3WGNA

Staphylococcus aureus ftsz bound with gtp-gamma-s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 106
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgnA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgnA01
4TUYA 4X20A 2BTOA 1W59A 4ZI7A 5J2UB 3VO8A 2Q1XA 2RHHA 2VAWA 4IHJA 5IJ9B 4ZOLB 5KMGB 5CB4A 3V3TA 3E22B 5GONA 5KX5A 1W5AA 4M8IA 5CB4B 4ZI7B 2Q1YA 5LP6B 1JFFB 1RLUA 1RQ7A 4I55B 5LA6B 5JQGB 3VO9A 3JATB 3N2KA 3RYFB 4X1YA 4IIJA 4I50A 5C8YA 3N2GB 3C8LA 5M7EA 3M89A 3N2GA 3RYIA 4B46A 3ZBQA 1SA0B 3HKCA 4TV8A 3ZBPA 4EI9A 4EI7A 4U39A 5LA6A 3WGNA 5IYZB 5MN5A 3JASB 4FFBB 4LNUA 3JAWA 1FSZA 4TV9B 5BMVB 4I50B 3RYCB 1FFXA 3JALA 5JVDA 4YJ2A 3JASA 4FFBA 4LNUB 4O2BB 4E6EA 4O4HB 5CA0A 2RHJA 3JARA 1OFUA 4O4JB 3WGMA 4ZHQA 4X1KB 2XKBA 4O4IA 5JCOA 4F6RA 3HKEA 4YJ3B 4WBNA 4ZHQB 5J2TB 2BTQB 4X1IB 4O4IB 1W5FA 5EIBD 3RB8A 1RQ2A 4X1IA 5IJ0A 4I4TB 3RYHA 4O4HA 5EZYB 4U3JB 3JAKA 2R6R1 3CB2A 4O2AA 5EZYA 3VOAA 4IHJB 5IJ9A 4U3JA 4F6RB 2GVIA 5JH7B 3VOBA 4DRXA 5J2UA 4DXDA 1Z5VA 5LYJB 4DRXB 1Z5WA 4I55A 5JQGA 5MN6A 5IJ0B 4ZOLA 2RHOA 4KWEA 3RYHB 4IIJB 2VAPA 5C8YB 3JAKB 5EIBC 5GONB 5KX5B 1JFFA 3UT5B 3WGLA 1TUBA 5JH7A 5FNVA 5LP6A 4TV8B 4X1YB 3UT5A 1W5BA 3N2KB 1TVKA 5KMGA 3ZIDA 5FNVB 3RYFA 3E22A 5LXTB 3RYIB 5LP6C 3R4VA 4TV9A 3HKCB 3VPAA 5LXTA 4HNAB 1FFXB 2RHLA 1SA0A 3JATA 3HKBA 3HKDA 1W5EA 2VAMA 4YJ2B 4B45A 5MN4A 4EI8A 4O4LB 5JCOC 4O4JA 3M8KA 5CA1B 1TUBB 4XCQA 5BMVA 5LOVA 4O4LA 3RYCA 1TVKB 5LOVB 5J2TA 5CA0B 5JVDB 4EB6A 5ITZA 4O2BA 4HNAA 4X1KA 5IYZA 4X20B 3HKDB 3HKBB 5ITZB 1W581 3JAWB 4YJ3A 3JALB 2VXYA 5CA1A 3HKEB 4WBNB 2XKAA 2R751 3WGKA 3JARB 2BTQA 5EYPA 4I4TA 4TUYB 4EB6B 5EYPB 5LYJA 4O2AB 3WGJA
chains in the Genus database with same CATH superfamily
1XTKA 1HE8B 1A4UA 2V6FA 3N8HA 4M1EA 4TYNA 2WAAA 4WXRA 4L50A 4JROA 1I6KA 2QLLA 2EZ9A 4FGJA 4ZCQA 4GXTA 1C9JA 4JB2A 4WH0A 3P2JA 4LEIA 2O2EA 1MW9X 4MQLA 3EXHB 1DJMA 3FBWA 4D7AA 5TJ9A 2XB2A 4EYQA 2IRWA 1XNRB 1ZD3A 1W2GA 2AW3A 3VZCA 5MHTA 4HGNA 4BP3A 4N3AA 1KYXA 2YZ2A 2AUMA 5F5LA 3RQSA 2ATEA 3WOVA 2GVNA 5IS2A 4ERXA 5UKDA 1VGVA 5IYZF 2P9YA 4CQNA 2H1LA 1GZ5A 5DMXA 2WMYA 2ES4A 3TXYA 3UW1A 4CM7A 5AUPB 5BXYA 1PT9A 3K6SB 1YJXA 3QIAA 3S2YA 1MOQA 1GUAA 1ZJZA 1Q0PA 3HUUA 5LBUA 4PC6A 3C3WA 3AG6A 2CL0X 3RF6A 2BEJA 3LOPA 3M81A 5EUCA 4ZHWA 1N2SA 3SHWA 4R0MA 3RSGA 1EVLA 2NQTA 4L28A 5KSOA 3PNYA 3F7OA 2H07A 2G5CA 4K6CA 5D51S 5B1IA 1ZVQA 2PKWA 1SAYA 5FYQA 1FQJA 221PA 2WE8A 4BFVA 5EIEA 2CJYA 2FSIA 4Y1RA 3SIWA 1YR6A 4PY2A 3D64A 4H3HB 1XCMA 1XZCA 4PCLA 4L7VA 4DLWA 4HNUA 3DVLA 5CH5A 2HM7A 3F6EX 1Z5NA 5CBPA 3CE9A 1QCCA 1W6UA 1KPIA 2V74B 2YWFA 3WMGA 4UDYX 3BGWA 3GARA 4Q82A 4RTOA 3CX4A 4ZT4A 2FA9A 4L51A 2BP7B 3G2JA 4RK7A 2XT0A 1DAFA 4CQLB 2WTAA 1NBIA 1I2BA 4IFEA 1DJPA 4M21A 4R3NA 2WM3A 4ALKA 5CDGA 4B3IA 1UBNA 2MJLA 3LFHA 1R8YA 2FW0A 1OJLA 1ZRMA 2ACVA 4J07A 1CUAA 2R1VB 1AGRA 5JE8A 3HWWA 1X87A 2AMYA 4RGQA 1AURA 1XELA 2JI4A 5KB3A 2Q7XA 4ANFA 5ARBA 5HQ3A 2PJRA 1FX1A 2RHOA 1DO8A 3LHSA 3LBYA 2GZLA 4LSZA 3T7EA 3AU9A 3ZOZA 2GFIA 4UMEA 5LYYA 3WDSA 5HQ3B 4YY3B 2ZG6A 5ED4A 4J03A 2AN4A 1PR0A 2XYGA 3REQA 4FGKA 1GUBA 1JJBA 4MJXA 1ATZA 1Y7HA 1L5MA 2R4UA 4MINA 3WLAA 4BNKA 2OLJA 3ZIDA 3WIEA 1F2TB 3PV0A 3QVKA 3P9YA 1WDLA 1GFSA 3N6RA 4EG6A 1S2MA 1DEAA 3ANYB 5E2IA 2C0CA 2PKQP 4NEGA 3WMFA 3EXIA 1TQDA 4YONB 4EA7A 3PJRA 3KSDO 3KYJB 4KGVA 4OYLA 1HE2A 1Z5ZA 4TRNA 3W2FA 4B71A 4ZYXA 4RK1A 4AJ4A 1E5DA 2C3OA 2IKSA 4CT0A 2Q3LA 2Q2OA 5DYWA 4HZGA 4FBGA 4KQ1A 2HLDA 1JY8A 4QYMA 4KE7A 3JQFA 4DAOA 3E0XA 1OGJA 5ITZA 2Z6VA 3W9BA 2NU7B 1Z12A 2W2OA 1MIHA 2OQRA 3NNDA 2HK9A 2HWUA 4P4GA 3W7AA 4CCAA 1B8PA 1QH9A 1B14A 2PGDA 4DS3A 4TZTA 1G5HA 1TDJA 1OD6A 2VZ8A 2OQVA 3WGKA 3A11A 1UOQA 4K3VA 4GZLA 5DK4A 2A58A 3OHSX 2E4WA 1DQPA 4D9EA 2X4LA 2QT0A 3ZZMA 3DGFC 4Y2SA 4J2HA 3RC9A 3H99A 3KZVA 4C8GA 4LWPA 4YCMA 1PDOA 1QVVA 4L5CA 2XBMA 2RHWA 3CRRA 4OEHA 1UWLA 1XD2B 1YI1A 3P94A 2CCGA 3VYTB 4LJ9A 3K4HA 1Q50A 2ZYIA 3GVXA 2OG1A 2JFUA 3I3SR 1GYRA 4P81A 3WYBA 1OLUA 2P9EA 3Q0EA 3TFWA 1I32A 5KWEA 1XA3A 2Y1DA 1NMQA 1WQ3A 2LKCA 4PAWA 1JIXA 2HMUA 1U3PA 1S7GA 4AO6A 4LJKA 3RE1A 2DZDA 3KYCA 2P6PA 4EKYA 1A71A 2QTLA 1RHRA 3R5XA 3IQGX 2XF8A 2LDXA 2UYKA 1OXSC 4GX0A 4L8LA 3R77A 1AV6A 3VU1A 1U1IA 3RS0A 2AXQA 1JJFA 3B3GA 5JATA 1KZGB 1AZTA 1MV5A 4EO4A 1SQ6A 1XR3A 3U9SA 3NZEA 4WCVA 4DKJA 2QEQA 4GT1A 4JT8A 4D6XA 2YWGA 3EZ2A 5E4YA 5TGTA 1PQUA 1CJBA 2HCJB 5IW8A 5HCIA 2VUIB 4II7A 5H9VA 2P3OA 1WD7A 1GNTA 2YDYA 3VDQA 3P8ZA 1TU3A 3HG7A 2DETA 5T57A 1GQQA 3L02A 1QFSA 4W7IA 2IH5A 2P9GA 3GRYA 3M6MD 3Q3HA 3EGDA 4P7KA 2BTQB 5ICFA 4ZWNA 1VLHA 2WD7B 3DKPA 3I28A 3AV3A 1G8KA 5TVGA 2HQ1A 4DJ5X 2BCGY 4C0SA 1HNXB 3G1TA 1HYBA 1E9FA 2Q5OA 2VUTA 3GAAA 3NTOA 2WJPA 5EZSA 4DWWA 4F2HA 2A88A 3OP1A 2YVAA 1NXVA 4PQRA 4DIMA 2GFHA 5LL6P 1COMA 4R98A 4WY8A 4C6SA 3DOJA 3M2TA 3TI7A 4G4WA 3N2NA 3HCPA 4DR3B 3L5KA 3UAYA 1R6XA 2HJGA 2HPVA 4PBSA 5K3CA 2NZWA 2EXXA 2QTNA 2IU4A 5IJXA 5DZSA 1R88A 1PRYA 4JIMA 3F73A 2PKYX 5I5GA 1E4EB 3HCDA 4EZEA 2CXSA 3OX1A 1E3WB 4BFTA 1XQ9A 4DCOA 1W5SA 2VF2A 4GVPA 5HDBB 2TSYB 2OBMA 2VBIA 4AMGA 3QKRA 5JZOA 3LHFA 1CUBA 3TIIA 1Y9DA 3RYIB 1YUNA 2QL7A 5CM8B 3ELDA 2I5PO 2IPMA 3V1KA 1BHSA 4M99A 1LSOA 1ST2A 3MCUA 3NDPA 4RV4A 4B32A 1P60A 2XCUA 1EWKA 4P4TA 5A4IS 5HJ5A 4PC1A 3CPHA 2F8LA 2NVWA 1PV4A 4CF3A 2QAJA 1U6IA 4B1FA 4C03A 1UBSB 4W99A 1IZ7A 4BOYA 3WAKA 5FWXA 5ALDA 3EJWA 2EJTA 1GJRA 1HGXA 5DBOA 4ND2A 4RJLA 4WFIA 4EJSC 1PR2A 1P2GA 4EEKA 5FBQB 1QBKC 3PQ6A 1SOMA 3H0KA 1SCQA 1SVKA 4ARIA 1KOFA 4WXHA 1M75A 1T36B 1C9DB 5ITWA 1DT3A 1K5HA 1UFQA 3I5XA 4CEIB 4B5CA 1MTZA 1QF6A 4ZO6A 4L9RA 1DV2A 2WYUA 1S2GA 3LQRA 4M1TA 2SCUB 1AA9A 4L5BA 4MPPA 5A5GA 3HRIA 1N4DA 1YZLA 2JFXA 1AG9A 4OXQA 1M7GA 1AY0A 1MAHA 4XCXA 3P0IA 2DQSA 3PQ5A 2H5IA 5KVQA 1TTQB 3TTWA 1BCRB 3UCFA 3WGOA 4QM7A 2QV7A 3T52A 4D0RA 2BELA 1FBTA 1UT5A 4YMHA 2XUZA 4ZVPA 4DDKA 4DCPA 1KMCA 2CLHB 3V3TA 3PDJA 1YZKA 3MJHA 3VHLB 2Q27A 1FYFA 5HE8A 2UUCB 3KBOA 4O4LF 1LPOA 4OH1A 3ZWAA 4W5QA 3ONVA 5G53C 1JLSA 3GAMA 2I6RA 4QNNA 1ETHA 2IGTA 4LZOA 3IS3A 5CIQA 3C8LA 5A5FA 2OMKA 2X3FA 3M89A 4KQHA 4DB4A 3JQGA 2P6YA 3KXDA 2ZBQA 3HKCA 1DPFA 5AVTA 2PX0A 2XVYA 4JJ7A 4L2IA 3FZQA 5D84A 1K9MH 2C9ZA 2XMZA 3GDFA 4W7SA 1CUHA 1G20B 1KQPA 1ZMBA 1R12A 2JJ8A 3PVCA 5JY6A 4NFHA 3UJAA 4B2YA 2VNAA 3AF6A 1KHTA 3LXRA 4FSXA 4G56A 4N54A 1AMNA 3J81A 4MJLA 2B34A 5DIZA 1N3BA 2BW0A 3P9SA 1CB0A 3GZNA 3DAHA 2PIAA 1U9ZA 1NJ5A 3EEIA 3KJQA 3W7BA 4YMTA 3RJ5A 1YH3A 4RU1A 4EYGA 3D4LA 2J3QA 3ZXYA 4DR6B 1SK9A 1EQUA 4TSFA 4ALNA 5DYTA 1BOOA 1GO2A 1GSOA 4GWGA 3LUKA 4HYQA 1VECA 2YVUA 2YXEA 3CX8A 5DO9A 3ILYA 5HGJA 4DG5A 3DDCA 2FPXA 1E2FA 1HSOA 1JBEA 2R8BA 5EPEA 3MMXA 3R0PA 5L51A 4E5PA 3RR2A 2AMTA 2C95A 3G8AA 4XIJA 3WJAA 3L01A 4H7PA 4B3FX 7AT1A 3QUWA 3BICA 2PO7A 1IN1A 3ISTA 3TMAA 3ZJTA 1WTCA 1VDZA 2GHTA 3VGPA 4PRKA 4YUYA 2B6HA 4BT5A 4YO7A 1P5FA 4IDBA 1UZAA 5CBPB 2VKQA 1FXWA 2ABWA 1EHCA 1R10A 3IPCA 3SSMA 1DEOA 4HF7A 3ZGXA 2Z0MA 4G4IA 4PX5A 5B3JC 3ZWNA 4ECEA 2WEKA 1UINA 2NO9A 3M1XA 3FPBA 4DLRA 3KDPA 5CGQB 3GHYA 1V9SA 4J1NA 4LG1A 5AW6A 4TM7A 3S8EA 1ISHA 1BMFA 2OCIA 3T35A 2XTAA 4QPJC 4UHJA 2VZEA 3AF2A 3HV0A 1GHTA 4MWGA 5AW3A 2HZ7A 2MQEA 3DLTA 3WX0A 4CIWA 5J40A 3BDIA 1DIOB 2P1ZA 4MV7A 4NECA 1EXWA 2PX3A 2Q1UA 4UC0A 4Y0AA 1OAAA 2Y3IA 4BX8A 1XF9A 1OREA 1VJ5A 3GCGA 1BDHA 3EUEA 3W3AH 2C5AA 5B58T 2AVNA 3D3QA 1OX4A 3IILA 4W8GA 4XASA 3R9KA 3S40A 5HZGA 1NT4A 2N48A 1XMJA 3CN9A 3TQCA 4X24A 1W8IA 4TMKA 1IXKA 1WNFA 2Q8PA 1KMNA 2ZUFA 1LQ2A 2QTMA 3TSWA 1DT9A 4K6FA 4JLAA 4HEA1 1F3LA 1HDOA 3MGGA 3BRWD 1MDFA 3I37X 4PAMA 5AVXA 2OB2A 1KK0A 1L7AA 3K09C 1B74A 4LC9A 3IKFA 1U2SA 1YJBA 2RHRA 5JRJA 3FPAA 4GSKA 1IG0A 1MJHA 5K0CA 4BBAA 1BX3A 1V7ZA 5C1DA 1TD1A 1JHZA 1AUXA 5HFNA 2BGIA 2NVOA 3NASA 1IQUA 3N8IA 2UYHA 3DUFA 3ZCUA 1NWHA 2V7BA 4J0DA 2HP0B 1W4BA 5K3EA 3F47A 4BVFA 2F43B 3T06B 1VHQA 3FKSA 5JSUA 1FXUA 1RACA 1VE6A 2H4FA 3DSRA 4OGWA 4PBTA 5K4HA 3FNEA 5LP6B 2NSDA 2QTZA 1U8YA 3G0GA 3OT1A 5C5EA 1KYTA 1ZUNA 2H1SA 4I9GA 1QP7A 1MA3A 2H16A 2AIZP 2IYRA 1W2WB 4OB7A 3I9JA 3GWGA 1CNMA 4REQA 4IKOA 5AM2A 2Q1WA 2C20A 3JVDA 4IVNA 3WMRA 4C01A 1UMBB 1RBYA 3WDKA 4U39A 2VJDA 3PG5A 3UMFA 2KTVA 1TTHA 1V4VA 3P2IA 1SPXA 3WFJA 4DV5B 1YDFA 3WNQA 4HBZA 4I50B 1YRQA 3IVRA 5JVDA 1U7UA 4GD3Q 4E6EA 3CFYA 2H2IA 3PRKE 1NJ6A 4C4XA 3ZUPA 1HK7A 2G40A 3TI9A 1JMVA 3PNQA 1YTLA 3IBYA 1C0PA 3KQTA 3BGDA 2H48A 3FYDA 1YL7A 3MBIA 1B3BA 1L4YA 3HGQA 3PEVA 4UBMA 3Q98A 4JJIA 5FRDA 3OHPA 4CW7A 3IAXA 1ISGA 3HXOA 1XCBA 1GA4A 1W96A 4GMDA 4KXVA 4EW1A 1ZXXA 4QSMA 5FL3A 2TRSB 5JIBA 4DQVA 1A8HA 1ZICA 2GF9A 2OVBA 4PNPA 3TWOA 1NVKA 1H2FA 1KJZA 1NVXQ 1E4EA 1MABB 1T4MA 2GVIA 3L0PA 3QVTA 5KNCA 1M2OB 2JVIA 1JU4A 1QXSA 2EG9A 3KKQA 4WLVA 3A8TA 1AUOA 2JGIA 3HDYA 1RMQA 4U2KA 4AZ0A 1UQRA 5KYUA 1T9ZA 1IRXA 5CNMA 2A3NA 2DUNA 3QA9A 4HL6A 4RVNA 4W6ZA 2O1SA 4WNYA 2H8EA 5TGDA 3SQOA 5J1SB 1PNRA 2KS6A 3T9BA 1FVHA 4UAUA 5KX5B 1BMDA 1T4CA 4R3UC 1Z8HA 2NSLA 1TVCA 2X2PA 3L6UA 3LX5A 4IJQA 4JI4B 3HPQA 3JTMA 3ABRB 5KMGA 2I6SA 3T5BA 5CA0F 3N58A 3J80M 1W36C 2XKJE 2Y1FA 3FMVA 3WYFA 1F60A 2NXEA 3D31A 2GNPA 3B1JA 2DKNA 1BCSB 3IUNA 4RNDB 3TB6A 3W5JA 4N7MA 3M5CA 1I0IA 4G2NA 1YB7A 4E13A 1VQOF 4NMHA 3IEXA 4ER7A 1EUDB 3VPXA 3S70A 4UBOA 4CMJA 3OOWA 3PDHA 4OJYA 1IU9A 4IJ5A 2HRZA 4AMUA 1SUPA 4CPDA 2CDNA 2HEGA 4KR3A 1M33A 1QIEA 4KWHA 3A1DA 1OFIA 3AFOA 1T3HA 4QRDA 4TWBA 4WACA 1RLJA 2UV8A 5JS2A 3KHKA 4E5VA 1E1YA 2AX4A 2YBEA 5I47A 1W49A 4KLNA 4C0AC 1F4PA 3A4MA 3QTTA 4OAOA 3FCAA 3NIBA 4YRAA 1RXWA 3TVDA 5A0VA 1XX6A 4MV6A 2XMPA 1FRFS 1R74A 1X8LA 2EKPA 3KQOA 3AINA 4P0QB 4DIKA 2B8JA 3M0EA 2HFJA 1YXMA 5B4UA 4YR9A 5MDHA 1I9GA 4XWWA 3CW8X 4YGYA 3ZV3A 5IRCD 5C4GB 1RVDA 2C42A 1VSBA 5EZ5A 5TVKA 2Q5JA 2VJYA 3WLKX 3B6ZA 3HDGA 1PJLA 4QARA 3IUPA 5F78A 2IZ0A 3EBLA 3ZHCA 5LQCA 3SWWA 3ENNA 1Y6QA 3H83A 5KQSA 2AMVA 2DBRA 2Q1XA 3P71T 4WXMA 1W8DA 2ZUCA 1MGOA 2NQ8A 3CRVA 1ETUA 1U2DA 1Z37A 1WMFA 3TNFA 3OJXA 4FR5A 4O1HA 5DHQA 1ANKA 1QLWA 4ZU1X 1Z8DA 3PNMA 4S1VA 4CYMA 5TMPA 1IM8A 1JFFB 2GN9A 3ZHYA 1P3Y1 4OLJA 1XB2A 3BJEA 3GJZA 5HHTA 4MV4A 2GS9A 3OKFA 2C4HA 1JHYA 1RWMA 1NW7A 1GTMA 1D1PA 2V3CC 4N3CA 2AWOA 3GMTA 1CBUA 1UWKA 5CCBA 4BQRA 5C7LO 1W44A 5SZHB 3UWMA 2AFIB 1LRLA 4J6EA 2ZZNA 2J32A 4ARZA 5EG5A 2G28A 2QE6A 4QJ5A 4MKIA 4PO1A 5CCEA 4MS3A 4BLVA 3WAJA 5BSTA 2WSYB 3VYSB 4A03A 1P5JA 1QHXA 2IEAA 4N7BA 3B6EA 3NBMA 3ZU6A 3CNHA 1Y63A 1E9AA 3GFGA 5IF3A 2WVJA 1YULA 4J1TA 3MLBA 2XX3A 5IAJA 1O9HA 4Q0MA 4OBXA 3DCIA 3ONNA 4MW4A 1IVNA 5HUHA 2EBFX 5CDFE 1PWYE 3ZP4A 2J07A 3E15A 3OTWA 1M83A 3QBDA 3IUQA 4BNWA 2XVAA 1ZR4A 2NV2B 8OHMA 8ADHA 1QLHA 1RM5A 1Y4UA 2FSGA 2Y2VA 2MT9A 3FDZB 4OFWA 3AVPA 1T5DX 3GRVA 3VR0A 5AJTA 2GD2A 3DR3A 3WZLA 1NRWA 3RDPA 1G21B 5ADUS 3GJTA 3FUXA 2NUPA 4KR2A 1VB3A 1AU9A 3I9FA 5MN6A 1RABA 5CM9C 3H9CA 4U7DA 2D0OB 4WN9B 1QG2A 1WPQA 3WK9A 2WA1A 2CHFA 3D1JA 3LUBA 3MTIA 5AXBA 3Q15C 5FEMA 1GKUB 3TVYA 3LYUA 1E18A 2W71A 1EUQA 5THQA 4O0LA 3N4YA 1U0RA 1TQ8A 2HK6A 3C3BA 3IMFA 3NQ41 2IV3A 1OLSA 1NTOA 2JI8A 4I1IA 4FDUA 1ZL2A 1A96A 3BB4A 2AG1A 1G5IA 1RW4A 1SRQA 3H5IA 1UKYA 1X9GA 1GUYA 1VYHA 2OZLB 3TZLA 5LWQA 1AMOA 3E3MA 1IVYA 3QE9Y 3V9AA 1FCJA 1OU4A 2OZLA 3DE7X 2ST1A 3CJRA 3IPXA 1EHIA 4CKEB 1YQWA 5JMTA 1J5PA 3QMWA 1OWMA 3N87A 3WDLA 1AV7A 1H6DA 2PBRA 1A8QA 3HXTA 3U1BA 4CTJA 4K8OA 3HU2A 1YFZA 1OF1A 5IT4A 3CS3A 3RSOA 3GUCA 3MCWA 2PGNA 5ARCA 4HY3A 3MZ0A 2IU0A 4DXAA 4GDMA 1PGQA 3O2JA 5CJPA 5JSKA 1V39A 1YA4A 3NPMA 3PBKA 4D4LA 1Q6ZA 3T54A 2Q0XA 2OHJA 3SC3A 3T1HB 3SMQA 2NTVA 4L07A 2XXAA 4JB3A 3FYSA 3SE0A 3CIOA 4EKDA 1R4NA 1JHOA 4B8ZA 3RBVA 2F9MA 2ZKLA 4CN9A 1OFHA 1V5IA 2GCIA 1ISFA 1DXYA 1KGSA 3H11B 3SYTA 4URWR 1P77A 1C9EA 1TEHA 4MMYB 3D7NA 5EWJB 1ZVJA 2FX3A 3H1FA 3UFBA 4DLNA 1Z83A 5FP0A 1IVSA 5EZ6B 1AGYA 4PIMA 4B4OA 2IGBA 2Y8EA 1M6HA 3LBFA 4UREA 2IS1A 3F5QA 3FLMA 3PC3A 1H2WA 4CTNA 3M6IA 2C7PA 2UZ3A 2GJSA 1FYDA 1LRJA 4LOAA 4N49A 3K6JA 4MWOA 1Y37A 2D2IA 4JK3A 4G5HA 1E9CA 1JZTA 1DFHA 1JQ5A 4PZYA 2NGRA 2X8JB 3FYUB 3ZBQA 3K8ZA 3ZK7A 4JP8A 3W4IA 4F3TA 1XFDA 2FX2A 4PTYA 3QF7A 1PZMA 5CFLA 3G02A 4YQZA 4FUQA 1S96A 3OF3A 4UVEA 4HB2A 4HN4B 5H3HA 4TTQA 4TWAA 5B4TA 1L5GB 4JL5A 2P1RA 3JD0A 4ZJUA 1IXRC 3L0IB 4GP7A 4LVCA 3C9SA 4YCBA 1LLDA 4MWSA 3UAVA 1CF4A 1NDQA 5CU7A 3PS9A 3WHPA 4I1PA 3ILVA 1OWNA 4YAEA 4NZNA 2LBTA 3I9KA 3NRJA 3T7CA 2IHUA 2XGJA 1XZGA 4C1NA 2I8LA 3ISVA 3QOWA 3DOEA 4Y7CA 3PGKA 4X97A 5DT9A 1WZEA 3AC0A 3FH0A 2AR9A 3ZX5A 3N8GA 4AJPA 5CLJA 4YCJA 5DHSA 3DPUA 3PNKA 2PJZA 4RKEA 2E1RA 1MR3F 3A6FA 3GPCA 3MWEB 4QPNA 2VWPA 4RORA 3VM6A 3W78A 2V0GA 2ZS8A 1A5SB 1R1MA 1CNEA 1U2DC 1QKIA 3A2NA 3DBHA 3ETJA 4HDNA 4YDSA 5EE3A 5FHQA 5TPWB 4MARA 4MGKR 4YCSA 1QQBA 1J49A 1Y81A 4GU5A 4I4CA 2C82A 4DRXB 3HU1A 3OPQA 4FMPA 2W43A 4JODA 4X3OA 4QDZA 4R5HA 5EJAA 1K2VN 4PAGA 5K3DA 3ETNA 3O9MA 3C74A 4QU5A 2OVFA 5U1PA 1SBCA 4QG3A 1XWFA 1JRLA 3R8XA 2XMRA 4ZZ2A 4C7VA 5IUKC 1AKRA 2GZ3A 2JFHA 3V4PB 2ZFUA 3CCUF 1W9HA 3CH5A 3ESXA 1TZMA 3HEBA 3ZU3A 1YASA 3PWTA 1HZZC 3TLMA 3V4VB 1UT6A 2HXYA 3EB9A 4DSAA 5IDWA 4HN9A 3HJFA 2VAVA 2G5TA 1P61B 1SIBE 2E85A 1YRLA 2VP2A 3EHDA 3KO8A 5TC4A 3U3RA 5B64A 2DU8A 1DHTA 1DRJA 1ZD9A 3AL2A 2ZRLA 2P3LA 2PWZA 1EZ1A 3CRW1 3GVPA 3JU3A 4WNCA 4EB6A 4QYSA 1MQSA 1E1RA 3INNA 1UK8A 2GWRA 2J3IA 2H3HA 5KNDA 1SEPA 3DE4X 5JZVA 2QQ0A 3IDSA 2EF0A 3G6EF 1PZGA 3U4AA 2PUTA 1UOPA 2GEDA 1USUA 2XUIA 3COWA 4RK4A 3WKAA 1Y9JA 4YECA 2V54A 1VFPA 3W8RA 4OHOA 4BDSA 5IVIA 5L7YA 4JXZA 1G3IA 3UJ7A 2DUMA 1U0OC 3SBXA 3W5IA 1JDZA 1Z9BA 1OYYA 4YP6A 2H5EA 3C7AA 3OCZA 4V0RA 1XGKA 1JVNA 3OQHA 1PVVA 2VHVA 1YI2F 1ZNWA 3BK2A 3O4FA 4K40A 2AQKA 5CT4A 5JAZA 5U4QA 5TIIA 1Q11A 2PWYA 3MOGA 1DCKA 3BG5A 5LA6B 3DAFA 4PRLA 4K6HA 2IVZA 1YQNA 3BVPA 3IT3A 4MA0A 1A9OA 1WTAA 1VG0B 3N2GB 2OY0A 2ZJZA 2ZJFA 3O4GA 2ZVDA 4GQBA 4Q4AB 5GJVC 3UJ8A 2CKDA 3JZDA 2G80A 3NDRA 2W2LD 4LJYA 3N2GA 2VZLA 5IK2A 2WPDD 3F3SA 4FWTA 3DCYA 1OASA 1IQPA 3PFIA 3QXSA 1O87A 1YVDA 1ZU5A 2GK7A 4TLCA 1X1TA 1V1MA 4GKAA 5HXAA 2QOEA 4EHJA 1QH8A 2W11A 4KBYA 1FFXA 1NVFA 4TXNA 3R9XB 3AY6A 3PUIA 2A0FA 3A4LA 3I53A 3R9XA 3K1TA 2ZUTA 1KY2A 2O50A 2FR1A 4L6CA 3HUDA 3NWBA 4ZVTA 1LNQA 1O2DA 3PK0A 3BHJA 2NU6A 1P1RA 4K2AA 1L5FA 3K9GA 3SQDA 4DSUA 1TUIA 1JLLB 4GLOA 5KTPA 1POWA 3WP0A 4TS9A 2JKZA 3IVGA 4P7JA 5D3QA 3EPKA 1GP2A 3WNDA 2CE2X 2DGDA 1YIDA 1QHGA 4MVWA 1SM4A 1VJRA 2JIDA 3LW8A 3RVNA 3DF9A 1AKEA 1HRKA 5CT8A 5B57C 1L4BA 2FB9A 3B5JA 4MYSA 4ZTBA 2V5UA 3K3PA 1DKUA 1NW8A 1V1JA 3B2EA 2H9YA 3ENVA 5DW0A 4ZDJA 1MHTA 3A6DA 4NMXB 4NYJR 4NQRA 2V96A 2VRBA 1I7LA 3EXHA 4JP1A 3RG2A 5CG2A 1E5XA 1IBCA 2HQSC 3K0EA 3JAKB 1TJNA 1YZTA 1GGFA 2WT9A 2R8PA 2D1RA 2CHVA 2QD4A 4O5OA 3A9TA 4Z54A 1ND5A 1R6VA 5ALPA 4E4TA 5FNVB 4DC0A 3WYEA 4UARA 5EMMA 1GGMA 3HXLA 4DY4A 1ZOSA 5G0SA 5A06A 4JGIA 4NBTA 5JD5A 1JMYA 2ZWAA 1PKEA 2QXTA 4M1OA 1E8DA 4UBLA 3TRDA 1R50A 4L75A 4BNIA 5I6DA 3WC4A 5ICMA 3E4DA 1ZLYA 4U2GA 2IY9A 3PHGA 3GZJA 3D8BA 5IC6A 1QPZA 5LU9A 3TJZA 2UZHA 4AF8A 3HYNA 4RQBA 1YB2A 4OI2A 3TD6A 1E2IA 1KQOA 5F9MA 2HSWA 3VU8A 4BFSA 2PNJA 1WUJS 3HB7A 4ZT2A 2YN0A 1B8UA 4PLFA 4E08A 1M2KA 2AK2A 3IGFA 3VO1A 4OIMA 1KI3A 1ZD8A 3AETA 1FNBA 4N03A 3HTXA 1R00A 2A9PA 3ELBA 3ZI4A 1VCIA 4CKCA 3TLXA 1ODEA 1S8FA 2VQ3A 4WKNA 3X1YA 4WK2B 4ID9A 4QDJA 2ZYUX 1AK1A 3NOQA 1G1MA 5DGXA 3A3NA 3HUEA 3N2YA 3FPCA 1FA9A 2NX2A 1W59A 2B4YA 2C7GA 2QSUA 4R7TA 4UMVA 4C89A 4LYHA 1N9GB 2OTJF 1YSCA 4OHYA 1PE0A 1CZRA 1SVNA 1IOWA 2VXBA 1NVVR 3H16A 1TEZA 3H2ZA 4PNEA 3PDUA 3C6MA 3T7KA 4E12A 1C8KA 1NBME 3MCAA 4QUAA 3HO8A 2DERA 2XNDD 1YRHA 4P5DA 2CE7A 2I78A 4JELA 2ZYTX 3UVEA 3W6UA 3WRXC 1TVEA 3TCXB 2FC3A 3IAEA 5ALTA 4MUIA 1XHOA 1D6NA 1D03A 4NPHA 2Q9CA 1TRKA 3VO2A 1KARA 3PIRA 4C76A 5EXTA 3ZQUA 1ADJA 3FMIA 3C5VA 1EFKA 1TM7E 4BECA 1FFBA 3WMWA 3HJBA 3LWQC 1BX1A 1E92A 5ERYA 4F45A 4CTMA 4PZLA 1KEEA 4NDNE 1KXZA 3RASA 5L6LB 2QRMA 1Z2CA 4A8JC 4K0RA 3KVVA 1YBHA 4U9IS 3IMKA 3ID6C 3G9QA 1RWVA 4MVJH 2XHEA 4XJVA 1CLIA 3IR9A 4DM7A 1JZSA 3D3NA 2JARA 3GAFA 1UOEA 1WLYA 1XAIA 2DPMA 3KQQA 3KZ1E 4RENA 3EBOA 3RUHA 2FUEA 2GO1A 1XQ1A 2YW9A 4HPJB 2DJIA 2H1RA 3Q3CA 3VI4B 1LTQA 5FUQA 1QF9A 2XDQB 3P0FA 5EGNA 2OYRA 5HWEA 2JRCA 4JP3A 2A9FA 5CLLA 3WADA 4AYTA 4D74A 1MIOB 3H4MA 4ZEOA 2Y4OA 3RYHA 1FP4B 2AWNA 2AXPA 3FD5A 2G5PA 1V35A 4E3ZA 2CLCX 3VTKA 3CF0A 1LPPA 4R1PA 5HWSA 1CJUC 4HWKA 4KQWA 3OCVA 1ZLXA 2B8TA 5KQRA 1BXRA 3BWVA 2Y1LA 3F49S 4A16A 3K9HA 4Q7MB 3TM5A 1EDDA 3A3KA 2JGDA 1F51E 3ZDZB 3I2HA 2O2DA 3T3MB 3WXMA 4ARAA 3E7WA 1NHGA 3F9IA 1CQPA 1X19A 4LYYA 4WOBA 3PXEA 3S2SA 1PUIA 1JEYA 4LWZA 4MDEA 4ZAWA 3PHJA 3ZJYA 3GJXC 2CNWD 3EUAA 4R4JA 4LFBB 4U7GA 4TV8B 4QFDA 4TMXA 4PNZA 5A2GA 2GZ1A 3KYCB 1NXQA 4DA4A 5CVVA 1DRUA 4F9TA 1NUPA 1Q3TA 3I6QA 3SU8A 4P31A 1UPAA 1EK2A 4FYWA 1QHEA 3PDWA 5AT1A 3SJUA 4QFCA 3V4OA 3BN3A 1B0AA 2GM5A 2WAOA 4LOJA 3DAYA 2R6DA 3EGOA 4LS3A 1KAMA 4LXUA 3NVKI 1VQLF 2RJOA 3MCVA 5DLEA 4BGIA 1W75A 3DZDA 1TU4A 1QIIA 1UJBA 2C96A 2PXCA 2FDXA 2PSEA 2HC9A 4YR7A 5ESRA 3NHWA 4MI3A 4ME6A 2FVXA 2WY2D 2XADA 4Q3BA 5AW2A 2YOFA 5DTJA 2L26A 1P2BA 4RVOA 4BNFA 1M1XB 2GWHA 4J90A 1TPYA 2JAQA 4Q3NA 2RI1A 4CM4B 4NEQA 1OXBB 2WD7A 3LXMA 1O0SA 1VJDA 2G4LA 5GANK 2ZOSA 1BFUA 1ZESA 3LVRE 3MCQA 3TUIC 3VPFA 4REOA 2CV0A 1QE0A 2CLFB 3N0WA 3GYQA 1IL0A 3PF8A 1C1XA 3BWBA 4F2PA 1Y80A 1KR5A 1UXKA 3QUBA 4ALMA 4AJJA 1Y9ZA 4ZI7A 3QBTA 5HY2A 5A04A 5E7IA 1NUAA 3E8XA 5IBPA 5G41A 2MINA 3LDUA 4X6LA 3JQFC 3NB0A 1AUVA 2A59A 5K3FB 2PMPA 1UP6A 1ZWKA 1G9XA 2AX3A 2FMKA 4C4TA 4MRMA 3QKUA 3WRYC 4B3JA 3LG2A 4Y6OA 2CL7X 4WNIA 4ZVOA 2BCEA 4QTZA 2PPVA 2D7CA 4F2DA 3PXDA 4K6KA 1Z75A 4GI7A 3SD7A 4JBHA 3ECCA 4FB5A 1U90A 3QPCA 2DKOA 4AMYA 1JR3D 1VL2A 1WAMA 1U28C 3K20A 3IQFA 1MAVA 1BQEA 1BWQA 3D7RA 1XKLA 2QTWB 5CT5A 5B1DA 1EHYA 4RIIA 4X62B 2PKCA 4HRAA 1UAAA 3A4IA 4JI8B 4CEHA 3IKMB 1P0FA 3T9FA 3R3SA 2A67A 4QAJA 4ED9A 1UM9A 3K96A 3DZCA 1X25A 2CVQA 3JQBC 1USIA 2BRUC 3LAWA 4BO0A 1HEIA 1YT5A 3IIIA 3Q3EA 3RSSA 5KVAA 5KJEA 2JAWA 3UA4A 4WOKA 3AR9A 4F6RA 1H2EA 2FWNA 3K8OE 1GRVA 3T3HA 1U8EA 4DGSA 1TEVA 4XJSA 3TGWA 3MXOA 1EQ2A 3A1CA 3PITA 4WXEA 1J8QA 2VF5X 4PLCA 16PKA 1TECE 5LYJF 1EGMB 4AY6A 2F8TA 1CEEA 2ID8A 5JBQA 2H8CA 1YAHA 4DYDA 2ZRFA 3DHWC 1I7NA 4GKBA 3HB9A 4QYIA 4Q7LA 1FPQA 2H2DA 2Y6UA 3QV2A 1BE6A 2GN0A 1V4BA 1K7SN 3U4GA 2JW5A 4LZWA 3O4JA 3JVEA 3LBAA 3B53X 1PF7E 2DFLA 3AHHA 4MP3A 4X95A 3F6YA 4P9NA 4R1LA 2CF6A 4GMFA 1B23P 5JRDS 2C5BA 4OQZA 3S02A 4PYRA 3RAPR 3I01M 3LL4A 2QMEA 1UZMA 5KQMA 3N2KB 2BUAA 4L7QA 3UB2A 1XYGA 1PVDA 1ZSNA 3CG4A 2UXBB 1VKZA 1CXZA 3FUWA 2WLTA 3OJLA 1JLHA 2PSSA 2ZROA 1BEEA 3ORHA 1DQSA 2VNHA 2I2FA 2VXCA 4PE5B 3CC8A 3FF1A 5JMWA 2JHGA 4G1EB 4IS2A 1UK6A 3SMVA 5E4JA 5CH8A 3X3HA 1NOKA 2X3YA 3HHPA 3ZTWA 2W8BC 3DC7A 2CMHA 3CE6A 3SHQA 4EJSA 3ZE1B 5BPFA 3ZD8A 3QEAZ 4BMXA 1RPTA 4JBLA 4KN5A 1KEKA 4YH1A 1RAHA 4MUYA 1OXKB 4OBWA 1VPWA 4O2AF 1F2UA 1N1MA 2J5XA 3E7PA 2BYTA 2GLUA 1AOXA 3ESBA 2QTRA 3JZMA 4Q21A 1FUEA 4BZQA 4C7MA 1QU3A 3ZV5A 2JLCA 4JJEA 1C7EA 4X44A 1E6KA 5CA1A 3HKEB 2FK8A 5DX0A 3NK6A 2D3TA 2JFPA 1VM6A 4FGWA 2D5IA 1XDGA 3MCAB 4MGIR 1I9CA 1NZDA 2C8KA 3AG5A 3GLRA 1C7JA 3NC1C 3C3PA 3TYXA 3GUZA 4FSDA 3E35A 4PIVA 3ICQB 2HRCA 2AMFA 4TMFA 2B7CA 1PL7A 4QTXA 5TNXA 4UMDA 3S0HA 3QHDA 1LK7A 3BKWA 1RJDA 2QB5A 2EAUA 5KTYA 2C9YA 2XODA 3DL2A 1CPYA 4A6DA 4EX7A 3L07A 1C4OA 5L4LA 3IIKA 1AO0A 1RWQA 1SBNE 2ZVYA 1VLQA 2XE6A 3QKTA 3PTLA 1UEXC 4NR0A 5KYXA 1E1CB 2ZZKA 4JU8A 4RGYA 4NABA 5JS8A 2B92A 3A31A 3IRUA 5D01A 4OY3A 1J7JA 2OA0A 3ZGLA 3MUOA 4YRRA 5CB0A 5IZ4A 4NXMB 4F3RA 2O48X 1RC0A 3GEGA 2HJHA 3NC4A 4P4LA 1P74A 1QC5B 2JCSA 4US0R 4Z3DA 2ONZA 4OHCA 5G1OA 2NIPA 1YQ9A 4DABA 3LOQA 1ZO8A 1XCPA 2HHLA 3KZMA 2NW6A 3T7RA 3TOCA 1FP2A 3KSMA 4LKOA 2JA2A 1N36B 3N0VA 2HB6A 3K7EA 4MWDA 1GG2A 3X0DA 4KGZA 4EB3A 2EKDA 2P77A 4HDSA 4LNUB 2J0VA 4RFVA 3MWJA 1WY5A 2RG7A 2EDAA 2QBYB 5C5DA 3WIDA 4HDSB 2FPIA 1Q21A 2BJWA 3QVXA 3IT2A 3D4PA 4O8ZA 1ESMA 5A1JA 5C8DA 3A6EA 5C1PA 1E5TA 2YXPX 4HMOA 1YNOA 3G2KA 1Y9AA 2PV0A 2WIDA 4KRGA 1Z0JA 1QGOA 1PK8A 1W0JD 3QLVA 4ZI5A 3HYTA 3KZCA 1U7DA 4A4DA 4WY5A 1EE1A 4KFSA 3I1JA 4OG2A 3PKZA 4FYPA 4AF6A 1Q16A 1YACA 4WCFB 3UF0A 2BFFB 3THRA 5ELXA 5LZ5A 3MRVA 4IXWA 4MTLA 5DNUA 4GPTA 2JIMA 3RAEC 3H1AA 1JQDA 2XXBA 3GP8A 3AXTA 2Q6KA 3MJ4A 2OV1A 2WSBA 3OOYA 3KJGA 1ZP6A 2DECA 1CEXA 3I9OA 4OATA 3S68A 1VL8A 3C6QA 1X8JA 4UCFA 1O9BA 2BTEA 2PLRA 2VDUE 3EBPA 1NF9A 1JDNA 2C59A 1XL1A 1QPGA 3PXXA 4KZPA 3ZW8A 1PN3A 1MOZA 4JIGA 1Q2UA 1HORA 1E3DA 3KL2A 5A7FA 2X5NA 3TH5A 4OFBA 1GKKA 2YMQA 3HWX1 3TNJA 3DB2A 1YU9A 1L7RA 2Y0DA 4XDZA 4NONA 1YC5A 2Q3BA 5A5VA 2IKQA 3QA3E 4MUHA 1V8DA 2C8LA 1K88A 4E21A 3GMIA 3OZAA 2O0HA 4JD5A 4WI1A 4AMVA 4DE5A 1JT2A 2PANA 4Q7QA 1ZN7A 4OHPA 5IHXA 1TAUA 1NOIA 1FDSA 3AEXA 4RSGA 3FMGA 4Q12A 3PTAA 1O95A 4BO2A 2Q2QA 5BRAA 3BD7A 3FAZA 2EF1A 2DUJA 3IPRA 2RAFA 1FDWA 1QBGA 3D54D 3O1IC 2V8OA 1TQ6A 1PHPA 1XLVA 1YR2A 3QMVA 4FN4A 1XMPA 4H6XA 4UEWA 3RT7A 3P2MA 3VHXB 5DDIP 1ZCZA 5KVVA 1L3BA 3JWGA 2YFYA 3LYAA 1DRVA 4X63A 3AI7A 4AJIA 4H4EA 3NW9A 2PHZA 3C70A 3FBGA 3OUZA 2IP4A 5AVWA 1EPUA 2BEVA 1ZBDA 2HLDD 5FBHA 3W4JA 4IIUA 3GF4A 3UK2A 3VR2A 4KE9A 4DDHA 1OT5A 3OE5A 4NLLA 1YJ8A 1R8XA 3W6NA 2WB2A 4AVYA 2ZKIA 3COJA 3FGZA 1YZ3A 2DFTA 4MUBA 4ZREA 1ODJA 5AKZA 3I9V6 2CEAA 5KX5A 1GKLA 1W5AA 4M8IA 1U3TA 2JGLA 1VP3A 1YVEI 4ND8B 3D6HA 3CVUA 1JE1A 3U31A 4TKVB 1NV9A 2RGCA 1XBTA 2A8YA 3SAJA 2P9QA 3HZZA 4Q16A 4A5OA 3PGJA 4X1YA 4F1WA 3CYFA 4EG0A 2AOTB 4DR5B 1QZZA 4RS3A 2J8ZA 4WZAB 4E15A 2X76A 2JVKA 1IZ9A 1Y5IA 1K1EA 2AOTA 3QHQA 4FONA 3T61A 1UOOA 5ITVA 1OVMA 1XL0A 2B4QA 3X2FA 3RV4A 2AR0A 2W9XA 4J7CA 3L49A 4PLTA 3K0KA 4P3NA 3L1JA 1SQSA 3WGUA 3V00A 1RLOA 1X7DA 1Y82A 4Q9JA 3V1TC 4AM8A 2ZCVA 3QE3A 4HWPA 3IOMA 2F48A 2JH9A 2IYYA 3OE7D 1OZGA 1I24A 2HDOA 2HPAA 4GE0A 5ALXA 2IE0A 2JHFA 3CEJA 1QQ5A 1GPAA 1RFGE 1XVUA 2GCNA 3A1EA 2RB5A 4GIBA 4PC3A 1BU8A 1YZVA 5GV7A 5JJIA 4Y2JA 1FU8A 3PSHA 3PVSA 5JDCC 3K12A 2EC5A 1MORA 3K73O 5LQJA 2O8EA 4Q4DA 1PNTA 2QRGA 3P4EA 3DLIA 2IX3A 5ER6A 2ZCJA 4K1XA 4PLVA 1JTFA 2IEDA 1QK3A 5LU8A 3HWSA 4PTZA 1T9DA 3CTMA 4ZT5A 3L2OB 3G0OA 2J9XB 4ZO8A 1QP8A 3D6VA 2KWIA 4U7JA 5JV5A 1T8TA 2FG5A 1JS1X 3BGSA 1UDWA 1RBQA 3O4VA 1Q7CA 4F4IA 1BVRA 5IKMA 3UC5A 3DWEX 4BP1A 3KDSE 1GO1A 3V8NA 2DLNA 3OWOA 1IB6A 3HJCA 4QRHA 5JANA 4MRRA 4CG1A 3EYWA 4LHSA 3SEQA 3ZXXA 1FUUA 2RFLA 3H8VA 4AKHA 3N2ZB 1JFFA 4CE6A 1XMSA 1ZI6A 4WLUA 1DDIA 2CMGA 3QYJA 4UQLA 1HFJA 1MUUA 1Z5UA 2I7CA 5LQKA 4JOSA 3LY5A 3EAFA 1QM5A 5FNVF 3V8PA 3ZY6A 4QQFA 1L5HA 4P34A 3CVOA 1NULA 4YBRA 2ENUA 2F9ZC 3FYCA 3ZWQA 1QDLB 1SBHA 3A26A 1NSFA 1T8WA 2E21A 1VIVA 4KIWA 4G4SO 2I3GA 4LRXA 4MS3B 5I3CA 1NP6A 4HWTA 3F4LA 1MVLA 2Z5FA 5FOVA 1ODIA 3KYDB 3RTBA 3L77A 4K9DA 3N4ZA 2O4UX 3KJEA 3TRKA 1V5EA 1Z6ZA 4Z9BA 1CS0B 4RACA 4H9GA 2FEPA 2IOFK 3B1WA 3M6UA 4LWQA 4IXNA 4DUGD 3FYUC 4KVGA 2HNBA 4BU1A 4DL9A 6PFKA 5F7XA 5FV4A 4C4SA 4WL0A 1K75A 1QRRA 5JSZA 1TZKA 3OPYI 2XYPA 4PHTA 5HOQA 3J80A 4K9PA 3AW9A 3FD8A 1H94A 2A86A 3RQIA 3NV9A 4GWKA 2YOGA 2JCVA 2J87A 1MXHA 4B6SA 1G5PA 4FZ3A 4Z9YA 5JZ9A 4TUYA 2MSWA 2ZIVB 2WUEA 3BXGA 2GFQA 3KUKA 4Y6RA 2ZK7A 2R8YA 4IZHA 1PEYA 5F7ZA 3RU2A 4URFA 5FLXM 1UFOA 1ZCJA 2RC5A 4EY8A 2A5LA 3AEKA 3KJIA 4NC9A 4JWKA 3ST7A 3STVA 3IP3A 4R05A 3ZEIA 1GT6A 2VNIA 2GEVA 1VQ1A 2FLKA 2Q1SA 3KQMA 4LZZA 5CD9A 3FR8A 2WRZA 4P8RA 3EVCA 3ESZA 5DHAA 5BN3B 1HYEA 2WHYA 1N1EA 2ZRDA 3QNUA 3I58A 3G8DA 1U2EA 5AKYA 3ZVMA 3FOEC 5HSGA 1RKXA 2FFQA 2Z1DA 3EULA 2G1JA 4C87A 1TMOA 1NFQA 2O5RA 1C41A 5CBKA 2Q21A 1TA4A 3WZMA 1QVRA 1C9MA 4BEVA 1AXGA 3ASVA 2DY1A 1XEXA 1L5ZA 1MVNA 1V95A 3A6HA 4LI0A 4RJTA 5IM4A 4D6PA 5JHHB 3BFVA 4AKEA 5K09A 2WF6A 2QLNA 4ZFNA 3WHKA 5H4GA 4C30A 3GWZA 2I2AA 4R3WA 2QSYA 2PXXA 1J7KA 2FVYA 1S2OA 3F0TA 2FETA 4F8JA 3KUXA 3LO5A 4ENSA 3PPXA 4LRWA 4MYRA 4JFAA 5DI3B 5EHZA 1HBJA 4NVRA 4OQQA 4B3TB 5JO9A 2X0DA 2ZPUA 3TQHA 4YMLA 2AW5A 2HJSA 2FYTA 4E2FA 1PYOA 2A1UA 3TZKA 1REQA 1OH5A 1Z17A 1HA3A 1KDRA 3THYB 3VYUB 1EX1A 4EBFA 4JBGA 4WT7A 1QV7A 2HNKA 3F5SA 4YC7A 3FDFA 3E18A 4UXHA 1DNPA 2P4HX 2ZR0A 4CF4A 1ZM2A 5DRTA 2B4RO 2FEMA 2FUG6 5FPPA 1LY1A 2PZLA 5FPSA 3OZEA 2Z58A 2CB9A 5I9BA 2F1KA 4XGIA 2BGUA 4B3XA 1OE0A 1S2LA 1PWHA 3WNVA 4P83A 3QVMA 3T80A 3CT6A 3HUTA 1IDOA 5G3ZA 3D01A 3WGLA 1OV6A 4KVAA 1JFSA 2H4YA 3WOHA 2XWBF 2NUTB 3K05A 3HV2A 1F1BA 1YOBA 3TNLA 1O7JA 2YZ7A 4ZVMA 2YKGA 4Q47A 4KXLA 4LYFA 3QXHA 2HHCA 1O94C 4NFYA 1B41A 2ZRHA 3RUPA 3WL7A 3UXEA 4BT2A 1F5SA 1NW5A 1WVIA 1Z68A 3GI1A 3ZGOA 4Z6KA 2YV2A 4QREA 4O1MA 2OHFA 1N57A 1Q7GA 3QE0A 2HA0A 4CFSA 4BE9A 1PJ8A 3QU2A 3CRZA 4Q66C 3VR4H 4RPIA 1D6JA 3TRFA 1W7AA 1V0JA 4JJGA 2HX1A 1AKMA 3R1IA 4X3MA 2VCHA 3PF9A 5K03A 1KQFA 5GIOC 2DBVO 1ZN9A 2HA6A 1KF0A 1Q1GA 1E6CA 2VPIA 2FAXA 3PE3A 2GYUA 6AT1A 1CUZA 1YQTA 2NWQA 1XZAA 3S2ZA 4DDWA 4C6HA 4ZQFA 1N1DA 2QRQA 3K1AB 1TJ3A 5AK4A 4DG8A 2FRXA 1JLKA 4R8RA 2W90A 4NX2A 1D0SA 2F1JA 3DR5A 4ZI2A 1Y8CA 1PFUA 1W3EX 4UCQA 3UYKA 2Z01A 2ZS9A 3C9RA 3A70A 1KAOA 4IO0A 3DBHB 4F4JA 4MQBA 1NLMA 1P2VA 4YT8A 2HX0A 1L7PA 2ON6A 2FPUA 2PQ6A 2R5FA 5A03A 3N5KA 4E70A 4A0QA 2J6CA 2GRAA 4YJDA 5GAPK 5B1HA 1SVMA 3VKWA 4YQEA 3P2OA 5BYJA 1SGWA 3V80A 5F3WB 3FPHA 3V2IA 1Y4SA 3F6PA 3PNBA 4G36A 3ZZ0A 5B1EA 2AZXA 4BEJA 1GGVA 1DBWA 5IARA 3B1VA 3FPGA 5JWOA 2B6NA 5L3ZA 4IF6A 5JJKA 2QUHA 3ETDA 4IOKA 1T9GR 3E3AA 1AC5A 4DDMA 3FI0A 3O6VA 2GM4A 3HAXD 1I4OA 2A94A 2IYTA 3CEMA 3L04A 3N05A 5BVGA 1JIJA 1N0WA 2FV8A 2O06A 4KH0A 5JWHA 4X7BA 3CMCO 5E2BA 4TV8A 4OJKA 2V7PA 4ZO7A 2BGMA 3W5SA 4CUKA 1Q0ZA 2XCQA 4MWZA 1ZOIA 4KPFC 2K5UA 2YIMA 3DQZA 3RIYA 5JNVA 1O0CA 1XQXA 3S8MA 3DUWA 4P3XA 4HAZA 2NVUA 4PBRA 3ZBUA 4C3OB 3AFNA 1GRRA 3AYZB 4TRRA 4HAYA 4HUQB 3NHUA 2AUNA 5AKHA 3RROA 1P7ZA 4HXEB 1KDOA 4M9RA 5C32A 3DOFA 1PJ4A 2UZ4A 1J24A 5DMHA 4Q24A 5JCOA 2NNWB 4HNRA 1Y34E 5AM0A 1ODFA 3CJTA 4XVCA 3CZ5A 3KJXA 2H2WA 4K9OA 1ZOOA 3PPIA 2C7VA 3ICOA 3B1FA 2O8NA 2FMFA 3DDWA 4IX1A 1AS3A 1QX3A 1XZIA 3CMMA 1YIJF 4KR9A 1PGJA 2P35A 1Z2NX 2AYYA 1U7XA 4RPHA 4KYUA 1ORDA 1WABA 4ZK2A 1PGPA 4WDRA 2VO1A 2D13A 1FL9A 2E2WA 3UG7A 4OOEA 3ZW7A 3GN1A 3E3OA 1QRSA 4OL0A 3PENA 1U8XX 1L6RA 1N7JA 3AT1A 1QYCA 3HNOA 5CHEA 1T13A 5EP3A 3TDKA 3RKSA 5KAPA 1IAQA 2XMGA 3UG6A 4C20A 1C3EA 2RKBA 3GD5A 2AYZA 5H83A 3WGZA 1ZC3A 1VE1A 2Z5GA 1UBLS 2J3MA 2Y2UA 3TD5A 4BKOA 2HIMA 2XTNA 3SIRA 4A5SA 2HO4A 1VI6A 4QPCA 4BGUA 4E1VA 4UOQA 1JG7A 3GHHA 4RUKA 2IIBA 1UKEA 4M83A 1LJLA 1R9JA 4YJ2B 2M1ZA 3CSDA 3OKCA 2GM3A 1B76A 3FTCA 3PT9A 4YK7A 3BPSA 1AJEA 3MERA 1E6EA 4OUDB 2TYSB 3U17A 4AJLA 3HLTA 5IDQA 1HDCA 3QITA 4OK6A 4CLOB 5HX7A 3O21A 3EZGA 5A5EA 2ZXFA 4YJGB 2JLUA 2YWBA 2B1JA 2GPNA 4UUQA 3RK0A 1WVMA 1SELA 1SHTX 4O2BA 4GKVA 5FXMA 1DV1A 4ASUA 4HUTA 1U0JA 4DJJA 3MJDA 1R9NA 2HRDA 3DG9A 2NUBA 3JY6A 2AXEA 3IQZA 5DM60 4HEJA 1VA4A 4YUAA 1BDJA 5J47A 4NBRA 2AC7A 4BLPA 3QX3A 3HTNA 1X3SA 4HQRA 2JJ2A 2GJ8A 2C2YA 3OO0A 2E87A 2Z09A 1YJNF 4TUYF 2RMKA 1KZ9A 4FINA 3IAM6 4UTPA 3HEMA 2OV4A 1T1IA 1E1LA 3MCZA 4N41A 5D5QA 3U61B 1E66A 2QLFA 3W9YA 2X5JO 4X1OA 3ZIAA 5F7JA 4RTLA 4QUIA 2RHMA 3BE8A 4OQ4A 3PGVA 4UD2A 3LDGA 1RIIA 3UV6A 1FTGA 1HETA 4MULA 4Y3UA 2O8BB 4A6EA 3N0RA 1WO8A 2BMEA 2XECA 4MEAA 1M0WA 1J07A 1G17A 3IIEA 2KG4A 1MEJA 2YHSA 5L95A 4ZU3A 2RGDA 3PUZA 4MUAA 5KSWB 4EG8A 5CK4A 5EWRA 4KU4A 3ROQA 3M6LA 1YO6A 1PK9A 3L6CA 3D6AA 3JZAA 4FHFA 2E4XA 3W9SA 4MCAA 2Y4NA 3JAMM 1W4CA 4HPXB 5T8KC 4IIEA 4RXTA 3HHEA 1NQ5A 4LI3X 1HT2E 1KJ8A 3CZRA 1NNLA 5J58A 4MSUA 1Z2DA 4C05A 4P4SB 2E5LB 5GINE 2GKGA 5EIWA 4EUNA 4FIZA 4MMZB 4C14A 4UTVA 3DLBA 4INAA 3MMZA 5AW0A 4AS3A 1ECBA 1ADYA 1EJBA 1PR9A 1K8ZB 2XB9A 5DULA 3B5EA 1HNZB 3DV9A 3HJWC 4MR9A 1B15A 1ZAKA 1JWBB 2MTBA 3BMQA 5FA6A 3TD2A 5J4KA 2GRJA 1JEJA 3ZLUA 1USGA 1DBVO 3TLGA 1XSEA 3O1JC 1Z6YA 1DBIA 1SC9A 4IEIA 1K3UB 1OOEA 2ZSDA 4IUCS 4JUCA 2FLWA 2YVLA 1KI2A 2PGLA 3PCXA 4R2WA 1OY1A 3WZ2A 4E1BA 3DHVA 4FDTA 3TOXA 1KK2A 2O3UA 4O4HA 3WJQA 4NEHB 4QDUA 3GRZA 2X19A 2O2ZA 1G6Q1 2IXDA 1PT6A 2C3MA 3LUGA 2AHRA 1RLGA 1RE0A 4BVKA 1JPUA 1OBOA 4WZBE 3RIMA 4DLAA 2W2MA 4HWSA 1H2AS 3F97A 3FCCA 1YOVA 3G7UA 4LOKA 2HA3A 4M9CA 2EJCA 4B5LA 4WUTA 2IAFA 3HN2A 4IDHA 1YOVB 2OYSA 3AUKA 1NTRA 1LUAA 1R0YA 2AQIA 2EFEB 2LV8A 4G5FA 1ECLA 4LJSA 4HDKA 1YB4A 3L4JA 3WGYA 1VGRA 1YZGA 1I5OA 1NFRA 1D2CA 1L5SA 1NN1A 1TT5B 3CR3C 2AI1A 3LNCA 2E4AA 3HRHA 3N8KA 1PR1A 2WJIA 2J7KA 4JEHA 5ITSA 4GX1A 1KEEB 1A3CA 1E1QD 4G9EA 4PSUA 5FT9A 5IBQA 1II8A 1MAWA 2X8AA 3C8DA 4H16A 4Y1GA 2QRNA 3F96A 4A1FA 2CSXA 2L69A 2OXEA 1CRLA 2LIVA 4HH4A 2I22A 3PQ4A 4OQNA 4U6NA 2VA9A 5JNUA 4C2UA 3OOJA 2R66A 5J2TA 2WVGA 5H9WA 2WI8A 3ZE9A 1PWZA 1P73A 4YXFA 3IA2A 3EUWA 1VPDA 3GRFA 3ZKAA 1QUFA 3ZYZA 1NZJA 3JALB 2AOXA 1XRSB 1P33A 2WZDA 2QNIA 1UQUA 3DE2X 3FZYA 3L7KA 1KXJA 3TZEA 4B3CA 2BEUA 4ZQGA 3ZCRA 1GQYA 3GDHA 2IYFA 2O8FB 3PYMA 2L18A 3A58B 5GTDA 4MI9A 5D6OA 2ODEA 4IY1A 1NBWB 3V42A 2QR3A 1TAHA 4GI1A 3OJWA 1EFVB 4ZCSA 5B2FA 4XE5A 2Z57A 4RH0A 1N25A 3GRCA 3IDFA 4IOLA 4LK2A 1ZS9A 4I50F 3BZBA 5L3SA 2ORIA 1BA3A 2YNMC 3KPJA 2EL7A 2E3JA 3QXXA 3QYAA 4L5IA 4YV1A 1A2OA 4ZOLB 2WPNA 3HZRA 1DKMA 2WV9A 3OE4A 4HQKA 5FPTA 5A6SB 2JAOA 3JZFA 3N7UA 1DWPA 1F0PA 3N28A 1E9BA 5DN6A 1Z5GA 2PAFA 2Q3MA 3DMGA 4BKQA 1QKKA 2C5GA 2WZCA 3G85A 2P2YA 1LI7A 4C6RA 4AD8A 2W70A 4A0GA 2B5OA 3SZRA 5CT9A 2WWRA 4LYAA 4NV1A 2IG8A 4JLBA 2MYPA 2HS0A 3C98A 3H2GA 2OHWA 2VNSA 1KA9H 3NTLA 4LUCA 4PCAA 1NVEA 2QTCA 4PLGA 3P7MA 4C3UA 1DTSA 1YR3A 2FRDC 3D7LA 4L8WB 5AMXA 3V97A 2BFEA 4TS4A 5AVYA 3HXQA 2WP8J 1G7TA 3QH4A 2QZ4A 1CCWA 3PWZA 3FPEA 1U1FA 1Z0FA 4OD0A 3GTZA 5U4XA 4C08A 1K2WA 2HK7A 4RTRA 4FI3C 4FHDA 1SUWA 4KMOA 5F98A 5KU1A 4YRDA 4LF6B 2IPLA 5KI6A 3IEQA 1E32A 2QQFA 5KOYA 3TSYA 4UVIA 3HDHA 1H9CA 2DP4E 3PXAA 2IVFA 1GYPA 4QTUB 1RKBA 3AVTA 5AXDA 3RF7A 3WI7A 2XZDA 3TL3A 4XJXA 1KYIA 1A8PA 2Z56A 2NO1A 3K0AB 5JFOA 1OGYA 5JUWA 4G0PA 2VBFA 5E7JA 3HB5X 4Q9KA 1P1BA 2CVLA 4EUSA 3RIGA 4RTKA 2ZUSA 3OCWA 1BU5A 3M4XA 4JV5B 1UKZA 1PFQA 2I3BA 2ERCA 5CAEA 1R0KA 4OYRA 2QX7A 1M10A 4PO8A 1UMKA 4J0CA 4ZAFA 1TKBA 3BMOB 5HDQA 1RFLA 3SLRA 4WZAE 5EP2A 5JPIA 2GZ2A 1I2ZA 2VHWA 1MJNA 2A5DA 1S2NA 3DKRA 3E05A 1DIGA 3TW8A 4B9AA 1S5PA 5JAUA 3AVOA 3WWDA 3E9QA 3U7HB 1M1ZA 3AFHA 4Y1FA 2BSXA 2FFBA 2C4WA 1FSPA 2PZJA 1ZM7A 1H2XA 3AP1A 2GI4A 1MB3A 1WCYA 3U4QB 2XZOA 1RRGA 4HAOA 4N39A 3IAS6 1K63A 1NA5A 2YIVX 4RCYA 3EGXA 3PCTA 2AFIA 4BVQA 2IUEA 3A9UA 3E9CA 4A6XA 3T1OA 2GD0A 4J16A 4WTOA 4A8HA 3CVVA 2J5QA 3OO1A 2VBGA 3QUAA 4HNHA 1LPMA 3KLMX 2PT7A 4PPYA 4QHYA 4F3NA 5IMSA 4LRTB 1VJGA 4MOWA 3WIBA 1SU8A 2B61A 3E1SA 2XUFA 1E64A 1XNJA 3JQ8A 1W42A 3C3XA 4D80A 2JGRA 2HUPA 2ALEA 3P9QA 3JQBA 1YKGA 3NRCA 1G21E 4EZIA 1OBVA 2C84A 3MAAC 2ZB8A 5AVMA 4ZT6A 4BO6A 5LMZA 2DLCX 3EDOA 2R62A 3KK0A 5A3RA 1F1JA 1Y4DE 3NATA 3ROXA 2YWJA 3VR5D 1SPBS 3TIFA 1I3KA 3TD9A 2V6IA 3O94A 1DIRA 1T9GS 1Z7EA 2DHEA 3EFBA 4OXNA 4WCDA 3WLTA 4H60A 1Q86H 3MJSA 4FDMA 3OLVA 2OESA 3QUTA 2V5AA 4YRNA 5KYYA 3MTDA 2DKFA 2GJKA 3FHJA 1D5WA 3DTVB 4DM3A 3L1IA 4WLEA 3QM1A 4C0KA 1NBAA 1FP6A 1V25A 1YBMA 2GM9A 2W2KA 3IURA 3TIXB 1JKIA 5C1OA 5GONA 1T0HB 2D1FA 1Q15A 3OT1B 4GLBA 3QFSA 4UULA 1C3OB 3E5NA 1VJCA 5D3MB 1Z22A 1N5IA 3M4NA 3ACCA 1JEOA 1I2MA 2P4UA 4J3JA 3FFBA 1UPXA 3CPQA 3N2KA 2RIRA 3LGAA 3LUFA 4EJMA 4PO3X 3VX4A 5T8KA 4AC9A 1SUBA 3WPWA 3KETA 1OA1A 2C0QA 3OIGA 1ZGAA 1FYEA 3E8SA 5K1ZA 4F5DA 4RK6A 3I5AA 1H3NA 3SC4A 5ECWA 1XRPA 1E8NA 3LWZA 5LA6F 3ZKWB 5FHRA 3SQWA 1KJQA 4BLUA 4FT4A 2YDXA 1HDRA 1VP9A 4ALLA 4ZK6A 3W3AA 2WK1A 1X86B 3D3KA 3ZXIA 5JDIA 2R00A 4PEVA 1NE7A 4Q48A 4AB1A 1CZNA 3L0DA 5EHXA 3H5OA 4K26A 4O4HB 2HPZA 1WF3A 2ISSD 1K68A 3DS8A 4QTTB 4TS3A 4Y9SA 5AKKA 3BH0A 1PG5A 3HJAA 3A4NA 3DBRA 4MITA 4A8PA 1WQ1R 4UHCA 3OT5A 2VF8A 2CLSA 4KIFA 3HKEA 1YGPA 3GROA 4KDRA 3BQNB 1E2DA 1NBEA 1AN0A 1JHDA 1NUHA 1SG0A 3EMKA 2O3RA 3HFGA 4HWOA 5LQSA 5LPNA 1WEKA 5HNKA 4BNDB 1Z16A 2WHRA 5EZYB 1C3VA 2WJAA 1QTRA 3OMLA 2VH1A 5CXQA 4Y0VA 4C4WC 2FP4B 4CIAA 4RNCA 5EZYA 1QAHA 1E3JA 1PGNA 1W9MA 4U3JA 4P92A 3RAFC 5THXA 4A6PA 3LP8A 3EXFA 1LPAB 2XCLA 3BJMA 4FGUA 3M5WA 4DCTA 1Z5OA 3NTRA 5JC8A 5F52A 2AJLI 2SECE 4DLVA 3EEYA 4LJ8A 2BP7A 4EB0A 4WFQA 5BWNA 2WOJA 4OGLA 2OZEA 4IDAA 4KXMA 5B8FA 4BZXA 4CODB 3FOBA 3GFTA 2RI0A 3H2BA 2CEKA 4K1LA 4BRSA 3PPVA 1PBNA 3UAOA 1Y1RA 1X1CA 5KKCA 1OLXA 3UOGA 3UAZA 4HH1A 2WWHA 3CB4A 3PRJA 2B8WA 1ZMTA 2HF2A 2X86A 3Q1LA 4WKGA 4KXWA 2PKXA 1LF5A 1M3SA 1D8AA 2FR8A 3N8NA 4I6GA 4QXOA 3K5WA 4YMSA 1JA1A 5T6BA 2JIRA 4EQ6A 1TE2A 1FRVA 2PUHA 1V6CA 2AKYA 2F00A 3BCSA 3F8WA 3KZNA 4FKBA 1J21A 4J0HA 2DFVA 5KCMA 1ZRSA 3NHSA 4MVJI 3UGKA 1HLPA 4OJTA 1RZVA 4AROA 1CQJA 3W7VA 1NLYA 4TQUS 5HRAA 3WDMA 1N6PA 3ZHZA 4BMVA 3CUVA 2HTEA 4LDAA 2FN9A 3L0BA 1O3YA 3F0DA 1GNVA 4BBZA 1L9KA 2V7XA 2Z83A 1TXGA 3BILA 3F0GA 2N47A 1A72A 3D4IA 3WRYA 4C3ZA 4Q1CA 4EA8A 3C1UA 3IE0A 3U48A 3U3KA 3EW7A 4AU1A 2GZHA 2RBGA 1NUTA 4UJ5A 1ZC4A 1VI2A 2YYAA 3A28A 1JDPA 3VPSA 1JIIA 3BB3A 2ICAA 4JSRA 1GLNA 3G79A 4PFKA 4PICA 5J2UB 1CJKC 3LDHA 4OQMA 4WY2A 3PIDA 3SXJA 1CB7A 4HDNB 1MFPA 4KLAA 5JXGA 5JBIA 4DR1B 1ZHOA 3ADBA 4HH3C 2POCA 4OQLA 5B30A 2HS4A 1VCOA 3R40A 4MCJA 3V2UA 1H3EA 1BFDA 1YJ5A 4BGVA 3PEYA 2F9LA 2V7UA 3DNMA 1L1RA 1H1LB 3GL9A 3IEPA 4PSCA 1ZFNA 1VL6A 3IDAA 3OT4A 3TTUA 1E3TA 2B78A 1UF9A 4HEQA 5ALVA 2CFRA 4CEJA 2QHXA 3BA1A 4TM8A 2PXHA 3LK7A 1VMIA 4POAA 4ENPA 5K6AA 4ON9A 2WD8A 5CIYA 4QBHA 2AB0A 5IVPA 4NZPA 1RQGA 4YT5A 2A35A 1XHFA 1ZG3A 5KYWA 2O1EA 1Q6YA 4EYEA 3CIFA 4K6OA 3WJ1A 1VI5A 3IKJA 1MAUA 3Q5EA 1H8EA 3B60A 3D6FA 3GT0A 4PZPA 4A91A 5IAKA 4F12A 3DFKA 5BN5A 4U8GA 2NU9B 5KTOA 1SHJA 4MS1B 2DFDA 1JEEA 4UE3S 3R6LA 2QD5A 3TEMA 1N2CA 4P32A 1FSZA 4F11A 1P18A 1W76A 2NU9A 3IAM1 4CMHA 4QLAA 4XX0B 5KHOC 2O52A 3RANA 2VTKA 5JJCA 5KYVA 3U7RA 1N8SA 1ZJ4A 4Q19A 1U0GA 2WTUA 2AI2A 3ESAA 4YJ3B 1GGEA 1OUMA 5FQNA 3T5CA 2EBWA 2AUTA 4P33A 4Y9DA 1GO0A 3AIIA 4J0IA 5KZMB 1CP2A 3HFRA 3IMCA 3OURA 2JJQA 5ER9A 5JBNA 3M4SA 4GP6A 5KOHB 3GLTA 3IOEA 4RZSA 3WISA 1WCXA 1K8AH 4U8HA 2Z4RA 4TMTA 1X1QA 1HYHA 1Z33A 4OJMX 4A36A 3KOOA 1PP4A 1YE5A 3AY3A 4V3BA 1FU4A 4EFMA 1H8HA 4LN1A 4Q1BA 4GH5A 4TS1A 2VDOB 1QMPA 5GIPE 2AH5A 4D4HA 3LPLA 2PSHA 1DT5A 1YCDA 4XD7D 3ZE2B 3ZCQA 4MPRA 2O1XA 2ZIEA 2ZRMA 4F21A 1BYIA 2A0WA 2BM0A 2I3ZA 3QJYA 1T6XA 1DO2A 3I6BA 3HCWA 3KFLA 2ZYAA 3CH7A 4NCNA 4BW0B 3IHKA 2XTZA 3EF3A 4I5FA 1PEAA 2GCGA 4I46A 4OIFA 2AN1A 3W8FA 4EG1A 1ES9A 2XXJA 3MTEA 5CP8A 2XSZA 2XEXA 3IT0A 1W0CA 2ZIFA 4R83A 2ZIAA 2HGSA 2QRKA 3WJ2A 3HH8A 4CKEA 2PKRA 3BXHA 4I5GA 3IIJA 5K2OA 4GRAA 2IIQA 2XNJA 3WG9A 1WXWA 3LSYA 4YPFA 4GL4A 3GLUA 3AVWA 1KS9A 4EGQA 1CHDA 1ZR2A 3O7MA 1DTWB 4XUEA 3A6PC 2YW2A 2JKVA 4NYJQ 3HKDB 1SHLA 3SJ7A 2ETXA 4ZIRA 2FDRA 2E1PA 4MQ6A 2FRDA 1GKYA 2YNMD 2AKEA 1PTKA 1CUIA 2ZVQX 3NBYC 4RPKA 3VNBA 1P29A 3CMAF 3BBLA 3HMQA 3JCZA 3O4IA 4W8HA 4PCVA 4G09A 3ROEA 3M5DA 2GOYA 2VDWB 3MEQA 4MVYA 3AVYA 1RU3A 4L4SA 5JSQA 3I2FA 4KAAA 1NXWA 1XDUA 4OAPA 5AVSA 1MPXA 1SU7A 3L6DA 1B4DA 3PC4A 4FD3A 4N82A 4TKUB 5HBRA 3WQHA 3LZDA 2XQJA 4H08A 1GEGA 2ODAA 2I4RA 1VDMA 3JW8A 1XG5A 4AZSA 5KNCH 4XD2A 4Y18A 1M0SA 1WXGA 1T36A 3NHPA 3QLUA 4GYJA 4B79A 1WJGA 2F4NA 5KS2A 4ZVUA 1TW3A 2DY0A 3T5TA 2HT6A 2NPIA 2JLWA 1RP1A 3ZVNA 4G0WA 3SC6A 1Q95A 1R8JA 2EWCA 3NGXA 4CLRA 2ZT6A 3O73A 4LMRA 1W6RA 3H87A 4DEXA 4IKPA 1DU4A 5L8VA 1QWSA 2JS7A 2BFCA 2PX8A 1MPTA 5F2OA 1FK8A 3A3YA 2QI2A 2OR3A 4I50A 3A1FA 3VJLA 3ZDRA 6REQB 4Y2GA 1H6CA 4NYMR 2ZPTX 3ORFA 4PN3A 4MUJA 1Z15A 4QNRA 4L4RA 5CYFA 4YREA 2LW7A 1Q1NA 2C8JA 4UAGA 1MO5A 2DHQA 2BHNA 5D7BA 5BNFA 5JALA 4LNHA 1P4RA 5IYZB 3ZDFA 3PA6A 2HCBA 1MKYA 2UVPB 3RYCB 3FNHA 3S1AA 2ADOA 3UK1A 3WMEA 2Q8QA 1Z74A 3JASA 4CFYA 2D4AA 2R6AA 3OQOA 3CWQA 1N7IA 2N46A 3LO8A 4W9NA 3ZDCA 4XARA 3AUTA 3U26A 4ZZ3A 2Q62A 4MRAA 4WLNA 3B1KA 1QVFF 4QSHA 2CXXA 5CK5A 3ZI0A 3DWGA 3KELA 4EMUA 4M1MA 2OAQ1 3I9LA 3OTHA 4ZCIA 5BV2P 1YFLA 5COQA 4FHZA 4I6JA 5AKXA 1O89A 1X0VA 4M7RA 5F9HA 5SY4A 3PGA1 3I12A 2QYSA 4Y8VA 3CZPA 3OOEA 3BXXA 1ZMXA 3CC4F 2DOKA 3QPAA 1ONOA 2H1OA 3I8OA 1UZUA 4HRVA 3QELB 2NVBA 3LT5A 3F8SA 3SIXA 3FZEA 1SUSA 3DJYA 3EXG1 5LYJB 1E6MA 1WBJB 3ACDA 1OXMA 3BZUA 1OZAA 1WZIA 3FIJA 3MD0A 5AJZA 4B47A 5ELLA 5CDTA 4LDRA 3WGGA 3G5UA 5DM2A 2V98A 1THGA 3ZD7A 2PL5A 2XWSA 4I9HA 5HM6A 3RNOA 4HADA 3I09A 2GBLA 5JO0A 4RPJA 1ZVMA 4R9UC 2IYXA 4QIHA 2ZYVX 4XUDA 1JJ7A 2QV0A 3IR7A 1FLDA 1KS2A 3MQ4A 1GZ4A 1U2GC 3ZHBA 1CY0A 3MUNA 3UUEA 2BKLA 3EHEA 2UKDA 3I52A 1O9GA 2IDKA 3TJRA 2D7DA 1HLFA 4IGEA 3NTVA 2K7ZA 4R54A 2JGFA 3NU1A 3SQMA 4BFCA 3PQFA 2GPSA 2XE4A 3GX1A 1CJCA 2PIDA 3WLRA 2QPTA 2IQ5A 4I8DA 5D1HA 1KWKA 4PQFA 3X1ZA 1EIZA 1EJ6A 2VDKB 4IGIA 2DM6A 4XR4A 6ADHA 4FNMA 4IOJA 4UOZA 3PLNA 4NNJA 1X8KA 3Q9NA 3ZWWA 5I7RA 3DTVD 3GFQA 2ACKA 4CMIA 2LBPA 2FZGA 1ESNA 2VA8A 2SKDA 5KTRA 1VPEA 2W2XA 2BUBA 1Q84A 1N6RA 3QWAA 5A0FA 4CMIB 5NULA 1LV8A 1MP0A 1Z4IA 3ECAA 1Z13A 4EKNB 3L82B 3Q11A 2V4ZA 4UNNA 5JJLA 1RVV1 3LUJA 4HDMB 1R16A 1RADA 1XPJA 1RAEA 2I03A 4IZ6A 1REQB 4JOBA 3DKVA 3HR7A 5F2EA 1QRDA 2IBSA 5JCZA 4NHOA 1KZ6A 2BKUA 1VMEA 2MSEB 1RHJA 4KH1A 2R7KA 1GTL1 1QU9A 1SU4A 2WNSA 3DDUA 3SZGA 4EOGA 2WWWA 2FZCA 1R27A 2XDWA 1ZJJA 1KH1A 4HTFB 4P5PA 2K7FA 4D1YA 1YJ9F 3B82A 2QMYA 3OLWA 2W2VA 2HU7A 1KYQA 2QW8A 4YIKA 5CB4A 2ASEA 4JVNA 1HDYA 3QWBA 3DYVA 2DCUA 3ZH2A 3PFHA 3AJ8A 5G4VC 4H1VA 4GZMA 1PBTA 3O8QB 1V7QA 1CJVC 1LLCA 2NO5A 1M0EA 4EAQA 2QAIA 1ISMA 2J7PD 2XOKD 2YVQA 1TLLA 3H5NA 3ZHVA 1AZSC 4G8JA 4J49A 2Z1EA 4RZ2A 3V2GA 3Q72A 3ADCA 3CLRC 1JQKA 5AW1A 2VRCD 2CLEB 3FWNA 1UJMA 2EATA 4HX9A 1CK4A 3EF0A 2BBOA 3LU1A 1RS0A 1SC6A 2B7LA 2J0EA 2V7VA 1F6DA 1IFXA 1RRFA 3L1KA 1XTUA 2V9PA 3OX4A 3V4SA 3WMXA 4EFKA 1WZCA 3AWIA 3RFTA 1EUZA 1DWOA 1I7DA 3A6KA 1ILWA 1L8QA 1YTUA 5JLJA 2Q3JA 1NBHA 1NF3A 3CSUA 1WDKA 3U3OA 3F6MA 1LBQA 5AVJA 3NHFA 4AL4A 2QVGA 2DHDA 4N6OA 2KJQA 2ZSUA 1SZJG 3K1AA 2CBGA 1A7UA 3ZW9A 1G21A 3OKPA 1T35A 1EKXA 1TJPB 1G8JA 3DBLB 5TF0A 3U4HA 3THOA 1HLDA 4D9GA 1DS6A 1GL6A 3BTVA 4ILKA 3R8CA 2R6FA 3LUPA 1O95D 1Q0LA 3EDQA 5IDYA 5P8WA 1XAGA 4BQPA 4V1CA 3ER9A 3CHYA 5L7TA 4BRWA 2J4FA 2VN8A 2RB9A 4ZP1A 2WTBA 2C7BA 1LBIA 1OLSB 2DF8A 3LRPA 4AMZA 4I0WB 1VLMA 3KPUA 4LVOA 3ZCSA 1XDBA 3BDVA 3Q85A 4EPRA 1EFVA 2A5JA 2WALA 2V55B 1H5QA 1OPRA 1OZ0A 4FYXA 1K8XB 1CQIB 2OCPA 2WLSA 1IEXA 5T3UA 1JR3A 2HMSA 5DK6A 5BPHA 1VYUA 5FNVA 5HRCA 2W58A 3K2XA 3TLAA 2QVYX 3H65A 5AWFC 1ILEA 4B6FA 4OK5A 5ALNA 4G07A 5LP6C 2V3WA 4ZQBA 5FTNA 2I33A 2R7LA 4HNAB 1D09A 2A9KA 1DG1G 1YZHA 3P9RA 2R2GA 3O4HA 1XV2A 4PONA 4NS1A 4NV3A 2FEOA 3EODA 4WLOA 1X13A 2YINC 1I51A 5ESXA 2RGGA 3RC8A 2HRUA 5LIRA 2IV2X 2DX7A 5JADA 4UQOA 3EPLA 3HCAA 2VDWA 1C2YA 1RI5A 2H17A 1P7YA 2QZ9A 2C5SA 3MA0A 4XDGA 3RSLA 1UBOS 3UBMA 4EHFA 3W5BA 1JH9A 1UXHA 2OUIA 1JA9A 3G8BA 2P9FA 2OV3A 2RGWA 4GBED 1G20A 1Q74A 4IRXA 5DWQA 1W0JA 4B31A 1OKKD 3INTA 1U2ZA 3DXXA 3G0IA 4UZFA 4DIOA 2BM9A 2PQ0A 3P27A 4MQFA 2E4ZA 2Q0SA 2QA4F 4CLEA 1UBJS 4IYJA 5KNBA 2DBYA 3F1LA 1UBCA 2P69A 4R40B 1E89A 4FBMA 1XAHA 4U0JA 4EP1A 4MYTA 5K7SA 3X1MA 3W8NA 2QP9X 2C4VA 2QMZA 3ND9A 1MJFA 4XLTA 1OR8A 1BVUA 1N5KA 3S0WA 2HWWA 3EG9B 3GJ7A 3CSSA 4A2CA 4PZUA 4R41A 3EXEA 3RUEA 1SUFA 1PUXA 5I9NA 4DCGA 1L7MA 2FFAA 3NDJA 4DCVA 3TL6A 3WLEA 4EO7A 4D42A 5IT5A 3STWA 1KY4A 1V7CA 4V0MA 1U3CA 1OHHA 1X77A 2IC5A 4MB0A 4CKBA 1IK6A 2BJVA 2EQ5A 2B3TA 1NVTA 2VDMB 2WHQA 2Y66A 2JLRA 3D00A 1WHTA 1DWUA 2RI6A 3IBFA 2VK4A 1T4DA 2IF2A 2UUOA 3KKZA 1Q1AA 3OC6A 1VZ3A 5ALSA 5KKAA 2Z4TA 1KDYA 3VC7A 4CL8A 1JDBB 3FHCB 3VH3A 2AFHE 4ML3A 1C81A 1W36D 5K4AA 2JF0A 4ZAXA 3LFTA 1L7BA 4R51A 2EFJA 5EJIA 4S0ZA 3UK6A 1GPWB 3B12A 1OCEA 1VYTA 3IB6A 5EINA 3T4EA 1QK5A 4WA8A 3AOGA 4CDRA 3U3XA 1LW6E 1T10A 2W8BB 2YFKA 1F2UB 2Z6QA 1JKXA 3E2PA 4FE7A 3I2JA 2WTNA 4NJEB 1O5IA 2VQEB 1E1MA 4JI0B 1J8DA 2FR0A 7REQB 4FUTA 1UPCA 3ADOA 2QI9F 2ZYWX 3COVA 5EKXA 2MMCA 4L4XA 3U16A 5JSYA 2VGMA 3SDSA 2NACA 2O3TA 2XEDA 4BXOB 3WWZA 3OBYA 1XD2A 2F7SA 2VDLB 3IO3A 5KHAA 3UJ6A 5F23A 2W2NA 3RVQA 2PRSA 4KQKA 5FJ4C 1AGPA 2DEUA 4GM0A 2A9VA 4HFNA 4CHTA 3GQVA 3VOAA 1NT2A 3P26A 2WDPA 4D4MA 2I6GA 2WHEA 3E58A 4BT6A 5DEIA 4F8EA 4RA6A 4ARBA 1DKOA 3QKIA 3WRXA 2OGUA 3K0FA 5TB5A 3STYA 4MEBA 1WXDA 5B4VA 1KYYA 3KYIB 4P35A 2WB4A 5AKIA 1W57A 4W5WA 3QF4B 4F97A 3SZOA 3P45A 2YL2A 1DRWA 4M38A 4DV7B 1QTIA 3OI7A 3QF4A 4WJKB 5DIFA 5IKOA 1ORRA 2PLAA 1FNNA 4O29A 5AK0A 1NONA 3G2QA 2O0KA 2RGBA 1U3FA 2H5JA 2ZJOA 3K9BA 4KVZA 1AA6A 3PL1A 2AE1A 2O05A 3HJNA 3P20A 4M9XA 4TKZA 1AT1A 2OM6A 1IG3A 1M54A 4Y67A 5AOVA 4F4UA 4E1AA 4KE8A 4QVIA 2WFZA 5AFSA 1QZXA 1ZSYA 2HFKA 1ONBA 1NVAA 2NZYA 1QO0D 1T1SA 2OAEA 3OZIA 4HHEA 4HRXA 5D2CA 5GIOE 4Q1AA 3T6KA 3KTFA 3S55A 5CTAA 3K70B 4F0JA 1TVKB 1YZUA 2PMWB 2BEWA 3OM8A 1RI1A 2I2BA 3ETHA 3BCUA 3EGDB 2YWXA 2PS0A 5EB0A 2Z5LA 4IIJF 4YN3A 1G8SA 2XPCA 3EQ6A 1MO2A 3O84A 1S3IA 4MVJE 4KXNA 3ETGA 5ALHA 4ZHSA 5BORA 3P9KA 1GL3A 2C54A 4JJKA 1GA1A 4CL2A 4ZEMA 1H0HA 1MU0A 2C2BA 4WAUA 4BJ3A 3KWLA 1F12A 1I7QB 3EA0A 4D4IA 3N74A 1UBFA 3I5UA 3FTPA 3GNSA 3X1XA 2M2IA 3Q0IA 5EQTA