3WGNA

Staphylococcus aureus ftsz bound with gtp-gamma-s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 106
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgnA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgnA01
1JFFA 5EZYB 4I4TB 5EZYA 4ZHQB 1W59A 4I4TA 2BTQB 4X1YA 4ZHQA 5JCOC 4EI8A 1FSZA 5JQGB 3HKBB 5CA1B 3HKBA 5CA1A 5LOVB 5LYJB 1FFXB 3JALB 3JATB 5CA0B 1W5BA 5KX5B 5LOVA 5LYJA 1FFXA 3JALA 3JATA 4TV9B 1W581 4M8IA 4O4JA 4TV9A 1TVKB 1W5EA 4WBNB 4EI9A 2VAWA 1TVKA 4DXDA 3ZBQA 4WBNA 4O2AB 1SA0B 2RHLA 4YJ3B 5IJ9B 1SA0A 4YJ3A 5IJ9A 1JFFB 5LXTA 3JAWB 3JAWA 2GVIA 3RB8A 3VOAA 4X1YB 5KMGA 5EYPA 3WGMA 5CB4A 3WGNA 3ZBPA 5FNVA 4U39A 3VO9A 4F6RA 2XKBA 5JVDB 2RHOA 1RLUA 3N2KB 5MN6A 4DRXA 5JVDA 4O4HB 3JARB 3N2KA 4YJ2B 3HKCB 3JARA 4O4HA 2Q1YA 4IHJB 4O4JB 4O4LA 5JCOA 3RYHA 5LA6B 3HKCA 5LP6A 4YJ2A 4IHJA 3UT5B 5ITZA 5LA6A 3VOBA 5C8YB 3UT5A 5C8YA 5MN5A 3M89A 2VXYA 5EIBC 2R751 3N2GA 4ZI7B 4X20B 5LXTB 4ZI7A 4X20A 3HKEB 4XCQA 5MN4A 5KMGB 5EYPB 1TUBB 5CB4B 3HKEA 3JASB 3C8LA 1TUBA 3M8KA 5FNVB 3JASA 1RQ7A 4F6RB 4E6EA 5JH7B 4HNAA 2XKAA 4DRXB 5JH7A 4I55B 4O4LB 3E22B 4I55A 4TUYB 4U3JA 3RYHB 5LP6B 2RHJA 4TUYA 3E22A 5ITZB 4IIJB 4LNUB 5J2UA 2R6R1 4IIJA 4LNUA 4EB6B 4ZOLA 4FFBB 3R4VA 4I50A 4TV8B 4O2BA 4EB6A 3WGKA 4FFBA 3CB2A 4O4IA 4TV8A 3N2GB 4KWEA 4B45A 2Q1XA 4EI7A 3WGJA 5LP6C 3WGLA 2VAMA 4B46A 2BTQA 3HKDB 5JQGA 4X1KB 3RYFB 2RHHA 3HKDA 5IYZB 1W5AA 1RQ2A 1OFUA 4HNAB 4X1KA 3RYFA 5J2TB 1Z5WA 1Z5VA 5IYZA 5KX5A 5CA0A 5J2TA 5GONB 1W5FA 5BMVB 4U3JB 5EIBD 5GONA 3VPAA 5BMVA 5J2UB 3JAKB 3ZIDA 4ZOLB 4O2AA 3JAKA 3V3TA 3RYIB 4X1IB 4I50B 2VAPA 2BTOA 4O2BB 3VO8A 5IJ0B 3RYCB 5M7EA 4O4IB 4X1IA 3RYIA 3RYCA 5IJ0A
chains in the Genus database with same CATH superfamily
3RAGA 2XQGA 4JGBA 1XYVA 4L8YA 1XZDA 5EKSA 5B53A 4RVUA 5DH9A 4MPRA 3BXEA 3DM9B 4KN9S 2AH5A 2DSNA 5ELLA 2C9ZA 3A11A 4G5SA 5AM0A 4DANA 4N0MA 1UZAA 1XA3A 2HRCA 2V1XA 1P1IA 3GRCA 3QXCA 4KJXA 4KQXA 5EIAA 2YH2A 2IYVA 1J8VA 2PWPA 4LDJA 1USUA 1W25A 2DPHA 4I5EA 4MQLA 1H2BA 1K5DA 2Y92A 2FVYA 3EVGA 3MWDA 4FHDA 4FWBA 4KOAA 5DCYA 4X6XA 4XWOA 2WIJA 1JR4A 3N74A 3QG1A 5FA6A 4XE5A 1NC3A 2UUAB 3UAYA 1DS6A 1FTWA 2ZUCA 4JB8A 1L7PA 2QD5A 1G41A 1QR2A 3GLVA 4KCGA 4QVIA 1BE6A 4GRDA 5FEUA 1A9ZA 4CL3A 1GA6A 2GXUA 3KJQA 4K9LA 5LU9A 3I56F 2FSSA 1SXPA 1Q1AA 3U7RA 5HGJA 5C7IO 2IHKA 3TSWA 2H1VA 1LLDA 3B89A 1BXRA 4HJXA 4XDGA 4Z99A 5CBPB 5B6JA 3T4PA 3BMQB 2P91A 5DM2A 4AUNA 1QQAA 2WIFA 4G89A 2O7VA 2F9FA 4AF7A 1D2MA 3I9NA 1QX4A 3C3JA 3RVSA 2VJKA 4ZDWA 1G3IA 2HWXA 1YA8A 2P4QA 4FMDF 1U7WA 1FYVA 2XF8A 2DG2A 3NVAA 1B74A 1MMFB 3W77A 2A9FA 2VF7A 1U3WA 2GYUA 5IXSA 1XTVA 4CHTA 2CYBA 4CM8A 1GYRA 4AP6A 3TLGA 1ZH6A 1ZL2A 2CBGA 3OZAA 4E3ZA 4QYTA 2WKQA 3JX9A 4PWTA 3H9UA 4DSUA 2P0AA 5HJEA 2HR1A 3T52A 2QMQA 4XR4A 2YS7A 2Z8XA 4M3NA 5LMCA 1FX0B 1I33A 4KO2S 4RDCA 3BXGA 3VKUA 2Y2VA 5REQB 4CLOA 4KB5A 2P75A 5JZ9A 2HLDD 1V5GA 3DEZA 3JYNA 4S1WA 2IUUA 2PD3A 3EULA 4E7PA 5MHTA 3DT9A 4MGEA 3IMKA 4MVJP 4RSMA 2IU6A 1UINA 2PEZA 2Z6VA 3NLLA 3A1SA 4MV5A 4XWWA 1CUVA 3NBMA 3P9NA 1KSHA 3SQWA 1UEJA 1W30A 3U1VA 2QW8A 4NCHA 1YB2A 2ZROA 3FG9A 1L3BA 2B2XA 1G0OA 3TRKA 3MC1A 3LD9A 2IIBA 2E5FA 3EMBA 2C4HA 2ZWPA 2HHJA 3OZCA 4GFDA 2P90A 2G1AA 2DFPA 1PZGA 1SN7A 3H2BA 4Z51A 5HJ7A 4FXOA 2R00A 4I66A 2SNIE 4DLZA 1GZ3A 1H0RA 1W5AA 1RQ2A 1BTOA 4JNCA 1IEXA 3PKIA 5FADA 5I8PA 2A5DA 3NHRA 4BJ5A 4H7JA 3WIVA 1UBKS 2PUBA 3N4YA 3MDOA 3IAFA 1FY2A 1E9BA 3GARA 3KJGA 1TAUA 4M49A 2FVXA 4JUBA 2EX4A 3HV0A 1FUYB 1X9IA 3TQCA 3SC2B 2G9ZA 1R6TA 2NSLA 2JCSA 3GVPA 1B4DA 1IZ9A 3G2JA 4NDAA 5EIOA 3SHOA 3FRHA 3WKCA 4DDUA 5KOJB 4Q3NA 1VI5A 4QJ3A 1Q7GA 3TBKA 3ZY6A 5G0TA 1GL3A 4OHXA 1Q6ZA 2NQ2C 1F0PA 1T6BY 2DT4A 3PGKA 4PG8A 4NZYA 3RODA 1EX7A 3KZOA 4X1YA 3WO0A 4CDMA 1D04A 2QU7A 3Q87B 4ZJZA 4AJJA 1T8YA 2NAPA 3RTAA 5KIAA 5LOVB 1ZK0A 4FGZA 4ILKA 2YCLA 1W5BA 1NI4A 1HT0A 3GROA 2C2YA 4RLSA 3C98A 4PYKA 2JHCA 2WKWA 4QARA 2NTJA 2VPQA 2XMZA 3E3NA 3K8ZA 5JOQA 1VDMA 2J0VA 4QPNA 1W0JA 1U3FA 3DH0A 5KOJA 2VN8A 3STWA 4X3PA 3RRNA 1DBRA 5K0CA 2I2WA 4FUTA 1SC3A 2FWAA 1NY5A 4DJAA 2ACKA 3CZAA 5L4NA 5JS1A 3TOCA 1Y4UA 4UTPA 2JGIA 1P8AA 1GZ6A 3C6YA 2G70A 1LK7A 3WRVA 3X1DA 2OBNA 1W55A 3E6AA 3H97A 3S1AB 3K9NA 2VHZA 3F4BA 1GSAA 3UFBA 4BTEA 3PFHA 4OB6A 4HPWA 1YFLA 2BDTA 3ZS9A 4TM7A 3K70C 1EWRA 3LJKA 3LUGA 3B8EA 4JODA 3AIMA 5SY9A 1NVVQ 1IDN1 2JL1A 1JJFA 4KVFA 1E3TA 1E5TA 1RYHA 1G17A 2QE6A 4S1TA 1P60A 2H1LA 3B3QA 3LGSA 3OMWA 3D5QA 3WL6A 3PD1A 3IDFA 4H1UA 5DRTA 4YX9A 4F97A 3PEYA 4CEIB 3SYKA 5H3LA 3COWA 1D0VA 3W2FA 3BWVA 2HTFA 3ZHSA 1KRWA 2OHXA 1GZ5A 3QMWA 5EEHA 3B6MA 2YFQA 2VAXA 3QI7A 1ADGA 2DC1A 3U4IA 1MQ9A 1NJ8A 1T0AA 2AOUB 2JK1A 1ECJA 1GSOA 4J29A 4JP3A 4ZJPA 1YL5A 2Y1KA 5AW2A 3BM5A 3UXMA 4C88A 4B4KA 3F6BX 1J0CA 1DKPA 4OBBA 1B73A 4U7PB 2QBYB 4DY6A 5LMZA 2MU1A 4BWGA 2CJYA 1T6ZA 1V0JA 5DHAA 2RJ3A 2WJAA 1KA9H 4Q16A 1HE2A 1KYYA 1UM9A 1XZFA 2EBUA 4PCAA 3CRRA 4ES6A 1NOKA 1ZMXA 2WP8J 3ITKA 2A9QA 2FZ5A 1AZTA 2WG1A 5GVSA 3FOFC 1M6EX 3QKUA 4KN5A 2Q0XA 4QA9A 5DBIA 3HJHA 5IF9A 1TU0A 3R1IA 4PAWA 1X15A 3C4JA 5KQLA 4DJDC 1T13A 5CTJA 1NQVA 1T8SA 3WGJA 1ZHHA 2VAVA 2CFSA 3HN2A 2I4MA 4IXWA 4KTTE 2VHXA 4XGRA 5DI9A 3DSRA 1SEPA 4BX8A 5GP1A 2JFHA 4F12A 1PUXA 3TLBA 4OIFA 4JNKA 3TJRA 1YS9A 4FGJA 5JCXA 1FVFA 1F5NA 4ND2A 2EL7A 4V0KA 4N8SA 4FEAA 3UHJA 4CU5A 4F11A 4R2HA 3MD9A 2YASA 3GV0A 2B9EA 4OJTA 4XWKA 3WE7A 3GVCA 2WWFA 2O19A 1HMPA 3QKRB 4KIGA 4QYXA 2CT8A 2RGEA 4QGBA 5BWNA 4JL5A 3EGEA 3HSKA 4CIWA 5BSRA 5FPKA 1BS1A 1UPAA 5SYAA 3FPCA 5FIUA 4KQ9A 3ROMA 1VQ6F 4S24A 2O7SA 5IEJA 1IXKA 4ZQEA 1KVSA 2F6RA 2SBTA 3FZEA 5KDLA 1E79A 3SJUA 2W93A 1P7YA 4EGSA 1FSZA 5JYEA 4X60A 4BKRA 1HDGO 5H16A 3WRXC 1D8TA 4A4DA 1LS6A 4F9GA 1PV2A 2ILVA 5CVJA 3HO6A 3M84A 3AI2A 4L5JA 3E9CA 1W47A 5IAOA 1ZH2A 1SBTA 5AK4A 4RCZA 5HZMA 4TVBA 4LY9A 1NP7A 3NR2A 4MVJA 1GPDG 3K1ZA 3SVZA 1OVGA 2Q0SA 3BWDD 3LPDA 4NEHB 4Z4QA 1QO9A 1QGZA 2MSDB 1KPIA 4R1MA 2CW4A 4C1NA 2FK8A 3U7JA 5IASA 9MHTA 4R1QA 4JXJA 2ECFA 1OXMA 2VDRB 5LZ5A 1P2SA 3E03A 4RETA 1DKOA 1ZKDA 4HUQB 5TMEA 2GDJA 4BEVA 3WHIA 2HJ9A 3ZHXA 4QD3A 4RDHA 3HB9A 1QH1A 2G72A 3N0TA 4LJ6A 3PQ8A 3AY6A 4YRGA 4HYEA 3TQOA 1DIOB 1U7HA 1M3SA 2K6GA 1P0CA 3COVA 3OJXA 4MUJA 1SCAA 2IYWA 4WDQA 5LLSA 4L2IA 2AKEA 2KPOA 4MQMA 1ZCZA 1KBZA 3GUZA 1PVOA 5LB4A 3OQBA 2OHGA 3EZXA 1QB7A 5D5QA 4MKRA 3L8DA 4PV7A 4EITA 4GYWA 5C7LO 3KEOA 4QPZA 1CEYA 4RDIA 4LDNA 2VDNB 2AJ8A 2V6FA 5HF8A 1KYQA 2ONKA 3LMKA 3CLUC 4JITA 2JG3A 4EA8A 4KQIA 1C7FA 5L3VA 2DH5A 2FX5A 2VHCA 1WXIA 1RI4A 2CHUA 4PC3A 3CF4A 4N3NA 3UA3A 3OPNA 4TTAA 4ZV4A 1Y48E 1ZLXA 1KXJA 3FNFA 4P35A 3QELB 1O77A 2DKFA 2ZSFA 4BY9E 1K3TA 5JARA 2JJ2D 3GA5A 3LWZA 4QDXA 3FUXA 3AF1A 1T2AA 3NASA 1C1DA 4YJDA 3K7EA 2B4TO 4RH3A 3B52X 1T8PA 4D8YA 1ZSVA 4IZ6A 3T7AA 3ZR4B 4AC9A 4JT8A 4YRBA 5JNVA 1K5PA 4QXMA 3WLAA 4OL0A 4WLUA 3G89A 4B3TB 1NKSA 4GMKA 3VR2D 4HTAA 2CCGA 4C6TB 2C7VA 3CBQA 1OKKA 3AO0B 3IBGA 5EL0A 4G5OA 3VXKA 3BS4A 4MROA 4RNDB 1NI3A 3HSYA 3C48A 4R81A 2Q6IA 1KYZA 1CV2A 2UYNA 2XGGA 3CIFA 3LF1A 4GE3A 3WJ7A 1RXVA 3WRYA 3KHTA 5D5PA 5AR1A 2FUCA 5FV7A 4YB8A 4MWZA 3RI3A 5DYWA 5KHOC 3MOSA 4MP6A 2OTJF 3BREA 3PPVA 5GONB 3U9TA 3GFOA 3AUJB 1PXWA 3ZDYB 1Z4OA 2GZ2A 4B81A 3EIFA 1E2EA 2KWIA 3I0MA 4IL5A 5CRIA 1HYGA 4TT3D 1YWGO 2C31A 2XH8A 3H9BA 3SJCA 2QL5A 3AH8A 1CJVC 2O8NA 3RYIA 4X1IA 3A3NA 4KR7A 4MB0A 5BQXA 5C5DA 2BBWA 2WLSA 4EKGA 3DQQA 3PWKA 6PFKA 2QUBA 1OF1A 2PKCA 2VZ8A 3HSSA 4UD2A 2BFBB 3ZW7A 2WHPA 1FQWA 4AKEA 1J21A 3U5TA 3WA6A 4JIGA 1CZKA 4J3NA 1F5SA 1WBJB 2WVAA 1XHEA 2FWRA 5LYJB 3HP7A 5AW1A 3JALB 3VR4D 4A6PA 4MV3A 1GQQA 2O3SA 3L6UA 4DA9A 1QHXA 3MRTA 3P0FA 4FE4A 1SRRA 2LKDA 1E3MA 3IHLA 4B7CA 1VQ4F 2BFAA 3Q7EA 5FI3A 3KD2A 3MTDA 2X2OA 4PGAA 1LW6E 2ENWA 5TMPA 1V71A 3EY4A 5AVXA 5JYBA 1P0FA 4QE3A 3RAPR 3QEKA 5BPFA 3K9HA 4OBWA 3D6UA 4IX9A 3URKA 2E4WA 1M1YA 3W79A 2YNMA 3DDSA 1W57A 5KYVA 2R97A 1MPTA 1DT9A 4D9CA 2HS3A 1X13A 1Z0SA 5IDXA 1TC1A 4K0RA 3IEQA 4MWBA 4UVHA 4BVBA 4CMKA 5BMOA 1IY9A 1LRLA 3H6KA 3DM5A 4CT0A 2R7NA 2BEJA 2TMDA 4EFDA 3R5XA 2WSSA 3NANA 2V55B 3O8OA 4LTDA 3QA9A 3DTVD 1WU8A 5JCPA 2CF5A 1N3YA 3UK6A 4CM3A 4CXMA 1Z5ZA 4LRUA 3RS7A 1Y80A 3R75A 1VE6A 1ZJ4A 4JCOA 4E4YA 1SCDA 4S1NA 2G0NA 1SBZA 4NNOA 1SVKA 1LF5A 5JDCC 3TTVA 5CXQA 3E0XA 4LXUA 1NJ1A 1XRLA 1ZJJA 2W6MA 1Y5LA 4P2GA 4KBGA 2EW8A 3BCSA 3PUKA 2VH1A 2IYEA 3IQFA 2X0RA 3E20B 1PVDA 2D0IA 3CKKA 2SKDA 5JDIA 3LM8A 1RQ7A 2GZMA 5A2QA 3FUTA 1Y5RA 3I9KA 1EZ1A 4F4FA 1LI7A 5LQUA 2I78A 3AEUA 3X2EA 3THWB 1LPAB 1G60A 2CXQA 1BNCA 3LKDA 4MS1B 1MO4A 4WNCA 5C1IA 9GPBA 1RPTA 2P68A 2NU9B 5HZKA 1TEHA 2CE7A 4I8IA 2UUCB 4JC0A 2FG6C 4LBVA 4QHTA 2CMDA 3D1VA 3NIDB 3ASYA 4D25A 3GFTA 5IM4F 1U2DA 1AK1A 3I2GA 3IVMA 1ESDA 1IQ0A 1WMAA 1HEIA 1WU7A 5A0FA 3A6DA 4EKDA 1NW9B 3PA6A 3LPLA 1G4AE 4IQ8A 4LCBA 2VXCA 3T99A 3UAWA 2RHTA 4TKUA 5ALKA 2XNSA 4R8LA 4AWAA 5BP7A 3M1YA 5KTPA 3NTUA 5LR6A 5FLXA 2GGSA 1UI9A 2QLTA 2BCGY 1NW7A 1UFVA 1WS6A 1XLTA 2DUMA 2VLBA 4M1YA 1KEEA 1T3SA 5I7SA 3WMFA 3IAHA 3KTAA 3IEVA 1TIKA 1RYBA 4RZ2A 4C4RA 4DG8A 2QRHA 1LB1B 3TRJA 1LBSA 1PT7A 3GDHA 2ANBA 3D2BA 2GD0A 4QQFA 3SIPA 3DLPX 1NVMB 1U0NA 1V9SA 3MA0A 5JSUA 4O4IB 1T3HA 3I2IA 1V4NA 2ZPTX 2AMFA 2Q07A 3K2IA 5HQJA 2D1FA 1NMYA 1I5EA 5B7NA 2BJHA 2JBAB 2H2WA 4C4PA 1NY6A 1R4NA 2UYQA 2QRQA 3B53X 4U9UA 2O0HA 2XB6A 1GUZA 3CH5A 3IPAA 4LXTA 1NONA 4KU4A 1TW2A 1E6UA 1NE2A 3FOBA 3PWSA 5EERA 5GGYA 1GUAA 1KI3A 1YDWA 2R25B 4NZ9A 1R16A 5CEEA 1WXFA 2ADMA 3PUXA 4BB0A 5KVCA 2FN7A 1MH1A 1UK8A 3TIVA 1MDFA 3PJRA 4JLBA 5CLJA 3EX7C 5JR3A 1XF1A 1SHKA 2CNNA 2BD0A 3BGSA 4TL6A 5EVJA 3RV3A 3L79A 1M10A 2G5TA 4AS3A 4DWOA 1YOVB 1DSSG 5AW4A 1SXJD 1M0SA 2QTHA 4DCUA 5T3YA 5K2MA 5K5EA 5BSMA 3WLSA 3UJHA 2OWDA 1BHJA 1NQTA 4QYIB 4WFIA 5GOTA 4JI5B 3KBBA 1KK1A 4IJ5A 3N9IA 1GPJA 4YGXB 3WIOA 4B4DA 5FX2A 1S0UA 2HJHA 1LRKA 5KOHB 2ORVA 5IABA 4QYMA 4CIVA 3T15A 3KJEA 1USGA 3QBEA 1AHPA 5ALMA 1UPCA 3E53A 5JCOA 3B9QA 4RJKA 2NIPA 3K4HA 1E2FA 4UBLA 1OX6A 1EZZA 1L4KA 1SD1A 3FCAA 2HJGA 5ITZA 2YTZA 4XCXA 2XTAA 3EDRA 1S6YA 3SEFA 4BQNA 4DPKA 4J7CA 2BFFB 2C5AA 5D3ZA 3TAHA 3VPHA 2C77A 2O8EB 4EYOA 5CYFA 4JBGA 1X7PA 3VTZA 1KEUA 2GZAA 2ZB8A 3S2ZA 5FP0A 1WNTA 1ICIA 3TLCA 3ZE8A 2W0SA 2NU6A 3DHEA 1ZCJA 3UM9A 3V4LA 1BROA 2PKRA 3TQIA 3PV0A 5SV2A 2IP1A 4HLUC 1DVRA 5GIPE 1S7GA 4EG1A 5JXIA 3QLTA 3WBBA 4TX1A 5AKHA 3TUZC 3NGMA 3ZV4A 4C8IA 4I4CA 1N2CB 1EK1A 5BQPA 4Q1EA 3RA5A 3SS9X 2CJWB 1H1LA 3HN6A 1ISHA 1N7HA 1W96A 4ZANA 4QO7A 3GRRA 2G8LA 5EPUA 1A9RA 1QAQA 2HXGA 4M4SA 3SQOA 3WXBA 4KMRA 4G37A 4YV2A 3PFGA 1ZUWA 1XZHA 3M5CA 1DAFA 3BH7A 4RPKA 4RKWA 1Y6FA 5J58A 2I6GA 3F0TA 1U5CA 3CEPB 4O8CA 2I7CA 3PQ5A 4EHLA 1RZRA 1XK6A 3AVQA 3K8YA 2HMYB 4TYMA 4II2A 4GPEA 2CL6X 2RC6A 4IFIA 4D2IA 2OB1A 4JLPA 4KJZA 1IWPB 4UUPA 4GR9A 2G40A 2OPHA 5EGNA 3BRCA 1DX4A 4DLPA 3OTOB 3MHPA 4FB4A 2CZCA 3KVRA 4PZZA 1A97A 1LDYA 1SB8A 2ZIEA 2FZWA 3WQRA 5BMVA 1KR2A 2HJSA 5BW5A 3C5VA 3DCJA 1VKNA 4CDNA 3Q72A 5CG1A 2HV9A 3IR7A 4M0EA 2J0SA 2UAGA 2IKSA 2WYWA 3IE2A 2WVGA 3P9PA 1YHQF 4JP5A 4YQYA 5J1TB 4LJKA 3WMRA 2ZIGA 3ZKAA 4DNOA 2DE0X 2NZ2A 2EW1A 2NSJA 1W2WB 1WLYA 5LNK6 1XU9A 4AS1A 1OW3B 1VYUA 4YC7A 4H59A 3PGVA 3C3CA 4YDRA 5E6UB 5LWHA 3D8SA 2WJ6A 1MC8A 2CDBA 3KQTA 3VOSA 4FQ5A 4LY0A 5LDDC 4AP5A 3LWQC 1MW9X 2DH6A 2I3ZA 1C3XA 1LPSA 1YGPA 3G82C 1UMCB 1UKCA 1RP7A 2D0DA 4IIYA 1TJ4A 3DW3X 3SM9A 2FN9A 4RDXA 5CVUA 2QNIA 3WDKA 2ZJ8A 4JVNA 4KO8A 5K6AC 1AB6A 1LWNA 1SUEA 1X94A 2YXLA 3NWPA 4Q4HA 4B3FX 5CEFA 4DV4B 3CPEA 3MUOA 4G85A 3TNJA 4BQSA 1HDZA 1XN1A 4DRYA 3DR5A 3MBIA 2GRAA 2ZZNA 3RFVA 3GCDA 1AX9A 3VSCA 1GLGA 4U5QA 1A5TA 3HFGA 4D1YA 1FXSA 2HRRA 5GIPC 1MBZA 2A9JA 2BL4A 2MMCA 3AESA 4TN5A 1IV4A 1N8SA 5DGIA 2P6MA 1XLUA 3F3YA 2VJMA 5B36A 5HR5A 2ZTHA 3IPRA 4BO6A 1N0VC 2YMMA 2PUTA 4TSFA 3ZWPA 3IUSA 4HN9A 4KQHA 1I3MA 2XIJA 4FR0A 4ND6A 4UCFA 2JD2A 1HQYE 5BUQA 2JJ8A 1U1DA 2ZBEA 2YY7A 3JPYA 3PD0A 2HA2A 2HA0A 4RJJA 1JHOA 3R0VA 3EZGA 4KE6A 4B2LA 4KIUA 2QK4A 3L0YA 4CCYB 3EY9A 5B7GA 5A7FA 1F2TB 2H2HA 3ESAA 3EWNA 4LQLA 1V16B 4HAYA 3ZTWA 4AQYB 4D6YA 4O4JF 1FB5A 1FJHA 3A9VA 1B26A 2UXBB 3G6WA 3S40A 1XU7A 4AURA 3T5DA 1Q44A 3T1VA 3ETNA 4DCCA 2Y1GA 3FPEA 3W04A 1O94C 3UEOA 1ISFA 2XRMA 4M7OA 4OHOA 1XWIA 4WBXC 3U7GA 4I6GA 3F8SA 1DEOA 1G59A 4M1WA 3F9RA 2H1RA 2O06A 5FA8A 3UGQA 3TR6A 3S8YA 4HF7A 1LV8A 3SMQA 2JGMA 4PCUA 1VE1A 4TGLA 1Q8RA 2FZ4A 4K8RB 5EHIA 1N2BA 2PHZA 2YW2A 3UJ9A 4RENA 3Q5GA 1N92A 4MI9A 4Q00A 5FOSA 1LDBA 3N0VA 5CIYA 3GCGA 1VCIA 1I2CA 3COSA 4ML3A 2Q62A 4ZOLA 1FVOA 2VRCA 4FOLA 5EFZA 4IIJF 4EY3A 2W2OA 3IUPA 4HEA6 4KV7A 2I71A 3HU3A 4L7VA 4Y6RA 5AW8A 5K8IA 4FGKA 1BAPA 1H8ED 3HFSA 4E2WA 4CEHA 3AERB 1XQVA 2QEQA 2VUHB 1X2EA 1A8IA 1XZMA 3JZMA 1DAKA 1CD5A 2CLFB 3NORA 2D3WA 2CHFA 3U26A 4DM3A 4FKZA 2H8EA 3RS2A 1S3FA 1K7XB 3FWHA 3JQBA 4RGVA 1JDPA 3B20A 3MJRA 1WW2A 1UBNA 2GPWA 1U7OA 4OFBA 4QXQA 5AM5A 5J2UB 1G2IA 2ZJBA 1UOEA 4C7XA 2LP4Y 3RTDA 2FKNA 3M6AA 1STOA 4Y6GB 5K0LA 2JLWA 1BKDR 2UVPA 2NV0A 1D6SA 3H8JA 4UNQA 5DGDA 3RQIA 2F62A 3VSDA 3ZHYA 2IHUA 3LXUX 1CUWA 1YE5A 3BERA 3R0PA 4TZZA 1JKIA 1EIWA 4IFTA 2ZI4A 5ARDA 5BYJA 3ZI7A 3ZE9A 4G1EB 4U63A 3BWXA 1TEXA 2RHBA 1EFRD 3LO8A 4F9EA 4IKOA 5LZ8A 5HQ3A 1G20B 1DUIA 2P2NA 3KKPA 1KIMA 1R50A 5BQOA 4C04A 1LDNA 4Q1VA 2FZKA 4QECA 3GJSA 1PVVA 3IRVA 4BAZA 2CKMA 2RFLA 2V8OA 1DOHA 3B5JA 5I8ZA 4RADA 1SXGA 1C2TA 1D0SA 1PKEA 4YRRA 2VQFB 2Q2VA 1ZKMA 3WL3A 5KREA 3OJ0A 2AK2A 1KE2A 4G8BA 4BNNA 3ND8A 5AVZA 1DIRA 1QB8A 1G5TA 1OBCA 4L4ZA 3V33A 3KVYA 2I22A 2JFOA 5AESA 1ZC4A 1D4OA 4HDMA 2EIHA 1P1JA 3DOCA 5FOXA 5L7TA 4PG4A 3CUYA 3R3YA 2C5HA 1VLHA 4CCWA 4KVGA 1NQOA 3DZKA 3VKFA 3QBVA 1R0KA 4JC5A 3T4UA 3PHCA 1A72A 4DL9A 3Q3JB 3OAAD 3M6MD 1S2IA 4L3VA 1M67A 4IIGA 5AMXA 5CT5A 1VQ1A 1DUVG 3U4CA 2PUVA 1VPWA 4BRSA 2MMGA 4WJZA 1CZRA 2DTXA 5K8LA 1IN1A 1NMZA 2PT7A 3PQ3A 1ODJA 1E3DA 4S1PA 2YVLA 1XTPA 2QDKA 4QSMA 4ZD6A 4X20A 3MPUA 1DB3A 3KR0A 2GILA 1Z88A 1KQOA 3Q4GA 5GWXA 4EHKA 4LXIA 1I7QB 2D00A 1NLMA 2F1OA 5EVCA 3KOZA 4HDSA 2X8BA 4PU0A 3OE4A 1COWD 2MSWA 4PPQA 5J4LA 1L4UA 1VG0B 5DNYB 5EPOA 3K0BA 2XYQA 2O7QA 1KI9A 2VK1A 3N1UA 1KEPA 2LCIA 4WQMA 4Q03A 4IIEA 1ATZA 1DDIA 2XNHA 3O8BA 4JS0A 3RNOA 1E9VA 4B40A 3DD1A 4PX5A 3ZN2A 2QRMA 3LY5A 3MGKA 1MQAA 1DL5A 2JIZD 5HJ5A 5JSFA 3U9LA 4AAYA 1O08A 2PRJA 1WZUA 2B1JA 3D81A 4W6ZA 1L5SA 1YMVA 3CEMA 5K4HA 1FFWA 1Z56C 2GPJA 3H84A 1RHKA 4PPFA 4REQA 2CNWD 4AG6A 3AFMA 1G38A 4H27A 3BYZA 1XMVA 4FHEA 2M6LA 1RD4A 2ZAUA 3CCMF 2IOQA 3QY0A 4S1OA 5H02A 3QWFA 3EUWA 1GU1A 2Q5QA 3I6IA 5IVKA 1VQPF 3RAJA 2Z56A 4K05A 3V8VA 4BBZA 3CGGA 5B12A 3UWMA 5C5EA 4KRFA 5M29A 2EFCB 3MWEB 2EWCA 4ZCRA 4W63A 1Q1GA 2ABWA 3DFKA 1GX1A 1T5IA 2CXTA 3IV6A 5CT9A 3VU9A 2H48A 3VI3B 1DG1G 2GXSA 3AYXB 5NLLA 2HSZA 1IV2A 1QCYA 3Q8KA 1YQNA 1X7XA 4G4GA 4UE2A 3PL5A 2GZ1A 2J5KA 2JVKA 3L5KA 4YP7A 5CX1B 3W5JA 4BS9A 4ZHQB 1M0TA 2I33A 4G4JA 4WACA 4YT4A 1IHXA 5BN5A 2UV8A 3VR4H 1Z8DA 1T36A 5JCOC 1RXUA 5JQGB 4AVYA 3TDNA 3ECCA 2XDQB 4JENA 1JH8A 3ELCA 1RZ3A 2C5EA 4R1SA 3JATB 3F98A 4X6UA 5F78A 3VH4A 5JPDA 2ORWA 1YE3A 4EGCB 4B7ZA 3FD5A 1BIFA 5LOVF 1UBLS 4DLTA 3SQXA 2KHZA 2PFKA 1MT3A 2XA1A 3LXRA 4L5YA 1N8RH 1LQUA 2YS6A 1GL7A 1JA1A 1K6XA 3U3MA 1Q57A 1UJCA 1XD8A 1CQWA 2R68A 4IO0A 4QFBA 1E7QA 5I9IA 1LXCA 4C07A 5LBIA 1O97D 1CE8A 2W90A 2H06A 3E3LA 5H3HA 4Q0MA 4UMDA 2Q3EA 4IGAA 4A8JB 4RKQA 1H2WA 4XPIB 3E70C 1MJNA 2C7QA 3TM4A 3PPXA 3K31A 2EOAA 3RVBA 3ZY2A 5H8WA 3KNZA 3G7NA 1F3OA 1WCIA 5LCXA 3RWBA 4LUCA 3GP3A 2X40A 4GL4A 3T9EA 2PSJA 4DBLE 2BI8A 4R51A 9ATCA 2D5LA 3CO5A 4ZJUA 2JGEA 4FWIB 2EKBA 2VDMB 3OIWA 4CLRB 1YB1A 2ZJYA 1SCKA 1USKA 2KW5A 3BXXA 3KX2A 2HGZA 1XXHE 1COMA 3VC3A 2Q29A 4GKJB 1I3KA 1L5QA 1T4GA 2OL4A 4ZV7A 3R8XA 3QX9A 4RFSB 3Q5DA 3SU8A 2ZUFA 2FPIA 1U8YA 2C7OA 3NHUA 1ACMA 2ZAIA 3GGJA 4FX2A 4Q4LA 5KPJA 1JSZA 3P32A 1N78A 1Q16A 3QVJA 3LC7O 2YFHA 1IQUA 2HGSA 1B2RA 4KXWA 5AK3A 3CZMA 3WGZA 1T8TA 1WPQA 2OCBA 1HDXA 3KXLA 2AI3A 3ANLA 3DCYA 3LQFA 4MS4B 4UM7A 3B2EA 5EYPB 5JS7A 4Q47A 4UEOA 3ZGXA 3WXMB 4X61A 4D4LA 3PQ4A 1EM6A 3H75A 4PO8A 4U2KA 5D5HA 3RREA 4ZVQA 3IQHX 4ZOQI 2XCRB 2ZRAA 1QRSA 2WUVA 3D3KA 2XAUA 4BLSA 5JXJA 4LOIA 2JLXA 1K97A 5TQJA 1ULZA 3RLIA 3NH9A 2C29D 1ZESA 4MIYA 3ZCUA 1IHYA 2M2IA 2IDJA 4NNPA 1AMNA 5EHNA 2PWBA 3MBMA 4YYEA 3BGWA 2EW2A 3JZIA 1PT8A 1W2BF 4EUSA 5CG2A 2JLBA 5HP7A 5BSEA 5EJEA 5IAJA 3U61B 3IULA 1YK0A 1UANA 4ZK6A 4RULA 4KAJA 3J80A 3H3XA 3FAKA 1Z73A 3C3XA 2FUEA 3SKVA 4C4WC 4JLSA 2RHGB 4Z6KA 3GRUA 2ZT7A 1ODSA 3ICWA 2BRUA 4CLDA 3KSMA 3M6WA 4DN6A 1GCOA 4J76A 4Q6WA 1IWBB 5A3RA 5C32A 3T1QA 1QYDA 2BFOA 2REQB 2ZVDA 2WFAA 3C7AA 4GIBA 4XOIA 3SQLA 4RTNA 2WTXA 4RPHA 5DWDA 4N8DA 4UCWA 5SZKB 1IN7A 3AC0A 3RTBA 1VCNA 3WIBA 4NRDA 1NNEA 3V8PA 1XHLA 4X45A 3ZDFA 1Z4IA 5BNTA 2FMTA 5IKEA 2EHDA 4KPGA 3BXPA 4HNVA 1J0DA 3KQNA 2IYPA 3P27A 4MUFA 3GLIE 4V1CA 1W85A 1Z2DA 3CYQA 1DXHA 3BGIA 4IRMA 1EFDN 1Y4SA 2G0TA 2IHYA 2LXNA 3HJTA 2LGJA 3DGFC 4LYHA 3RYCA 4HX5A 4MCHA 1Z0IA 1JDTA 2A3NA 2NYRA 4KO3S 1KK3A 4EI2A 5E7QA 4CM4A 4DBLC 3FPHA 3TNDA 1YB5A 3SC3A 3HP4A 2GFIA 4EI8A 2ZM6B 1G98A 3SCZA 5DLYA 1H66A 1E1CA 1W0CA 4ZOBA 1N2CE 5HIIA 4BVLA 4MYHA 3U09A 2HADA 1PS9A 3LDFA 5B2FA 1YZTA 3A6LA 1ISGA 3QHQA 4U7GA 3FLBA 1F8XA 4QNMA 2E1PA 3OUTA 1W5SA 2VC2B 3DO6A 2F3UA 4FP9A 2D4HA 1T43A 2EQ5A 5TMDA 3A4MA 4B87A 3WSWA 3HJFA 4DQKA 1UBCA 4ZIRB 2AE1A 2QT0A 1ND6A 4LHVA 3GGGA 2AD5A 2R8EA 3REQB 2QN7A 3VU1A 2ZK7A 4KAXA 1E4EA 3PI6A 5DT9A 1M1NA 2D2VA 3TDKA 4BO9A 1UBTS 3HMQA 1GV0A 3RLFA 4C0HA 4B3MB 1XROA 4BV8A 2H31A 2KTVA 2QQ5A 1U3PA 4Z1MA 1DUSA 2A9OA 1ZWKA 4LZOA 4OSPA 2CV1A 1RXSA 1RAFA 4HDRB 2OCPA 3RUAA 3UJPA 3UC5A 2JRLA 2QJRA 3GP8A 1ZHOA 4Z7QB 4WMLA 4E33A 1TTHA 2B8EA 5KWVA 1L8OA 4K7JA 3M3PA 3ICVA 4PYJA 3IBCA 1TZCA 4QYWA 3BN3A 4XUEA 4WKNA 1SBIA 3LF2A 2CWJA 4QUIA 4CG3A 2H4JA 2R47A 3G4SF 5C1BA 3ZNPA 2DOKA 2ZYTX 1IVNA 1YRAA 1D1TA 2HC9A 3JQBC 3OZSA 3PYXA 2B25A 421PA 3L49A 1ORDA 1UC5B 2CLHB 2IZ5A 3AETB 3N6XA 1E64A 1R4ZA 1T5LA 2PO7A 3KVVA 4DMLA 3TF5A 1VKRA 2CNBA 1FJXA 1CIVA 1J5XA 1QZZA 2CL5A 4FXPA 2OBYA 2WAAA 1M5TA 2PMCA 1UCFA 3A3KA 4MVXA 2WWWA 3VU3A 4U3JA 2ANCA 3RT1A 3OO0A 5ELXA 2DQKA 3DP9A 3HUEA 1SC1A 2C9OA 5LKAA 1ISRA 1NP3A 1PR0A 1VKOA 2XYHA 3A9CA 3X43A 4J8PA 4Q9NA 5DI3B 2J0UA 1AXRA 4PQEA 3RSFA 1JJ2F 1X7WB 4MEBA 3M6VA 3EYAA 2IYZA 4LA4A 2ZS7A 5BV1A 1N25A 4Y7CA 2GLXA 4LZLA 1XA4A 1EWTA 2HK9A 4IICA 1MRNA 4X8HA 2VS1A 3WJAA 3LL4A 1JB9A 1V8ZA 2J07A 1CQPA 2FW6A 2NZJA 2P3QA 3JZFA 3R3HA 3RCBA 4MITA 1CY1A 3F3SA 2P35A 4OKNA 3WGYA 4DSNA 1ILWA 1H65A 5CIWA 4KQ6A 4XIFA 5JWRA 5EG5A 1N6IA 3GRYA 2NW6A 4HTFB 4TS4A 4C22A 2AFHA 3U81A 5HEKA 3B6ZA 2A1UA 1SOUA 3E5MA 2PNJA 3S3TA 1RE0A 4MQBA 5GONF 3DE2X 5M04A 3P0IA 1PR1A 4IEIA 4O08A 4EEZA 3QUTA 1P4AA 4Q37A 2P9QA 1WDWB 4DV7B 5A05A 5DCLA 1U80A 4ASUA 3ESBA 1JIIA 2DFVA 1GYQA 2Z4RA 1JECA 1P9OA 3TKLA 3NTVA 4L8WB 3ZLJA 3KIPA 5CCEA 2REXB 3DV0B 1ULUA 3OE7D 2BELA 4BKUA 4A9AA 4NBTA 5IH7A 4UBNA 4DG9A 2IIQA 3W2EA 2NVUB 4YCJA 3ROXA 4WZBB 2HF8A 2J7PD 4B3SB 4OJKA 5E7MA 3UGKA 5C37A 1U0FA 4DMMA 5LYJF 3IKLA 1H2EA 5B1YA 3WGQA 3L7YA 4UHBA 5DLDA 1PWEA 2R7KA 2UYOA 4C0XA 5A4AA 3OEED 3HXOA 1PJCA 3KAPA 4TSRA 2JF0A 3G8BA 1KC8H 5ENZA 3D7NA 4B32A 5B4VA 2QUJA 2C2OA 3EXFB 4QNRA 4A6DA 1Q0RA 4BVGA 1P2UA 3DLTA 3O1IC 4WJKB 4A15A 2CLMB 4KPYA 4ZFNA 2VBGA 1ORVA 1C4OA 2ZETA 4WXYB 4C1BA 4KLNA 1NSFA 2QGNA 5LIRA 3NMUF 2FETA 3LDTA 1D0IA 1DU4A 1L9XA 1R64A 4Z49A 3HRHA 5IXJA 3KQHA 2AFIB 1EFTA 1ZUHA 2OV6A 2AF3C 1ZXXA 2VYCA 2E1RA 3UJ6A 5LP6A 3NI2A 1EMDA 1RM3A 4MV8A 4MQ4A 3D7KA 4M38A 2Z1FA 1WXXA 4GOOD 4AJOA 5EJ7A 3P9RA 1W35A 3ETDA 4TMVA 3VGPA 1FDVA 5JFGA 5A62A 2ISCA 2PPVA 3AFGA 4NFHA 1KEWA 2O8CA 2BMAA 4JBYA 2OAP1 3ZI0A 1QE3A 1QTIA 1BXGB 1RWNA 2GA8A 2IX9A 4NY1A 521PA 4BFCA 5IT5A 3BFVA 1H2FA 3ADDA 1XVAA 5FQNA 4KDFA 2QR3A 5IWCA 3HB1A 4LI3X 1VMDA 2ZU0C 1K8AH 1Z29A 3ZHOA 1QP4A 3EHDA 1B15A 3UHAA 2PL9A 4UDOA 2OQVA 3V55A 1O7JA 4DEXA 3GEIA 4GE0A 1NUPA 1OI4A 2GBCA 4ND8A 2ZOSA 4C87A 1QVWA 3WYFA 2Z8ZA 1IXZA 1BVRA 1DKQA 1PO7A 4MUBA 5FFNA 4QODA 4KITB 5L8VA 3QLUC 4LHSA 3OM0A 5IM4A 3ZBUA 4M9XA 1Q95A 1JEYA 5AJXA 3DHNA 3JWPA 5G2OA 5GTDA 1SR8A 2LBXA 2BHRA 3GEEA 1Y9DA 4QKQA 5CD9A 3NTLA 3O8RA 1ORIA 1WABA 2UZ3A 5AKJA 2RONA 2R8BA 3UJAA 1CQIB 4PYIA 5ITSA 2AKAB 1BN7A 3HKDA 4DG5A 2FB9A 4QFCA 3I01M 4ZVLA 3BGDA 1IYZA 1TK3A 1D2CA 1QIKA 2QI2A 1XTZA 2OCKA 2NPIA 3IIEA 4QPJC 5JXWA 5KWIA 1FBTA 1GAXA 3A31A 2YZGA 3OIFA 1JPNA 2J3HA 2ZGVA 4J1QA 4PGMA 3JAKB 1B6TA 4Y3UA 3QOYA 3ZIDA 4R8SA 4I0WB 2QQFA 2Q4OA 1THMA 1QLWA 2HO5A 3IP8A 3LZ6A 5U4XA 5K9ZA 2INGX 3FCOA 4OP3A 4PWZA 2ZXEA 2QF7A 3ISJA 4NZZA 2QRVA 5ALUA 3DAPA 1U8ZA 4CR6A 3GFFA 3K2XA 4MWEA 4EATA 1JDBC 1Z5PA 3OQMA 4C5CA 3QEBZ 2QJWA 2XA2A 4O4IF 1GU0A 1VB5A 4PLCA 4RCYA 2OQIA 3JQFC 2B35A 4H6WA 1QMGA 1FK8A 1EVKA 1SC4A 4WESB 4V0LA 4F3NA 4Z5XA 2F55A 1O0CA 3KB2A 2SECE 4TXNA 1SHTX 2O5EA 4NBUA 1J1UA 2FCRA 1ID1A 5KX5B 3NT4A 3WYNA 1B1AA 2PR2A 2Z30A 5JU6A 1G1MA 2IHJA 4F56A 1BX1A 1SQ0A 3S2FA 3BWBA 3CR8A 3VR5D 4HAWA 2W58A 3E2PA 3NTRA 3V48A 2LZ0A 3ACBA 2WSYB 5DGHA 5BNIA 2VH2A 1L7QA 3GLRA 1HFKA 2QX9A 3BB4A 3UAGA 4GDFA 2HRZA 3U60B 4LHWA 3KD3A 3TTUA 3SD7A 1NGSA 3HGTA 3KS9A 3KP1A 3CJTA 2Q8QA 3PLRA 4IH4A 1IOWA 1ZD3A 2OHVA 1P5RA 1SIUA 2B78A 3AIKA 3DVAB 3F4LA 3H3JA 3OEHD 3P4XA 4TTIA 1GDHA 1QH8A 1H5QA 1NJ6A 1N9GB 4MWGA 3SPXA 3BWCA 3UMSA 2CXHA 2O5VA 4L75A 1VI2A 3WGOA 1NKTA 3T6KA 3VR6D 2QMYA 2MIIA 2EJBA 3DC7A 3GZTB 5G4UC 4EH1A 1OB2A 4YPOA 3JVHA 2AWOA 3C9UA 3BJZA 3E9ZA 1PP4A 3HCOA 2WSBA 3K0AA 4K8OA 4Q4AA 4WXMA 4EJSB 4UTVA 2Z2XA 5A0TA 4UNPA 3VOBA 1VHLA 2F67A 3KJXA 3PIDA 5TS2A 3TTXA 4FZRA 4MPDA 4COOA 4YCCA 3HYNA 1KVTA 3V1KA 4BTVA 2D1RA 3KAQA 3SSAA 1QFXA 3L07A 3LHIA 4FDVA 1AT1A 4Z8YA 3RABA 5LU8A 5JPIA 3OU7A 4IHAA 1DPGA 4NWIA 4KFSA 1QIEA 2ASVA 1VGRA 1CUUA 2IW3A 1WMBA 3IELA 4UASA 1MR3F 1P33A 1XCMA 2P6OA 3O9ZA 5BN1A 3TECE 3AJEA 1E1YA 1KQNA 5JH7B 3W2IA 5HJ2A 5DHUA 2FP4B 3FRIA 3WAKA 4UHCA 2Q28A 1TJ5A 2AZMA 3E81A 2C9CA 1OZHA 5LQDA 4OQMA 3LX8A 3FYUB 1KO8A 3NHZA 2XUOA 1H2AS 4CVNA 4DEVA 5ICCA 3D6VA 3HBJA 2AOXA 3T1TA 2V7WA 4G1UC 3KSRA 1B14A 1JEAA 2GRUA 4C9BA 3HNOA 5LWQA 3G2LA 1DKNA 3MRSA 4OA8A 3ER8A 2LTAA 1U2GA 2GKOA 1XZLA 2UVDA 4GOKA 2IPLA 3ZUGA 5LDHA 4RD0A 3T3OA 3E48A 1UFOA 2BEWA 4FR2A 4I81A 3I6ZA 1JAHA 1PT6A 1VBFA 5B2EA 1YJNF 1A8SA 4YRSA 2GLUA 4MK4A 3RC7A 2J4DA 2C4MA 3NHMA 5B4TA 2Z43A 2RJNA 1R0BA 1KJZA 5DW3A 1UKVY 1II9A 4FGWA 4W9NA 4XUDA 4C78A 2W4MA 1T5DX 3K6KA 4PY2A 2DULA 4PSAA 1NRJB 2AMLA 1JKJB 3DLCA 4QDJA 4DKJA 4MYCA 3GY0A 1MX1A 2C92A 1DTSA 4IQFA 2WWRA 2QX6A 2H17A 2EX0A 2CLCX 1N0IA 1QK5A 3D7LA 3JXEA 2EZ4A 3B85A 4NJOA 1E8MA 1A69A 1YFZA 2GZDA 3P9YA 4F91B 5JZBA 2NZYA 5ARCA 3H5RA 2QL7A 4DMRA 1UPTA 1YVDA 2OMKA 2B7CA 2ZBGA 1JVSA 4IS3A 2O1XA 4RK0A 3WV4A 4DDKA 1SD5A 4Q9AA 3VH1A 1T9KA 1FUIA 3OIDA 1WPGA 3O92A 1E1LA 4E88A 3LFTA 4EUKA 3I92A 2PDAA 2NUTA 1ZG3A 3WHLA 4EDHA 5A4MS 2AYXA 4DV6B 3IT0A 3V2UA 3TGPA 1FBNA 2DUNA 3Q40A 2JJMA 1NV9A 2ZBFA 1QDLB 1HDEA 4GECA 2PRKA 1JFRA 4FT4A 1A8UA 3ENVA 4MUEA 3KOWA 4B2YA 1HURA 5BWCA 4MTCA 1R0CA 2Q45A 1SUDA 1AKMA 3OY7A 4MKHA 3CRW1 4AMYA 5CVTA 2XHZA 1QHHB 2W6JD 1DCMA 1UF9A 4Y9SA 1EDZA 1QIHA 1IUNA 3WNQA 2CYCA 4JUDX 1ZN7A 3U7QA 2GVIA 1KY5A 2H2IA 2OGWA 2R62A 4IJMA 4R7TA 4XJVA 4F2GA 1DAGA 5H4HA 2QSZA 2WABA 1JFSA 3O94A 3LWPC 3EIQA 4JB2A 1GGHA 4QXAA 3IDOA 5L45A 1C9YA 1OAOC 1THZA 1Y42X 1JJVA 2Q9CA 4XWYA 4DJEC 4G8JA 1U2QA 3VNRA 2RGAA 2CVLA 5E4FA 2HWYA 1L4LA 1L7AA 4A8JC 3CVXA 3WLQA 4QOSA 3RRXA 3LQ1A 1H8HA 1CQZA 1SZPA 1VCOA 3T3EA 4UATA 3RKSA 3IXLA 4HGPA 1QVZA 2A0FA 2DPXA 3OT1A 4JU8A 2P9CA 1QU2A 1N5MA 2AYYA 2R1TB 3RVRA 3WNZA 5LXTB 3OQNA 3IS3A 4NF2A 1PYGA 4IDAA 2X5KO 5IN4A 4OKIA 1O4VA 4BZWA 2X5NA 4MR7B 4MQFA 1NFRA 3PXUA 3IAM6 3A37A 4MLZA 3UUWA 2IPAB 1XR3A 1DV1A 3IAUA 4RORA 5EY5B 2H4WA 3KLPX 1X52A 4DGSA 3I0NA 5LQMA 1F1JA 2G8NA 4R5HA 5ESDA 4E07A 1ZH4A 1KFJB 1LLQA 3FETA 4K9PA 3GGSA 1JFLA 2IZ0A 2BR3A 3WDSA 4ZZ0A 4V03A 4ZV9A 3VHXB 4IIJA 1N77A 2ZRKA 2GPAA 3TLZA 2NPFA 4RVGA 4O2BA 2V9ZA 3ROQA 5C4GB 3RVNA 3OOYA 3W1EA 4C0KA 3KV1A 1ID8A 3MJDA 2JKYA 3C4VA 1IOVA 4TROA 1K9SA 1B41A 3RVOA 1Q19A 5LJLA 2C9MA 1G8GA 3L7IA 4E30A 1XJ5A 1ZOLA 1G6Q1 5ALJA 5GANK 1KD1H 3IMFA 1RWVA 3CF0A 4L5CA 1YUNA 1IV1A 2G9IA 1LQTA 1IPAA 1TA4A 2P78A 3UMVA 5KOYA 2O6LA 2PVSA 2PL5A 3NNDA 4IXTA 2HV8A 1QVVA 1TF5A 1Z2CA 1BW9A 4HVAA 3BXHA 4HDAA 5BN3A 1AURA 4DABA 2ZKLA 3PE4A 3NHFA 3A6PC 2A8YA 3TWOA 4B6QA 5E4YA 3AB7A 1EX9A 4O5AA 4UHDA 3GNSA 1I01A 2VAPA 1T1GA 3BGOS 2FPRA 5KS2A 5J2UF 2MQEA 3C6QA 4TYYA 5IJ0A 3AUUA 3NWJA 3CNOA 1AKYA 1JHVA 1H2RS 1NXWA 3L18A 2DERA 1KDYA 2CB9A 4EO7A 5JJCA 1SBCA 2FQXA 1JLRA 3MGBA 3DEFA 2WM3A 2OV4A 3VTIC 3EQ9A 3DBLB 4PLZA 4X7RA 3OKCA 1I1NA 2FG7C 1NM5A 2ZJAA 3NEAA 2H00A 3QV2A 5DNAA 1E1RD 2WWXA 5T57A 3O4JA 5C8VA 3HV2A 4KXMA 1YKGA 2VHEA 3HR4A 4RF4A 5EQDA 2ZCVA 4BLOA 1DRKA 1VBMA 1YDMA 3JRNA 4MULA 2VKQA 4TMXA 1ZOSA 1EXWA 1XVVA 2FFAA 4E5KA 3VI6A 3VPDA 1BMFA 3L0IB 2QV0A 5K8JB 3JAWB 4G97A 1UT5A 1RKQA 1P80A 1LK5A 4K6FA 1TDJA 5JAPA 2JZNA 5EJ2A 3SS7X 2AEJA 2J5BA 4Q6BA 5ALRA 2DU8A 2YYYA 1UBUS 4KIJA 3A3OA 1X1DA 4OU4A 4N5DA 3WBFA 1B2LA 1XAIA 1TE2A 2I7TA 2Y1FA 4P3OA 5DULA 3HXQA 1YZHA 3LPAA 4LWPA 4CN9A 2P9BA 2PX5A 3AYZB 3OZUA 3PDHA 4UEQA 4W7HA 3P0RA 3DMYA 5IZCA 5EJMA 2IPXA 5ALXA 5TVGA 3UO8B 2UDPA 2VP2A 3V4SA 1I1HA 1K7FB 1XZPA 1SIWA 2O1WA 3I6MA 2V5AA 3OJFA 3OQ6A 3K0FA 4ZHVA 4D02A 2XAAA 3WGTA 5A9SB 4CDGA 1KI1A 5J59A 2ZLBA 3D54A 3NYRA 4V2IA 5IMBA 4AT1A 1IOZA 3UPUA 1YQXA 2A1TS 2G9RA 3CUKA 2P6UA 3OKFA 2YFYA 1X7YB 4IRUB 4D0LB 5TIIA 4MNTA 4QJ5A 4U2EA 4AICA 2A2ZA 1TUBB 3GGCA 2Z08A 3LW7A 2Q3FA 4CKWB 2OO5C 3FVQA 1FX0A 4MW7A 3O85A 2H08A 3Q11A 4FMPA 2ZAOA 2B6HA 4GP9A 4RKFA 2IBSA 4HLNA 4WZBE 1I5OA 1NDUA 1VC2A 3DHVA 1OOEA 1YMQA 3L77A 1WZIA 4TUYB 3KEMA 4QOJA 1ZQ1A 3TD5A 4ZAXA 3RU3A 1SCNE 2VBFA 4G1FA 2PUAA 2A86A 4B6PA 3BF8A 3FMVA 1Z74A 4XB6B 3DWGA 4X97A 5AM3A 1T2FA 1XCJA 4UJ3A 4BIIA 1ZGHA 2X2PA 1U0BB 3AEXA 2C95A 2VTBB 3A9WA 3DCNA 4BFWA 1D6MA 4I3GA 1BE8A 5CNIA 4R2XA 4DCNA 2J6BA 3G9UA 2W6IA 4GOMD 1SIOA 4PLGA 1VJCA 4YAUA 5I7UA 4WOCA 1M8GA 3WGLA 1MX9A 1LSSA 4D96A 4LFCB 1ZRMA 3NALA 5LMUB 4DTIA 1CDZA 4PX2A 4BNMA 5I7EA 4GLOA 4OBXA 2RHHA 2AFIE 1LWOA 2AVNA 2WIKA 1ADYA 2YHIB 3ANTA 4XD2A 5E0KB 2HSDA 4QTYA 1ZAYA 4HCJA 3O6VA 2BH2A 1WDKA 1KH3A 2WRZA 4FYVA 5K0GA 3HEBA 3PQEA 1V5FA 4RYLA 1BDMA 3CNNA 4GPTA 1G2OA 4K9OA 2ZP1A 1IZ0A 2ZSUA 3PDIB 4EJ6A 3O26A 1OCEA 1YBMA 2GTPA 3V3TA 3SC2A 3WWPA 1JNXX 1PBTA 2OBXA 3RUEA 2I7DA 1GG2A 3RSHA 2JLZA 1S4MA 2TS1A 1J1IA 1NVBA 2I55A 1J1ZA 2B0JA 1J8MF 2RI1A 1Y6QA 3OEWA 3FNHA 4IDEA 4E4TA 5DSXA 4B2IA 1AQ6A 1CT9A 1M34E 1E59A 3FYHA 4KHPB 4XIIA 4ZHQF 1V11B 5A3JA 4DMUB 1P6UA 3C41J 2ES4A 2R60A 2A4KA 2QTAA 1CG6A 2I6RA 1U65A 3NKLA 4F6LA 5LOVA 4NARA 5JQGF 2P2SA 2X5XA 4O2RA 3M6IA 2CFOA 4YMLA 3IJRA 1SU8A 4BO0A 4RABA 4XYEA 1LPBB 1MVNA 3SI7A 1ABBA 1M1KH 2V7VA 3AR3A 1TUIA 4IDBA 3GXBA 2JPDA 4QJBA 4Q9DA 4J6EA 4WERA 3MWYW 2IS2A 4MI3A 4YRIA 3R3XA 1YASA 3VYWA 5DW0A 3C9RA 4FN4A 3GJYA 4GXQA 3WJPA 3ZVNA 4IMRA 5HDQA 1KZ4A 1E2MA 4DRZA 2IH2A 3WGNA 1ZEJA 2BCJQ 1H5UA 1TF7A 3AM5A 4U2BA 5DMXA 4EYEA 5JATA 1XKLA 1G63A 5JO0A 4LMRA 3TPZA 4XQEA 2PMWB 2FWMX 5HWEA 4W9RA 1G3MA 1UDXA 3N2KB 5LC1A 3MRVA 5DYIA 5T4FA 3JARB 3H18A 3BTUA 8ABPA 4IRXA 2QTMA 4JELA 4M99A 4H1HA 3ORQA 4BVTA 3OESA 3PFBA 3C2QA 3WLEA 1ZGBA 3HVKA 3NG1A 1KK2A 2CC2A 4S04A 1FE8A 5KBYA 3ZJUA 2Q9UA 3DL2A 3AKCA 1AH2A 4TRJA 4CEIA 4EWLA 3EA5A 2ZAYA 3B8HA 5KC8A 1MORA 2CFIA 2N47A 4YRKA 5JTTA 5HCIA 2LVBA 3AR6A 4I5GA 2G04A 2GAOA 1LBIA 1R4MB 5CB4B 1IY2A 3MYRA 1LD3A 1H42A 3Q15C 5CM8B 2WR8A 5KJ6A 1D2GA 3I9FA 4N76A 1KVRA 2YHBA 3ZIUA 3MJHA 3BJRA 4R8VA 5CH8A 1QQ6A 4OQLA 3SG0A 3CLUD 3OPQA 2CVPA 3PVSA 1QZ3A 1Y8AA 1HLFA 5GM1A 1M7BA 2QZ9A 5T4BA 1L5KA 16PKA 2Y4NA 3RNLA 4D9MA 3MCAB 4I9HA 5B1SA 5ALVA 1I3NA 3GG2A 4X85A 2BHLA 5DHQA 5LZ7A 3TLKA 2XYVA 3LWNA 2YVQA 4BO2A 4HVLA 3E05A 3FY4A 3N2GB 3F9CA 3WKBA 5BRJA 4EUHA 4UEKA 3D0OA 1L7RA 4P7GA 1E1QD 4UARA 4C0AC 2RIRA 3FBTA 3ZVMA 3ZPXA 3JVEA 5KNLA 2RAUA 2C8VA 1H2YA 4PZPA 4U2CA 1Z6YA 3OJWA 1A95A 1O95A 3LIPA 3LUJA 2BI4A 4M9UA 3JQQA 2AR0A 2IQIA 3L7QA 2VCHA 3Q9UA 4QU0A 2ECQA 3EYWA 4YK7A 1NLFA 5IAEA 2WPDA 2Q3HA 2QOEA 1XTTA 3NX4A 4UM9D 5CNMA 5ULLA 4R71A 1OD6A 4TQUS 5DGXA 3GIDA 4WE3A 3EZFA 3GYQA 1YBFA 3HWX1 4N1AA 2CVHA 2VGMA 2WJIA 3GVXA 4LWZA 2P79A 4RPCA 5AXAA 4JI3B 4YRPA 2ATEA 1EGAA 5IFKA 1KSFX 2V03A 1E0SA 5CFLA 2J1LA 3OH8A 4US2R 3H5AA 3R7SA 4TMYA 1AUVA 3P4YA 3BWMA 1UFKA 2KM1A 1SVWA 3HGMA 5KAPA 3STYA 4QRHA 4BQFA 5KZMB 2WY2D 4JI2B 5LLDA 2WWIA 4A1OA 3IQEA 1R2QA 4CMJA 2EWWA 3N05A 3UQZA 3HCPA 1BU5A 2IDMA 2QUKA 1LX7A 1KMMA 2FWIA 1HLDA 1ZL0A 3D02A 3ISVA 4L9SA 4OQEA 4ZZ1A 1GTSA 1LQ2A 1NBMA 3FMIA 5HMMA 4DILA 1NXSA 3OZDA 3PUWA 3OX2A 5K8VA 1K4KA 1K0UA 2CD9A 3HI6A 2QLJA 2Z3ZA 1UODA 4JAVC 4S1VA 3W2TA 3DOHA 4HUQA 2V97A 5F3DA 4DB4A 1G3UA 2Z3WA 3FHTA 3L4BA 3K2BA 1CXZA 3HDYA 3O3OB 3PRKE 3PNMA 2PVCA 3U3OA 4D3ZA 2NMUA 5AM2A 4CL8A 2PN1A 3S55A 3A9RA 1FUUA 1Q2XA 1ZGAA 4RZQA 1AIPA 1HC7A 4K9MA 4KFUA 4C4YA 4JI4B 5CYPA 1ESNA 5I8WA 4BO5A 2VHVA 5JXHA 1SMKA 1NXXA 2CXPA 1G0NA 4EELA 4V0OA 1Y81A 1C8KA 3ZIAA 1S3GA 2FR8C 4HFMA 4RL4A 4WUVA 1D7AA 1VKZA 4I99A 1KIFA 3B1XA 1YCGA 1C9KA 1Z3IX 1RI5A 1DBWA 3U62A 1RJGA 3JQRA 2VPIA 1E0KA 3GCXA 2NXWA 4LV5B 4O29A 1GEEA 4RKRA 4BWFB 3Q7RA 3B1WA 2ZE5A 1KQSF 4OHRA 3GLUA 4BNLA 4KNWA 4W7IA 1IVYA 3OKAA 1R88A 4TYQA 3W78A 4AJ2A 1P81A 1SU4A 1L9KA 1Z5GA 2FE4A 3CXRA 5EWLB 3VHRA 4MWCA 3JSAA 4J4HA 4OM7A 1USIA 3E5NA 4CHGA 3TCNA 1FP4A 2I6DA 1PDVA 2E37A 1DDGA 3EXAA 3FJOA 4FFLA 3RYTC 1FS4A 2W8BB 3IUJA 3N3BC 4HYQA 4Q7KA 3RUIA 1UDWA 3GX1A 1RQXA 1U0TA 2XCQA 5IARA 3WGUA 4UPEA 1CUFA 1SFRA 4WEOA 1BEUB 3M34A 4DZZA 5EMHA 1CUIA 2HFJA 4P82A 4E32A 2ECPA 3IOYA 3KEFA 4C6TA 4KIFA 3UYLA 2BJVA 1ZUNA 1M0WA 2BUBA 3A27A 3R09A 2W4QA 1W6RA 3IPCA 1JWLA 1XL1A 2QD1A 3R5HA 1ETHA 3E9RA 5F7JA 2DQSA 2PGOA 2XDWA 5EAIA 1C50A 2R6HA 4R7ZA 4C6HA 1CS0B 3AKYA 3QFTA 1KO4A 1NYTA 1Q5PA 2NN3C 3CONA 2HMWA 3DTVB 4M0LA 4RM2A 2I3BA 2H11A 3A6FA 4FNOA 1E98A 2NV6A 4RVSA 4TTTS 1CERA 1KI6A 2DBVO 4DSZA 2B0CA 3M4NA 4R05A 4AUEA 5GONA 4QEDA 3CX6A 2FXVA 4XGQA 4OMFG 4BOYA 4TZTA 3T95A 1RLIA 4UUAA 3DWEX 3ZV5A 3TFOA 3LUKA 1AQLA 3G5MA 1NHGA 4NQZA 1WUHS 4WT7A 5DT2A 3CUTA 3K05A 1JIUA 5SICE 1YR9A 5B6PA 3N28A 1FDTA 1W0JD 1ZINA 3FPAA 4U5XA 2X14A 1Q3HA 4HWPA 4IDFA 3PHJA 2MR6A 4ENQA 4XI9A 4CEJA 5GY7A 1UM8A 4MR9B 1QVGF 3LP8A 2XCTB 4CKCB 2BFBA 1E2JA 2DFKB 4JASB 5ADHA 5HIKA 1RI3A 4AIIA 3T0IA 1T5SA 2FSVC 1BVHA 1ZEMA 2XRYA 3TZHA 1CZOA 2JLVA 2V6BA 1NN5A 4YS6A 1Q86H 1WEHA 5LYJA 1WXGA 1XXLA 3JALA 5FOVA 1G18A 4ENWA 3TGLA 3AHCA 1AK9A 3AR9A 4NIMA 4LJLA 2MJLA 2VT6A 3TTTA 2OC4A 3QXGA 4NCKA 3AZOA 1OGYA 4R68A 2OD9A 1MTZA 4RIEA 2G88A 3T3DA 3F7TA 4NL4H 4OXNA 2G36A 3NC1C 3M2PA 2P2YA 4UCXA 5KTNA 3WZ2A 4YRLA 2XLBA 4LYEA 2QA5A 4CMBA 4JGGA 2ZCJA 3R5KA 4YJFB 4NICA 2GUGA 2A9VA 2JKZA 4CIXA 2G77B 4GX2A 3WGHA 1VZ2A 1MABA 1FTGA 2I34A 4EF4A 3KOMA 4F5DA 2Q5HA 2PUGA 3UN1A 2FSUA 4OH7A 1CYDA 1E4YA 3ICOA 3Q1LA 2ZRBA 3LWDA 3IVCA 3OMLA 3PHIA 2JVJA 2UYJA 4GBGA 3OONA 1PX2A 3PXDA 5AJHA 5AVOA 3CCQF 1Q91A 3NJRA 5IWAB 2DQ4A 5DGCA 4UUNA 2WSLA 5DRYA 5JS6A 3H1EA 2VTDA 5DV9A 1NT4A 1P45A 3ZS8A 3HYLA 3ED5A 3SDZA 3K0KA 2FQ1A 5EXDA 1K75A 1KMIY 1ZIPA 3AF6A 3F6PA 2IE0A 2HD4A 5KWJA 1E3JA 5BSKA 3B3JA 3M1AA 1O9HA 1DG9A 1P0IA 3IAS6 2JHAA 1IEVA 1QF9A 2A1IA 2JFPA 2HF2A 2P2LA 3FWKA 1DRWA 1Z6ZA 2QD4A 1DAOA 2CUZA 3QTTA 2HO4A 1C30B 3B5IA 3WKDA 1X1SA 5D51S 3AV0B 1X80B 3T80A 4UUOA 4OPMA 3EXHB 2PLFA 4I2NA 4JEIA 2WTUA 2O8DB 2F9ZC 2C96A 1SUSA 1Y34E 1K6JA 2R6GA 3ELDA 2P4EA 3RYHB 3EIUA 1WKBA 1VJ1A 4JQCA 4C01A 5JVDF 1LFAA 4MS1A 4RHEA 5EGSA 3R40A 2NU9A 4D3FA 1J56A 2LKCA 1E2LA 4F85A 2PJRA 1KORA 2II6A 3GLFE 1IEWA 2HCRA 3T38A 2HHLA 3A9TA 1XHOA 1JHRA 1U8XX 5EWRA 5DWVA 1GQSA 2YQ5A 5E3JA 5C1DA 4RFVA 1RRPA 5TQ2B 2JHPA 3L1UA 3SICE 4EO4A 2YIDA 4ZQCB 1UAYA 5CT8A 1XWFA 3JWGA 1E79D 3O0TA 1NW8A 4D26A 2NVBA 4RVDA 3KQSA 2OZLB 2GQ0A 2XY4A 3VZPA 4XJTA 3KKQA 2GRJA 4D9JA 2APJA 1TEVA 5KNDA 1O57A 1KE1A 3SHVA 2I6TA 821PA 1HF3A 3GG9A 1ZX1A 3ZWMA 5CJPA 3LW8A 3K5IA 1Y8QB 2PZEA 2C58A 2VPWA 3BRWD 2X4DA 3QVGB 1JMKC 1G3QA 2QZZA 4TKZA 5HZHA 2XA9A 3OPYI 4BLPA 4C7VA 5LDGA 4C7OA 1MJHA 2J4FA 3H8SA 1EX6A 1RQRA 3J7AR 2G80A 1ZA2A 2C3PA 3HA7A 4NOJA 3AW8A 3B6JA 2AV6A 2JBAA 1RZVA 2GB4A 3N7UA 4JOCA 4KK3A 5HFNA 2O4CA 1ULTA 2YXNA 1AQUA 4R2WA 4YAFA 2UKDA 4NYIR 2ZRDA 2VF2A 3R9KA 2I6SA 3H6HA 4NTZA 3QLEA 2VQ3A 4XASA 3SZOA 5IT9A 3AKZA 3RAEC 3O8LA 1GRRA 5KX5F 4JP8A 2B4AA 2X1HA 1I0LA 4TWBA 4XB1A 3QFFA 3UANA 1P17A 2UVQA 2VJYA 1LY1A 1SPBS 3WJRA 2K2WA 3V1TC 3ZQUA 3OUUA 3SXPA 1YDGA 2ZYUX 1PWHA 3GDFA 1ZR2A 5AQ1A 2OXTA 4TTPA 5JSYA 4PHFA 1N6RA 4GI7A 3VZDA 1YOVA 5CYOA 3AK4A 4X3CA 1CK4A 1C9NA 1OX5A 1L8XA 2RAPA 4GWGA 5T8KA 1F6BA 4G4VA 3USES 4D9BA 4M0FA 1U4NA 2XUPA 1QIJA 3VV2A 1CFZA 3KQPA 4RHXA 1IJFA 2AJCA 2WWVD 3UNXA 1G5QA 4IG9A 5BR7A 4TXHA 1AZLA 2FSGA 3G79A 2VSXA 2YWCA 2BFPA 1O4WA 3QVUA 2BKUA 5C0OE 2FEWB 4O4HB 1E77A 4ERXA 2Z1TA 1TJPB 2AEMA 4H2DA 1HKUA 1H93A 2FWJA 3IX7A 5FEMA 1RCTE 4LE0A 4LWQA 4CDRA 3HE3A 3ND6A 4I1YA 4ABTA 1ENZA 4QL3A 1UXIA 1QAOA 1GM5A 2D59A 4ZYYA 2BFFA 2XMQA 3M89A 4YFYA 1JEYB 4ZT7A 2O8EA 1AMUA 2F1RA 3E7XA 2PQMA 3NP9A 3GMIA 4JBNA 4ZQIA 1GNVA 2WA2A 3HYCA 2GAFA 1CIPA 3QPUA 5HK8A 1ZD1A 1V39A 3QNWA 1NIPA 2HPVA 2V7TA 3LWOC 3IC5A 2IVZA 3FWNA 4WLNA 1ZJYA 2FFQA 1UJ2A 1RTTA 2OBFA 1Y3FE 4E08A 3HUFA 1KNQA 1GQRA 1XLWA 5JH7F 2B5VA 3UMYA 4BNGA 1O94D 2RHJA 2QXYA 2PRSA 1DC5A 3O1JC 2I6XA 3C3KA 4C5BA 3K20A 3DFUA 1GCIA 1Y9EA 3DFFA 5EKXA 4UTOA 2B21A 2HCTA 3HU5A 1XNGA 4MKFA 4ZVNA 4LSGA 5ESXA 1Z12A 4KL8S 3MIZA 2W42A 2XOXA 1ORRA 3H11B 3SSNA 2YN2A 3UMJA 5KPDA 3EIWA 3FHCB 1DAHA 5F64A 1Y3AA 1AD2A 4B6GA 3RVDA 5DSZA 1BVUA 2OECA 4MB6A 4LY6A 1N6PA 1RW4A 2XCOA 4RW0A 4BZZA 1NLZA 4BLUA 4W99A 4JD5A 1I8TA 1AKWA 3DBIA 4DV0B 4R2JA 3LOPA 4RTOA 3IVXA 5BNFA 1T0IA 3LG2A 3KWFA 1IN5A 3EXIB 1DADA 3W3AA 1QGUB 3P52A 4WCFB 5T41A 1AHNA 4MVCA 2OSVA 3STXA 2OTCA 4RLQA 4B83A 1MHTA 1WUKS 3Q8HA 4TS3A 4F9FA 4B5CA 4N3GA 4OYLA 2FMIA 4I50B 4DUPA 1C3LA 1T2EA 1K8YB 2R7LA 2B2CA 3L6OO 1TYBE 1YV9A 3R2JA 1WHTB 3AUSA 1RQPA 1DMSA 4DSOA 4BNYA 3OO1A 3ETHA 4EARA 4BCCA 5LNK1 5E6UA 1CUGA 5CP8A 2CDAA 1QWOA 2JCGA 2YNMD 3C97A 3D3QA 1FLVA 1KAOA 3F0EA 4KRXA 3DHYA 1ZR4A 2C5BA 1KGSA 3TS1A 1PW7A 2NU8B 1OHHA 2IEZA 5C8ZA 4KO1S 4LVOA 1UMCA 1T9GS 4TL9A 5GJCA 5KJ1A 1W581 4RYDA 2PLNA 4NBRA 4Z86A 1GHTA 3U7EB 1NJSA 1F60A 2WSSD 5AJWA 3KCQA 3NZEA 4MRPA 4YPFA 3HNPA 1GUBA 1PZXA 1RJWA 2L0XA 4WKPA 4RHYA 2V4ZA 1GPNA 4B09A 3NC0C 1J22A 1FNDA 4QG3A 1ZIOA 1QIMA 2I65A 4KFRA 1WXHA 3RANA 5KYGA 1FFDA 3TTWA 3HS3A 1KHTA 2MWMA 1JIQA 3UH1A 4DMKA 3FZGA 1WPXA 1RLUA 1J09A 3G1WA 1DWOA 4IDOA 4L27A 2XZTA 4LZZA 4EW1A 4DSTA 3BRSA 2DLNA 3SZ3A 1PBNA 1RTKA 2IPMA 4ZPXA 1J07A 5AW3A 4KODA 1A9QA 4CCYA 3KB1A 4O02B 3NV9A 4MH0R 4BJ3A 1F2TA 4MZXA 4F4JA 3MMNA 1V16A 5HYVA 4Z3OA 3EMDA 3OG9A 3UPTA 1I94B 1NN3A 1ND5A 2X5OA 3N87A 2HEIA 3EE6A 2R1VA 5FWXA 4FEGA 1TCBA 4AXBA 2IEDA 1W1IA 3JVVA 3D0QA 2D54A 4MP3A 3OLQA 4DVJA 1TYDE 4ZOCA 2I2DA 1X19A 3HKEB 1YE8A 5MN4A 2YWXA 1V1MA 3V7YA 2OMEA 4LRYA 3MHTA 4BRUA 5E6SB 4LGMA 1A4RA 3EC2A 5LXTF 4DC0A 1DC7A 3QQ5A 1XRQA 5A4DA 4RTLA 4KOEC 5HCNA 4ZCLA 2AZTA 1PL0A 1R18A 5JPCA 4EBFA 3A3PA 4NFYA 1PEYA 4CMCA 4DBVO 3KQQA 4IMJB 1N3IA 4QDOA 1Q92A 2NG1A 4B0PA 2BGKA 3JQAA 5JFOA 1E5DA 4A3SA 4I1PA 3E82A 4EL5A 1WETA 2H9YA 4BC0A 3ESRA 3T61A 3WLFA 4XVRA 4C7KA 3EEYA 1IEQA 3RS3A 1R4AA 4X93A 3WS7A 4RZIA 4M8LA 3TW6A 4K28A 2PSEA 1JWBB 3D3WB 1JQKA 1TCVA 3H9CA 4JJAA 3CNEA 2Q7XA 3HLKA 4JEMA 4B79A 3AEZA 1P4JA 1N2XA 4P58A 1WZEA 1YRQA 2J3DA 3I2KA 5GIOE 1TUEA 4BMVA 1SZJG 4HEA1 4RLFA 4BNZA 4RMIA 4C6RA 1QP0A 3D4BA 2F3QA 2AN9A 4HMPA 1SU6A 2VOEA 2Q21A 4WTOA 4ZDIA 4ZARA 5F23A 5J2TB 1Z5WA 3C3WA 3QLVA 4B3BA 3OCVA 3AXTA 3HCEA 1O6BA 1TLFA 3QPVA 5HTOA 1ZWLA 4ZO9A 3H9JA 3VZQA 4BMNA 2OFOA 2OAQ1 4NUTA 5EE3A 3JQ7B 2BFEB 1VL5A 3FYDA 3OIGA 8ADHA 3QJ5A 2Z09A 1MFZA 2VYVD 5M7EA 2Q5LA 3D0KA 3GJQA 2ZM5A 1N2ZA 1DTWB 3ZQ4A 1J2RA 1GDDA 2DGDA 2UYPA 1KFEB 1VCMA 2DQYA 1FCJA 5F3RA 4MUHA 2P6PA 3N6RA 4DLVA 2CNLA 4G0XA 3Q3GE 1K7EB 2XQJA 3G68A 4UU7A 1W41A 4BT2A 1I3OA 4MGYR 3MTQA 1G2PA 1NZDA 1OXXK 2CVZA 1MXFA 2NU7A 2HLNA 2P3SA 2BAGA 3NP7A 4KMOA 2DXIA 1G20A 1LJUA 3HB7A 2A58A 1N3LA 5J40A 4BQPA 4C8EA 2GWHA 2GHRA 4XR9A 3L2OB 3M6LA 4GSLA 5DSTA 2IXTA 2C59A 5FNZA 5EWMB 2CSLA 4M1EA 3AG6A 1EINA 3O03A 1OQAA 1EEHA 4GMHA 3FOCA 4PZEA 4EKYA 5FDFA 4KQ2A 2EGGA 3EGVA 4PQYA 1SA0B 5D8DA 2O2YA 1TU4A 3G9XA 3K9WA 5CH3A 3TUIC 3VYRB 1IVSA 2W2KB 2XB2A 3GC6A 1JPVA 2GHTA 2G9VA 1HA3A 2RI0A 4NU6A 4BP9A 2X19A 2NUAB 4M9ZA 3JQ9C 1Z82A 4DC1A 1E60A 1XTKA 1EQUA 4BFXA 1VQ8F 1V1RA 1JG1A 4ITUA 1RJ9B 2QAGC 2WA1A 3S29A 3PF9A 1NPDA 3CVVA 3TNLA 3DT8A 3PNVA 4N0DA 5F9FA 4FFNA 4AQ7A 1N0HA 3R0QA 4YRNA 3PFNA 4B8WA 1CF2O 3WNBA 3AVUA 1T25A 3TRDA 1L7VC 1GSHA 3R9WA 1F2VA 4C08A 2HK8A 3WWZA 4WVLA 1GWNA 2Y67A 5JSKA 3C6XA 4GYJA 3F5SA 5GIOC 1DZ3A 4L5AA 5DB4A 4ER5A 1BGWA 4F2DA 3UWSA 3O38A 1JB1A 3AU8A 2I7VA 3GRKA 4GPAA 4KLAA 4E2XA 1S2OA 2QI9C 2C98A 3O9VA 4BAGA 2DAPA 3LX6A 3CR3C 4BFUA 4HRAA 3IIMA 1X1TA 1HOTA 2AEEA 3OWOA 4EG0A 4EBBA 1RZRD 1DRVA 3UGJA 3ZU5A 4Y67A 1SVIA 1BD4A 3RUPA 5CDFA 3V7QA 2FPLA 2RBGA 3K6RA 5EKDA 3HFJA 3RUHA 2V7GA 4YP6A 4EQZA 6ADHA 3EOBI 3K0TA 3LHFA 2Y77A 3E9DA 1TYEB 2WFLA 3HC7A 4OH1A 1IULA 4R2MA 5I9NA 5T6BA 4TUYF 1DCTA 2WKPA 3PIIA 4HEQA 4J07A 4RPGA 2ZTLA 5BVHB 1I6LA 4R69A 3ZZTA 2RB9A 1M2VB 1VZ3A 3WI7A 4INJA 4Z8XA 4P5EA 3UG7A 4HWGA 4D5EA 3ZDCA 1H4TA 2GNPA 3HCBA 4GZ5A 5ER9A 3T7EA 3OC6A 4HFNA 1J8QA 3R3SA 4HATA 3TOXA 3EARA 2XB4A 2A7QA 4BVQA 2PSFA 3P19A 3AU9A 3GXOA 4EIWA 1IQPA 1FFAA 4P93A 4XGIA 2OTMA 1LVUA 2JGAA 5LQNA 4L3WA 1OXTA 3ETJA 4M0CA 3T9FA 2XEXA 3ER9A 5F33A 5HNKA 1E3WB 4IDDA 3CRVA 1TO2E 2QTZA 2YV2A 5E1OA 2ZR8A 1G9XA 2D74A 3L4EA 1WZ2A 5TNXA 4NZPA 2X1LA 4Z9FA 4MSUA 3Q1KA 4C5AA 4UVIA 4IXMA 4LRTB 1DELA 3ANSA 2K87A 1E2UA 4ARZA 3P9CA 4G81A 5DOZA 1W5TA 3OTGA 3PC2A 3QWHA 2P6NA 3WK9A 3U56A 4Q34A 4PO1A 4QJIA 4HX9A 2FCAA 2N0SA 4JT9A 1I14A 4MA4A 1W59A 1M8KA 4FPXA 4QT0A 4J7XA 4ZHQA 2IHBA 3QHPA 3PXBA 4OXQA 5CX1A 3RJZA 2OCGA 4KR2A 1NRWA 1G55A 5DNWA 3WJQA 2H2GA 2XDQA 4NAHA 3I39X 3SVTA 2PUDA 1C9JA 3VJMA 3T3IA 3S44A 3JATA 1VBKA 4TSFD 2O2CA 2VF4X 4C20A 1H6BA 4RL6A 1Q1NA 2PYZA 5F4BA 1PEAA 1SXJE 4IJ6A 4DA6A 4E46A 2QN2A 3CVUA 1IPEA 4PPGA 2PK3A 3IBYA 1W42A 4RMNA 2C4KA 1CJSA 1U11A 2O2EA 4KE9A 3ZDAA 5IBRA 2FG5A 3HL4A 3VNBA 4K46A 3W4KA 2REOA 1CS4C 3BHIA 4TLDA 1ZSYA 2MT9A 3DAOA 3ZX4A 3CX3A 1EXDA 1DDOA 1XNQB 1PF7E 3PNOA 5FBHA 5HXZA 1J8YF 4QTZA 3F4KA 4GLBA 4DCJA 4HBGA 5AVVA 4JWTA 4YUVA 3BG5A 1CPYA 2VF8A 1JXQA 1MJFA 3NVDA 3QUCA 1AZSC 1YBVA 2FEAA 1ABFA 2WAYA 3KKNA 1DFIA 1IBSA 1T9ZA 3PUHA 3Q7QA 2F43B 3SZUA 2R96A 4D8VA 1DEXA 2AGVA 3TLEA 4QUDA 2BE9A 4IMIB 3PEFA 5AKGA 5I7VA 1Z38A 4H7EA 3V1NA 4YQFA 1ZJWA 3NWBA 4HZUB 3ZP4A 1MD9A 3AFIA 5AW6A 4D4MA 2H9IA 1HT1E 4RFSA 2IAFA 2W8ZA 3VPFA 2Z6QA 2XXJA 3DXFA 1X39A 2P27A 2F48A 3O9MA 4XPZA 5F3WB 1LBHA 1NXQA 3E9NA 1R6UA 1AVTA 2VRCD 1X92A 2DWPA 4JJIA 4JYBA 4FLFA 4LJ7A 1GADO 1PL8A 3QKSB 4D9IA 4QAJA 4NEQA 3PICA 2GKGA 2JJ1A 3K0CA 3WXMA 4P7KA 2L18A 1KFKB 1RHQA 4E6EA 3P10A 1ECCA 2HPAA 5CB4F 4CGYA 3IDSA 5DKFA 1XNJA 4JLKA 4YR7A 3FD6A 4HNGA 4NLLA 4HGOA 2O4UX 2P2GA 3PCTA 1S01A 1NMEA 1S8FA 2HQSC 1LTQA 1UQRA 1XD9A 4DIEA 5L6LB 1NXOA 2IEYA 4WAUA 3H1AA 1AMOA 3CC8A 4HAVA 1ODTC 2Z2KA 4P92A 3RIYA 3TRHA 5DN6D 3M1LA 1QTNA 1ZNYA 4FZ5A 4X66B 3AF2A 4TXJA 5EOVA 1JU4A 4WECA 3DMGA 2QSUA 3ZE6A 1MC5A 3HA5A 5IFLA 3EF3A 3PZBA 3NHKA 5FYDA 1KTIA 2ID9A 3GPBA 3LVBA 5DM1A 4RTKA 4Z4GA 4ZYWA 1NUAA 4WINA 1VJ0A 3CW2A 1PQUA 4U2GA 1JDVA 1VQOF 1SXJC 1UDRA 3ON1A 1VQ9F 2ZVPX 3KALA 4A92A 2L17A 5A3SA 5IULC 1A5SB 4NJMB 2Z5GA 3WLIA 1DIGA 1R0YA 1YC2A 3WTBA 1XTBA 2B7LA 1RXCA 2ZE6A 1ZMBA 3WJ1A 1OYOA 5JNSA 2Q6TA 3KZCA 3M9WA 4L4YA 4WADA 4QYSA 4MVJH 1YXMA 5EJIA 5CEJA 3DKIA 1Y1KE 3H0CA 1Q0QA 4WFQA 1EUZA 4JB3A 3P8ZA 2GF9A 2XUGA 4HLDA 5FLEX 5FT9A 2GBPA 2QMUA 1ZMTA 1HZZC 3LY9A 2VSFA 4Q4JA 3BCUA 3C5WP 5MFZA 3B1KA 3KXDA 3QTLA 5FBLB 1ISMA 1DT5A 4ZCQA 1KP3A 2BF4A 2OV8A 2QTCA 2XRFA 4BV9A 3C9TA 1LS1A 3GUUA 4V2UA 4EECA 4JJKA 4V0SA 4JKOA 3VPXA 3NAGA 3BXOA 4GPIB 2F9LA 2VTEA 4LWOA 5DDIP 2GJ8A 5KNCA 2ZSIA 3IESA 2YDXA 2GBFA 3D8BA 3GEDA 4EI9A 4Z0NA 2YHSA 4KACA 4TRRA 4O2AB 1RKUA 3F0GA 1UKEA 4FNAA 1F3LA 2CLSA 2ONZA 1R0SA 1JDJA 3K9BA 3PPYA 1BYIA 2EP7A 2YWGA 1TMGE 3UT6A 4CM7A 3B60A 1TO1E 1X6VA 3PSHA 4ZIRA 1SKAA 2J67A 2WF9A 4P0QB 4OFZA 2QQ0A 4YCBA 4DZTA 1D2AA 1PIWA 3REQA 3G2PA 3HY4A 4DLNA 4BBJA 5AVWA 3QYPA 5JWOA 4DLBA 1Z0ZA 2ZYHA 3H1PA 4HSGA 4FILA 3T35A 4L95C 4B6EA 1OFUX 4YIHA 3BRQA 1QLHA 2PM8A 2AMJA 1BE0A 1EFUA 1YIDA 4AECA 3RHFA 4EG5A 2M1ZA 3BZBA 4QASA 3ZHRA 4I6JA 2X8JB 2Y76A 3ZU4A 5B1IA 4E2ZA 4HDRA 3O21A 4I4IA 1XFAA 2BYTA 3IKMB 3W5UA 2VHYA 2RKBA 1HE3A 2YICA 3IT3A 4FYHA 4BGVA 1KTVA 1REQB 3GHYA 4NH4A 3ES9A 1EAMA 3I4CA