3WGNA

Staphylococcus aureus ftsz bound with gtp-gamma-s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 106
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgnA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgnA01
1JFFB 5J2UB 3RB8A 1TVKA 4X20A 4O2BB 3JALB 2VAPA 3M89A 3N2GB 3VO9A 3VOAA 5JQGB 1OFUA 3VPAA 4YJ3A 3R4VA 5LXTB 4EB6A 3RYCB 4HNAB 4O2AA 4YJ3B 4B46A 5BMVA 1W5AA 4E6EA 4O4JB 3HKBA 5ITZB 3JARB 5JCOC 3HKCA 4F6RB 1SA0A 5C8YB 5LOVA 2R751 3JAKB 4ZI7B 4ZHQB 5KMGA 4O2BA 5IJ0B 2BTOA 2RHOA 5CA1A 5IJ9B 2R6R1 3HKCB 3VO8A 5EYPA 4TUYB 5EZYB 4ZHQA 1FSZA 1TUBB 5IJ0A 5KX5A 5LP6C 1W5EA 2VXYA 2GVIA 3WGLA 2RHHA 5CA0A 4EB6B 5CB4A 4O2AB 3JATB 2Q1YA 4B45A 5BMVB 1FFXB 3M8KA 1RLUA 5MN6A 4XCQA 1TVKB 3JALA 3N2KB 3N2GA 3WGMA 5JVDB 3RYFB 2BTQB 4DXDA 4KWEA 2RHLA 5JQGA 4EI9A 4X1KB 4X1IA 3ZBPA 3JAWB 4YJ2A 5LYJA 4O4IA 4TV9B 3RYIA 4O4LB 5FNVA 5LA6B 1JFFA 3HKDA 5FNVB 5GONA 4I55B 5IJ9A 5LA6A 2BTQA 4O4HB 3JASB 5GONB 4X1KA 1RQ7A 3RYHB 5J2TA 4I4TA 3JARA 4IIJA 1W581 5LYJB 4WBNB 2VAMA 4FFBA 5LOVB 4DRXB 3HKEB 4F6RA 3JAKA 4U3JA 4ZI7A 5JH7A 4EI7A 3WGKA 4U39A 3C8LA 5M7EA 4I50B 4O4JA 5ITZA 5MN4A 5LP6B 5LP6A 4M8IA 4U3JB 3JATA 3UT5B 5MN5A 2RHJA 3ZBQA 4HNAA 3CB2A 3RYCA 1Z5WA 5KX5B 4O4HA 3ZIDA 2XKBA 3WGJA 4WBNA 4DRXA 5EIBC 5EYPB 1W59A 3E22B 1W5FA 1W5BA 4TUYA 1RQ2A 3HKDB 4X1YB 5KMGB 4IHJB 4ZOLA 1Z5VA 3RYFA 5JVDA 3HKBB 3N2KA 2XKAA 4LNUB 3UT5A 3JAWA 4TV8A 4YJ2B 4X1IB 5CB4B 1SA0B 5LXTA 1FFXA 4I50A 5JCOA 3WGNA 5IYZA 4TV8B 5CA0B 5IYZB 4FFBB 5EZYA 3HKEA 1TUBA 5JH7B 4IHJA 4ZOLB 5EIBD 2VAWA 2Q1XA 4I55A 5J2UA 4LNUA 5J2TB 4X20B 3JASA 3RYHA 5CA1B 3V3TA 4IIJB 3E22A 4I4TB 4EI8A 4O4IB 4TV9A 3RYIB 3VOBA 4X1YA 4O4LA 5C8YA
chains in the Genus database with same CATH superfamily
1RM3A 4YDRA 1W85B 2ZPTX 3TVYA 1XGKA 3NPMA 5KVCA 3HXPA 4RD0A 4C30A 1IEQA 3I5UA 2IDKA 4PHHA 1ORWA 4GC9A 2F9FA 3W2FA 2BDTA 3CUUA 4RKEA 2D5LA 5JD3A 5DJ5A 3W2GA 3BS4A 4H17A 3MC1A 1P9LA 1A88A 1PT8A 4CUZA 1UC4B 4WA8A 4D45A 1D5CA 4RJTA 5IFKA 4B3MB 3H5IA 1F4VA 1VBMA 1KI6B 2GXUA 2POQX 4O8CA 3N2IA 3TIGA 3KELA 1X6VA 3AF5A 2WJJA 4KJZA 2NAPA 2AK3A 1HT2E 3TIFA 3COVA 3FYHA 1DI0A 2KSQA 4NSNA 4UEJA 2B8JA 1IY8A 2GAFA 3N2NA 4WBXC 3K6JA 3JVEA 2ZVPX 4RL6A 3KR1A 1L2TA 2GPJA 1DUSA 3GB9A 2XB2A 3LCCA 4BO0A 1YJAA 4CQMA 2VT6A 1W93A 3NVIB 5AW3A 3G0HA 3JQ7B 4Q4AA 4Q1CA 2O5CA 1P60A 1CE8A 3OPXA 4GZMA 1T3HA 3HMQA 1E3EA 3UWSA 3V7FA 1EINA 1QD9A 4H6WA 3AJ9A 5EKDA 5MDHA 3CPSA 3GARA 3I28A 2V7BA 4LOLA 4DJJA 3MXTA 2P6RA 1MFPA 4OL9A 2ZSBA 2H1OA 4KPEC 4A1FA 2FCRA 3OJEA 3VU1A 1FW8A 4N3NA 5BWNA 3U49A 4Z3DA 2NO4A 1RRVA 3GYBA 4XYGA 3U7EB 1T5OA 3NASA 4HO1X 2YNMA 4ZDWA 5IJ9A 2P77A 3R7WB 1BEEA 4UCQA 1IXYA 1BDHA 3OJLA 2Q6KA 1P18A 2HIGA 1Z38A 2XUFA 4DRXB 1IHUA 1BMFA 1JJVA 1M2OA 1XLWA 4LG1A 1OXKB 1ZVJA 2O1SA 3OLVA 4N12A 4KH0A 1V4VA 3KKKA 3WQBA 4AVYA 4BP1A 5REQB 4NQ3A 4GXQA 2EWVA 2C8JA 3HRIA 2G08A 1PVDA 4O2BF 1X1BA 1WVGA 4ZYZA 3IUEA 2M1XA 3HUTA 4OQEA 5CUQA 3QF7A 3C9UA 4WXEA 1WW3A 4D3ZA 4Z49A 3WKDA 4W63A 3ZV3A 4IV0A 5JDIC 2PGNA 4HAZA 4BB0A 3I64A 1NXTA 2FVXA 2IYUA 2HYDA 1BU5A 1E5TA 2A0UA 2OO7A 3AB7A 4OP3A 1RS0A 2VHVA 4F4JA 3CWQA 4RWZA 2OAQ1 4FMCF 1HFKA 1ZVMA 1ECGA 4HX2A 1A9SA 3O8LA 4JT9A 1W0JA 4UPDA 4Q1DA 1GRRA 5EKSA 2CVPA 3THSA 2AFIB 4QFDA 3MT7A 4R2LA 3W5JA 5F23A 3ZIAA 4EABA 2CD7A 3ZJUA 2I6XA 4Q9DA 5JXJA 4EYEA 4NP6A 2FUKA 1OYVA 1O2DA 1GTRA 2YOHA 3HK2A 3HWSA 1TDJA 3CVWA 4JBWA 4OFBA 5EHGA 2XLBA 2QQ0A 5EHZA 5KC9A 1U4NA 2CB9A 3FIUA 4OAOA 4YTEA 1PDOA 3GROA 3RRJA 5CITA 2EKDA 3UK7A 2CNNA 2IU0A 3EODA 2UYYA 5CPBA 1OI2A 4BLWA 1PN3A 4J29A 5GIPC 2JFUA 3AFMA 3NDPA 1DO2A 1Z2AA 1MP0A 1QQAA 1EVIA 4RQTA 1ZL0A 3GOHA 4F2PA 2GT1A 2OCBA 1NDQA 3K8YA 2EL9A 5M34A 1EGHA 3RF7A 2VTEA 1AC5A 3AR4A 2R7KA 1PJAA 4U9UA 4FM9A 5L3RA 4G84A 5U4QA 3FZQA 2UXBB 3H8WA 4M0CA 4CLRA 1A8QA 3DMPA 4HOYA 4QYTA 2BGGA 2FR8A 2D2EA 1MGOA 2HRQA 2PRZA 3AHIA 4LRUA 3LC0A 3QELA 3IR7A 3EISA 5KO2A 2CK3A 3U0VA 1PJ8A 1TM3E 1OLSA 3CW8X 3V4LA 1LTQA 4WLNA 2DCMA 3KUKA 1RWVA 3D31A 3GMSA 2NO5A 3FRJA 2WU0A 1MG0A 2C03A 4BKMA 4ZHQA 3P20A 2XGJA 2DULA 3JQAB 1JR4A 1KDOA 1EB8A 3RF6A 2PZMA 4LMPA 4LPKA 3VZQA 1ND5A 4KOEC 4Z4GA 1XZHA 4Q16A 1GPJA 2IYOA 3DVLA 1VIAA 1EMDA 1U7TA 3AUTA 4M99A 3CZQA 3GPBA 4XSGA 2M6KA 4BFWA 2BR5A 3PLAE 3P9CA 4GWKA 2DT4A 1QMPA 2I7DA 2W4IA 3B3JA 3CVJA 4EKYA 2HQOA 1WDKA 3OI7A 2JD0A 5LKRA 1M6NA 2IY7A 2V6MA 1QHHB 1NQOA 2PBLA 2X2FA 1HMYA 1DBVO 1LNZA 3QVMA 4QOGA 4R83A 4TXJA 1UBKS 3UNXA 4D9BA 5TPWA 1V8DA 2W6OA 2Q45A 3JASB 1LGYA 1XVTA 3QPUA 5EPUA 5EESA 4F85A 5JRZA 3MF4A 1LDMA 2WOJA 3Q9UA 5DXFA 4LCKA 2GZ2A 2I4LA 1TW2A 3LOPA 3AEQB 4HDMB 1VA5A 4MRRA 5B4UA 3H13A 2H2HA 1E6KA 4KR7A 1HDGO 3AF0A 2G1AA 1KTVA 3ZU3A 3AERB 2QN6A 4JC4A 3WLIA 2O8DA 2R7MA 3TFWA 4LGVA 5BQ3A 3RYCA 1W48A 4KQ1A 2RBEA 5HCIA 5B8FA 1FFYA 2WP8J 1A5SB 3ELWA 1ZSYA 2W22A 4HAXA 2ZJBA 4XE5A 4EHFA 1Y6GA 1H2BA 3EIOA 2AX3A 4X8MA 3EASA 2BMAA 5FWNA 1VXOA 1P4JA 3K15A 3KT0A 2V7TA 2HX1A 5G40A 1R0WA 2ZUBA 3D9QX 3IRVA 3BXGA 3HAXD 3HKBB 4K1XA 3EAQA 4ZTBA 4OHYA 3F2IA 1NX6A 2CXSA 3Q15C 3PWTA 1PW5A 2PYZA 4DB2A 1WABA 2QZJA 3C5EA 5IDQA 1CX9B 5A2QA 1SHUX 2GXSA 1V26A 4KNVA 4S2EA 121PA 1S8AA 1IMOA 1PZEA 1QR6A 2FFBA 4PO9A 1WCIA 1QH9A 1S01A 3PEWA 2B94A 2Y1FA 4HGNA 2TSYB 3TE6A 4BNVA 4C7KA 1I3LA 5B4VA 1U1CA 4GPZA 4MVYA 1W5TA 2WWWA 2ZE7A 1T1JA 2RGYA 3OKPA 4MV4A 3IUQA 3AR5A 1BEZA 3F3MA 4P22A 4KLCA 2DYYA 1WG8A 1XWWA 4RTMA 3NOQA 5G4UC 3GRUA 3QU9A 1C30B 4W6ZA 1AU9A 2AF3C 3SBDA 1QZ3A 4E2YA 2Z04A 2ORIA 3CJRA 1XF9A 1Z0IA 4LOKA 3P2IA 2V9CA 3RJZA 4QT4A 4DG9A 1VECA 3R7LA 4CDMA 4O5OA 5TQ2B 2BFEA 1TEZA 3TCNA 1VH8A 3MZ0A 3FXAA 3PEVA 3ZS9A 2Y3IA 2MSEB 3FKSD 2W8BA 3Q8XB 2ZR7A 2CXHA 4P36A 5B58C 3UMMA 2FN7A 2YCBA 2VK8A 2G9RA 1U2DC 3D3WB 1OI7A 2V9YA 1ZLXA 4RF2A 1O94C 2RGNC 3C8DA 3WP0A 1X3SA 4MWEA 1PFGA 4LGMA 1QKKA 3CNNA 1FNMA 1V43A 4G4GA 3BOSA 3QNWA 1KL7A 4I4TF 4CODB 3FMIA 3U7GA 2DECA 4E5KA 3TW8B 2JGFA 2VYVD 2WPDD 3GCZA 1Y6QA 5U4XA 3MWEB 3FGPA 4I3HA 3S2IA 3AB3A 3PFNA 1I13A 3H8VA 4HUTA 2N46A 1W29A 1SD2A 2D2FA 1PK9A 2HSZA 3VSDA 1BDIA 5BV2P 4BAGA 4D3XA 1NXSA 2B30A 4X1IA 1NBMD 2H2FA 1UPAA 4NXNB 3DGEC 5BV1A 4TKLA 1SBHA 1DOAA 4X62B 2QE7D 1EGVB 1PX2A 1Z8FA 2W83A 4QHSA 5JQGF 2FOXA 4DCMA 1T9CA 2W8BC 5IK2A 1PU2A 3RSQA 4MUFA 5AOVA 5AKHA 4ZKDA 2X19A 3I9NA 1FFGA 3JQGB 4JI2B 4WJZA 1U2DA 3CNBA 5FLYA 1XZ8A 4DAEA 1CR1A 1K75A 2XCQA 3DTVB 1HBJA 1PFVA 4CM8A 3S8YA 2AOUA 3BE8A 3OZRA 2NV0A 4WFKA 1GNVA 1VCOA 1ZK1A 5E2BA 1R6TA 5EJ9A 1UKEA 3L8CA 3CB2A 3AESB 1S1MA 3H0EA 2QMZA 1ZWZA 1AKTA 3PHBE 3BMQA 4AWBA 5JFGA 3HY6A 2JLUA 2KLHA 5FLXM 5EHXA 3DG9A 1IJKA 4EHNA 1JBKA 2GBLA 1U3VA 1RQ2A 2GTIA 4AY2A 3KOMA 3FH0A 2E1RA 3HCAA 4RYLA 2VYNA 2PMPA 1XZCA 3T3EA 3RTGA 2X0IA 3A9SA 3RAGA 4CKCB 4WESB 2CXRA 2R62A 2BFFB 2C4UA 5DEOA 2FPUA 3BRCA 4LYJA 3UGKA 1VKJA 4CV3A 2RGCA 3C7TA 4K3UA 1KAOA 1WXHA 3MLBA 2PG3A 1XG5A 4RHAA 1KQOA 1LQ2A 2O2CA 1X7XA 3RRZA 3ASUA 1Z06A 5I9NA 4QTZA 5EIXA 1EXDA 1EZ1A 4UTRA 3H75A 2RGEA 3ESRA 1FNCA 3Q0TA 2YV1A 4GS5A 3BXPA 4CU5A 5K5EA 2J4FA 4ZRNA 4YQFA 1XNJA 3IX7A 2BKLA 4IINA 1E6CA 1MN6A 4ZGBA 4D98A 2X42A 5J2TB 2HBQA 5E4FA 3B78A 1TW3A 4PN7A 1BHQ1 1JDBB 2XKKA 3P0EA 1JF8A 4N40A 1Z0KA 3HC7A 3ESJA 1SH7A 1JJ2F 1US8A 1TZCA 3HLYA 1BXZA 1A4UA 1UBRS 3OFVA 5DBGA 1M33A 4BW0B 3OF5A 5CX4A 4D6YA 2JASA 3H5WA 3JR7A 3NKFA 5GAPK 3AM3A 3EQ9A 5JJCA 4YP5A 4L08A 5TQJA 4BQEA 2AHRA 5E6RB 5A3VA 2PA0A 2HA3A 4O4IF 4E1BA 3SD7A 10MHA 2P6OA 3ZGOA 1QRTA 2HTFA 1UXKA 1DAEA 3BRQA 1Q95A 2FPSA 1S02A 2WAYA 1Q7YH 2YV4A 2GSWA 4UEWA 3C87A 1X7YB 2VYND 5K3EA 1JPJA 3UJHA 4FNGA 2WJ6A 1QWOA 4LK2A 4B73A 3VMFB 4Q4LA 2IEZA 1FDUA 1XT6A 1BMTA 1NR1A 3SVLA 1M7BA 1M8PA 1HDEA 4D8UA 3FI0A 2BHSA 1KNJA 4HSEA 4JHXA 5HK8A 5BN4B 5T4EA 3AETA 3CEMA 1N2GA 4KGDA 1L4YA 3AHDA 4EVIA 1IPFA 1N32B 3ZGLA 3ANYB 1QK3A 4LXXA 1JB9A 1GXSA 1ZD4A 3E4DA 1N6OA 4LECA 5KWJA 4QNMA 4A27A 4A8HA 1Y3DE 2WIBA 3D2CA 3PXBA 5JADA 2WABA 3GNTA 1IVNA 2BMEA 1SXGA 4GI7A 5IUJC 1FXWF 1IUKA 3QMPA 2FWNA 2ZJ1A 3KFLA 2OGZA 4QJ4A 3CH6A 1WUJS 2PQMA 2I2BA 3DUFB 1P9NA 1WU7A 1YWGO 3BVPA 4V24A 1P7YA 4D44A 3A9VA 3PE3A 3SS8A 3LWNA 3AVYA 2GNAA 4NFLA 2DPYA 3C6QA 4BQQA 4BX3A 4IILA 4BGDA 1USGA 4O4HB 2Y76A 2QSZA 3ZE1B 3TXXA 3LCVB 4CBVA 4D4GA 3GGSA 3N6XA 3EXEB 1GTJ1 3NK7A 3O8QB 4W8OA 3SNHA 4AY3A 3GD7A 2FPMA 4JJ8A 4U7JA 1BX3A 3A06A 1P33A 3B9RA 1QUFA 3EZXA 3FGZA 4EG0A 1CE8B 1P2FA 1JW9B 3FUVA 2VN8A 2ACKA 3GI1A 4O2RA 4ZQHA 2HRCA 2OEPA 1EI9A 2QP3A 4IX9A 4H3KB 4M38A 4Z7QB 4QJBA 4EJ0A 2RHJA 3TQRA 4TTQA 4H1UA 4PLVA 5ALHA 5K6AA 4GOND 1AZSC 1UP6A 2EJVA 2WZDA 4OJNA 1EBBA 2I8LA 2ZTUA 2R7NA 1RYEA 4FMBB 4RFSA 5EKUA 1RJ9B 2MYUA 2PAFA 2VRCD 1B8OA 1K2VN 2OG1A 3WQSB 5JMPA 3V4ZA 3WV4A 3D7KA 3CCQF 1WD5A 2VZEA 5H1YA 1OC4A 1AK2A 3HXKA 3L5KA 1OQAA 3Q7EA 5LUAA 4ZCLA 2BSQA 5FFNA 3UAXA 7GPBA 1V3UA 3W1WA 2BMDA 4AJIA 3G2QA 4GPBA 4IXDA 1FBTA 1JX6A 1P61B 2LW7A 2IZZA 3D1LA 3EH2A 3FSEA 2SNIE 3KL2A 4AJ1A 3K70D 3CCJF 3QVJA 4DLBA 4DPMA 4QPNA 5E8RA 6GPBA 4KQXA 2DJIA 1RRPA 4UBIA 3WISA 4AXBA 1X86B 3LX8A 2LCIA 4BBAA 3ORYA 3HSYA 3TWOA 3UMJA 2Q3FA 3WLHA 4I9NA 2J48A 5J9FA 3QXSA 4WE3A 4M7RA 5F76A 2P9HA 4O2AF 2ZANA 1XHOA 2H0QA 4YMWA 1ZDMA 4KCGA 3FDJA 1GPAA 3SGLA 2RKWA 1DQRA 3PJGA 3N0XA 5KSZA 4TMTA 2JCVA 2YV5A 4IJKA 3CLKA 2ARKA 3PF9A 1F6WA 1T9AA 1X87A 4DXAA 1EFHA 1MOPA 4B46A 2J7KA 4OB7A 3TOVA 4RZ3A 2Y1LA 3Q6IA 4Z0PA 2YY6A 5KKAA 1U1IA 5FYQA 1X1AA 2IYWA 5CLHA 1N33B 2ZYRA 4F9TA 2GI4A 3EBLA 2C00A 2QTLA 3KB6A 2C96A 1E0JA 1WEHA 1EUQA 5BMVA 1ODLA 1P1BA 3KALA 4OXQA 1NU8A 3K0CC 2WJWA 3IAS1 3RHSA 4PIVA 3H7AA 1U65A 4FS3A 4FYXA 1YVDA 2GDZA 1FW6A 3QA3E 1E66A 3D8HA 3ENZA 2HDNB 2CLEB 3LGXA 3B82A 4YP7A 2GF2A 3D0QA 3P9PA 4GECA 2E5FA 3R0QA 4H6VA 4OI2A 3DR3A 3FYUC 4YPVA 4NESA 3NMUF 2C7GA 1L8QA 1IQRA 4DDHA 2ZRIA 1D6MA 4YCSA 5ALRA 5EWMA 1FFDA 2BF4A 4E3WA 1YGPA 5HIAA 2ODAA 2VTBB 2VJCA 4DEVA 1Y4DE 1WY5A 4XPZA 2V8OA 3IBYA 2HP0B 4PO1A 4PQEA 2M6SA 1ORHA 1WQ1R 3D6HA 2E6UX 2H1WA 2Z5GA 3IB6A 3B3FA 1H3NA 2PUDA 3NAQA 4URFA 4CLEA 5JH7F 1GAEO 4QXAA 1CZKA 1THGA 4MLPA 1GPMA 2HZBA 5JAPA 1KZ7B 1K8ZB 3HCRA 3OPMA 4D46A 3P9KA 2XXBA 3EW7A 4UUAA 4YAWA 1E7RA 1KBQA 3L4BC 2EFEB 3ITDA 3O82A 3PXXA 2EF0A 4TV9B 1JJIA 1Y1RA 4MCJA 4MS4A 4WCDA 3WA6A 3ZHTA 5BUSA 2ECKA 4EFLA 1KS9A 3IH5A 4F91B 5CYGA 2QY6A 3N75A 1DFIA 5IS2A 5LA6A 1UDAA 2F8MA 2OB2A 4QGFA 1JXAA 1QH8B 5EJ8A 1J7JA 5KIAA 5FL3A 1KMQA 1L7VC 5CFLA 1W19A 1ZR2A 1Z5OA 3FYUA 2WYOA 3A6DA 4NE9A 4ND8A 2MDTA 5GMOA 1HSZA 3N8GA 1K9SA 2UZ4A 1L7AA 1FIUA 2OD7A 2WSIA 1KH3A 3LWQC 3DV2A 1GZ0A 2NZJA 2ZROA 1J8YF 3AF2A 2GD6A 5DT9A 3B6NA 2QD1A 1HG1A 1NM5C 4OJQA 4R7GA 2R6FA 1PZHA 4C43A 5BYAA 2CMFA 2X40A 3R7NA 5HF6A 1LBSA 4Z9XA 3ASYA 4RKFA 1KAMA 2ZI6A 3A9TA 3HP7A 2CDCA 3HU3A 3LHSA 4JJKA 1TXGA 4J0KA 1WRBA 4ZI3A 1T5HX 2OTJF 1D1QA 2VK1A 4LJ8A 6ABPA 2DH6A 4P4SA 3WHKA 2JG3A 1Y9DA 4J0EA 3EUEA 3NEJA 4N49A 4BEWA 2GD1O 4IOLA 1E1RA 5FWDA 5JVDA 1XDSA 4MKIA 4EA7A 4UHCA 1OB5A 1NVAA 3DUFA 1ODSA 1T15A 5TARA 2ZJOA 3H65A 3M5WA 4OB6A 2TMDA 1NBWB 3EG9B 3QVLA 4H7JA 1GUAA 1Q20A 1TYDE 4CIWA 2MYPA 5KYVA 3RQSA 1N2XA 3DDUA 3FHLA 2ZE8A 1W87A 3B6IA 1T3TA 1VZ2A 3EF0A 5KB3A 3K0HA 4OP2A 3UT6A 3WHLA 3MUOA 5EZYA 1UANA 4HWGA 1CY6A 2C0QA 3LWDA 2YJ6A 4MGEA 2W6PA 5CVCA 1QVFF 2C2KA 2J8ZA 3OMWA 4HEQA 5A5EA 1M54A 4Y6RA 4KO8A 4URWR 3C0KA 1XTQA 3ZDXB 5AK0A 3JYOA 3OO0A 4M87A 3RS3A 5AUPB 4OQDA 2A0KA 5EY5B 4N5MA 3EPPA 3QLVA 1TVKA 4RFSB 1EU1A 2BISA 3BXZA 4LVOA 3E9DA 2AN5A 2JB9A 3WYNA 1YRWA 4TTVA 5THKA 4KWTA 3LUBA 3UQZA 2ZYUX 2A4MA 4A0RA 2QTWB 4F97A 1B6SA 3P19A 1MF7A 3G9QA 1BIFA 2IHYA 1QWSA 2J87A 3KKEA 4WXYB 3U16A 2GASA 1ZM7A 2V5UA 3OO1A 5DK4A 3X1WA 5HNKA 2H57A 2IUFA 5ELXA 3LYUA 4C0QC 1SKMA 4FS8A 1X92A 3IESA 1YASA 2WJAA 3EF1A 1DS6A 3L7AA 5ER6A 2FUG1 1VSUA 4X3MA 1MG5A 1X0XA 2VUTA 1N1GA 4IDPA 4IXWA 4D41A 2CV0A 3BFPA 4F4IA 1QX3A 2EX4A 1FYEA 2H9YA 1LEHA 2W0SA 1RU3A 3A4VA 4JLPA 1DIOB 3AR2A 3Q3CA 3QOYA 5L3SB 2YFYA 5HTKA 5A3SA 3TMKA 3TUZC 1V37A 4L15A 4CV0A 2QTZA 4N48A 2RGRA 2Q1WA 3THWB 1KY5A 1VE5A 4F4CA 3FF4A 1U9IC 2NYUA 3OJ0A 2P9QA 1KDPA 3Q88A 2NQ2C 3NIWA 3N7AA 4QTUB 1W88A 3QFHA 3X44A 5CXQA 4N41A 2F4NA 2G3YA 1Z2EA 2P2YA 4MAFA 4N3CA 2OZKA 1G9SA 2J45A 3T3PB 3HBLA 1NF8A 1N9GA 4NZZA 4D4JA 4EMSA 5I51A 3KHKA 4P1ZA 1ISMA 1RYNA 4QARA 4DG8A 1RAHA 4RV5A 1V48A 2CLLB 2HA7A 2YXEA 4BFTA 1N2ZA 2VZ9A 1RLTA 1RT9A 1ZGAA 2IXEA 2VJMB 2REQB 2W58A 1I7NA 3RJ9A 1XTJA 1ONIA 4EFDA 2CKMA 5ITVA 5GONB 1PNRA 2C98A 3EY4A 3BCRA 3Q8HA 1CUEA 2A0YA 2NUAB 1WF3A 4DW8A 2WVHA 3DM5A 3ON5A 3PENA 3WWOA 1KQGA 3OJWA 4E70A 2Q29A 3IKVA 3MJCA 2IOFK 3KQOA 3LFTA 6CHYA 1I2CA 3PT9A 5U9CA 2OCIA 4PSAA 4Z7OB 3G7UA 5GTDA 2HRUA 2Z6UA 2X5OA 2BSAA 4PC3A 5DEIA 2C3UA 5E9AA 1KXJA 1KK3A 3GEHA 3IKLA 4PG5A 5IM4A 3P0IA 4NVRA 8AT1A 2XEDA 2YHUA 3FN4A 3M4YA 2GF0A 4A3SA 4RMNA 4D43A 1VPTA 1RQLA 4RZSA 3W9UA 1LBQA 2G1UA 2W2PA 3DBLB 1NQ3A 3BXEA 3JQ8A 1PW7A 3EIFA 4NCJA 1BQEA 1MPTA 5AJWA 1N0HA 3AKCA 1M6VA 5F9HA 3OMXA 3WE7A 4AIIA 1QGAA 4HDKB 2PL9A 3OU6A 3B6EA 2FFQA 4KPGA 3KVOA 4OV6B 1P29A 4MKGA 4RX1A 2IU3A 3WXMA 2UUBB 4A0FA 3K0AA 3P4YA 1RSZA 3COYA 1FMLA 3ENNA 4KW7A 4YHHB 4FCWA 2IW3A 2B7LA 3WHPA 2X14A 1KYXA 1UPUA 3EMBA 1E2QA 4Q0MA 3RBZA 3WBBA 4MP8A 3FVVA 1CPYA 4F5EA 1YKFA 2HMVA 4Q7JB 4P58A 1MC8A 1NVEA 1B26A 2GRAA 2ZULA 2JVIA 1MX9A 3ZIUA 1P4RA 1KWKA 3T3OA 1OFVA 1QAMA 2JGEA 1XCPA 3ICCA 5I5GA 1T6XA 4ZCTA 1C9DB 2KWIA 4B5LA 1IUPA 4GM0A 4P38A 4JP2A 5ARDA 1QV7A 1S2LA 2XADA 4UE3S 4ZODA 1VHDA 2J32A 5FX2A 2O7RA 2II6A 2PKXA 4XVQA 4MRAA 4XQGA 3L01A 1ZK3A 1R4MA 5AOBA 2C42A 5LOVF 3INRA 1Y0BA 3EB9A 3ENKA 1N4AA 4ZZ1A 4TRMA 2RBKA 1PVOA 5BSGA 2VQ3A 4NBSA 3F1LA 3TRDA 4CTKA 5KYKA 1SVLA 2PWBA 2VL7A 3B9QA 1G6OA 1N6HA 4FDTA 4REQB 2B4RO 2OGWA 4DAOA 1TAGA 1XNGA 3BWYA 3QYJA 1L4BA 1YL6A 2VRWA 1QJ4A 1E8MA 4R40A 3HKCB 3ESDA 2BEJA 2J3HA 2WF8A 3I9JA 4R8VA 5FRDA 5TY0A 5IT5A 1NTRA 1YZGA 2A9FA 4HNRA 3K0FB 3W7AA 3PTAA 5BNWA 1XL1A 3DBIA 2JIDA 1X1DA 5P8WA 2I2DA 3K8ZA 3ONEA 5TS3A 3IXMA 1QC5A 1DBRA 3W3AD 3NS7A 2QF7A 2NZYA 3QBEA 5E6RA 2FWBA 4QT0A 4RH0A 4XPIA 5DHAA 1GZ6A 5BQXA 1ODIA 1DAKA 1SU6A 1X1CA 1JR2A 4C3UA 5CCEA 3GRCA 4R2MA 1K9MH 1XU9A 4K9RA 1YJBA 3SLKA 1HE5A 4OHRA 4WKPA 5AW5A 3IEVA 2OYRA 1ZMXA 3QKWA 3HGTA 4LRSB 4MKRA 1Y4SA 3FPJA 1DXOA 3LBAA 4PINA 4TS3A 5HFAA 3WNZA 3IRUA 3LUJA 4OMFG 4ZRDA 3Q8KA 1ESZA 3SXUA 4RHYA 2QLTA 2WYHA 1NLUA 1E9FA 4CL8A 1CUYA 2I3DA 2P6PA 3ND9A 3AXTA 1MOSA 2XUIA 2F90A 2NYAA 5AI4A 5U1PA 5BV8A 5IT0A 4MA0A 1KZ4A 4PSVA 5ALFA 3C1TA 1AS0A 4O2LA 4AJOA 3JCMM 2WMNB 1SQFA 5ICCA 5ALKA 1I4WA 1AMNA 2J0VA 1K5PA 1UT6A 2X8LA 3B12A 1L6RA 4L6IA 1JQDA 3HB7A 2JFVA 5AI6A 5CVUA 1KZ9A 4HGZA 4WY8A 3D4NA 5F78A 2SBTA 4BJ5A 1PHRA 3DCNA 4UVIA 4E3ZA 3J7TA 2GHIA 3U4AA 4A8JC 1XD9A 1YMVA 1WPRA 1O6FA 2GEBA 2J5RA 3CJQA 5HBRA 1HSOA 1NWHA 4OD0A 1YDGA 3VVBA 2O4CA 1G2QA 3IMEA 1TZ2A 3G8AA 3MCAB 1EBUA 4JL6A 4DWVA 5AUOB 2C59A 2I3AA 1R5BA 2QUZA 4MPRA 3E5MA 4C4RA 4HQ0A 5TT1A 1GDDA 2E89A 1F6DA 2PMWB 3CNQS 1JFSA 1QE5A 1XYVA 6LDHA 1A2QA 1PYDA 2GGSA 2RH4A 3D6FA 2O2JA 2WF5A 3O1LA 5CDHA 3WOVA 2DAPA 1N6IA 5LQKA 3FOEC 3GPLA 3WL7A 5T7BA 5KJEA 2BGWA 5LQRA 5I7OA 2QEXF 4UHHA 4RVGA 1G64A 2BH9A 3LLCA 4KGXA 5EZSA 2A5LA 1UZUA 1HFJA 2R5WA 5EZQA 3B9PA 1SCJA 3A6ZA 4MTCA 3OZDA 3SDZA 3W05A 3LT1A 5EB0A 3O1HB 1LLDA 2NGRA 3I6QA 2QDKA 3OAAD 4ZAFA 1RKQA 5FR1A 1E2DA 1Y1KE 3NANA 4F3KA 3BFVA 1GGNA 3DE6X 4FXOA 2EV9A 3KAKA 2BUAA 1Z6GA 2QLNA 3GVCA 3PQ2A 3QBTA 4FK8A 1KJ8A 2AC2A 5AQ1A 1B23P 2O8CA 3W5AA 4L5AA 4YJ3A 2TECE 3V6MA 3AI3A 5CVDA 1GZVA 4CIBA 4CL0A 3L07A 3M33A 5G0WA 2E82A 3ZQUA 4BB9A 2Y1WA 1YU9A 4TTSA 5DWVA 3TZCA 1M2HA 3RSOA 4Z53A 5CU7A 4KE8A 3ZKWB 3UJAA 3WLTA 2F8TA 1A0OA 3UC5A 4XYLA 3LDFA 2C5LA 2DR0A 4ZO9A 3W1VA 3V4RA 1C1DA 1J9EA 1MVNA 5G1OA 1C9EA 3KQQA 2QTCA 2FPKA 1Z73A 2AQKA 1COWD 1V9SA 2XYVA 3CN7A 3EEYA 2I3GA 4UC0A 3JQ9A 2KW5A 1ZLYA 3PKIA 4XX1A 1K6XA 2W2MA 4ODIA 3WB1A 1CTQA 2F3TA 1XMJA 1KA9H 3CPQA 4QDUA 4MP6A 2KS6A 4N7MA 1QRRA 4S12A 3ECAA 5A62A 4ZK6A 2N1MA 3OM9A 3F0GA 3UHOA 3KVVA 5BMVB 1J8VA 1SD1A 2Y9PB 3DE2X 1KC3A 1LRLA 4JH0A 4NX2A 1OZAA 3GEDA 3J80M 4OEHA 2IYEA 4AZ3A 4DDUA 2Z6QA 4JVSB 1QOPB 2G77B 1QDEA 2G40A 2G0AA 2X8JA 3DLAA 1O6BA 3PZRA 4X92A 3IQZA 3UGJA 5KWEA 4KDRA 5CLIA 4X84A 4NMWA 2BM1A 1NQUA 3FJYA 1ODKA 1NXVA 3RC7A 1LK5A 1NTOA 3I83A 2GXAA 4LHVA 3SDSA 4ZI7A 3BKWA 5JNTA 5KNCH 4DY4A 1NAHA 4BIMA 3PA8A 4P5PA 3ZLUA 3X2FA 1MEOA 2GFIA 2IELA 4BQRA 2XDAA 5EE3A 1UXJA 2XVXA 2C4TA 5AM5A 4YRSA 5I47A 1AKUA 1GAQA 2N42A 4A1OA 3ZBQA 3JD2A 3JVIA 3VYVA 3IP7A 1D2EA 1NUHA 2FR0A 2V7EA 3DE1X 4GQAA 4A7PA 4EWLA 2IHZA 1IV4A 3IBGA 3K4PA 1U80A 3BILA 4QL3A 3LCRA 1RKXA 2DPXA 3AK4A 3VDQA 3U1TA 4C5BA 2JAHA 3L8MA 3UK2A 4QUIA 1QVAA 2Q9CA 4JR1A 1AUPA 1ZYUA 4XVRA 4IHJB 3TMAA 1SOWA 2HL6A 1V9LA 1K7SN 2IY8A 2OFFA 2IX3A 1LBEA 4CQLA 4NF2A 3ZVNA 1SBYA 1VJ1A 8ATCA 3Q40A 4Q1FA 5DN6A 1CLUA 1IN8A 3JQEA 3ZN2A 4YRFA 3ZJ4A 1I01A 2GK4A 1L4FA 1TO6A 5HRUA 4UD6A 4BWGA 5EWRA 1YC5A 3RC3A 1E2MA 1AMUA 4FFMA 3K9FC 1HKUA 1NX9A 2WUGA 4E22A 3PNPA 3GT0A 3K2BA 3X43A 3ZC3A 1E2HA 3AKYA 4F5DA 5D01A 2H6LA 3KTOA 3EZGA 4UVGA 5FLXA 3CCLF 3CBGA 2HGSA 2OFXA 1D2AA 4MAAA 5C32A 1YVRA 2G6BA 3KXKA 4C5AA 2BVNA 1ODTC 3ZHQA 1J4AA 1Y98A 2CDRA 2P3LA 4P4SB 3TKLA 1YQTA 3REOA 5K03A 1R8YA 2VI5A 4GEGA 4AJNA 3PGKA 1U3WA 1VHAA 1L7DA 5KKCA 3J81k 1T0AA 1R1DA 4XRGA 1YRQA 2VAXA 5KOJA 2WYVA 1UBUS 4BFCA 1I4LD 3TL3A 4B6QA 3RGGA 4H0FA 3NHSA 5IKMA 1Q7BA 2RC6A 1Y34E 3JPYA 2H1RA 1I3NA 2XTZA 4LE2A 4XIYA 2ZSEA 4GKJB 1PSDA 1MHTA 3VI6A 1S7CA 1YHYA 3P7MA 4Q3LA 3GJYA 1DT3A 2ZJ5A 1XQ9A 4LF9B 2NM0A 4ZZ2A 5FPSA 3DV0A 5FBVB 3KU1A 1XYYA 2BTOA 2H8KA 1ULSA 1UIMA 2QORA 3LWPC 4HWSA 1SVIA 1CDDA 1ATZA 3U5ZB 1VQPF 5AHXA 1X8KA 3V7EA 3KHUA 4ZARA 1TYCA 3QTYA 2AJTA 1J07A 3SF8B 1AA6A 4BB5A 3M4XA 1A2BA 3DAOA 4B71A 2XE7A 3A4TA 4C29A 2X4DA 2HY7A 2O6LA 5I8ZA 2WR8A 3ZK7A 4HATA 4CCSA 1ZJJA 1ZIDA 4JVNA 1E1CA 1P5FA 2ANCA 4S1NA 4EHLA 3WIUA 3X1JA 1HPLA 1ZN2A 4ISBA 1J8FA 2DE0X 1TB4A 3GG9A 4M9SA 4MW7A 1WUHS 4WZBE 4YT5A 3U40A 3R9KA 2O8CB 4AZWA 1L7XA 2GEDA 4J0JA 5CURA 2PZ8A 4YDSA 2OHXA 1XUOA 2VHYA 2IITA 3KQPA 3NI2A 4RZIA 4Y9TA 5IUNC 2J4CA 3CX6A 1E6LA 2UKDA 2IV7A 5HRAA 1K68A 1R16A 4ZCSA 3ZZUA 1EVLA 1U1FA 2QW8A 4X1KA 2EZTA 1PGPA 5ILGA 3M1AA 2D0DA 3RK1A 4JLWA 1RXVA 1W0JD 1I2BA 1VI2A 2H6EA 4M83A 5AKGA 3FI9A 3IQGX 3OICA 3IV6A 3P9RA 4RSRA 5GJWC 5TQVA 3LUAA 1NDUA 2PHNA 3EWIA 3OLYA 2MIIA 5D1NA 1Z4LA 2AFHA 5I7AA 3ZY3A 5IJZA 4RL4A 4OYHA 5BR7A 1XZPA 4R5HA 4MDHA 2EWMA 1IRIA 3I01A 1K8YB 3OIWA 4I19A 3UHPA 1QHXA 3KLMX 2C7BA 3VV2A 5KS2A 1MU0A 3EZLA 2AVNA 4ZT4A 5K6RA 3P1JA 3Q2OA 4KXFB 3X1MA 4EB8A 1OB2A 3E3AA 3TD6A 3K6RA 2WY2D 5KTYA 2ZG6A 4B6PA 3MFYA 2JANA 4IJ5A 4IDHA 2IPOA 3EY9A 2RH8A 5FBQB 3G82C 4N47A 3CE9A 4EX7A 2A1TS 2JZNA 4TV8A 1FX0A 2ZIZA 3BAZA 1U2EA 3PUZA 4J8PA 2ZVYA 4OGKA 4WDQA 2C4HA 3FNRA 3HGMA 1EFPB 3QVSA 4GGPA 3RJTA 1H69A 5G1PA 2AHOA 5K0BA 4DB4A 3HL4A 1B6TA 2D1SA 4G25A 4NATA 3UJ9A 3R23A 4W1SA 2XNDD 3EQ8A 4BZZA 4HJXA 3ZVRA 5A0VA 1TE2A 2HSJA 3SJCA 4CCYB 3C7CB 2BBSA 3KOYA 3OCVA 2F43A 3DTTA 4JQZA 1WW8A 1TQ2A 1UFYA 5G0SA 3IAXA 2BKVA 4IFEA 3W8FA 1S2GA 5AW6A 2HFJA 3TSWA 4CUKA 8OHMA 2JAWA 4CR8A 2ZZNA 2CW4A 1V1RA 4ND5A 3S0HA 1KK2A 2PUBA 1ESEA 2O5VA 1ADFA 1ZAYA 3G2KA 1X7PA 1BQ4A 1TYAE 3W5VA 4BGIA 4L6CA 4ESHA 1RWNA 2MCFA 2MOKA 4CF3A 5KX5F 3G68A 1I7SB 4ES6A 4O0LA 4DMGA 1AHIA 3BE6A 4JSYA 2CXPA 3BDIA 4GU5A 4Q12A 3VHQA 2OO5A 2EFCB 2LGJA 3H86A 5BV0A 4X6UA 2VFAA 1UMCA 2R11A 3LQQA 1JEOA 4G01B 3WSVA 3V8QA 4DLKA 6REQB 4CMKA 1R8XA 3OPVA 2JLWA 5EFOA 1CY1A 1LWNA 1S0UA 4R8MA 4YT2A 4IJVA 4L07A 3L7CA 2C54A 4EJSB 3HDJA 2O7NA 3OT4A 2PKEA 4X85A 2HU5A 1GZ5A 2DSNA 4WV3A 5AHKA 1JY8A 3KYIB 4BQPA 2OPBA 5LU8A 1EFVB 1TPYA 1HLPA 4DA4A 3AM1A 1D2CA 1M10A 3FNBA 2H29A 1NMZA 1XFAA 2QD4A 3HV0A 4GBJA 1YBMA 2F3PA 4D6PA 1L7RA 1VBFA 1XHLA 2X3YA 3LWRC 1YTUA 2WF9A 1LVUA 3R44A 2PR2A 1ZPDA 1CJTC 2OHOA 4TL8A 1YI8A 3F8TA 3T5BA 3V4FA 1GDHA 5JNVA 1I4TD 4Q4HB 1BWRA 5TF4A 2CFOA 4V0LA 5FBHA 3JAWB 4F2DA 5ALJA 2L26A 2IWHA 3PEYA 3ONDA 2CVFA 2X3FA 3DXZA 4IXMA 4F9GA 1WM1A 3PIRA 3AU8A 3RUIA 4BKOA 4YRAA 2HF8A 1SJ9A 3CSUA 1ZEMA 1GADO 3FNFA 2JKYA 4K6OA 4NK5A 4FI3C 4NYJQ 2TMKA 3A1DA 1USUA 3BMNB 1YV9A 3CD6F 2WUFA 1H05A 2BEUA 3UO8B 1YJNF 3C14C 4OGFA 4EW3A 1GKKA 4UTZA 2OBBA 2OGUA 1N0VC 4UHBA 4NBWA 1QKJA 3GVIA 1QC5B 3IO3A 4BB6A 4Z4QA 1LV8A 3V8EA 2BHNA 3GLFE 1O95A 1J0XO 2AZDA 1OCEA 2Y05A 4OQLA 2WG1A 1Q1AA 3C6YA 4AJHA 1FQWA 1VSVA 4B0OA 1FMCA 1OZ0A 2P1DA 2QA5A 3P9NA 4FW9A 5JUWA 1RXWA 1PR3A 4C0HA 4KVFA 2X0JA 3OU2A 3HVUA 4GR5A 2I7VA 4J1NA 3HQ4O 4DM3A 4C01A 3OG9A 4Q4CA 1HO3A 2FSSA 1ZJ5A 5CYFA 5ALOA 4LQDA 1QOQB 2B25A 1RYDA 3KJJA 4KSBA 4OA5A 3HZRA 3PDIA 1EE9A 2XUPA 3U3DA 1IONA 2J85A 4HXYA 1JPVA 3ZKAA 1MIOB 3F5QA 1EWVA 3Q1KA 3NRCA 1KFEB 5KI6A 4L72A 2JVKA 1KDZA 4XVCA 1M2VA 2JEOA 2IV3A 4CQMD 4CEHB 4X7RA 1QZUA 1APBA 4KH1A 4GVLA 1JQAA 2ZIXB 1O54A 2C1EA 3I8XA 3QQ5A 5BPHA 4N5HX 3I6BA 2B0CA 1C41A 2FEKA 3KXLA 4X97A 4LVCA 3T1QA 1Y8QB 1NVDA 4EY6A 1M1NB 1A8PA 4V1CI 2C7RA 3DBRA 5FOUA 4JP1A 3UV6A 3GL9A 4P3PA 2FZEA 5CAEA 4HWPA 1JNYA 1Y3IA 4GXNA 3HCDA 5DI9A 5HS6A 1JXQA 2H11A 4XUCA 3JASA 4XGKA 1M7GA 3ZE7A 5GANK 3CT6A 2QOEA 3UF0A 5C4GB 2KB0A 4OUKX 4W5QA 4PYIA 4YXWD 4CXMA 3R3YA 3JQFA 4JNCA 5HQJA 2YIMA 4GZ3A 3FLEA 4GH5A 5DOVA 3M89A 2PUEA 1ZM4A 1L5SA 3IHKA 1UKCA 1GGMA 3EOZA 1VQLF 3IVRA 4DYHA 1X7WB 4ABTA 3EEBA 1F8YA 2OV1A 3W90A 2GXQA 1ISFA 5LC1A 1E79D 2BR4A 1RYMA 4ZI7F 1Q7GA 5KTRA 4Z4IA 1OUMA 1R10A 2WPDA 1RXUA 2RHRA 3LRPA 2XGMA 4NS1A 5GADl 3WMFA 3E1KA 2BUCA 3B1YA 3Q4GA 3S44A 1H1TA 4BNDB 3FTPA 2XOKA 4RQOA 3NTOA 5GONF 1HV8A 4ENPA 5JYDA 1ZSVA 1HQDA 2AYYA 3C3EA 4C20A 3VR2D 5TQ0B 1ZH4A 4KFTA 3DE4X 2HWXA 4BHTA 3I9V6 2I9KA 2J33A 1UBSB 1QJCA 2VGNA 2GK3A 2H16A 1G0NA 4OKNA 4R6XA 4YBZA 5AJZA 2WIAA 5AUNB 4B6EA 4N7JA 3VYUB 2RI0A 3DLIA 3LX4A 2QI2A 4K8RB 4EEZA 2GPTA 4KKVA 1EBFA 3TD2A 1OJLA 2HPZA 3BB4A 5LZ4A 3ILVA 3NDBB 4LQ4A 1KJZA 2CBGA 3L6UA 5A7HA 2LRHA 2FPRA 3FF1A 4IHJF 3N6VA 5EEHA 1Z25A 4HDRA 1KAEA 1JG7A 3BJIC 1BRTA 1FFCA 2YBEA 3JALA 1N2HA 3C4QA 1S2DA 1ZK4A 4EI9A 1DX6A 1RHJA 4RLQA 2C07A 1C7RA 4G37A 4LYEA 4GLFA 3UA4A 4C22A 1JVBA 4ND1A 3PPYA 4V2IA 4G1FA 3DEYX 1NW6A 3NWEA 5FNVB 2ZJ0A 1E9VA 2QJFA 3ACBA 4LS3A 4PTLA 3RWOA 4FZVA 4MQMA 3U7RA 4ASUA 4YMUA 1AUVA 3SIXA 1MT3A 3GUZA 4RVNA 1KQFA 4BVSA 4ZVUA 1ABBA 3M9WA 4PTZA 4YVFA 4EAQA 4EJSC 3AUJB 3Q7PA 4CEJA 3VU9B 2B3DA 2DWPA 1AOXA 1RQGA 2R6GA 1ENYA 1ULAA 4BWFB 3HYCA 4XYMA 4J2TA 3AOEC 1P62B 3D8TA 1IZZA 3AL2A 4R3WA 4JUIA 1XOIA 3FYCA 1D2GA 4KXLA 3WGVA 4BFYA 2V7WA 1DBPA 5JXHA 4C2AA 3L7QA 4NYIQ 1CK2A 4OX9Y 3KEOA 2JA1A 1YR2A 3OZEA 4PNPA 4ZVTA 1U02A 2E37A 3K1AA 4Q93A 1JDPA 4V1CB 4LBZA 3U3JA 3D3QA 4HX5A 4QFBA 2ZM6B 5JC1A 1JAZA 3VIUA 1J2EA 3HCCA 1OAOA 2HA5A 5CT9A 3H6KA 1H0SA 3IR9A 1E94E 4QVKA 5C81A 3A1EA 4TLCA 2M2IA 4UTXA 4DJDC 4PC6A 4ZT5A 1QVWA 4F4FA 3TECE 2O8BB 3L8ZA 2HS0A 3JAWA 2QLMA 2ZK7A 3SIVA 2DXIA 4DHWA 2A94A 5TX7A 3MWEA 4PQGA 4ZJYA 3FTEA 3ILSA 3ZDAA 1SKAA 4D9KA 1DAOA 4YCBA 2QL7A 2ZE6A 3TW0A 6Q21A 5I6DA 3EWNA 3MTQA 4WFQA 3SKYA 2VTBA 3B48A 1OMOA 3EVCA 3IMPA 3RS8A 1J7KA 1ICIA 1P1CA 2O6HA 3JXEA 5FA6A 3O90A 5KYXB 3GEBA 1Z33A 2GEVA 3NTQA 3NC0C 1XTBA 3EHDA 4KBFA 4L02A 4E6PA 4F60A 3QW4B 5KQMA 2FXIA 2HMSA 3EC2A 4P98A 2DPMA 3J81M 5B2EA 5J4VA 2G5CA 3BJMA 1N5MA 2EF1A 2IDMA 1S2MA 1SU7A 2RGWA 2CNWD 3N2GB 2VF7A 4E31A 4DDVA 1B1AA 1RPAA 4KUGA 3E6AA 4LDPA 2QUBA 4NBTA 1BOOA 3LT0A 2FPLA 4CG0A 4D5EA 2EW2A 1V5IA 2IG8A 1XZAA 2G9UA 2YFQA 1X42A 2Z56A 1B41A 2AN3A 5J63A 4YV1A 1FP4A 2IYPA 2JIPA 3OQPA 4I1RA 1LSOA 5HUJA 1KKUA 4ZU1X 1E3LA 4E21A 5K0ZA 1OKKA 1GCGA 1SUPA 1L4EA 3FWPA 3GP5A 3KTAA 1T5IA 2OMKA 3N8IA 5LOVA 2X41A 4WLFA 1BH6A 5DM0A 5M04A 5HCUA 2IHBA 1D4OA 2DFPA 3QXJA 4IVQA 5EIFA 3RC9A 3W6NA 4C4YA 4QWMA 2ZSIA 2FMTA 4LKRA 3WJ2A 3NHYA 2NSYA 5FOSA 1U0SY 5F5LA 1EUCB 2VQFB 1TJNA 1G7TA 1TK2A 1PKEA 2F1JA 3S2ZA 5L7WA 3QE0A 4DJAA 5GZ1A 4ENVA 1KI6A 1KGDA 4WEQA 1RZRD 3O4GA 2CGEA 2D8AA 4ZO7A 3IOEA 4KR0A 3WGTA 1GQQA 1SBZA 1G5IA 1Q74A 3OSUA 3MD0A 3RVSA 4WGGA 1E58A 3K9GA 1X7WA 2O2DA 4R2JA 4WW0A 4RF4A 4KQFA 1UOOA 4UBLA 1EK0A 3C3JA 3ZBPA 2WYWA 4M0MA 5CJJA 5B2FA 1MV5A 2Z5FA 1FFSA 3I2IA 1BJKA 1Q6ZA 3QSGA 4OP1A 1EE2A 1W49A 2PY6A 3QFRA 4XM0A 5TE9A 4NFSA 2ZIFA 1GPNA 1I5EA 2DKOA 4RCYA 2O9JA 1N8TA 1DT5A 2OGSA 1U8UA 3MCVA 2G1JA 1HT1E 3RI3A 4ZT2A 3U3XA 1J25A 4X6LA 1B0UA 4AMZA 2X7HA 1V9CA 1XRSB 2WP0A 4JL8A 3VHLB 1CD5A 1LF5A 1UPTA 2VUUA 3R2JA 4Y1GA 3GJ6A 3R6TA 1AKYA 5EG5A 3KT6A 3PLRA 2W42A 2DX7A 2G17A 3PE6A 2C94A 4LJ7A 2IW1A 4I4LA 4UM8B 4ALKA 2WTXA 4IQGA 2FFRA 2NQ8A 1OWLA 2ZU6A 3KCQA 2QXTA 3MIIA 5IMSA 4FP9A 1KZ6A 4DRXA 4L8FA 2ZDGA 1DX4A 3UVEA 3S0WA 5CYOA 4B3RB 1E18A 1YJ9F 2HGZA 4N0MA 2ATIA 4KVGA 3TW6A 3BRWD 1KIMA 4ZOLA 4IKEA 3DULA 1PS0A 3GAAA 3IPAA 4QUBA 1GJRA 1G98A 1QHSA 3N2KA 3CCRF 2K2WA 3NR2A 4KGZA 4RHEA 5EP4A 2XRZA 1RLOA 2XEXA 4M55A 1XTRA 1QK5A 4JXZA 5IABA 5BSVA 3FB1A 2PU7A 1UM9A 2JK0A 4YREA 2F00A 4FQ5A 5CG1A 2NLOA 1OI4A 3HPRA 4HDSA 4YJ2F 3V1NA 1KNKA 2QY9A 4MA5A 3OTWA 1Z8HA 2HQRA 1RPJA 4MW0A 1ZW6A 4LGCA 4TN1A 2BFPA 1L6IA 1JZTA 1NOKA 2EFYA 4NNPA 3WAGA 3BCHA 4NCHA 4CV2A 1XEXB 3OVMA 1ULHA 1V4NA 4G56A 2XGOA 3N28A 2QLBA 1XRRA 4KRXA 4YLEA 1Q2XA 3RAJA 4BGUA 1Y33E 3N0TA 3HG7A 3WYBA 5C4MA 1YQ9A 2WHQA 3V4OA 4BE4A 5CB8A 4ZTZB 2CUTA 2QRHA 1TJ5A 3PEEA 4PWZA 4WZBB 3PGVA 1KE1A 3CC2F 3T4XA 3WWYA 1YJCA 3U26A 2E6KA 4A5OA 2MSCB 2EARA 1CNMA 4M9UA 3S29A 5CBPA 4TWJA 1DKNA 1TM2A 5GJBA 5CDFE 3GLHA 3GQBA 3K9HA 5LBUA 4DIBA 5A9RA 2RHGB 2I87A 4Q37A 2VYQA 1ZZGA 3ZD7A 1MVLA 1KF0A 4K88A 4B40A 1I2ZA 4WKGA 5DHFA 2J9YB 4V0ME 2C9YA 3HN7A 4BT7A 3RT9A 3JYLA 3KKLA 4TX1A 4V03A 3LUKA 2Q4OA 1KYTA 4YONB 3UWDA 3WK4A 5IFLA 2J09A 2EERA 1GNRA 4S2UA 1WB5A 3VU3A 3GEGA 1CQWA 4DLXA 3F8SA 5EUBA 1WDWB 3CWZA 3K14A 1NI4B 1VDMA 2C9OA 4UMVA 1L3BA 3H2HA 1ZJ4A 1V11A 3JWHA 3M6FA 4MIKA 5JOQA 2GEJA 3GZNA 3D3KA 3CZ9A 3NUZA 4H60A 2Z4TA 4QGHA 4TZZA 3B1FA 4MGHA 3GY0A 4WSOA 4PBSA 1HTWA 3SHWA 3D02A 3HJRA 4HFMA 3BQNB 1VP3A 3O93A 4MQEB 1FU8A 4G5SA 2YR0A 1M67A 3DS8A 3IAUA 3QWFA 2SECE 2AI2A 1AN0A 1E2PA 4C2TA 4A8JB 4NUTA 3TINA 4XWOA 4RV4A 5AW8A 3GGOA 4QE3A 4XYEA 2VBIA 5DRTA 5CMLA 2HB6A 5BNZA 2HPHA 3K53A 4GWLA 4PNZA 2JGMA 4YK7A 4ZK7A 1K4YA 2GJAA 1M1YA 4I8XA 4RPGA 2GFHA 5A6VA 3AHGA 2QTFA 4QQFA 2ZZMA 1FFWA 4K28A 4G1MB 2O0MA 5DOZA 3LJKA 3TZQA 1K73H 1UWCA 2CFTA 2GVZC 4K1LA 2HN9A 4LVNA 2KX7A 2QR2A 2X0NA 2DPGA 1OZHA 2FKAA 3AJAA 2FLVA 3C4JA 1NY5A 3ZY2A 5TNXA 1PR6A 3G2NA 3UT5B 3V3KA 4ARBA 5H02A 1E7MA 2XJ4A 4GLJA 5KX5B 3QEJA 2C4WA 1VYVA 5IEJA 3OLXA 1EFRD 2VP6A 1KFJB 3KAPA 1UBFA 4ITRC 4NZPA 5F2EA 4CM1A 1IXSB 1YB1A 2GN2A 2IXFA 2CFCA 3L06A 4IIXA 4DIDA 2O54A 4PO3X 5K3SA 1KAHA 1TTTA 2PLAA 2RKOA 3DWFA 3I23A 3TUIC 3PICA 3GK3A 4BTEA 3GJ5A 2ECQA 3AY6A 4JCOA 4KO3S 1B8PA 4L4YA 4PONA 3I58A 5DM60 4GPAA 3WLOA 1G8SA 3E7WA 3FNEA 1XMSA 4ZCPA 1K3FA 1EGMB 1N5JA 1V2HE 2GJ9A 3CONA 2HUPA 4EB0A 4MGZR 4WCFA 5AVKA 3IIKA 2EHDA 3OZCA 4ZOAA 1A76A 5FPPA 5J59A 5JZ9A 3QVGA 3VNAA 2O2SA 3MHPA 1H42A 2VS1A 2XWQA 2VZ0A 2W6CX 3D6MA 3QITA 4KHZA 2O3TA 4KXNA 3ZQ4A 4EFKA 1B2LA 1G8HA 2C2YA 1XVAA 3FMPB 3OIYA 2GMWA 4IUDS 1EFUA 3HO8A 4E4RA 1KDRA 1T36A 2Q4EA 2YMQA 2ZT7A 1WMEA 2PTHA 1QTNA 2Z09A 1BN6A 4KBGA 5AMXA 3BCUA 4X63A 1H1LB 4EHBA 1LQUA 3VHXA 3U5TA 1O0CA 5DTMA 1NZDA 3QTLA 4I1SA 3UXMA 1EM6A 2QTVA 4MV6A 2YH2A 4U6QA 5EJGA 4EGFA 2ZAIA 2CCGA 3W3AH 3V1TC 2RK3A 3C6XA 3JZDA 1VG8A 5HF5A 4X00A 3SSNA 2I4OA 3KD2A 2XXJA 3WZ2A 2YKGA 4E5VA 3DWGA 1ZA2A 1QU2A 2AKYA 2BW0A 3ELYA 2AXQA 4M1OA 3QU5A 4CTOA 3W5HA 2NUPA 3G1WA 3TB4A 2I6GA 2F55A 3IP3A 1YD7A 3AG5A 3MUFA 3TRHA 4E30A 5C18A 1W5AA 3IP1A 1X25A 3EPKA 1QFMA 1R9MA 2B92A 2CEKA 4RENA 2YWXA 4JVMA 4L50A 3KYCB 2XXAA 2DUWA 5LD2B 3OX4A 2OZLA 3TBHA 5JWRA 4H27A 4F6RB 1ZICA 2J3EA 5IJAA 5L45A 4HEJA 1OE0A 2D0OB 1ZU4A 4K6FA 1SCIA 1LK7A 2XA9A 4B31A 2QZ9A 3UENA 2GFQA 5BW8A 1WOYA 5CH8A 2ZSHA 2PQ0A 2HLHA 1S5PA 3WTCA 4W5JA 4P3XA 3DZFA 2E4WA 4K6MA 1TU3A 1TUBB 4BKRA 1P4HA 3D8NA 1X7ZA 2GF9A 3EZYA 1TT5B 3D5TA 4BUJA 4K9SA 3MJDA 2I8CA 5HZMA 4ZVSA 1J0BA 4GYKA 1UR5A 1QLHA 1E4VA 1NKSA 1RZVA 1U7ZA 2H3HA 2ZAYA 4OOEA 3V8BA 3H5TA 1PZMA 4E09A 2MINA 4PLTA 4B45A 4YAGA 1Y7HA 2P91A 2V3VA 5FR2A 2AWOA 2NG1A 4KPUA 4KXMA 1J9ZA 4NMXB 4ZEOA 2TMYA 4MMXB 3RYFB 2Q46A 4RIFA 2HS4A 3OQOA 4L28A 3A2KA 3EN0A 1SIWA 3HSSA 2IIBA 2V1XA 3U1VA 5JO0A 1YRBA 3IERA 4NCIA 4S1OA 2HCRA 3F5FA 3TOXA 4UTPA 4QDTA 1Y3CE 2YYEA 3KUCA 4MYTA 2CMHA 2O48X 1CJVC 1OV6A 3KEFA 1YITF 3ONFA 4KO1S 1JL3A 1U04A 4WKOA 1II0A 4HNUA 1BAPA 1JEQB 2EP5A 3B53X 3VPBA 3JAKA 3T06B 4QBHA 1V7PC 3M0EA 3QUSA 4RANA 2QM7A 3G2PA 1TCVA 4IDOA 4U2KA 3ZWXA 4A6XA 5L4SA 1GFWA 5E7JA 3DP9A 2X7XA 5FV7A 5JBIA 4L0MA 1HFWA 1CS0B 3TTUA 1U8TA 4RGVA 3VZSA 3WFZA 1DMRA 4QZVA 2I71A 1SFRA 2GHQA 2FW9A 2TYSB 1IPHA 4M60A 4ENWA 5A4MS 5I7FA 2RDMA 2H7XA 1T6BY 3HEMA 5E8JA 5EIEA 1I14A 1TPZA 3A2MA 4V0SA 2HV8A 4YAEA 1TD9A 1ZISA 2GUWA 4NBKA 4Y2GA 5L3SA 3I2FA 3VTAA 5TR9A 1QIJA 3I6MA 3STXA 1NPDA 4WI1A 5K4GA 4FOPA 2BGJA 2XKAA 1EVEA 2GHRA 2ZRDA 3GH3A 1CXZA 2XIQA 4DJTA 1TA4A 4Q1AA 5NULA 1Y9JA 4OBBA 2MSWA 4BVJA 2HRZA 2XE6A 3SQNA 3WDKA 5DBEX 1AKRA 4EA8A 5IYZA 5DTRA 1MPXA 2XB4A 1UJNA 1B3BA 3E58A 3HDQA 1HLFA 5DWDA 5JNWA 1SVNA 4JWKA 3MTGA 3RAEC 4I1IA 3FLBA 1GA4A 3HKEA 5IBCA 1OA0A 4BUCA 3C8ZA 4GL2A 3ZWKA 4ZYVA 5BXYA 3I32A 1U7PA 4CKCA 3GJ8A 5J2UA 1LX6A 1PL8A 1VGRA 2YQZA 4WESA 3K2QA 3T95A 1IV2A 1O0SA 2YWCA 3MRTA 3RBAA 4F71A 1UPFA 1BGVA 4YPOA 2ZJAA 4V1CA 1J1UA 2ZEJA 3O7MA 3OWOA 4B3JA 3K9LA 4GX2A 3D64A 4M2LA 5DXJA 4CT5A 2UV8A 2Z1FA 4X24A 4DLPA 4IIGA 5DX1A 3C74A 4XQCA 5H81A 4PAWA 2XQVA 3VH3A 4AC9A 3IXQA 1OFUA 3G6EF 2P0YA 5KU7A 4AY5A 1OR8A 5ECGC 5IK2D 3TUJC 4MW4A 2PZKA 3TLBA 2FSHA 5I9TA 1IPEA 1NN0A 1UODA 1ZD9A 4OIMA 1CEYA 3M1LA 5AJYA 4RVDA 5G4VC 1NUUA 2AS0A 2F67A 3K09C 1JGTA 2OLKA 3D3NA 1RMQA 1DKQA 4D9CA 3DZHA 3C2QA 1FYVA 1Z5UA 2DFVA 4OMUA 1V6AA 1Q91A 5J5VA 3AVXA 1Z83A 4N65A 2ZVDA 3AR8A 4PFSA 5FI0B 3ZQJA 2J5KA 4GGMX 4GVXA 3WK7A 5FPKA 3CYPB 3OWXA 1OLSB 2IPMA 3QIAA 5EN4A 4GWGA 3TL2A 2O20A 2CNLA 1T36B 2VBCA 3D7MA 3HZHA 3PP8A 3UJ3X 16PKA 2BJHA 1U3LA 1T5DX 1A7UA 4QVGA 4UPVA 4PFQA 3O3OB 3T0IA 3N9IA 1XXLA 1TFUA 2XYPA 2YYAA 4DNQA 1E8DA 2M9MA 4G8BA 1PSZA 4M6WA 4N39A 3S5JA 1PWYE 2P2NA 3TDMA 1FP4B 4Z1OA 3TSYA 1QH0A 5C80A 3WJAA 3NU1A 5F1OA 2Q4TA 4EF5A 3DYIA 4PPNA 1FSGA 1DU4A 2PSHA 3V2IA 1HF3A 3MJRA 4B8WA 5JARA 2O50A 3RBVA 1SVUA 1KJ9A 1X7OA 3QNUA 2G76A 2A9RA 1GCIA 3S7ZA 4Z4HA 1J2RA 4MGKR 1FRVA 1Z6YA 1QHHA 1C3EA 5LYYA 1BOFA 4OHVA 3R7WA 1TF5A 3SBOA 1SCBA 2J6HA 3NXSA 4NMHA 1AD2A 3A6KA 3KQSA 5E95A 4L4ZA 3ZDRA 1M0WA 3JYPA 5JH7A 3E9EA 3SP1A 3GRVA 2A1UB 4JV5B 1RQNA 2IU4A 3QUTA 2Z1DA 4NBVA 4O4JA 5IUKC 4JI8B 2P90A 1C0EA 3ESAA 3AR9A 3QP9A 4I08A 2ZIEA 4NAVA 4P34A 4DLNA 4IOJA 4ZEVA 2OBXA 3HR7A 5KYUB 4BDSA 2CE2X 2O7SA 2JHAA 4Q9JA 1J2JA 1VRCA 4F0JA 3O8OB 1R2QA 3AHEA 3QPDA 1COZA 1YZHA 3PVCA 5KTMA 2A33A 5DI3B 1D9XA 2DCUA 3EXEA 4B87A 4D96A 3C8HA 3R0VA 2CZCA 2F17A 3BXXA 4HR7A 4NU5A 4UD2A 1LPBB 5DCUA 4M1WA 1M8FA 2HJHA 3HU1A 4B17A 2IBMA 2B1JA 5L51A 3OAAA 1SG6A 4L0QA 1U11A 2C3YA 2QNBA 1QONA 4UBKA 2P2SA 3KKZA 2ON6A 3D00A 3PYXA 4XLTA 4XWGA 1YNSA 3ZWVA 4E13A 1I3OA 3T5PA 3ITNA 3KPYA 1L8XA 4HVTA 1K7FB 5BYBA 5KZMB 1UBHS 2JI6A 4N5LA 4NONA 4CYMA 2EX1A 3EXHC 4M54A 1BX0A 5JCZA 5L8VA 1OH8A 3GEMA 4LF8B 3MCTA 2KMLA 1OU4A 3GRAA 2EJCA 1LK0A 2VQ6A 4FYYA 2HO4A 4JFRA 1F5NA 5I9MA 5KSWB 1T3GA 3GFRA 5C3MA 1YFJA 5ALXA 4NOMA 2IWRA 3HFJA 2KJQA 1ZA1A 4TWAA 1JA9A 1X39A 2RFLA 2RCYA 2XAUA 5ECYA 5HUQA 5LNK6 4NY1A 5FI5A 4CL3A 5LM3A 2V1UA 1FRQA 1RLJA 3T9AA 3DGFC 4YRZA 4WY2A 1RC1A 2WT8A 2X2PA 5CG2A 4R98A 1NP7A 3J7AR 1DDGA 3DFUA 1UINA 4DDKA 1WUIS 2RJNA 4Q1EA 4RVOA 1BKDR 2BGLA 2IZOA 2ZSKA 3O31A 3RRFA 2AOTA 5BSFA 3VPAA 3X2SA 2C8KA 4KTVE 2MTBA 3VPSA 3GMTA 1ZFNA 3V1LA 1P1JA 3I52A 2Z1EA 3UYLA 4FNAA 2QTAA 4MV9A 1PJQA 2LTAA 3HBAA 3CYFA 4YRGA 3BIWA 4C82A 2PS1A 2ZAOA 3MLAA 2QPTA 3BDVA 2PAAA 3WC4A 1KDTA 2NYVA 3FCXA 5LR6A 3QSYA 2DTDA 4MVWA 2YICA 4QIHA 4C7XA 2X4LA 1PJCA 1P7VA 2CMDA 2FOIA 4RADA 5EJFA 5SV2A 3UMRA 4DIEA 1E9EA 1SK9A 1IIRA 2CNBA 4QM7A 4MIEA 2H48A 3OHPA 4UUPA 2MT9A 3DB1A 2AUMA 3JD4A 4QQ8A 2VXBA 2FLWA 4DCSA 1DRKA 1X1RA 2V5AA 5CVJA 3UFXA 1TU4A 5BW4A 2HQBA 1SAYA 2G72A 3L8GA 4J4TA 1GZSA 5KYYA 3H8SA 4C8EA 1QZXA 3FSRA 1VM6A 4O3FA 1OLXB 2QUJA 3L0BA 3T5DA 3GT3A 1AHHA 1XVUA 4UZEA 3JAMA 2R85A 4HLQB 7REQA 2FK8A 3QEOA 1PEKE 1DJPA 1MRZA 3NBQA 3RVKA 4COOA 3LPLA 5CH3A 1I33A 3OZBA 2C0PA 2GRUA 4JYBA 1KOLA 2C4KA 1L5MA 1DEHA 5DDIP 3ZK9A 1SEVA 2BDUA 2W6ZA 3PFHA 4ARSA 4DLSA 4DQ0A 2I62A 4HBZA 4YT4A 3PNVA 4XOUA 4TYQA 5EMJA 4WOCA 4RKYA 3LP5A 3NB0A 3RVRA 4U3JA 3DHWC 5J4HA 5CBKA 5FV4A 1KQ3A 3SHFA 4TXHA 1JWLA 1E0KA 3ESCA 5TV2A 4B44A 2RSLA 2ATCA 1U94A 2A5FA 4GOMD 4W1RA 4D0LB 2ZJ8A 2QENA 2XECA 1A72A 2R4QA 3FPGA 5L3VA 4C4SA 3DMTA 1L7PA 4P81A 4Z4FA 1IBRA 5EHIA 2W2LD 5FFMA 4O08A 4DL9A 2JBAB 4EL0A 1VFPA 4U7PB 3L7NA 1TLLA 3DOIA 1UBLS 2IEIA 3FCYA 1K0FA 1E64A 5ITWA 5C1OA 3VH4A 3BMQB 2BWJA 4EZIA 1KIFA 5LJLA 3HNOA 4GGOA 4EJSA 221PA 3RS2A 1C3JA 3I7TA 1G1AA 1Y4ZA 4FQ7A 1CUFA 2BI4A 1N0UA 2H0RA 1GDTA 1P5ZB 2IT1A 4DCGA 3OCCA 2A7QA 5ARCA 3NAMA 2PJDA 4INPA 4W6QA 3SYLA 3LCJA 1SXJE 1B6GA 5FUVA 5GOZA 4F2HA 2CXQA 4AIRA 4Q24A 5EKXA 5EO3A 3QHQA 2DQSA 3U81A 3K72B 2VXOA 1KO7A 4BJ3A 1EXVA 1S1CA 4EMTA 2DRIA 3PKZA 3REQA 3GC6A 2Z8XA 3BTSA 3OZAA 4BT3A 4IPTA 3ZYCA 3LFUA 2B5WA 3PKJA 3KSUA 4ZWNA 1NMQA 3T7RA 1ULZA 3ZD9A 2DETA 2DLCX 2H4FA 1TAQA 1QYXA 1PGOA 5C8YA 3O8OA 2L0XA 3SS7X 4YMSA 3GLIA 2WUEA 3K5WA 2NT3A 4QJ3A 3ENQA 1LTKA 3I9KA 4RAQA 5DT2A 2H85A 1T9BA 1IM5A 1LPSA 3CZCA 1T5BA 3GRRA 3KV1A 4POOA 5LJIA 1P2VA 3LGAA 4RPJA 4QHTA 1NUAA 1QZTA 2D2XA 2OK8A 2RCNA 3FZYA 2E4VA 4BMVA 2V7XA 5A5FA 1ECJA 5BO5A 3RU3A 3OE7D 4RKRA 3DSRA 1V5WA 3CZRA 3G17A 4HLUA 1T8WA 3U9LA 2DFKB 4AJEA 2Z98A 4C89A 3TF5A 4FZJA 2XCRB 1N9ZA 3P71T 2HRYA 1IK4A 1GZDA 3KTFA 2W8BB 4MXDA 1MC4A 4C5CA 3TNDA 5C7OO 3A6FA 2D0PB 4WZAB 1ANKA 3BK7A 3N3AC 3I9LA 4FC6A 5HMMA 5EE0A 5AWFC 4BVHA 1VHJA 4B6FA 4LXHA 1FNNA 3PA6A 2HK6A 2JFOA 3OEYA 1LBHA 1T35A 4OHMA 3ZOPA 1QG6A 4CLDA 4D0GA 1ORTA 3EARA 1W5EA 1PJSA 5AHRA 4YN3A 1Y9AA 1U7WA 4CUJA 1PQYA 3F4LA 3WGLA 5IF9A 2QNRA 4P7FA 3BXOA 3GOQA 3K12A 4H59A 4WNAB 3CUKA 3N8HA 5GVSA 3Q3EA 2RGXA 3L8DA 1VQ9F 3TGWA 1X15A 3OC0A 1QFJA 1XD2B 1NJGA 4GOJA 8LDHA 4ZTUB 1RACA 1TX4B 3AJ8A 4MJ3A 4RHCA 1A9OA 3NUGA 4HD8A 4ZO4A 4M1KA 1BWQA 1I4OA 4NJEB 1JZQA 2BE9A 2XTAA 1ECLA 4G4ZA 1Y8CA 4QUGA 5KVVA 2OORC 1TIPA 1QUEA 1MC5A 2Z0MA 3Q3VA 2PV0A 2YJTD 4H7PA 5IAJA 1LA2A 4IOMA 4KMMA 3FUWA 2PJRA 4TWRA 1U4SA 3KSZO 4EFNA 2UUOA 2EX0A 2Y67A 3CLRC 2W9XA 1H66A 3BSYA 4P4TA 2VNKA 4PPQA 4DV7B 4OL0A 2XUQA 4UW9A 1PEAA 4HDOB 3SC6A 8MHTA 2J4DA 2JI7A 3TAUA 1GL6A 3AF6A 4R05A 3UCXA 4IEIA 4MV1A 1CR6A 2ECFA 3OJOA 1R18A 4NE7A 4OXXA 1HR0B 3T80A 1Z47A 2ZJYA 1CDOA 1ODCA 4RNDB 3W2TA 1FNDA 2FDRA 1O89A 1NW8A 5G02A 3ZOZA 4KU4A 1KEUA 1ZBQA 2A92A 3OQ1A 3F78A 1JFTA 1Z6XA 3ILHA 5IN5A 2PGOA 2YIJA 4N0PA 5IP5A 2UZIR 4C04A 1TO2E 3STWA 1DAIA 2OXTA 3B13B 3G2HA 1AKWA 3DBVO 3RHZA 3PD0A 4K9LA 1ST2A 1RHRA 3C3MA 1PBTA 2NAFA 4XD2A 1E1CB 5DWQA 1C4XA 2FPIA 3HU2A 3O73A 5BUQA 3SZ3A 1VFNA 3WNVA 4V39A 2ZR0A 4DBLC 4DZZA 5BWBA 4UDNA 1YFKA 1VL8A 5AM0A 3WYCA 4BUZA 2OLEA 1JHPA 3PEUA 3VU0A 1GLGA 1C2TA 2CD9A 2D0IA 2BI7A 2PGJA 2DFDA 2E0IA 4HDKA 5FOXA 3VPFA 1VI5A 5EUMA 4DF3A 3AVTA 2Q28A 1GNLA 3CG0A 1VHQA 1KI7A 1Z4IA 2A2ZA 2QNIA 4PM4A 2VATA 3WNCA 3EUAA 3A4IA 1OGYA 4PQYA 1JFFB 1JIKA 1PR9A 2BGIA 3PQ5A 1DJMA 4GLBA 3BEDA 2UAGA 3BMCB 3GPDG 1M1UA 3ZO8A 1PF7E 4JLAA 4N8DA 4RQUA 2E2WA 3N86A 3K32A 2SCUA 2YHSA 3E9NA 3G2OA 3GDGA 1W2GA 4HG2A 3OHSX 3SJ7A 3GLGA 3PUKA 3QLEA 1UP7A 1DMSA 2C99A 2VTKA 3EGXA 4LZJA 1MW9X 1A8UA 3KQNA 2O8FB 1J00A 2QAGB 1G21A 4O4JF 1EA7A 1QVRA 4F8YA 1F4LA 5DGTA 2IZ0A 3GCWA 3H3FA 4XIIA 2OVBA 4DYVA 4L0DA 4GT1A 1XP5A 4IJMA 4RDXA 5I7EA 3FDFA 2QL9A 2K1SA 1RFLA 2R6R1 1S4MA 2LBXA 5KWSA 4P3NA 1TECE 1G42A 3ZS8A 2CVZA 5J4YA 1GUYA 5EIOA 4XB2A 5JXWA 4LZZA 2PS0A 4TV9F 1CJUC 1D4FA 2G82A 3AU9A 3SIUA 3NFYA 3NKLA 3HTNA 1SC4A 4NZNA 2DBQA 2VSYA 4UNNA 3V4DA 1U7UA 3NNDA 4WCVA 1Y80A 4R71A 5IVPA 1PGJA 1RRKA 2O19A 4PR0A 4FMCB 5DHQA 1C3XA 1MV8A 2G63A 1LRJA 2A0XA 3IIJA 4OFWA 2XF8A 4F7WA 1WL8A 1DVRA 1A7AA 4H16A 3SZUA 2FZ5A 1A50B 1PQUA 1R37A 3QX7A 5AK5A 4HFJA 3GJTA 1ABFA 2IE0A 2YMMA 1VIVA 4GZ6A 3RYIA 2G28A 1GGFA 3EDOA 4Y18A 1K8RA 1BA2A 1DQPA 4NULA 5JALA 4PYMA 4B82A 1VKRA 1GUFA 3RYHB 2WFLA 2WICA 1RQ7A 2WU3A 1JQLB 3L8FA 3VTIC 3LBNA 3ND6A 4OSOA 3MEQA 1XJWA 4TM8A 3W3ZB 2QJOA 3NDIA 2O2GA 4XPIB 4YO7A 4PFKA 2QJWA 4IV8A 1ZONA 1EA5A 3Q72A 2JAXA 2X5XA 2AG5A 3R4CA 2FRDA 2X6RA 2W6NA 3HTXA 4BPRA 3QJGA 3W6ZA 4BGEA 4I8IA 4LJ6A 4L4UA 2XAAA 2Q6TA 4Q03A 5CM9C 2IXDA 4W1QA 2UYKA 3OIVA 3KSRA 1CZUA 2Y1KA 1NW5A 3DLHA 2V96A 4BP9A 2D7JA 3INGA 2D59A 4ND2A 3T0GA 4EYGA 4HZUB 2RGDA 4LYDA 3SXUB 1LI4A 5HKAA 1YA4A 4KODA 4MQLA 2H59A 1PV1A 4QYMA 3PXEA 3CT4A 4U1RA 4ZU3A 5H5JA 1W5FA 3P9IA 1O9BA 1MW8X 5DMXA 4TVOA 2ZRBA 4MEAA 2J3JA 3FX2A 3O3NB 4KKXB 4EPYA 3IJEB 1CR2A 5AFSA 5I45A 2WJGA 2VDNB 4YAIA 4LJAA 3DT8A 4XSVA 5L6LB 4EG1A 2BMWA 3M6VA 3BICA 1RXYA 1S3GA 1T1RA 3FPBA 1NM5A 1DOHA 3OIFA 3QPAA 4K2AA 1VIMA 1X7DA 4DSTA 4D42A 4J0HA 3AQIA 1ULUA 3CMCO 2X1LA 2UDPA 3PX2A 4BMCA 1T4MA 3MMZA 1AURA 2FRDC 2V0NA 3CC8A 2H5JA 1ZCJA 2I55A 5CLGA 1NNI1 5T8KC 3KLBA 2NVUB 2EBWA 1ZHOA 2ZODA 3GGDA 3H9CA 3HB1A 4IF4A 5FBLB 4JBGA 1T1EA 1BCRA 1ODFA 2XTJA 4UHFA 5TGDA 5BSRA 3G89A 1IOZA 4Q39A 1G38A 1Q1ZA 1NOIA 3CV3A 3JX9A 4MV0A 4NARA 3R5HA 3AR6A 3E3MA 4WKBA 1I51A 4PXYA 3VTZA 4YUWA 1FA9A 1XXHB 2F1KA 2CLIB 2XYQA 5G3YA 2ADOA 5JSZA 1X94A 2HX0A 1E9CA 1PWXA 1Z4JA 3M4NA 1NT4A 1M5TA 3AYZB 3FCAA 3HKBA 4H6PA 1N2CE 2DWUA 4XGQA 4RA6B 5K3BA 3O84A 4CLXA 3KDPA 4BT5A 1KKLA 4HGYA 3QGMA 3U4GA 1SRQA 2QYOA 4RYDA 4Y0VA 4P0PB 3BSSA 4L9AA 2LDXA 1YBHA 1TK9A 3PDIB 2C2XA 1ZGCA 4CN9A 4TLAA 1DHTA 1LDGA 1SNYA 1GV1A 1SPXA 2HADA 1O5OA 2IIQA 2JZOA 4FGZA 4R0MA 5DNUA 2MYNA 3ONVA 4HPWA 3K0TA 1BJTA 4FYVA 3ABQB 3WGGA 3FCCA 2R86A 1Y6ZA 3GP3A 3CR8A 1AX9A 5EJ2A 4OX9B 3TPCA 4KWCA 1XF1A 4M0UA 4HAOA 4HQNA 5L53A 2HP0A 4RXMA 3DMNA 4YJGA 1KORA 1Z6TA 1AGNA 2FMIA 2G8NA 4IZOA 3GIDA 4YMHA 1JEDA 5A9TA 5JPDA 3U4QB 3VYUC 5A0TA 1IHDA 3UPDA 4C7VA 821PA 1ZK2A 2SCUB 2VPWA 5HIKA 2LXNA 5EL0A 3P4EA 2XQGA 1VJRA 2J9RA 3I3SR 4QUDA 3HLKA 3T99A 1Y6JA 2QVYX 4YUAA 4U2EA 4WGFA 1JEJA 5L7TA 1H3EA 2EFJA 1OIVA 3CC4F 3FTDA 1I3MA 1PJTA 3AH8A 4A2QA 1U98A 4PY2A 4PX2A 1VMEA 1G8GA 1TADA 2BFEB 4Z0HO 3KYDA 2YCLA 5HIIA 4CT0A 3I05A 4ZHSA 4G0WA 1U9IA 3RWBA 1KFCB 4J1QA 2H2WA 1QYIA 1XZMA 4AKGA 3ZXIA 1JFLA 1ORIA 3O8DA 4XWAA 1ID8A 1G2OA 3T7CA 4CIDA 3C3DA 1MQAA 3H9UA 3KOOA 3DZDA 3OFSA 1IY0A 1DWQA 3OE1A 1X7GA 2Q2QA 3HCPA 3MINA 5D00A 4DV5B 4H77A 4IKPA 1GLNA 1RWMA 3HUFA 5AM3A 1UXHA 3RU9A 3KIPA 2H9IA 3KQYA 3BTVA 3NBMA 1YVPA 2RHWA 4PF1A 5GZ3A 3ZXUB 4MO2A 4DCTA 2FR1A 1D4ZA 1AH2A 3FTFA 1TCCA 5L3QA 2N3ZA 1IZYA 1NXWA 1USKA 2HCJB 4G9EA 4CM5A 4MA4A 2WD7B 1QIFA 5IAKA 3D81A 4MW9A 4JGGA 4FT2A 3M9XA 4W9NA 2P67A 2ZP1A 3GZNB 2PXXA 1OTHA 5BOVA 3HFSA 3ZHXA 3UKOA 1RPZA 3WXMB 3GGCA 3T5TA 1NJ8A 2HHLA 4HH1A 3Q8LA 4IHJA 2GESA 3JZIA 1TRHA 3LVFO 3A1UA 1NF3A 3K9NA 3O9ZA 2KM1A 3KQLA 3PSAA 3G2IA 4X66B 4NEHB 5BXQC 3IKJA 3VNRA 1FBNA 4R9SA 7ABPA 4MRNA 1B16A 1D1TA 1YCFA 1FUUA 4PAGA 5FOWA 1NFQA 2XH8A 3KX2A 4YWHA 4TYYA 4RD4A 2FF5A 2P7HA 3UUFA 2CFIA 1Z26A 2V5VA 2B1GA 1GFSA 3F5DA 3NT2A 4AURA 3AONB 4HC4A 4KN8A 3S4YA 3CEHA 3UJBA 3JZAA 1TRKA 3SC3A 5H0IA 1VRVA 3TZBA 3VGJA 4ZICA 3B5IA 4I14A 3A3OA 3AO0B 4C0LA 3SSAA 4F7DA 5EQFA 4XCVA 3TLZA 3EBOA 4AQDA 3MWKA 4KK4A 2FJ0A 4P8RA 3LX5A 3OEHD 2BBWA 1HDYA 2H3EA 3ZDYB 4J07A 1YI1A 4IIBA 2CUNA 4IGAA 1H5UA 1VJTA 2FWPA 4QU0A 3MCWA 4R69A 3TOZA 4DKXA 5JV5A 4F1WA 1SXIA 4JI5B 3NIBA 1J56A 2NZVG 3PQEA 4Z3KA 1Z34A 4LZLA 1XHFA 2XE8A 1X9HA 5CCXA 4Y3UA 3EMKA 1FSZA 4KI0A 4REQA 4EUEA 2HDOA 4X44A 3CRNA 3DKVA 1RC0A 4B6SA 1WB9A 2R68A 1QCDA 4HS4A 4EPTA 3FVTA 5SYAA 1FDOA 1I1NA 3LKZA 4QGAA 1U99A 2PH3A 4H1HA 2A86A 1CYDA 1CHNA 1CUUA 4MARA 2W6MA 4CMHA 3P94A 4M1SA 1TQ4A 1PD0A 3AX6A 4D82A 1NW4A 2P5UA 3F97A 2V59A 1WCXA 3BF8A 5B30A 1P1HA 1TC2A 1Z4NA 4BP8A 3PS9A 3H1TA 4QLOA 3G0CA 1FP7A 2FGJA 3PHIA 4CMEC 5EZYF 4NYIR 4LF5B 5TB5A 5HJ2A 4EBFA 4UJ5A 1GUZA 5B58T 2AJBA 1GD1O 2GCEA 2VRNA 4IIJA 4NOKA 4WBNB 1A9XB 1KWGA 1N3BA 3GUCA 3F7NA 4N8EA 2Y77A 1ZOPA 5G4KA 2J46A 4BKPA 2ZM5A 4GI5A 4J1SA 1Z3CA 1L9XA 3EXHB 1DX9A 4JJEA 2CL6X 3A3NA 5MN4A 3O94A 4YQZA 4TL9A 3FJOA 4WNAA 5EMNA 3SOPA 1G4HA 2IOHA 5JAZA 3AFIA 4RAOA 3NDJA 2OCXA 4ZYLA 4G4SP 5IAAA 3U0BA 3ZEIA 3H1EA 2LP4Y 5ADWA 3WGOA 3EXAA 2INGX 1O77A 1RXEA 2A9VA 3V7YA 4BPBA 2GK6A 5FCDA 2XMCA 2G36A 1NJ1A 3ROEA 5IAEA 3IPRA 3PEFA 3QVTA 3KJGA 3PHGA 5LB4A 2V97A 4IXNA 1PF5A 4DV1B 1GPKA 3QY9A 5DM4A 1D07A 1NQXA 4Z7JA 3LCMA 5LIPA 4DQLA 3M6LA 5AW2A 5INTA 1G3RA 5CLQA 4I1VA 1ZVKA 4K8OA 4LC0A 4UM7A 1Z7WA 3PWSA 1KI4A 1IK6A 3WRVA 1J49A 3Q8MA 4IBOA 2NACA 1JSZA 1O96B 3ROMA 4PLPA 2QU7A 1YIDA 3MN1A 1E1NA 4PAOA 2V4ZA 1FLNA 1RVDA 1QYDA 1UBCA 2IXGA