DYNA 1Y7HA 3GFTA 1KQNA 5KTMA 4Y2UA 3U56A 2BF7A 2CL7X 2GJ4A 4N6OA 4C1NA 2NGRA 1LKZA 1FXSA 1YR6A 1KIFA 4NFSA 4C3UA 2JLXA 2CDAA 2JFYA 2XYHA 2QLBA 1TA0A 4JELA 3LLCA 4U63A 5ALMA 5FI0B 4A0HA 2FOIA 4GPAA 5BSWA 1CF9A 4KPEC 4TQUS 1HSOA 2AQKA 4J1SA 4GF5A 3AJ9A 3LCUA 3PPYA 4FS8A 1GNSA 4US2R 1J8FA 1Q91A 2QHXA 4HWOA 3WXMA 1LQ2A 2R8EA 2B7LA 1NQTA 1K8YB 3QFTA 1NSFA 4D44A 4MKIA 4HNQA 3VPCA 2HX1A 3SVTA 1KU6A 1SC4A 4ZVUA 2V9PA 4H4DA 3D00A 1KP9A 3VGPA 4JV5B 4H59A 2EKBA 4RJLA 4NH0A 1RHUA 2GRAA 4KZKA 4RVNA 3DVLA 2XMSA 1ZVVA 2J67A 3PNYA 1P81A 1DUVG 3I1IA 3KD2A 4FVTA 5L3VA 5A9RA 3AVXA 2PRZA 2VBGA 1NZFA 3HAXD 3ML1A 4X7RA 4V2IA 1FTNA 5ERYA 4AZSA 4WY5A 3FDXA 3S27A 4B4DA 5CX1B 3R1IA 5TX7A 1A4IA 3GFQA 2QZSA 4MJ7A 2VNIA 3LDTA 2OPHA 2W58A 4QFCA 1H4SA 2B9VA 3OA2A 4KW7A 4P82A 5AVSA 1U2EA 4ZHSA 4K9KA 2Z1EA 1BWQA 4S0XA 4KN6A 2ZAUA 1RI3A 3GVHA 2OXCA 4B82A 3EQZA 4M1TA 1LY1A 4FGWA 2WJGA 1MJGA 3NU1A 2XCLA 1N32B 5FO1A 4M9QA 2GO7A 3A1TA 2BONA 3E8SA 4F8JA 3LQ2A 2QUHA 1EFRD 4PLPA 1ESCA 1V6AA 2GRJA 2KX7A 2WIGA 5C2JB 3BBLA 5JH7A 1A2BA 2BEUA 4AG5A 3FOFC 4I3FA 4WT7A 4C1BA 2WE8A 4KKVA 1W1UA 3THRA 4AKEA 1BDMA 1JFSA 3WKBA 5I7SA 1UFOA 1KSJA 1K89A 1X87A 1O77A 2XVYA 3KO8A 3MWFA 4BJ3A 1E3LA 3HKBB 4E2YA 1N2BA 1E60A 4XRGA 3P26A 2XNKA 1SM4A 1S9HA 1WL8A 3E05A 1PDWA 1WXFA 3GLHB 3D54A 3MLBA 4C0SA 2DT8A 4F1KA 2W5UA 3KEOA 1RVDA 2ZRCA 2Y99A 4AUEA 2Q2VA 5DZSA 5FTMA 3VDXA 3VUFA 2PUEA 3FUXA 1L4FA 3UCEA 2PQ0A 1GCOA 1XZAA 3UAOA 1AV7A 1SRQA 4Z4HA 4GZLA 4PX2A 5G41A 1H7MA 2JATA 3IC5A 3NI2A 1ZCZA 2SKDA 4EQZA 1Y1RA 1GPMA 2H5IA 1WE2A 4DRXA 1COWA 3RIEA 3NDBB 2F3QA 4RULA 1CR0A 1RJ9A 3MJVA 1GV0A 3HM9A 3E7XA 2HCJB 2PKWA 2VSYA 3LX4A 5CNMA 3TIIA 4TOIA 4HDNB 1AMUA 3IL2A 3VI4B 1H8HA 4F2HA 4URHA 3VKWA 5I7AA 3VKGA 4O6VA 2HF2A 4M9XA 5D51S 2UVDA 4HWPA 1LPSA 4FJ1A 3EPRA 1MCZA 3H97A 1Z88A 3SDSA 1JL3A 3AEKB 1F1BA 1II9A 2QMEA 5LOVF 5A7HA 3VOTA 3OCWA 3HXKA 4XM2A 4RPCA 5TR9A 4QFDA 3RO7A 1AC5A 2ZQZA 1T2FA 3T3PB 2AC7A 4F04A 2GXAA 3ESYA 2WAXA 4KWIA 1SA0A 4N5IX 1HDIA 5DBEX 3SZGA 4RJJA 4PAOA 1Y8RA 1IG3A 3AEQA 2G06A 1EGHA 3K1JA 4I1UA 2W2MA 4DBLE 3IEUA 5BSVA 5CBKA 4CCYB 2YZMA 1P91A 2VHCA 3TZCA 4LI3X 4AF8A 5IM4F 4HVTA 5ILGA 1LH0A 4MR9A 2QI9F 5KTSA 4H1TA 4BT3A 4DEYA 1Z16A 5DBHX 4IRUB 2ILTA 1JD1A 4WK6A 3S44A 4LRUA 3UK6A 4DHWA 5CIQA 3W5BA 4L15A 5BN5A 1YJ8A 5SYNA 4HTAA 2QX9A 2AR9A 2FEMA 2VL7A 1FDRA 4GI5A 5E3JA 1C3LA 4OHPA 2LBTA 3HP4A 3DW1X 3A1CA 5LUAA 1KQGA 5AVMA 3IMEA 2R1UA 1FQWA 1US8A 2I54A 3CUUA 3PQEA 1HE3A 4ROTA 3JQDA 2X19A 4KXVA 4UM7A 4BJHB 1C4WA 1W52X 2B8TA 3TRFA 3WLPA 3MTGA 4NYJR 4JOQA 3A6PC 2WTNA 1C9MA 1KY4A 1VL5A 3SC6A 2GB4A 1KI7A 2R3SA 2ZVYA 3HPRA 4P2GA 3SXUB 1SXIA 1X7OA 4ATNA 3A26A 3I8XA 4HH0A 3A11A 4U3JB 1RJWA 3AJ8A 3WGTA 1ELOA 3LWNA 4TZZA 3MC1A 1WCIB 3HYTA 4PR0A 5SY6A 1ODTC 3HR8A 4OMDA 3MRXA 1USUA 3KKEA 2WM8A 2H1IA 1U5BB 4H6VA 3GXOA 3ZHCA 2OZLB 2V7WA 3E53A 3OPNA 2PSHA 4IL5A 5ADWA 3QHPA 1OX5A 2VHTA 4HQLA 1D1TA 3G13A 3U4HA 2C88A 1SKMA 2ZM6B 4U9IS 1EM6A 4IDOA 4D8TA 1GFSA 4YCSA 1PLLA 1SIBE 1ZKDA 3BVPA 3OMLA 3ZQUA 4Q9IA 3Q72A 3OPVA 2BKEA 3TLEA 3BG5A 4Z1OA 1O95D 5K8LA 4RCVA 3LBAA 1CLEA 3OTIA 4LBYA 3MYRA 1NPTO 1FNCA 2J7PA 1T29A 2ZAMA 3EWIA 3U61B 2G3YA 2XCRB 3WNZA 4TWZA 4FLMA 4XKJA 3A2KA 5GZ6A 4CQMA 4QQ8A 1LPPA 2XECA 4W8OA 1C1YA 1W88B 1Y3IA 2HIAA 3HG7A 5JE8A 4Y9DA 3DFFA 4TMZA 1I2BA 5F3RA 1HQKA 1TVMA 1X7YB 1E9FA 2JJ8A 3AUAA 4JAVC 5FFMA 5DOVA 2R86A 3G59A 4OJYA 3ZR4B 1R0RE 4E2ZA 4OCZA 4ZO9A 2CLEB 4G84A 2OHIA 3OZEA 4IFBA 3VZPA 3C8UA 1NVAA 2XHZA 4BN5A 1P5JA 4N8EA 2H2HA 4Q21A 3CZCA 3LRPA 4JLWA 1J70A 2HS0A 1I0ZA 1N8KA 3IEWA 2GBCA 3JRXA 5TPZA 2YIDA 4DLWA 3GF4A 3VR5D 5KYKA 5CDYA 1URPA 4KGDA 6ABPA 3BN3A 2VT2A 3KQKA 1V26A 2JEYA 3C3PA 3DUFB 3LUKA 3GPCA 1KZHA 3EEIA 1J90A 4UCFA 3BMNA 3T7EA 1PX2A 3WYGA 4R3NA 2YXPX 3R0JA 2VR1A 5A0VA 1UBOS 5CH8A 4BO6A 2OG1A 3NWBA 1R12A 3OPYI 2GLZA 1GSIA 1YFJA 4C81A 1DXHA 1MB4A 1XA3A 5CYPA 3WLSA 2EDCA 3GWGA 3URKA 1C7QA 1NONA 1G3MA 2GZ1A 1K3UB 3A4MA 4GMDA 1LEHA 1B16A 1SBIA 1FW8A 1XZHA 1EQAA 2AWNA 3LGXA 3P9XA 4FT4A 4L75A 4GPBA 1EHYA 2Z8XA 3ZE6A 5CG2A 3VMFA 5L9AA 3QYPA 5KTYA 1G59A 1GR0A 3K1AA 1IM5A 4RAQA 2J5KA 3KB2A 2GERA 1XRNA 3VPBA 1JJAA 3CX3A 2X40A 3IVMA 2PGOA 3NBXX 4NP6A 5FIUA 1VKOA 3AB3A 5HILA 3TL2A 3KRTA 3UY4A 3B6ZA 4ZALA 1PQ4A 4REQB 5DU2A 3SOZA 1KYVA 1Y37A 3PFFA 3W8FA 5J4KA 4EGQA 2DYYA 2DT5A 3I3SR 5EWJA 3CCVF 4LOKA 4YN3A 1T9GR 2GN2A 3A4VA 3CYQA 3VU9A 3GGJA 5HQ3B 4I14A 1Q7GA 2C4MA 1WHSA 2EF1A 2OL4A 4Z7JA 3X1YA 3K05A 1OPRA 3OBIA 4RGYA 1F7VA 2VJQA 4KXLA 3GHHA 4IDBA 4MP6A 4X84A 1YI2F 4KQJA 4WCDA 5EC8A 1ZRMA 4RSGA 3ZI0A 4ZAXA 1K6EA 1PJ3A 2AN9A 1WVGA 2E6KA 2VUTA 2BFCA 2YY5A 4IIDA 1O7JA 4H9GA 5B2EA 4MUFA 1HH4A 3ZZUA 1R88A 1KO4A 2RK6A 5ALGA 5F33A 5B7NA 3KALA 3GLFB 2EVWX 3MS4A 5E1DA 4YCMA 5A4FS 4MLPA 4JB3A 1MC4A 2Y1FA 2YN4A 4ZCSA 3P9PA 1UDAA 5JZ9A 1PNVA 3WP1B 2Y76A 4EKYA 1G6Q1 3WMFA 1RM0A 1GTMA 1SKAA 3RFXA 4WZAA 1DCFA 4P4SA 2A0YA 3SNKA 1DDIA 1SEPA 5EUMA 4PGHA 4FHDA 3FR8A 4F60A 4TSFA 5EG5A 1A7UA 1C7ZA 2UV8A 5C8YA 4TWIA 5HRUA 1R1MA 1XUOA 1WB4A 3GT4A 2O8EA 5FOVA 1E1YA 1NIPA 2X4LA 3O75A 1J0AA 4RK0A 2VYVD 1Z75A 2FZLA 2K7FA 2ZXUA 3JD4A 1M34A 1RYHA 3E0XA 4GNKA 2G8LA 4Q39A 3ELWA 3FMFA 1OXSC 2WHQA 4V1CB 1JEQA 3KJIA 1NYRA 1ZAKA 2AI3A 4MVJM 2R6FA 5K1ZA 4U2CA 2POQX 2GBIA 4MPTA 3H1TA 1HOTA 1T5OA 1OTHA 1Q3TA 3ZEAA 2AFHB 1OYOA 4R01A 4B5LA 2Q3LA 2VH5R 2ZRFA 3GN1A 1DG9A 3VZRA 1E3IA 2XYPA 3VC3A 3I56F 1QGUA 1BJKA 2HMYB 2ILVA 2P8JA 4MLCA 1RRMA 3RTAA 3FB1A 5BYBA 4EZIA 2BSQA 4O2BA 3RM3A 4QE3A 4D45A 1AUVA 1AM4D 3KOUA 3G8YA 1R0ZA 2VDOB 4ARVA 4ARIA 3BK1A 1IY2A 1RYBA 4X94A 1BCRB 3L2OB 3EQ6A 4MIOA 5JTTA 3HEMA 4F72A 5HKKA 2WVHA 2O2CA 3MWLA 5L95A 4NPCA 2JFUA 2EATA 4YP5A 4MRNA 2EZ9A 2Q8PA 5BSTA 3SZUA 4H1WA 4C2TA 3OIDA 1YB5A 1ID8A 4ESEA 3P0JA 2IQIA 2ARKA 3HRIA 4XA8A 4DCVA 3NNSA 1XKQA 3EXFA 1YA4A 4W1QA 1CUZA 3HYSA 2F6RA 2VHZA 2ZUDA 4FZVA 5ECDA 1R7RA 3MBKA 1H66A 4CG3A 4FM9A 4BB9A 3I2HA 1E2BA 1DUSA 5BNZA 3H9GA 3WGQA 3QQPA 3BD9A 1LX7A 2H2WA 4QASA 5JLAA 2H16A 2Y3IA 3K2QA 2I91A 4JJFA 3F47A 2IY7A 2QE7A 1ZHOA 3QTLA 4ZHQA 3PVCA 3V7FA 1R4MB 1Q1NA 4QA9A 4QL3A 1TTHA 4Y1FA 1P4AA 2XPCA 4ZDJA 5IWCA 2FZ4A 4UAGA 1T3ZA 5CAEB 4XQ9A 3U3MA 4PZAA 4QYTA 1PF5A 2A30A 1JFFA 1B6RA 1C9JA 2FPLA 1FY2A 2RIRA 3NQ41 3O31A 2KM1A 3VKVA 4CL0A 4M7WA 5AK0A 3EVTA 3VU8A 2N1BA 4MHTA 1EFUA 2ZZNA 2AI2A 1ESNA 3V1MA 1YNOA 1S3IA 3K32A 3F3KA 4P1ZA 1O87A 5DJ5A 4BAZA 4GDFA 3BE6A 4CKEA 4B3CA 1ZD2P 3ZE1B 4EY8A 3D59A 5EZ6B 2FDRA 1GGMA 5LA6A 2NO9A 1XRRA 5IKOA 5HFAA 5FNVA 1ZI6A 2KHZA 4JC4A 3JD1A 4PN7A 2ZQYA 3IURA 3ZZ1A 4H31A 4IJMA 3G8CA 1DKRA 1ZU5A 4NBRA 4H7IA 5JAMA 1WBDA 1NNI1 3KU1A 4F97A 4DCCA 4FHCA 1GTL1 1FU4A 4IDPA 4GPZA 1OI2A 3CLRC 4Q9LA 3WTCA 2OE2A 1P80A 3WLKX 5CLIA 5HKBA 1XKXA 3JZFA 3H3FA 3QU9A 5JRZA 1B00A 2FXIA 2ZPAA 5I4BA 3DHEA 1IHOA 4OHRA 5D01A 3QOXA 2PXHA 4JA2A 2ID7A 2XDYA 1QFXA 2JD1A 3FYHA 1N77A 4NJMA 3LIPA 5ALZA 1ZLYA 1Z5PA 2WSMA 1GG5A 2B33A 1RYZA 2C5SA 1D6MA 4MS4B 4WTOA 4ZAWA 5AUOB 1A2KC 5BR4A 1NW3A 2H0QA 2OLEA 3DCNA 3HNPA 1Z82A 3B12A 1I36A 4OVKA 3DLTA 1OI7A 5CDFE 5H3LA 1JQLB 1VJ0A 1XCPA 1T9KA 3K12A 1DXQA 1EG2A 3KHNA 2P1DA 2J5BA 2HADA 4NPHA 3WJ1A 3IKJA 4P36A 3BFJA 3IKEA 3H13A 4QODA 2CV1A 2GCEA 4R2LA 1Z6ZA 2PZJA 4G4SO 4HOYA 4MW4A 1DAKA 2IUEA 1COZA 4PNHA 2NUAA 4LCBA 1LDGA 1YZGA 3Q2KA 2VHVA 3GT7A 3JYPA 2UUOA 2Q7DA 1ZVMA 4TKLA 1A9SA 4IGIA 5IXYA 3TTYA 5EJ6A 2FWBA 4R1QA 3S2YA 3T8YA 3CCJF 2NZWA 4JI7B 2P9JA 2XDQA 4FNOA 1NG1A 3FMPB 5GVRA 4AYXA 2PD4A 3O8OB 2V4UA 4ZXFA 4RTOA 3QLUA 2CJWA 1ZI9A 1IUKA 1ECFA 3GFOA 5CA0F 2OWDA 2PK3A 4BMCA 1IE3A 1SQ0A 4UVIA 4E07A 1EWQA 4HL6A 2QX8A 4K1LA 2AG5A 3PDCA 4DV7B 1J39A 1N9GA 5LBIA 4J94A 3ZBTA 1K9MH 4GP6A 1ECLA 4LF5B 2A6PA 3A3OA 1DQRA 1FTGA 2QRGA 4E2XA 5JWHA 1KQOA 3K8ZA 3LY9A 2R6HA 1J7KA 2CDBA 5JMOA 1CEYA 4EHLA 3DHNA 2R4UA 1UBJS 3N58A 5JCOA 3EULA 4GVLA 1L5RA 5HXUA 5E8RA 1FSPA 2TRSB 3LOUA 3QKSB 4KN8A 3VJKA 5LLDA 3S1LA 4L9AA 5KAMA 3CX4A 5IT4A 4FMDB 3H86A 1ZN2A 1G38A 1DWQA 4BFWA 4HXFB 3GLIE 2H52A 1XTTA 1A8SA 2R0QC 1O5IA 2OLKA 2SCUA 4CUZA 3A1WA 2I2BA 3EGXB 4LECA 2V97A 3I76A 1ZN9A 5F7JA 3BRSA 4PLHA 4REMA 4YBRA 1W6RA 2YFQA 2Y1XA 3RKRA 3TEJA 5DYWA 1SOUA 4EDFA 4LZNA 1YI0A 2AA3A 3N2GA 2Q4DA 2X9LA 3DVSX 3JWHA 5HA5A 1QVFF 4PC7A 4RV5A 4H1UA 4FLEA 4G41A 5HZHA 1S2MA 2F2TA 4WDQA 4ZVNA 3TB6A 4ZRNA 1JAHA 4C7XA 1XPUA 4BNZA 3S7ZA 5LYJF 1QG0A 4IAOA 4HVAA 4JVMA 4RZSA 2IZOA 3L6OO 4C04A 2G25A 2ZUUA 3V97A 2JJMA 1GG2A 5IK2A 4YUWA 1ZWLA 1EUQA 1WR8A 2YTZA 2P5YA 4RIHA 4NXNB 4W9NA 1VQ4F 4D9NA 2RGWA 4L0CA 1SQ5A 1N8TA 4IIEA 2HV8A 5DM1A 3LXMA 3DDNA 1T2VA 2Y0PA 1W46A 3RYFB 5B2ZA 3DHYA 3OIGA 4QARA 2P4HX 2PVPA 2PWBA 4WOKA 4AMYA 4EY6A 4JUCA 2JLCA 1BYUA 4OYLA 3DC7A 3ELBA 3FZEA 4IJUA 4IQ0A 2UYCA 3ZHBA 4HDMB 2Q41A 3S0WA 1GILA 5JASA 1V8ZA 3ESBA 1CUDA 1GRVA 4E31A 2RARA 4MWBA 3OLCX 1AT1A 2D1YA 3NXKA 1Y1PA 2E4AA 3GZNA 2ZIXA 4JITA 5E4TA 4EB0A 1U0FA 5MDHA 3PFIA 1W41A 1EXMA 4G4ZA 2I4IA 3P2JA 3CT4A 2ZYTX 1ODFA 1CQXA 4U7WA 3X44A 5AO9A 3OTOB 3UFXB 1GR1A 1APBA 1VHWA 1C1HA 2P2NA 2HJ9A 4ND7A 3RUFA 1YF3A 1P5RA 3W6UA 5EZYF 2C4KA 2R8ZA 3EZ2A 3FIJA 3GFVA 4KKXB 2XYVA 5FCDA 1AV6A 3DBHA 3W5HA 3CCBA 1QO7A 2PX8A 2PL9A 2FPIA 1GPDG 4XX1A 1BWRA 3PPIA 4YWHA 3O91A 2X2EA 4II3A 4RQBA 1MLDA 3K0BA 3B9PA 3G71F 1Y8CA 3LYHA 1KZ4A 1L8QA 4LZJA 4QRIA 5F52A 3RSQA 3UHFA 4WBNF 1IZ0A 3UAVA 3DWGA 1DLIA 2HA7A 1OY1A 2QQ5A 1F51E 2OHWA 2W22A 1VPTA 2R4TA 2F1IA 2OXFA 1JH8A 2VAVA 3ET4A 2GSDA 3LP5A 2D8MA 2QMUA 4KFSA 1IZ9A 2GBPA 4BT7A 1L2TA 3G23A 2A0WA 2XGSA 3U4IA 3DKVA 2RI0A 1SUBA 1T4MA 3BZBA 5TEVA 1XVIA 4BMOB 2B35A 2JHCA 4F91B 2JHFA 3NIWA 4NAHA 5K45A 1E61A 3GROA 3AP2A 4JP1A 4QHTA 3W5IA 1U90A 1H5UA 2QTGA 1P0PA 2YDYA 3RQSA 1AUPA 1SO8A 4R8MA 2GJ9A 1I4TD 4U2DA 3V4DA 3ZDRA 4I1SA 3ZWAA 1JJVA 4LZZA 1PQYA 1Z2EA 3BGOS 1K5PA 1SUWA 4G01B 1EVQA 1NN1A 1QX4A 3EG5A 1J5PA 1I13A 5TXGA 1M1YA 2AXQA 4HGYA 4XWAA 4RL4A 1HLDA 2EC5A 2XNJA 3GJ6A 4CWAA 1IQRA 1VL2A 3T3OA 3NTUA 5I7WA 1I2MA 3K2BA 4XSGA 4F7WA 2P9YA 1KMHB 3QKUA 1TYBE 2EFCB 2H06A 2NAPA 2OP1A 3B1XA 3RE1A 4K9SA 3TOSA 3UOWA 4WLFA 3TQSA 4EG5A 3ZDAA 4GL2A 3L7DA 4E03A 2R6GA 2WG2A 1R10A 3TIXB 2CFIA 3MBOA 3S8EA 2WFLB 4PLGA 2BI7A 3N76A 2IUSA 5CXQA 4J4TA 3L01A 3P2IA 1G8GA 3GCGA 3O1JC 3O95A 1Q50A 2WJIA 3COZA 2W4MA 3JQBA 2FFQA 4ESVA 2FMTA 2WDZA 1FQOA 2PKYX 2JHGA 4N0EA 1GDTA 2H11A 2GZLA 4DEXA 3KELA 5B2FA 1BVRA 1TUIA 4FZJA 4JSRA 1DOHA 3FVQA 3MT9A 4IX9A 4Z1MA 5AVOA 2BTQB 4RA6A 4J2HA 4HO1X 5KMGB 2WPDD 3VIUA 3A36A 4CEHB 2Z1DA 4PAGA 1UKCA 4IV5A 4R81A 2QT9A 1KFKB 1XF1A 2C1ZA 3Q8XB 4JA0A 3IMPA 1AQUA 3I04A 3K4QA 4KLZA 1NC1A 2JFWA 4MI9A 3BGIA 4Q4CA 4EBBA 3UJDA 3ZWKA 4NHOA 4UHBA 3RRMA 1DIOB 3M1IA 4FR0A 4E5NA 4DWWA 4Z4GA 2BGTA 4BMZA 5B1IA 5DHTA 1VFPA 4WERA 4X3CA 1S1CA 4S0ZA 4TTSA 2XSZA 5L51A 3IJ5A 2YZKA 3H18A 1RQ7A 1O1YA 2VT3A 2D4AA 2IHJA 3KEFA 4NTZA 2PZMA 4UM8B 3IIIA 5HE8A 3SHQA 3WJ2A 4XGNA 4BFSA 5EINA 1G5TA 4TZ0A 1G20A 5LLSA 3P94A 3BIXA 3F73A 2XTAA 2TECE 3ASVA 3CYPB 2CLSA 4UTVA 4XWYA 3DHVA 2AHOA 2FPGB 4MYDA 1TTQB 4BAGA 1U4SA 4MK4A 1UI9A 4I9HA 4LZWA 3L82B 1Q57A 1KOLA 3DW3X 3D3WA 3OI7A 3VPXA 4AMGA 3EXAA 5AHOA 4BKQA 4LVUA 5H16A 3O2NA 4Z3DA 4DMRA 3LWDA 1SUAA 1T4CB 5JXGA 3ANNA 1JFVA 5F5NA 4EW6A 1QSGA 1UODA 2O2HA 2BHRA 5JCPA 5KQRA 2QN7A 2HTEA 4OI4A 3FPSA 3P52A 1LXCA 4Q6WA 1BA2A 1H6AA 1UOPA 1VL8A 2FJ0A 2J09A 1IHXA 4M1WA 1RBMA 2DKOA 3I5AA 4JGGA 1LLUA 1MF7A 5PNTA 1OBFO 3SEAA 3T95A 4ZZ0A 2IXGA 1JLRA 1KETA 1LI4A 2QP4A 3ESCA 5CNJA 1DJNA 4C0WA 4JEIA 5IULC 1GU0A 3VI6A 2O2EA 4MS3B 1NP3A 4YVFA 4DYVA 3TEFA 2PBLA 2ROQA 2IYLD 3ZP7A 2ZT8A 3HJHA 1SRRA 1ZWKA 1JAYA 1Q22A 4K0RA 4WEOA 1ODEA 4J7XA 5D1HA 1SCUA 2F1OA 1RJFA 1CU1A 3FPIA 1NVFA 2PSEA 3CNOA 3GOQA 4FNMA 3T9FA 2BRUC 3BIFA 3FOAA 3HDVA 5G3YA 5GV8A 3PC4A 2ZRGA 2XTJA 4L5BA 5SY9A 4F2PA 1HL7A 3O85A 3RYCB 4CMIB 3N6XA 2IODA 1V48A 3NKVA 5I01A 3K0EA 2GFHA 4B7XA 1V1MA 2O4UX 2MCFA 4ZYUA 2NO5A 1E7SA 2J48A 4ARUA 5IBRA 2ZFUA 3PNOA 5LKAA 1ZIXA 4MR8A 3RBXA 2DTEA 3D7RA 2FF7A 3WBBA 2IEBA 4F4JA 1VCIA 1J8DA 4OH1A 3DMPA 2CW4A 4HHEA 2XUAA 4WY8A 1AKMA 4BFYA 2XWBF 1CUYA 4CDRA 3MJDA 3FFAA 4TV9B 1EUZA 4BVGA 3IUYA 1T5TA 3ONVA 2ZIFA 3BAZA 4BKMA 3LL4A 4MGKR 1JMKC 3JQ6A 4YQFA 4DA4A 1TZMA 2RH5A 2D0PB 4G26A