3WGNA

Staphylococcus aureus ftsz bound with gtp-gamma-s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 106
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgnA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgnA01
4O2BA 4O4HA 4TV9B 5LYJA 4E6EA 4I50B 3WGNA 5J2TA 4EI8A 4U3JB 2GVIA 4IIJA 4YJ3A 5FNVB 5J2UB 1RQ7A 5JQGB 4KWEA 3RYCA 4I50A 3RYHB 3C8LA 3JAWB 3JAKA 4ZHQB 4O2AB 4O4IB 1SA0B 4I55A 5FNVA 4FFBA 5JQGA 5KX5A 3HKBB 5LXTA 2Q1XA 3RYHA 5EZYA 3JAWA 4X1IA 3WGJA 3JATA 4LNUA 4HNAB 4I4TB 1SA0A 5EYPB 1TUBA 1OFUA 5JH7A 3RYCB 4X1KB 3HKCB 4O4HB 5LYJB 1W5EA 4TV8A 3CB2A 5KMGA 5J2TB 3UT5A 3M8KA 5MN6A 4M8IA 5BMVB 4IIJB 1W5AA 4YJ3B 3HKCA 4X20A 3RYFB 3JAKB 5IJ9A 1W5BA 5CA0A 5BMVA 5CB4A 4I55B 2RHJA 4FFBB 3M89A 5KX5B 5LXTB 4WBNA 2Q1YA 3VO9A 3VO8A 3V3TA 3RYFA 5EZYB 3N2KA 4X1IB 3JATB 4LNUB 4X1YA 4ZOLA 1TUBB 5LP6C 5JH7B 4YJ2B 4O4JA 5GONA 4TV8B 1W59A 5KMGB 2RHOA 1FFXB 3UT5B 2RHHA 3JARA 4YJ2A 5JVDA 4EI9A 1TVKB 1RQ2A 4X20B 1RLUA 1FFXA 3HKDA 4ZI7A 5IYZA 5IJ9B 5CA0B 1Z5VA 5CB4B 2BTQA 5JCOA 1TVKA 1Z5WA 4WBNB 4EI7A 3N2KB 4B45A 4IHJA 4X1YB 4ZOLB 5MN4A 5JCOC 5C8YA 4O4LA 4B46A 4O4JB 3JASA 5GONB 5LP6A 2VAWA 3VPAA 4XCQA 3JALA 5CA1A 3JARB 5JVDB 5EIBC 3N2GB 4F6RA 5LA6B 4ZI7B 2VXYA 3HKDB 5IYZB 5LOVA 1JFFA 2BTQB 5IJ0A 3N2GA 3HKEA 5LA6A 3VOBA 3RB8A 3E22A 4IHJB 1W581 3R4VA 3VOAA 5C8YB 2VAMA 3WGLA 5ITZA 4O4LB 2XKAA 4DRXB 3JASB 5LP6B 4TV9A 4U39A 4DXDA 4U3JA 3JALB 5CA1B 5EIBD 4TUYB 5J2UA 4DRXA 3ZBQA 1W5FA 4F6RB 5MN5A 4EB6B 1FSZA 2R6R1 3RYIB 4ZHQA 2RHLA 4O2AA 4O4IA 3WGKA 5LOVB 1JFFB 2XKBA 4TUYA 5IJ0B 3HKBA 4O2BB 3HKEB 4X1KA 4EB6A 3ZBPA 3RYIA 2R751 5M7EA 3WGMA 3E22B 4HNAA 4I4TA 2VAPA 5EYPA 3ZIDA 5ITZB 2BTOA
chains in the Genus database with same CATH superfamily
1QNFA 3BIFA 3RV4A 1Z56C 4C2UA 2FSUA 3MPOA 1ISPA 1NMXA 2OZEA 2SHKA 1EFLA 3KBBA 4Y7DA 4G0NA 4MEJA 4B5KA 3E27A 5HCUA 2FHPA 3QNMA 2EWCA 2VYND 4FWIB 4JZKA 3TXAA 4B4WA 2JAWA 1ZA1A 1JQLB 2G9ZA 2BPOA 4EJSB 1ADJA 1GOTA 1W46A 1Z2OX 2JJ2D 3BXFA 4HVAA 4MTLA 3ZIAD 4ZYWA 2ROQA 1TEZA 1EWVA 2VC2B 4W1QA 2J6HA 2Q8QA 3DZ8A 4ZHVA 3NDJA 5ITSA 3AO0B 2CHUA 2LCQA 4BCBA 3P2JA 4PYLA 1NNLA 3AF5A 2JDID 4K6OA 4TXNA 1BKSB 1FOEB 2JCXA 3EBLA 5AM4A 3R6WA 4ZARA 2CSLA 3HKCA 3MSXA 3K1AB 2L82A 2ODQA 3CF2A 3P45A 3PFKA 2OTMA 1FDVA 4PTYA 4ZQGA 2DKNA 3TRIA 1IN6A 4XW2A 2B0JA 4ZAZA 1USGA 3MJSA 4ZP1A 2D1TA 2P75A 1CY8A 2O2GA 3HGTA 5DEOA 3OCVA 3BIWA 1Q20A 3FAKA 2ZRJA 5E1DA 2X9NA 2IYYA 1R6TA 3I2FA 4IEIA 1GN9A 3FVRA 4RJ2A 5EFZA 3OECA 1GUYA 2IP4A 4RH0A 4F1KA 3VX4A 3FTEA 3D0OA 3EOBI 4UUMA 1DC4A 1QLHA 1Y1SA 5CCXA 3EHEA 2GPSA 4IV0A 1VSUA 4IUBS 2H1CA 3NASA 2HRYA 3AJEA 2WWRA 4Y6SA 3OQNA 1REQB 4XR4A 4AUMA 4Z5XA 1KQOA 4FEEA 4BNJA 4IO0A 1C2YA 5AI6A 2PSDA 1SBNE 4DA8A 3QZUA 5BVHB 1IHUA 2J3JA 3O4JA 1YBVA 1M7HA 4EYOA 4CM8A 2GAIA 1L9KA 3KRTA 1CXZA 2PZLA 1KQNA 4EEKA 2R96A 3TDKA 4B84A 2WKSA 5FAKA 4J8PA 4BWVA 2VHZA 2ZDQA 1V2GA 1G7SA 2W2XA 3A6KA 3IBTA 1QYVA 1SG9A 1COMA 1Q7TA 1SHKA 1ST2A 3QNUA 2RGBA 2BGUA 2HJWA 3CZQA 3CNQS 1N5JA 2QPOA 3OEED 4O0MA 3ZDAA 5IYZB 4FYKA 4MV7A 1W40A 3RG8A 1PWXA 1K5DA 4PVDA 2XT6A 3O3NB 4O1IA 3DUFA 2XZTA 3UK0A 3FCSB 3RFCA 4FWBA 3LO5A 3EIWA 2NO4A 2RGXA 3J80M 4LZPA 3TW8B 4L08A 2JJ1A 1BHSA 1PGQA 5AW9A 2JARA 2V7WA 4MCJA 1JHAA 3DZFA 1WMEA 2REOA 4K7JA 5BRJA 1XTIA 3L6RA 4UNRA 1DKOA 1ORWA 1DXHA 1Q57A 2A1TR 2KW5A 2WMDA 3UWDA 3UMJA 4CKXA 1JLKA 2AQIA 2PJDA 2Z0MA 3BGSA 4QU8A 5AJZA 4Z86A 1XXHA 2EG9A 2Q3LA 2CVQA 3V7NA 3KEFA 1NPDA 1RBYA 1JN0A 3M6MD 3EF0A 4X8MA 2BVNA 2QVCA 3ERCA 1VIMA 2ZTVA 3WP0A 1U8CB 1ZK1A 3OFJA 5EB1B 4B8WA 1OV6A 4DVJA 4GHWA 1D6JA 3A2NA 5FWDA 3HYCA 5DYGA 3ZJTA 3KAKA 3QMPA 3GFRA 1IXYA 3HFJA 4L8VA 3V5NA 5ECDA 5A4AA 2JNBA 2H0QA 1KFJB 2OBNA 4FFLA 1NN1A 3NC1C 4L22A 3KUKA 3ELBA 3MGBA 1NKVA 1K9VF 3E48A 3R20A 5K45A 3UK7A 2OV4A 5LDDC 3GRUA 3B3JA 5AFSA 1QGZA 1EQUA 1T1EA 2GILA 3C15C 3B53X 3PR2B 4QYXA 4HNVA 4MICA 5B4UA 5L53A 2OV1A 3Q3CA 4CIXA 3K9CA 3R40A 3FSGD 1CUEA 5FFNA 4KIWA 3FCEA 4REQA 5MF6A 3D6AA 4AZSA 4EUKA 5KTOA 5J5CA 2IF0A 3QUBA 3K4PA 4V0RA 1Z5OA 5H80A 3UMCA 2ZOSA 1XKQA 3Q3IA 4RULA 3VZDA 4KO4S 4QYIA 4V1CI 3KYDA 4CZ2A 3CLRD 2GPTA 4XSGA 5L3QB 4K9SA 4MQFB 4KFUA 2R6ZA 1O95A 2EC5A 3C74A 3EF3A 3LG2A 3QFRA 4HPWA 1ZINA 4JENA 2NO1A 7REQB 4C4YA 2YFQA 3C8UA 3LDFA 4NU8X 3J81M 2WEKA 3C3KA 2IXTA 2V6MA 3CN9A 4EHFA 4YDQA 2FXIA 5IZCA 1XCLA 2R8RA 1QQTA 1RKUA 3KT8A 3L4BC 3NNDA 5HK9A 4EKEA 3LDTA 5HDBB 2ALJA 2VP9A 2G7ZA 4A0GA 1FFXB 4Y2JA 4E33A 2YXNA 3L7BA 4BMOB 3NOQA 2QUIA 3T9AA 3HV2A 1MGOA 3EUWA 2OMEA 3IKLA 4KQMA 4GWKA 1V4BA 2OR3A 1KO8A 2WZCA 3NIWA 3WNCA 2VDRB 2F9ZC 1W35A 3GEGA 5DWQA 4D57A 4MUGA 3VR3A 2IWHA 1H8EA 5T4BA 2PUDA 4XEHA 5I9SA 2HV9A 2BM9A 2POQX 2JIPA 2W58A 5ECGC 3TW0A 4AN4A 4AZ3A 1D7OA 5EPOA 3WIDA 3SQMA 1L7RA 1ZMOA 2AW3A 3QKWA 4LF4B 3WC4A 5D3QA 1NXXA 4GLJA 5CFPA 2CHFA 4UASA 2FF5A 3WLFA 5THXA 2A88A 2BZGA 4BTLA 3ZGZA 1E1QA 2VCHA 4XX1A 1KFEB 4QXAA 4OOEA 1YR7A 3F3KA 2IOFK 3FJYA 4K6HA 1LV7A 4BYMA 3HJUA 1Z68A 2I6UA 1W48A 3N6RA 3I9V6 1XTSA 3P2KA 4ZWNA 3ZH2A 3BCUA 2XCRB 2V6JA 3MJHA 1C8BA 2J9FA 3KEOA 3BSWA 1CK4A 3FGOA 4BJ6A 2VT2A 2Y1WA 3IP1A 3L6OO 1H1LA 3UQZA 2VEOA 3QGMA 4YWJA 1A4RA 2IZ1A 5B6PA 2VP5A 4WGFA 5TT0A 1KU6A 5EP2A 1M8PA 5EHNA 3ZXIA 2Z6AA 3CWCA 5J2UA 4DRXA 1HA3A 3VR6D 1U8AA 1KYQA 3ORRA 3WWOA 4ALIA 3D0KA 3G2QA 4D1YA 3WGQA 3EYWA 4WA8A 3E3AA 3CVJA 3ON5A 1FJGB 2FQXA 3GAFA 3B5IA 3OPYI 4X6UA 1BKYA 4HDSB 3CX8A 4RJKA 2EFDB 2VDNB 1U6KA 2BHSA 3TZHA 4I81A 1X1QA 3ZW8A 1BQ4A 3OCWA 1T3TA 4YV2A 4RTSA 2CYAA 5AKLA 4M9RA 4AKHA 1MX1A 1K63A 1FBNA 3KSBC 8MHTA 2WHRA 1PS8A 4KWEA 3AUAA 2MIIA 4DTIA 2DE0X 4I4TF 2WFLA 1E66A 3WZ2A 3CCMF 4BLPA 1H22A 4LXUA 4DIKA 4O4HF 2BGWA 1YRQA 1CN7A 4PC6A 1PNVA 5DRYA 3RSFA 4OHCA 4KN6A 3OTHA 1T8SA 5I51A 2DLNA 2C9DA 3B1VA 2GNPA 3DWEX 3H05A 4H4CA 4O08A 2QZ4A 3H7AA 5TR9A 3RBVA 3C8DA 4DN6A 4F9FA 5JTTA 3S8YA 3P0IA 3NUQA 4ZANA 5KREA 1VG1A 1NYLA 3U7EB 1QIMA 4RU1A 1V6CA 2GPWA 1E4VA 2Q0SA 1KDVA 5BMVB 2CNOA 4IIJB 5K3FB 2BHRA 4BWYA 4Q7QA 2C7PA 4A8JB 2ZTLA 4OJYA 5AUPB 3MN1A 1ZLXA 5JFTA 1LX7A 1GAJA 2B7CA 4IJ6A 4JC5A 4KWHA 3R09A 4TXHA 1Y8CA 3KYCB 4B9AA 3EOAI 1QZZA 4IKPA 3MERA 1KR2A 3QY0A 5E4JA 2W6OA 3RUPA 2BL4A 2GD2A 3P2MA 5A06A 3IR9A 2K2QB 3T54A 3IR5A 4LK2A 5JXIA 1VJGA 3IHKA 3R6TA 3IAM1 4J3NA 3OHSX 4PZLA 3B6IA 4DV7B 3T80A 2YBEA 3ZCPA 1FMTA 5A62A 1WDTA 4GLOA 4UM8B 2HR1A 3P94A 1WY5A 3G5TA 3H4TA 2YY5A 1BROA 1UMCA 3UA4A 1VLJA 3AHDA 5LNK6 2WIGA 1R10A 3HYRA 4V03A 3UFBA 1I5OA 1AZSC 1EWKA 2GR9A 1E6KA 5EHGA 3KE1A 5CDHA 2N42A 5JE8A 3VVBA 5KJFA 1U6JA 2BH2A 4MVJM 3OBYA 3NK7A 4JP1A 1SVLA 2IYWA 4RF2A 3PA6A 4MX8A 5JNTA 2BEUB 5F9FA 2FMKA 3ZV7A 1V45E 1VA5A 4K3VA 5COAA 4UMEA 3SAJA 5BN5A 2ERCA 1XZDA 2QN9A 3DZKA 5B58C 4V24A 2ZYHA 2PVSA 4BT4A 1CDEA 1XU4A 1PR1A 1YJCA 3ESQA 3G02A 2RAUA 1G17A 2LUOA 2PT5A 3K2IA 3V7EA 4YP0A 1ZOPA 3ZVKA 1OH8A 1Y8RB 1XVAA 2EJCA 3GLHE 3U1VA 2A5YB 2O05A 2Q6OA 2GYUA 2N46A 2B36A 2AN9A 2BZ1A 5CBKA 4F92B 2FZKA 4N82A 4EBBA 4KGDA 2CJWA 1OBHA 1XK6A 3KT3A 4F38A 3EW9A 4OA5A 5C7LO 4FKMA 4U6NA 3FBAA 1JAYA 2GZMA 4H7DA 3VPCA 1L7EA 4TL9A 2W9XA 2VJDA 2WAOA 1JD1A 1PE0A 1CY2A 2HQSC 1Q2XA 1Z4JA 3TQRA 2R66A 2X7XA 1UF9A 1E2FA 2V5VA 3B38A 4WDRA 2O1XA 3WV5A 1PFVA 4EFDA 3U2QA 3HZZA 3ZI7A 3Q12A 3Q1LA 4WXEA 1B8NA 4O4IA 2GAJA 1KS9A 3B20A 1D7AA 2I7DA 3D0RA 2VJLA 3COWA 2QI9F 3DLIA 4GP7A 4NG4A 4QXOA 4ZOQI 2CUNA 4R5MA 4UDYX 2C92A 2VDUE 3H1BA 3M6LA 2AR7A 2DTXA 2D54A 1KO7A 4D9GA 1O4VA 3EA4A 3FRHA 1A77A 1IQ0A 1JRLA 1WEKA 3AF1A 1TADA 3C98A 3GFVA 3Q0EA 4CDMA 1GUBA 4WDQA 5EEGA 3WGNA 4HGNA 3WK8A 4WOCA 3HYTA 4HD8A 3TNLA 3TSWA 4Y6QA 1Q1NA 4YJ3A 2QVYX 3SHQA 2W93A 4QUIA 1KAQA 4UNIA 2J9YB 3Q8XB 3AIIA 3AQ4A 3I23A 4BJHB 4FFBA 2RARA 3GA7A 3L0ZA 1ETUA 1CZKA 1U3UA 1ZD9A 1HE8B 1EP1B 2XZDA 3KL4A 4G0ZA 4IYRA 3WGJA 1O57A 3NOXA 1JB1A 1I1NA 1MENA 5DNEA 2C2BA 4NK5A 3EH1A 4ILKA 1PS9A 1NUUA 3FHLA 3L8CA 4LG1A 4MGZR 4EHHA 1AHNA 3BQ9A 3MGKA 3P9KA 5K6TA 4CM9A 5KMGA 1H66A 3ZBPA 1SCDA 1G60A 4LF7B 5CXXA 4QASA 1QIHA 4KN5A 5E4FA 4ZJYA 2DSTA 3D00A 3HHPA 1N6PA 4KN9S 1J8QA 1KY3A 1MJGA 2EERA 2BM0A 3BTVA 3DKIA 4GZMA 4GSLA 3RVQA 1W5BA 4A10A 1ID8A 4DV5B 3WZMA 4CXMA 1RYZA 1E6UA 1YMUA 4LI0A 1VKZA 1Y4AE 3MELA 4QT4A 3SZ3A 2XWSA 3M2TA 3OHPA 5TF0A 5ITVA 4DDUA 4IGAA 1T0HB 4O4JA 3CLSD 4PBSA 3IA2A 4DY6A 2X8JA 3QIAA 1P2UA 1Z7BA 4BUJA 1TECE 3GGCA 2ZVDA 1T2CA 1NOJA 1WO8A 4IZOA 4DT1B 3VC1A 1NZFA 1Q92A 2CHVA 1FNNA 4PBTA 4E12A 3GLQA 3ZK8A 1EJ2A 3QITA 3S8EA 1M33A 4US2R 3SJAA 4KXUA 4WLFA 4ZVPA 1HT0A 2NVOA 3F1LA 1CQIA 3IJRA 4X8LA 1EUCB 1RIFA 3IBCA 3WPXA 1QE3A 3UPUA 4KR3A 2OHJA 4JLJA 1JHXA 3LDUA 4JB2A 4MLCA 1XZKA 5ALQA 4UOEA 4UUAA 1T9GR 3RFUA 3HJTA 2CNNA 3FN4A 2Y6UA 1T5SA 3QNWA 4PQFA 1JAXA 4XSVA 2MWMA 1RTTA 3ONEA 4TSFD 3DLAA 2QVLA 4QUDA 1LI5A 5B6IA 1EIWA 1OY1A 2MMGA 3NHWA 4Q7KA 5CVDA 1N8KA 2E9SA 5DBOA 2BTQB 1S5PA 3N2GA 5BV8A 3LQ2A 4AZWA 5KYXB 4MTCA 5AI0A 2RGRA 4UQLA 3RB8A 4D74A 4DDWA 2B1JA 4ARZB 2Z1FA 3KHUA 2P6MA 3TLXA 5AW3A 2F67A 3FBGA 4HBGA 3UJ7A 4BBJA 4LX8A 2C4WA 1SXHA 1YBFA 4HAOA 3UJ8A 4A9AA 4DLSA 4QQNA 3PX7A 6YASA 4N0MA 4H0CA 4Q9LA 3F98A 1GITA 3B6NA 1QX4A 3UHAA 4AROA 2JBHA 2JHCA 3DGEC 5DULA 1F8YA 4OJQA 1WTCA 1RSZA 4IKEA 4GOND 1L5LA 3FFAA 4ARVA 3K2XA 1YJ8A 1MTOA 4IF4A 4N3GA 4JR1A 4JC4A 4BO8A 1V96A 4Z7JA 4KBFA 1L5GB 2OAEA 3AEYA 1BKDR 1M1XB 3IUPA 4J0KA 4YONB 3TK1A 4DQXA 2NM0A 1RQ7A 3KAQA 4RPIA 1QP8A 2R68A 3OY7A 5CHEA 4BP8A 1K66A 2DCMA 3GEIA 3EVGA 3I2KA 2WZQA 5CBPB 5EJ9A 4MB2A 4C22A 1L1QA 2BW0A 1LPOA 4P4UA 4PCAA 4PGMA 3EMKA 4WN9A 3L0OA 4YAEA 4ZDIA 3OW2F 3PYMA 4MZXA 2F9FA 3A14A 3PDIB 3DAPA 4WNAA 4Z7NB 1KEUA 4MW6A 4M1YA 2FPIA 2GRJA 3QPVA 2XLCA 3Q2OA 4P98A 4HQLA 4W9NA 4EPWA 1AKVA 5IAOA 5DOVA 1HORA 1QTRA 1XU7A 2JLBA 2ZSFA 2DLDA 3C6MA 4L2IB 4TTPA 4ZK7A 1KQFA 4FXPA 3B9RA 1NQVA 2PLAA 2ZG6A 4ACAA 4OEHA 1G1MA 2CC2A 1SM4A 2IVZA 5AKHA 5G0TA 2JGIA 2ZT5A 3E1YA 1H3NA 1M1KH 2V5AA 2WWTA 1E96A 1HDYA 2XMCA 3AGQA 1D1SA 3C70A 2I7CA 3LXXA 1YJQA 4FZ5A 4LE2A 5FWNA 3LT5A 2QNRA 2DFNA 2SCUB 3KOXA 4RJJA 4YRPA 3F8WA 5GVSA 4DUZB 3D3JA 4K03A 3ICWA 4BQSA 4E1AA 5TVGA 1WJGA 1VJ1A 4V0LA 5L8VA 1C4XA 2HHJA 3R9XB 3HYSA 4TQUS 3VO8A 2CLDX 3PHCA 3FYSA 1U9JA 5KQRA 3LWPC 1SXJA 1QDLB 1E4OA 3BB4A 5JJIA 4IDQA 5G41A 1R7RA 3K9FC 2DBYA 1Z0FA 1YKFA 4I7EA 4DR2B 2ETXA 4R8SA 3SFVA 3BN3A 1TE2A 4CMCA 4F06A 5T3YA 3H97A 5JVDA 1YDHA 3ETLA 4GECA 4IJUA 2X76A 1PFQA 4NVRA 4XGIA 1E3SA 3EVZA 3OU6A 3MNFA 3QIVA 4G9EA 5UKDA 3DL2A 1HQDA 3FFTA 3N8IA 3EUAA 5KYYB 3BHNA 3F6SA 4PLYA 1FJHA 1UMDA 2OQRA 3I30X 2J08A 3KFXA 1K68A 2H7VA 3GF4A 2DPYA 2O8EB 2I3DA 1NBWB 5NLLA 2F1IA 4R6XA 3T41A 4PFJA 1J8MF 3EGDA 4TKUB 3KZXA 4DCMA 4OM7A 5HZGA 4U7DA 2F1KA 5IANA 1ESZA 4RS3A 3SE7A 2PHZA 1GYRA 1LEHA 3SDZA 3ZCTA 3T7SA 1W7AA 2QVBA 1Z22A 4P4TA 2A30A 4Q34A 1IJFA 5D00A 2GXUA 4AYTA 3I1IA 2FFHA 1JHDA 3TTXA 5HXAA 1T1IA 2JFWA 3CR3C 4WKNA 3EDOA 4ZRMA 5BP7A 1XXHE 3TCKA 3PEYA 3WK6A 2PANA 2YN0A 3REQB 3PYXA 3B85A 4D0RA 1P39A 5HW0A 1P9RA 3K53A 5D3MA 4P82A 2ZAIA 1PWZA 1RQNA 1MF7A 1VCIA 2D7CA 3W8NA 2V4ZA 1F3LA 2FEWB 3IDSA 5CA1F 3CCJF 2BC9A 2COEA 2Z9DA 3JWIA 4O4LB 2M2IA 1TMOA 2OQVA 5LLDA 3RH0A 3E84A 1TJNA 4LC0A 1XNQB 2PXAA 3OFND 2NZJA 3BMQA 4PLHA 3I39X 4OXKA 3EZ9A 1ILWA 3AESB 4R05A 5G1NA 4EECA 5CT5A 4CKBB 4EY4A 1UBSB 5CFZA 1LVUA 1VDMA 2YL2A 3ZY3A 3G0GA 5T41A 1BA3A 3ZV4A 3DC7A 2Q5HA 3WBFA 2G4CA 2R6R1 1PFUA 3A4VA 1RWMA 2QYHA 2QN2A 5DXFA 3TD9A 4R0VA 3IFSA 2JBAB 4KRXA 1XP8A 3E3LA 3OO1A 3F7TA 3HC7A 1H2HA 4QOGA 1OH5A 1NJGA 2EGHA 4PLPA 1TMKA 2WIFA 4YMUA 1J42A 4FB4A 4OG2A 3UWKA 1LBEA 3ZGNA 4FZJA 1D6NA 1MNQA 1NW4A 2WUGA 4JR2A 3UO8B 5CYGA 1QHYA 3LIPA 3CPHA 2HF7A 4FSDA 4NIMA 1U2GC 3RVMA 1RWBA 3SIVA 1CVLA 1E2NA 2VUHB 3I8XA 3HCRA 3LHFA 2WWHA 4GPIB 4ZVMA 2Y27A 5HMLA 4IHKA 3GLFE 4EO9A 5HJ5A 1H5NA 3OAAA 1MEOA 3FMPB 5KX5A 2QL7A 1X7XA 2QRPA 4YIHA 4GLLA 2C96A 5AK3A 1FVOA 4OSEA 1OVGA 2WHQA 1JAHA 1M6EX 3O4VA 1VH8A 4KEAA 5HG0A 5HOEA 5KYGA 3ETDA 3COVA 1M76A 3FUUA 4DIEA 1E2LA 4ZV4A 2F7SA 4LJLA 1WABA 4BO0A 1L4BA 2DSNA 2QYTA 1G42A 1T9DA 1XDZA 1P4AA 3AW8A 3R0XA 4MDHA 4TWJA 4U6QA 5EWMB 4FYHA 4YP6A 3K0HA 3HQ4O 4NU6A 3VU0A 5DH9A 1RM4A 1TI7A 3DMGA 3O0DA 3EGWA 1U8EA 1V43A 1KMQA 2H00A 4HZUA 1FMJA 3H0CA 2E0IA 2RFLA 3PC4A 4JBWA 4HCJA 3OBWA 4LSMA 3ZK9A 3C8MA 1V7PC 3E5MA 3I9MA 3LP6A 4MA4A 4BX9A 1CZLA 1HYQA 2PQ6A 4QREA 4WINA 4IH1A 4M3NA 2ORWA 4RH3A 4KYTA 4RF4A 3TB4A 5EMNA 4FJ0A 3F67A 1S9HA 2XT0A 4HAWA 1LTHR 5F98A 3AI7A 2RHOA 2A1UA 2V7PA 2Y6VA 2E21A 3CF4G 3FPFA 1AOXA 3OLQA 4Y67A 3JARA 2PGOA 5JTUA 4OQEA 1NVVQ 4Y98A 4B82A 1Z12A 1ONNA 4N6OA 1PR6A 4FLEA 1W6UA 4P4GA 2L0XA 4XUCA 5EP4A 4F93B 1P3Y1 2NXEA 2PY6A 2QUAA 3CC2F 3D2AA 2UYYA 3BWXA 4CIVA 4OLBA 5GINE 2QTZA 1WEHA 2W0SA 1BXKA 4ADSG 1I2CA 1VPEA 1C0LA 3L6UA 4GM0A 3MQ2A 4FC6A 2X6RA 1M2OB 5LP6A 1HSZA 1S7GA 5K6AC 4EG4A 2JIMA 3KXLA 1U0LA 1ZJ4A 5BR4A 3MUEA 2DTDA 4UBIA 4JXZA 2C95A 5KQLA 1LA2A 2ZJ5A 4KDFA 2LXNA 1G0NA 1JVBA 3IIIA 5DK6A 1H4VB 1NYRA 3TVDA 4G8DA 3ZTYA 1G8FA 3GRRA 1YA8A 3PFWO 4JMPA 1SAYA 1RRPA 3IYLW 2Q2QA 2YV2A 3TCXB 3D31A 5AVMA 1SKYB 3I6IA 1GZVA 1LPAB 1P61B 3NBKA 4GSKA 2QZ9A 1DUVG 4WJKB 2VOEA 3FMOB 5D6NA 1M5UA 2BFDB 3LO8A 3VZRA 4BNDB 1I4EB 1RJDA 4UOQA 1B8PA 4CJXA 4FYJA 2GB4A 4TX1A 1SOAA 1AX9A 1CF4A 4LCEA 2W6JA 1XVIA 3X0DA 4A2PA 2JC3A 4CMHA 2YTZA 4NESA 4TSRA 3T5AA 3TJRA 5B37A 2NT4A 4J6EA 1QRUA 2QJFA 5GOZA 5DNVA 2CE7A 3ZPXA 2Q99A 3D3KA 1B76A 1G8MA 1LNQA 2ZSDA 1NOIA 4DLZA 3U7QB 1F7VA 3QA3E 2I1VB 4X63A 4G4XA 2KE5A 3IMGA 5G0UA 4PIMA 4Z54A 4L78A 4QUAA 1OI7A 3ZCSA 5FYDA 4EG3A 3ZN2A 4OV6B 2IOHA 4YB8A 4URVR 5BN3A 4LYEA 1YZ3A 2BFBA 2XB8A 2ZJAA 3G0CA 3KTAB 2Z1EA 2PSFA 2WJJA 1TAHA 3GNQA 3M6VA 1LBHA 2RG7A 4FDVA 3ANTA 1S96A 1UIMA 2OO5A 1A9XB 1UR5A 1NRXA 2VWGA 4REMA 4UFNA 1X7WB 4A6EA 1IBMB 4Y9RA 4KFCA 4I55A 1MD9A 2YICA 1HG1A 4OXYA 4Z3OA 3EARA 2CKDA 3NH6A 4XPIB 3KJHA 3ZG6A 2FAXA 1RPTA 4HNAB 2JFBA 3ER6A 4WOPA 4EJFA 2FNAA 3TQQA 2A9RA 1DC3A 3TD5A 3HRHA 2W2KA 3O6VA 3GVIA 3D3WB 1ESMA 4R31A 5AW4A 5JEEA 3I58A 3WX0A 5SY4A 5FJJA 4MVCA 1SC3A 1V41E 2GQ0A 2YJ4A 3PUVA 2CZWA 4NULA 3FI0A 1OLXB 2NQTA 2Q6TA 3GHHA 4Z8XA 3WAGA 2IX9A 1UBMS 3DHWC 2GEUA 1C2TA 1JU4A 1ZCZA 4DUGD 1KERA 1X1RA 4CQMB 2AB0A 1BEEA 1KVUA 3KAPA 4CMBA 4TYMA 1LK7A 2OKCA 3LT2A 4G0XA 4S1OA 4BECA 1YR9A 2W7TA 4OA8A 3TLGA 1D2GA 1FUUA 2RGYA 4I14A 3E7WA 4KK3A 4NYJR 4P4SB 5HY1A 2YIMA 2COKA 3NHLA 4DRYA 1XQ1A 5EZ5A 4PNPA 4GXNA 4CKEB 4Q4LA 4D45A 1C50A 1Z0ZA 3BDVA 2CB0A 4OB6A 4UVDA 4X94A 3F0EA 1VB3A 5CLIA 2FN9A 2JHGA 3D6UA 4PR0A 2YS7A 3OZTA 2GBLA 1F20A 4NQRA 3YASA 3L7IA 4ZVSA 3RSSA 3ANSA 2XVYA 1EDEA 5AXBA 2CXHA 4EA9A 2LIPA 3UEOA 2HO4A 1Y4ZA 1RP1A 3EY9A 3PEEA 3R3HA 1E32A 2FRDC 3V2UA 4B73A 2XRMA 2OORC 2Q6VA 5IAJA 1JG4A 2C29D 2AT1A 4GE3A 1QQ7A 4E5NA 1VHQA 4PZ9A 1DADA 1U3VA 4QEDA 2ZRGA 2FPLA 3U1BA 2FPSA 3AF0A 3FETA 4IINA 2X9QA 4X3CA 3KWLA 3QVVA 5DHSA 3PHJA 3NZEA 1HDEA 4HPXB 4JJ8A 3OTOB 3KR2A 1A98A 1YB2A 2H9YA 2WUDA 3ZW7A 1XKTA 1KU0A 1QK5A 1VBMA 1J70A 4MV5A 4ZI7B 4MPPA 3I05A 1G20A 5E1BA 4Q3EA 3ZTTA 1Y5RA 2H0RA 3P0FA 2ZUTA 1BEUB 2B8WA 2D0DA 4KJZA 2SKEA 5EKXA 5EJ7A 5IW8A 1Z75A 1T5IA 3LBNA 4QA9A 4B47A 4MRNA 3C9UA 4R98A 3ZE2B 3KAJA 2M98A 2XE6A 2VZ9A 1Y82A 2JFPA 2PJZA 2BRUA 4Q18A 3TRHA 3ROKA 4B3JA 5CEFA 1JF8A 3B6ZA 3HEBA 4TKLA 4Y1RB 3ETEA 4G5QA 4WY2A 2ZU6A 1X7YA 3EIEA 3E9MA 2ZIVB 1E1CA 1R00A 1WXEA 2H1IA 3H2IA 4FUQA 3VKFA 1N92A 1QIDA 1MQSA 4M83A 3TOSA 4YV7A 3AOGA 3MS4A 1EYZA 2WA2A 4IX1A 3C1AA 1VPLA 3O21A 4N6NA 2R9VA 4LF8B 1TX4B 3U80A 2QX8A 2Q50A 5AM0A 2PZMA 2GO7A 2AKYA 5FOXA 3IUJA 3VBCA 4A92A 4KITB 4U2GA 2F62A 3T3EA 2VNIA 1PEKE 4LXGA 2OXRA 1KETA 5E8RA 4ML3A 4HQ6A 3FR8A 3E1SA 4FI3F 1ADFA 4BQEA 1Z08A 2GNOA 3SDSA 3D59A 4IDDA 4Q4CA 1JLLA 3RNLA 1AK2A 1SQ0A 5HKLA 4AKSA 1GKIA 3BK1A 5JD5A 1WDMA 2AMLA 4MO2A 4X84A 1H93A 5AYVA 3QKTA 5LXTA 3JQBC 3M2PA 1QG6A 2RJOA 4FGWA 4JCOA 4TMVA 4W9RA 1KMCA 4BLQA 4ZYUA 1LVGA 4X1IA 3U3OA 4W8OA 1HI9A 1ZI6A 5AVOA 4NR0A 4F56A 4URFA 3I9FA 4ZXPA 4FLMA 1SBZA 3U26A 2ONZA 3OEHA 1EWTA 3R75A 1CQJB 4HNQA 3F1KA 1PWHA 2IZ0A 2TMKA 3NUGA 4M8NE 4EJMA 3HXTA 4EGAA 2J41A 2Z43A 3I1YA 3T5TA 1E0AA 1SUBA 3CKYA 4FGZA 5AVQA 1OE0A 3VI3B 3AETB 2CMFA 1MEEA 1CYDA 2JI9A 2EOAA 4KDRA 3D0QA 3B9PA 1NUAA 1UJNA 3E15A 2APJA 2A35A 1UKBA 4A03A 1GQOA 3D4BA 5L3VA 3H42B 2RC6A 4GOJA 2JD1A 2Q0QA 3BXZA 4NFSA 3SNHA 3VC2A 2Y1LA 4KN8A 4URZR 1TJ5A 3UCFA 1GVNB 5FL7A 2FK8A 3FXAA 4AF7A 1ZESA 3D8HA 4J9UE 4TRMA 5MFZA 3VDMA 3FOEC 3A2MA 5ALOA 5BMVF 1LFAA 4XYEA 1P5HA 1WAMA 3BK2A 3KP1A 1ZUIA 1EM8A 3PC3A 3JCMM 1YI8A 3O8OB 1C8KA 2ATXA 4QGBA 3JWHA 5AO9A 5G1OA 4K0RA 4AXBA 1FJXA 4NMHA 1AHHA 4Q1DA 4EHIA 4Q9AA 1OIXA 4ZHWA 3GUHA 5CA0B 3WSVA 1I4WA 4TKVB 2Y1OA 4TTAA 1XOIA 3OZSA 1S89A 1T6NA 5JANA 3ICOA 5F7JA 3ZDRA 2XTAA 2BGRA 1E1RD 1RBMA 2QG6A 5EIFA 3V00A 3DVLA 1EUQA 1K73H 2CT8A 3GNTA 4V38A 5AVZA 2QQGA 3H9JA 2WV9A 2G4VA 4XCQA 2FC3A 1SELA 2E89A 2HBQA 2MYPA 5I9BA 3STXA 1WB4A 2ONCA 3HU2A 4UPDA 3TG8A 1MC4A 4UVEA 5KOJB 1PVOA 2HI0A 4PYJA 1W19A 3ENWA 5BOVA 4C7OB 3ZYZA 1ZSNA 4Y2HA 1KEEA 1OWPA 3OIGA 4PSVA 4S05A 1F0YA 3OM9A 3UK2A 1RKVA 1Y33E 1OAOC 3RC2A 1WZ2A 2YX1A 3FCXA 1DKQA 1JPJA 1F2UB 5CAEB 1QYWA 4C7KA 5JCJD 4QDJA 2JK1A 4RTKA 5M29A 1ZHOA 3O4FA 4U2CA 3CG0A 2J8ZA 4HX2A 5FORA 4W4TA 3B6JA 4HEA6 1QHSA 8LDHA 1IM2A 3LBYA 4AMZA 5KOHB 1UEJA 1C1DB 3G13A 3RANA 3LUDA 4ERXA 3UMYA 1T3HA 1T8TA 3KD2A 5B1EA 4Q05A 4O02B 2YKGA 3DO6A 1USVA 3MTGA 1WS6A 4RJIA 3OOWA 1EZ4A 4CKYA 3DOIA 1ADBA 2Q0XA 3A05A 3OM8A 3OWHA 5AWFC 4KXXA 1GCGA 1T0BA 1G3UA 2O20A 2GEDA 2O8VA 2ON6A 3NHMA 2J67A 1NHGA 5AKKA 1Z73A 2QVZX 3I7TA 4I99A 3K9GA 4YUAA 1L7QA 1LQUA 1N57A 1FIUA 3ER8A 2WNHA 5KQGA 4BQIA 3I3OA 121PA 3EY4A 4JLAA 1EK0A 1RKQA 3TIIA 2AQKA 2B78A 3FIUA 2JF0A 4ZQCB 3EWNA 4E1BA 1I0LA 3W90A 2ZRFA 4EQ6B 5A71A 1N5IA 3C3BA 1V4VA 3DP7A 1RQRA 4UCFA 1H2ZA 1NU6A 1TU3A 1VE7A 1VG9B 1Z3CA 1ONPA 2X14A 2EEZA 2BSAA 4QDZA 2XGMA 3HBFA 4KLRA 5LNK1 3DO5A 2XOXA 2PMWB 2VDOB 3UENA 1SQGA 3TN7A 1C8VB 3KVOA 1AKYA 1JEYB 1JLRA 1B3RA 1Y8QA 1FQOA 2FW1A 1PNQA 3TKLA 1ZKDA 2OHWA 3MCZA 5CIYA 3HB4X 3PVZA 2G67A 2A84A 1JBEA 1NDUA 3OE5A 1TVMA 4DIFA 2CV2A 2D0OB 1QS0A 2NZ2A 1URPA 4M9UA 5C32A 2R1ZA 2CW5A 3U40A 3QWFA 2FXVA 4B74A 3S2IA 1Z83A 2PH5A 3VUEA 4JH0A 2QMUA 4HWSA 2C98A 1SUAA 3ELDA 1MABB 3FNQA 3KDSE 3MJDA 4KTTE 2YJ3A 2QZJA 4YI3A 4DPKA 2PUGA 2O2EA 4QGFA 2AN4A 2O3TA 4Z7OB 2KLBA 1EVLA 3DCIA 2JIQA 4DB4A 1VQ5F 1BCSA 3I1JA 1VXRA 4P7FA 4TPKA 4X6YA 2AMJA 5JNLA 4NCAA 3RAGA 3WLAA 1AXEA 1DXYA 1O87A 1ML3A 1QR6A 2WJZB 2XYGA 4HDNB 5THQA 3TGWA 2OBLA 3ZDFA 2J3LA 4F12A 3M4YA 2P2YA 2ADOA 3T7IA 1C41A 1ENOA 3WSTA 2HWUA 4I5EA 3I9OA 2XH8A 4CDRA 5ICFA 4S2UA 1BQEA 1I36A 1MV8A 3BH0A 1G59A 4C03A 3Q0TA 4O5AA 3U17A 2VJMB 1T8RA 2FX5A 4AK9A 1G18A 3FUWA 1S0UA 4B0PA 2BGLA 2QAGA 4GI5A 2PNJA 3K0AA 3WLNA 5EJFA 1RWKA 2FN8A 2A0WA 4ZCLA 4G4WA 5ULLA 2H3HA 4GR4A 1OT5A 4OH7A 1FP1D 3MJRA 4XVQA 4UM9B 4K9KA 1LPSA 4GMGA 3IALA 2UDPA 1LZKA 3AVVA 1P3JA 4QSMA 4RVHA 4E32A 4BNGA 1ENZA 1WUKS 2NPFA 1CRPA 5FFFA 2HHLA 4KV9A 4EB8A 3PCTA 1JN1A 3BEDA 3VRHA 1N0HA 3OOHA 1PSZA 3JV7A 4QVKA 5GPBA 4ZGGA 5E8JA 3FRIA 2VQFB 2XRZA 2VAMA 1AGXA 1OXSC 2WSLA 3RPEA 3T06B 1E3WA 1ZCFA 4H4DA 1YQNA 1UM9B 3ENKA 2BH9A 1MX5A 4AMBA 1YUNA 2QVXX 4YAGA 1JQKA 2KWIA 2VYVD 3DA8A 3ODPA 1UPBA 4KR6A 4H60A 3JVVA 4H7KA 4KXNA 1UBLS 3RIHA 1WCIB 4KAAA 1AJEA 1TCUA 5K6RA 3AR8A 3LZCA 4IICA 1PIWA 2WMNB 4A7PA 2V1UA 5IVKA 1WMFA 2Y71A 4ZOCA 2ZBRA 1SIUA 1UXKA 1Y4SA 4MWDA 4BFYA 2IW1A 3PTLA 4YP9A 1SKQA 3HWWA 3DDOA 1Z4KA 4TGLA 2WRZA 3N0VA 4GLBA 1MC5A 4RH1A 5DBFA 2D00A 3DCNA 3I4LA 3B3AA 5FQNA 1E63A 1LDNA 3R8XA 4QLOA 4FYWA 5JIBA 3BXGA 2F17A 1Q7RA 4X92A 3GYBA 2I2AA 1TZCA 1M5RA 2QS9A 4CQMD 3A27A 3VUFA 3GRCA 4RIIA 4CPDA 2UYNA 1SUDA 2X2PA 3HP4A 4X95A 3NANA 1WDWB 4OHMA 5FPHA 5TQ0B 4NPHA 3UG6A 1ILEA 3SQXA 2D7JA 5F3DA 3DDSA 1NZJA 1ISIA 2FMUA 4MULA 2BR3A 1EVQA 2EW8A 3KLNA 4ER5A 5ALUA 4MSUA 5K20A 2GMWA 2C7VA 2K2WA 1TGVA 2W6ID 1U98A 1W5EA 5F5LA 3U9TA 2H2WA 3UT5A 1MMFB 2I4NA 3QXCA 3R3UA 2QG4A 4K1LA 3U4DA 1VP9A 1GGHA 1QU9A 3RAFC 3SEAA 4KO8A 1YIOA 3BMOB 1CUSA 1QFYA 5A3SA 4TWRA 1SCNE 2NU9B 2XCSB 5EWLB 3DUWA 1O94C 4MARA 4JNKA 4IMPA 3NV7A 1IVSA 2NXWA 4NOKA 3HAXD 4X45A 4F60A 4ETNA 3B2NA 2XMDA 2GPNA 3CO0S 3HZOA 3JWEA 4R9NA 1DWQA 3STVA 5JECA 3ZHZA 1SKUA 2VN8A 1ZVMA 2YASA 3UF0A 4M60A 1KOJA 3VYUC 2DY0A 2VIIA 1COZA 4F6LA 4O59O 5BNIA 4UM5A 3LXRA 4J0FA 4C0LA 3W5BA 3OHMA 5J4LA 1I10A 1J5PA 2AFHB 4RIHA 1XCPA 1F0NA 2FG6C 3DBRA 3FGZA 5IJXA 1SU8A 1HMPA 4G4SO 1OYOA 2PNFA 3K1JA 3LHKA 2DMRA 2QE7D 5HCIA 3WADA 3IP7A 1FC0A 4C0QC 2CCJA 1YNSA 1K5GA 1G7TA 2Q8PA 3KC2A 3KM0A 2VHXA 2EEPA 1P0MA 1SCUA 1YA4A 3KZCA 5JSYA 3CCEF 1E9RA 3FH0A 3F6EX 3PGMA 2VDWB 5CT8A 5COBA 2HDHA 4DR6B 3GZNB 2B6NA 1T6YA 3JQPA 2B82A 4MVJD 5J4YA 2D1RA 3JYNA 5JQWA 3A1WA 3D4PA 5CUQA 5LOVA 4EGSA 4CM9D 2PU5A 2OT3B 4YCAA 3ADBA 1ZX1A 4PSDA 3AVYA 3OZCA 2F43B 2XCOA 3H04A 3HCDA 3KLPX 4QVGA 5E9JA 3MTQA 4FX2A 1BXRA 3WGGA 5IKMA 2Q8NA 2ZT8A 3QUSA 2WWVD 5C8YB 2WHPA 2VT3A 5HSGA 1QH1A 1LNSA 2XKAA 3EGXB 2HP3A 2GZAA 5PNTA 1FS5A 4EMSA 3Q6MA 1RPAA 2IEBA 3TZKA 2G17A 1SVUA 2ZE8A 5E6RB 1XJWA 2AX3A 3A1DA 5ERYA 1KHHA 2QYOA 3UICA 3NBZC 2VDQB 2M1ZA 3JQAA 4J0JA 5E4YA 3DSRA 3TOZA 1C9YA 2RJNA 4B75A 1FL9A 4N8EA 4YV0A 2G5TA 5HILA 3C6YA 1R0WA 4I4TA 1A5SB 1IBRA 1TIBA 2W90A 3PKJA 2HRQA 3MT8A 4LAFA 4O4LF 4RFSB 2HKIA 4RLSA 3CUYA 4KLCA 4O4HA 2COUA 2ZQYA 2D2EA 2B5WA 1SVNA 1RT9A 2JVKA 3BCHA 3G1UA 4ZO7A 1GAXA 4MIOA 1EDBA 1CB0A 1S2NA 3IIJA 2B4AA 4NMMA 3R3YA 4NX2A 3DXFA 3SOZA 3RYHB 4E22A 1QJCA 4W1PA 1SA0B 1YBAA 3L0PA 2HADA 2HJHA 5K3DA 3E70C 2ARKA 4GBMA 1P7VA 4YACA 1NN5A 3FZGA 3V4DA 3JQFA 4QL3A 4G0YA 1KEVA 3ZE9A 4RF3A 3PNOA 3MWFA 3Q72A 5EUMA 3ADKA 5FUYA 2C1ZA 3N07A 4RTPA 5CLJA 4JP2A 3VNBA 2JHPA 4YAKA 3ZHCA 3TOVA 3ZO8A 2D2XA 2Y66A 1XVUA 2W43A 1I3KA 2FLVA 1Y42X 1PNOA 1T9ZA 1SJ9A 2ATVA 3C3MA 4TVSA 8ADHA 4KPFC 1Z35A 2WJ4A 2IZ6A 2WBLC 1NL3A 4RL6A 2ZZKA 4P5EA 4NZMA 4UMFA 4LTDA 1GT6A 3GT3A 4M37A 1HDXA 5KC8A 2I1WA 4JDUA 2I62A 4CQLA 4NI5A 1JWLA 2OM6A 3M34A 3OQ6A 4R51A 2LR0A 3C7TA 4MZDA 2EP8A 1E3DA 1RDFA 4HWRA 2JJ2A 5FXMA 2P35A 3RVKA 2HCFA 3ZIAA 4PX2A 5FEMA 3O95A 4RANA 4YYZA 6REQB 3SZLA 1GZUA 2Q3EA 3NVMB 5IC5A 1N2HA 2E7ZA 5K0JA 3PDUA 4Z2AA 4MP6A 3ZCQA 2AG0A 2YOHA 2FW6A 3KT6A 3ROPA 2JDIA 2RHCA 3FSRA 4OLHA 4ZYLA 4JUFA 3GLGB 4QJ5A 3OX1A 1GKUB 2I54A 3N2ZB 5F7XA 1NVBA 2P5SA 4TRRA 5B12A 2J0UB 1TUIA 4GXQA 2YWBA 3HJCA 2QROA 4DTCA 1OFGA 4M0EA 2GFHA 4KQ2A 5AXDA 2BBWA 4CR8A 3EVAA 3S2ZA 1PJAA 2Y93A 3EXHA 3L8HA 1LPBB 4CHGA 4LE1A 4TL6A 2PMCA 3MBOA 5F2OA 3ESXA 3G17A 3UJCA 1XFDA 2EW1A 4W1SA 1N7IA 1I3CA 2QKYA 5JMTA 2Y1FA 4EZIA 5KQSA 3SSAA 3KVYA 5KYWA 4FJ2A 1VLHA 1DQPA 3CNEA 5LQJA 2OENG 2PU7A 2YXEA 3OP1A 3EQ8A 4WASA 3VTZA 3THRA 1GDHA 5ALLA 5TEVA 2ENWA 4YC7A 3B5JA 3BWVA 3IP3A 4XRRA 4DIOA 5T3UA 1HFKA 2GZHA 4ODIA 4DNXA 5DGTA 4EB6B 2H08A 4N1AA 3UWOA 4KVFA 3SC6A 1G5RA 4X97A 4DNPA 3VNSA 5BNWA 6LDHA 4XI9A 2QL9A 1JFFB 4IS3A 1I0ZA 5FTMA 2FMFA 4YRGA 5J4KA 4EUFA 4ESHA 3L5KA 4F04A 1M2EA 4GE0A 1FRQA 1QCYA 1U99A 2C0PA 2R751 3BA1A 1EK1A 2XRFA 3V33A 4W5QA 1PV4A 1MEJA 1VMDA 2ZT7A 1KBZA 3AXSA 1KOLA 3IOBA 2PS3A 3L02A 1QAQA 4ALNA 3TRJA 2B4RO 2RDMA 4G5FA 1LQ2A 5KTKA 1X15A 5DHPA 4N65A 4YJGA 1XRRA 5H59A 1DEXA 2BF4A 1C3LA 2DJ5A 3DMDA 3QVLA 1HTTA 2QTVA 2PBLA 4EG6A 2E4UA 3TQSA 3RT7A 2QTCA 4JNCA 3NWEA 1M34B 5LZ5A 1N32B 1Z2CA 2PT9A 2R5FA 5J2TF 5IDYA 3VVLA 1KJQA 1OD6A 2NU8A 5LP1A 5LYJF 3I83A 4B80A 4XJSA 1TUGA 3MG9A 1RRFA 3CPEA 4O5OA 1S2MA 4ALKA 1CHDA 2OCKA 4REOA 3P0EA 2BIFA 4YASA 3Q6IA 4KMSA 1DX9A 1FFCA 3HFGA 1DG1G 3LY9A 3OIVA 3WMWA 1UINA 1WXDA 4P0QB 2XQIA 1A76A 1SXGA 1C7JA 1NZDA 2A94A 3B51X 1W30A 1Q95A 1XDSA 2ZBPA 2AJBA 1UXOA 3CVXA 3DQPA 2KSQA 5CB0A 3BJMA 2EQBA 3GLRA 1YI2F 1A9TA 1R6XA 3P20A 2XNKA 2PLRA 3MUFA 4ZU3A 4FWTA 4RKWA 3QMVA 3O85A 4LXIA 1QDEA 1Z5ZA 2BKXA 2EWMA 2JIOA 3IBGA 3L6CA 2GZ2A 2XXBA 4BXOB 4L6AA 4PZAA 4U5QA 3W1EA 2E18A 2O8DA 3CM0A 2AF3C 1FUKA 3TZCA 4D96A 2JD0A 1CD5A 2UAGA 2B33A 1EUZA 2PEZA 3Q7TA 4PYRA 3PQ8A 5K3BA 3V34A 4NBUA 1KBOA 1Z7GA 3DBHA 1HNZB 1YXMA 2RK6A 3I12A 4UM9D 1J4AA 2R00C 4BVBA 4C7JA 5KWSA 1Y3BE 3FSGA 5TS2A 1L5SA 3I09A 1DAHA 721PA 3UMMA 2DR2A 2QRMA 4CM3A 3VR4H 4B4VA 1SVIA 1QU3A 3JR3A 2O14A 2IDJA 1MAHA 1ISMA 1NYQA 5HS6A 2VUIB 4PRKA 2WU4A 3VR4A 2JAPA 2O2SA 4CCYA 1ZD5A 3H83A 4D8YA 1G1AA 5CG1A 3BD6A 4BO1A 5M5BA 2F4VB 5GZ3A 3QVUA 4ZCTA 4FOPA 3W4IA 4TZ6A 1SBYA 2G5CA 2BUBA 2CLLB 3OSUA 3ZK7A 4UXIA 4YUZA 4MW7A 5T8KA 1L7AA 1GWNA 3PA8A 2CV1A 3AUYA 3NRBA 2XQJA 3C0KA 4RSRA 4C21A 1OV4A 3VTFA 3WG9A 4ZEXA 4C30A 1SXPA 1Q82H 2YCLA 3CCRF 2Q28A 4J2HA 5KYKA 1BH2A 1F2VA 3F4LA 4H1TA 3QOYA 4UAGA 1PFKA 4D6YA 3C6BA 4MWTA 3QW2A 2YJGA 3T7AA 2YYAA 5A6SA 3DCYA 1ZUWA 2IHKA 1U0SY 2PUVA 1LWNA 3E3NA 4PLTA 3PJEA 1JHUA 3BMCA 5IJAA 4BGEA 5K2MA 2GCEA 3WHPA 4EX6A 4F11A 4UTVA 4LYJA 5IF9A 3HUUA 4AL4A 1IHDA 3MFQA 2DWQA 2Z8YM 1KAHA 5E7JA 1DDIA 3MRVA 4GMFA 4AO7A 4UD6A 2WV7A 3OTIA 4J94A 4K3UA 4OFWA 3LX6A 2Z2XA 4NOLA 3AHCA 1V3VA 4KFRA 3AEUB 5HWEA 1D2RA 2EZ4A 2IYQA 4IGEA 1UDCA 3KO8A 4PZCA 4Y1FA 5LIPA 1DEOA 2ZCVA 3K5WA 1UQTA 4MS3A 4BWFB 4C5AA 3ECSA 3RYIA 1L3CA 2I55A 3WGMA 3PJGA 1QV7A 1OBFO 3WQSB 5EYPA 1BHO1 1M67A 4OAOA 2EQAA 3CEHA 2OGUA 3IT3A 4PHFA 3EASA 5CRIA 2ZWOA 3ROGA 2WSSD 1LUAA 1KVTA 5KSPA 3F74A 4QAQA 1YV9A 3SQLA 3ZVNA 4B3CA 1QKIA 3ZQ4A 1Z2EA 1T4CB 4EG5A 5K0NA 4EFLA 1AK1A 2GEKA 2Q3MA 1BW9B 3W7BA 1HRKA 1NN0A 1RM3A 1UM8A 4P33A 5KKAA 5CXUA 4BT5A 4MITA 1MAAA 4RKQA 4D9FA 4BFSA 5K0CA 1WL8A 1QANA 5EZ6B 3MT0A 4R0MA 1KBQA 3RC8A 1T5DX 5AQEA 5TEWA 1I6WA 1KPGA 4HNGA 4NLLA 1WCYA 2FN4A 4UTPA 4O6VA 5CPFA 2NO7A 2NSHA 2KG4A 1VSQA 4F5WA 2NADA 5A2GA 3KJNA 1E1NA 2CK3D 2XMZA 3D7SA 3R0IA 5JC1A 4GW3A 1BYUA 1M8JA 1DHRA 1KYXA 2Q49A 4ZQEA 3H75A 3QVGA 3GP3A 3L7NA 1CC1S 2XF2A 1S4MA 1PLLA 2X0RA 1SB9A 3EA5A 3BJRA 1PK9A 1DWUA 2EL7A 3IIEA 3JTEA 3ZV3A 3PR1A 4GGPA 2OFPA 1M2VA 2H06A 1SBHA 1X80B 3DFZA 3RRYA 1YHQF 5EZYB 1NJSA 1W0CA 3D8UA 1Z3IX 3S8MA 3NKVA 2LVBA 5HKKA 1GQSA 4IRMA 4NMXB 3SKXA 4ALLA 3RAPR 4NXMB 5JS8A 4LKOA 1A5AB 2KTVA 3BXOA 2AFRA 1A5TA 4J07A 1PKXA 2X13A 3WRXA 5DN6D 5IWCA 1GQ2A 3BQMB 4UXHA 4BIMA 3VYVA 1ZGJA 3RUAA 2OM2A 3DBVO 2B20A 1XNGA 1FDTA 1JA1A 1ECPA 3BTSA 1SVMA 1U7PA 1MPTA 1XN4A 2WJYA 1UFKA 1YVEI 2CXRA 3AHHA 1E5XA 1LI4A 2BKAA 3DMNA 3K94A 4GVXA 1CZHA 1M54A 1XTZA 1G5HA 2W6PA 3KKLA 4LS3A 4V0NA 4BB0A 1M2HA 3DLCA 4EI7A 2IPXA 3MS7A 4MK4A 3UKDA 3HBMA 1NI4A 2Y0CA 5IJZA 3PRHA 3O8RA 2NSDA 1CR4A 2ZI5A 4MROA 3PC2A 1E60A 1UJ4A 1GZHB 1XEFA 3A1EA 3CISA 3D4LA 1TYEB 4EABA 1TT5A 2AX4A 4TL7A 1R0LA 3FRJA 4A0QA 2MINB 2DX7A 2GXSA 1B3BA 2PGAA 2REQB 4CMJA 3AF3A 4ENTA 5CA1A 4TLEA 5KVSA 3VNVA 2YXPX 4GPTA 2FV8A 4CKWA 4Y0NA 2XCQA 4F6RA 1LQTA 3V4PB 1E6CA 3UGTA 1DI0A 5DVZA 2VAXA 4YGYA 3FTNA 1GZ7A 2RSLA 5ALKA 3GLSA 2YRXA 1JDSA 2RAPA 5K2OA 2W2LD 2GN8A 2ZUDA 1W36C 2H2FA 3MQ4A 1NM5C 2GN9A 4JXKA 4PWYA 3JAMA 3ESZA 3R6GA 1YB1A 3V97A 2IYXA 4L02A 2IKQA 3H65A 3WKEA 1VE5A 2FKAA 2ZS7A 4C88A 2YYYA 3VGPA 1O7JA 4UHCA 1DIRA 2HGSA 3LC1O 3Q9LA 4JP5A 1GNSA 2C5EA 2WDPA 2XF8A 2YMPA 3TBKA 4MAMA 2KM1A 1DEAA 1E6MA 3PD0A 1R4MA 1PR3A 2EP7A 4DOMA 1RI2A 1Z2PX 5BNTA 5SZHB 4ESVA 3P9CA 1ABBA 1U28C 2R6FA 1XZLA 2O8BB 4YUXA 1KY5A 3VZSA 1JIKA 3LOUA 4U63A 1G21A 3TRKA 1E58A 4MW0A 4FS8A 3H8VA 4RPJA 1DPGA 2ZYRA 4WUVA 3DKVA 3DWGA 2BUAA 3RIEA 1YZUA 1XG5A 2ACKA 3PEUA 1PYOA 3HLYA 2XCUA 3OOEA 1EE1A 1XEXA 1USKA 1FX0A 3NBAA 3CQ9A 4ZT2A 3CVUA 4WCVA 1N4AA 2GM9A 2YVQA 1E3MA 2ZTSA 2WWGA 4BBAA 1H5UA 3UOGA 3ZU5A 5C1OA 1ZGBA 4Q9JA 1YZFA 3LFUA 4G5RA 3FF1A 3RFVA 4ZCIA 4CCWA 1YZYA 4OP3A 3KUDA 1MJHA 1T5TA 3ADCA 1ZRNA 2D62A 1IPFA 4AMUA 3CLUC 3VIUA 2PYDA 3TYXA 5BSVA 4S0XA 1U7DA 3CZ5A 4WXMA 4KPUB 4MH0R 3KQPA 1VIYA 4GDMA 4EGQA 2IHVA 5CNIA 1H42A 4HWPA 3OTWA 1UBCA 3USZA 3E8MA 1C7RA 2IJGX 4KE6A 1TMGE 1DSSG 1UEXC 2GHTA 3A1FA 3ZDZB 3ZCRA 4OMFG 3CD6F 4AP9A 4F4IA 2FUNB 1NTOA 4DV1B 1KEWA 4HZIA 5FBLB 2PX0A 1T2AA 3K1AA 3ZHXA 3A7EA 5A7HA 5HVNA 3ZUPA 2X4GA 4RENA 5G0WA 2I2CA 4TTTS 2WLTA 1KP3A 3WK9A 1NVVR 2BSQA 4DDHA 5HUQA 3DZBA 3RS5A 2IP1A 3O8BA 1LI7A 1T4BA 3QH4A 5IM5A 4KR2A 2PRYA 2W2NA 2AGVA 2Z1TA 4NBRA 5GM2A 1ZD3A 1M1ZA 1JDBC 4CT5A 1DJLA 5IPFA 3B60A 4RBNA 5TLSA 3HXQA 1ODTC 4DCTA 1P4SA 5ALIA 1RYHA 3MCVA 3T3HA 5B7GA 1U02A 4ID9A 1XZJA 2EX1A 1U5CA 3H4IA 1WF6A 4MYHA 5EE9A 1FW6A 1ATIA 4WUTA 4OJMX 2VTBB 1ADYA 2ZIUB 1H47A 1G7CA 1REQA 9ABPA 4JWTA 4R4JA 1HDOA 4O0LA 2SECE 1JVSA 2Q4RA 3OJLA 2OOKA 5BYAA 1GZSA 4CM6A 1A1VA 3NM6B 1GTVA 2FY8A 5H9WA 3JS5A 1V5IA 5B30A 4BNFA 5BN4B 1U40A 1DKPA 3PX2A 2WZDA 3FPEA 4OK5A 3VYUB 3A04A 5JSUA 3L6DA 2F6RA 4WLVA 5AJWA 1DARA 2G9VA 3IRUA 4TZZA 2PSSA 2Q3HA 4L9RA 3LDAA 3TD6A 4KQKA 4L74A 5LA6B 4N5MA 1GADO 2IXAA 3DEHA 3DWFA 1DT5A 2YHAA 1W4BA 3DHVA 1PK7A 1XJQA 1P6QA 1YVRA 2A5DA 1ZNYA 2HRZA 1O9HA 4MPRA 5T6MA 3T0FA 3DTVB 3BC1A 5IAKA 3UGQA 2ODEA 4OO3A 2A2ZA 3VKHA 4DLUA 5DV9A 2IH2A 3ZDQA 4XOUA 1XZMA 3KSAC 6ABPA 3B6EA 3H1AA 3WJ7A 1AUQA 4MR8B 5DTIA 2VTVA 3I5YA 2B37A 3F46A 5JD3A 1ZIOA 3AINA 4POOA 5L6LB 1NXSA 1JV2B 1J20A 3OUTA 4KYIB 3Q7IA 3TLAA 3UUEA 4ZZ0A 4MWZA 5CJJA 2QTGA 3AB8A 4LQ4A 5B4TA 3WDLA 1H94A 4BMYA 2P4QA 1RZ3A 4DMLA 1HNWB 3ROQA 3U62A 3GGOA 5KNDH 4TV9F 3WHLA 1J1IA 2RJ3A 2GZ1A 2XECA 4RPCA 3I5UA 1C1XB 1HY3A 2C7BA 2BEKA 4FS3A 3R7DA 3RVNA 3GPCA 3AOEC 3BSFA 3TTVA 3F5SA 3ZDYB 1PGNA 3PD1A 2OD2A 4KG7A 3DW3X 5KNDA 3WJPA 4JJEA 2QRVB 3HR7A 3WL7A 3LNCA 2WF5A 5KU7A 5B3JA 1WSAA 4X24A 4Q3DA 3LUHA 2JS7A 5IH7A 2VBFA 1ZRSA 4TVBA 4HQ0A 4IFIA 1KRHA 4PC1A 3IE0A 3OZGA 1WE2A 5CU7A 2PUBA 1VSBA 2B98A 3GEPA 1RAFA 4WIAA 4F3NA 4Q1FA 4BFUA 4N6GA 1JI0A 4FNAA 5HRCA 1IU9A 1AQJA 2RGAA 4JLSA 3WTCA 3CSUA 3AR4A 2A9VA 1KXZA 2WUVA 4PC3A 5AVJA 2IWRA 3S4YA 4F7DA 2Q3CA 3L4KA 1JQBA 3L05A 3MXOA 5A5FA 2R85A 2CZQA 5HCNA 3VJMA 5KPJA 3A32A 3IOYA 2F00A 1H0HA 1Z29A 2CWDA 3K9QO 3B1YA 1GZDA 3GJQA 4M8IA 3JVUA 5FKJA 4JY7A 5H4HA 3VOSA 1U81A 1UFVA 1RZRD 3A3KA 3WLSA 4HZGA 5SV2A 1W0JD 5E4TA 4E30A 1ZR4A 3OZWA 1PVVA 1BS2A 5EXXA 2XNDD 1SHUX 4JSYA 3WXBA 5JI3E 1YZTA 2YC2C 4U8GA 3JWGA 4UUPA 3B13B 5L3QA 4MQFA 2VCEA 4OXRA 1UJBA 5DX1A 3TXYA 3BRWD 3T95A 4LQLA 4C6HA 3ZV5A 1JIIA 3EXFA 4KR0A 2UYHA 4U7JA 4FB5A 2KJQA 4P93A 4NEGA 3T7TA 4TV8B 4M98A 1X39A 4BJ5A 4ID3A 4B83A 3A8TA 2Y1DA 4LQCA 4DANA 4NCBA 2JL1A 2DYKA 1WVIA 1SURA 3ZZ0A 5EEHA 4KO2S 5L3RA 1KSJA 4BDSA 2JFNA 2XUFA 3EOZA 3P2YA 1FFXA 5FI0B 3KZKA 5JDCA 2ECOA 1DELA 1B6SA 4LCKA 5GANK 5C37A 3OICA 4YRDA 1GPNA 1Z0JA 3LFOA 2AXEA 2G3YA 3VR5D 2VS1A 1FLNA 1XD9A 3OJOA 3H5WA 4NPCA 5A4MS 1FA9A 1C0EA 4IIUA 5J23A 1KI4A 1YBHA 4QQ8A 3PKZA 3MTEA 5AXAA 2R0QC 1EX7A 1YK1A 3TAXA 1NP6A 3EUEA 3KJIA 2PL9A 3CEMA 5LZ4A 4NU5A 3N8KA 2GBPA 2Z04A 6CHYA 3MAGA 5DT2A 2ZJ7A 5I7FA 1UWVA 2QRNA 821PA 4I36A 2X0DA 4BFZA 3I3FA 3M70A 4YP1A 1EVJA 4INJA 2PS1A 3BYQA 4BUCA 4WKOA 3G0IA 2CXQA 4JDPA 1IL0A 2G72A 2R1TA 4CW7A 1W581 3PD7A 1RCTE 3VA7A 2XIJA 1I30A 4M0MA 3HFRA 4WK0B 5K0LA 1VOTA 3FDFA 2EZUA 2DFDA 1ZEMA 3LBAA 4F5YA 2D06A 2P9CA 1CE8B 5FPPA 1K06A 3DOOA 1JZTA 4IY1A 4LJRA 1EXWA 5H4GA 1Z06A 1OFVA 1W5FA 2VP2A 3IEKA 4G26A 4B3DA 4OVKA 4YPFA 4B2IA 2OFWA 4HN4B 2D7DA 1GCOA 3TSCA 3DAGA 2VJOA 4HFJA 3L7KA 4G5HA 3T4XA 4KOEC 3VMMA 2Q5LA 4ZVQA 1L5OA 4QDXA 4G01B 3DZDA 5I5EA 2EKLA 4D02A 3ELWA 4BX2A 2Q2NA 1V8DA 3KJXA 2VAPA 1JDVA 1QORA 2IOFA 1EBBA 1TO2E 1YS9A 1UT8A 2UYGA 2P9YA 3AC0A 4QDUA 4WTOA 3TZBA 4HUTA 5GJWC 3GRYA 5FBZA 1I1HA 3K09A 2PRKA 2G63A 3G0OA 5CTAA 1QZXA 2C59A 2CN1A 3LZDA 5IMBA 1E18A 3SHFA 3A1CA 1U2QA 2HPAA 3PLRA 5F5XA 5JQGB 1IOZA 2VNHA 2BFPA 3ZDBA 3K0FA 2YNMC 3KG2A 2YOFA 4PG5A 4Y6GB 3OFNA 1ST3A 5EUBA 5JSZB 1JB9A 3HBNA 3FFXA 1IEXA 2QA4F 1OBVA 3IESA 3W6OA 1C0KA 2HL6A 4I1OA 2BGJA 5FA5A 4FKZA 4HAXA 2VJPA 2HYDA 3TX2A 4CFZA 2F2TA 1X6VA 3I9KA 5JO9A 4Q37A 4FMPA 1US8B 1T91A 4XFKA 1M0SA 1NVDA 2UUOA 3INYA 3UV6A 4BZWA 4RVUA 1UANA 1T9AA 4IQ8A 1VHJA 3LP5A 1HTBA 1DIAA 1U9ZA 2O0JA 2YOGA 3I32A 4DQKA 5REQA 3SX0A 4N7RA 2FDXA 3P26A 3GROA 1R0XA 4WD3A 3TW4A 2LW7A 5BMVA 1O96B 3QLUC 1QQBA 3GL9A 2C82A 2P2NA 3VC7A 1XHEA 4WBNA 1ECFA 3RAEC 2I2BA 4B44A 2Q45A 2C5SA 3K6RA 5B7NA 1TUBB 1TM7E 1SHTX 1N9ZA 1XROA 2IOYA 5GONA 2UUBB 1CDOA 3GRZA 3NAGA 1PJZA 2LBTA 4CEIB 5AOBA 4ABYA 5IS2A 1C30A 5G4UC 4FMBB 2DM6A 2QUZA 1C4OA 2C4UA 5DSTA 1HUQA 3V9PA 4B6SA 3IGFA 4ZIRA 5GIPE 4XB2A 4A0HA 3CF4A 1SEPA 3EG9B 1I6LA 4MO9A 3SJBA 4DDMA 1PUXA 2J87A 1KE1A 4EUHA 1R2QA 2YQZA 4BLVA 4KQWA 3L0SA 3OPYB 1B0ZA 1P81A 4PM4A 2O06A 2QR5A 1ACLA 1E3TA 3DXYA 3C2QA 4NATA 1GILA 4HC4A 2FSHA 1CVIA 2YIJA 2PBFA 2W8BA 1C3JA 1YMVA 1BVUA 1CZRA 1VC2A 2E4XA 4AC9A 2D1QA 3BIJA 1MKYA 1RHRA 3LRTA 3W5IA 2B2XA 4AJLA 1SBQA 4KQ9A 4NK4A 1LDEA 1L7NA 2HZBA 2ST1A 4FHZA 2X42A 1R4NB 2P0YA 3DS8A 4DLWA 3KOOA 3H5LA 5JZSA 4QBKA 4HLNA 3V2HA 2H31A 3IR7A 4UUQA 1RHMA 4KAXA 3QEOA 4N03A 1MT3A 2IY8A 3EIQA 2QD2A 3A3YA 2CFRA 5SYAA 4C4TA 3E9RA 1Z8HA 3FCOA 3R4VA 4IDGA 4C43A 4ALMA 3WA7A 3V46A 3IEPA 3OA2A 1Y8RA 2I4IA 4F5ZA 2ZWIA 3TDNA 1DQRA 1N0WA 2CUZA 3CLKA 3W6PA 4UNQA 2Y1XA 4JA0A 5A5GA 4OB8A 4FSXA 4OPMA 4XQGA 1KRXA 1O08A 4R9UC 3U0VA 4C3UA 1H6CA 4FCWA 5GTDA 2GBCA 2MTBA 3CMCO 1E4EB 1SBIA 4B76A 3CCLF 2B1RA 1JY8A 3GJ3A 4D4LA 1ZRMA 1N2CE 3RR2A 4AS2A 3ZHUA 1QO9A 3LW8A 1O89A 1KVQA 1SPXA 4GMDA 4LMBA 4BTEA 4YRNA 2Z01A 1SMKA 3PTAA 1XBIA 3G1WA 3LSTA 3N3AC 2V6GA 4QNNA 4XD2A 4PHCA 3W06A 5JSHA 1HT1E 2OB2A 3T9EA 4OD0A 2D5AA 5EC8A 2W37A 3H5NA 3N2YA 3X2SA 2WFZA 5IT9M 1U0RA 3GCZA 1U8FO 4QO7A 4RSGA 4WQMA 3T0IA 2HJSA 5C8XA 5J1SB 1K6IA 3BJEA 4CEHA 3AJ8A 3MMZA 1J2JA 2X86A 1X2EA 4GOMD 4EW3A 5FOVA 1T3LA 4AJIA 1XBTA 5T67A 5F52A 1Z36A 3B1KA 3MINA 2Z2JA 3MT9A 4JEMA 3HBJA 1V3TA 2A9PA 4IFBA 2NTYC 3U9SA 3VVMA 2GN1A 2QTBA 4L16A 4LJKA 2IGTA 4IH4A 5DGCA 1R1DA 4AF6A 3OT1B 1MV5A 2FN7A 3IXMA 4PSCA 3QHDA 1E0JA 4JL5A 5AHOA 3WWYA 1ZCJA 1NAHA 3TLCA 2ZYUX 3GDGA 4PNEA 4YCNA 4PQYA 5JZBA 1UJ6A 4Z1OA 1OB5A 1XVLA 1RNLA 2JCBA 3JQ7A 5F73A 3VPHA 4Z3KA 1U9IC 3UJBA 2FPGB 2NQ2C 2SKDA 3RFXA 2IOQA 4GWLA 4JBYA 1Y9EA 1J2YA 1YZNA 2WQZA 4ZT3A 4F3YA 4RDHA 5BSEA 3WKDA 1O94D 4P4LA 1C4WA 2EV9A 4V39A 3VO1A 4FFWA 1CU1A 1VKHA 4N3CA 3DLBA 3LY5A 1QYCA 2K1SA 1EFUA 3L7MA 4D3XA 3N8GA 2HS4A 3FCUB 1E1MA 2UYOA 5I9NA 1BQ3A 4R2MA 1P29A 2HDWA 1VBFA 1RC1A 4D5GA 2ZRHA 4JP3A 4RY0A 3H9EO 4L72A 4TS4A 5BUQA 2HU2A 4C7XA 2VSNA 4OI4A 3G7SA 5HIAA 2DUUA 5INTA 3FOZA 3P4XA 1IV2A 3FUCA 1QE5A 2PRZA 4PF1A 1J1UA 3TM4A 3B9BA 3DTVD 5EWRA 5LB2A 3L7OA 5TE9A 4D3FA 3HDGA 1F1JA 2CVHA 3RK1A 4DT1A 4DZRA 5DGHA 1LBSA 1P5RA 4H3HB 2I7XA 1Q50A 1W29A 3U4QB 3EEQA 3K30A 1Y1RA 5DI3B 4KQHA 3D54D 4YA6A 4DCSA 3GEDA 4U1RA 9ATCA 2GSWA 2XUKA 1NLYA 1NY5A 2WWWA 4HWGA 4WNYA 4IJWA 3HB5X 4U02A 1L9XA 1SQ6A 1M10A 1RTKA 2FSGA 1XTTA 2VPTA 3GARA 3LC2O 3NTOA 1BMDA 4PG8A 4Z51A 3HWRA 3ZLBA 4R54A 3ROEA 4KRYA 1K89A 4JKOA 4G86A 3NOOA 1NMUB 2BR4A 3AKEA 2Q9UA 3I2YX 1CW2B 4KDCA 1IFXA 3AJRA 5JMPA 3WGVA 1G21E 5IKXA 3LOPA 2CXOA 5DGXA 1UP4A 3NGMA 5A3VA 1KEZA 2X2OA 5CLFA 1K4YA 5LQDA 2PUAA 4IZHA 5A7FA 3QELA 5DBHX 4QQRA 4F5EA 3MUOA 3FWHA 4MA0A 2XODA 1XCBA 1U2SA 4AIRA 4OHBA 1Q7BA 3COYA 3EZ7A 3FHOA 3BSYA 2BFMA 4ITRC 4JLUA 1ESEA 1ZJ5A 1NF9A 2R7AA 1ZN9A 1PS0A 2VBCA 2EZ9A 5FP0A 1CBUA 2HPZA 3E6AA 3NDIA 1J49A 3WV4A 3F5MA 5LC1A 3OWOA 4O8ZA 4DM7A 1SUFA 1G5QA 1W36B 2G28A 1MIOA 1IPAA 5HP8A 5CNJA 1BDIA 4EY7A 2VJYA 3PI6A 3AUFA 2NZWA 5A6VA 2W11A 1RYEA 2IKSA 3HEMA 3BRCA 1NW3A 4W7SA 1Z37A 2WU0A 3FPBA 1H2WA 4ISCA 4PANA 2VUTA 4BNNA 3OJFA 1U0BB 3VPSA 1EQAA 2V8OA 4C3VA 1KMHB 1VXOA 1FBTA 4H0NA 2W2VA 3DOHA 4G23A 1EAMA 2G1AA 2P2LA 1VLLA 4N54A 4OQQA 5BRNA 3B52X 3RYTC 3PLAC 4YR7A 2CNKA 2A9KA 3G7UA 3I01A 4IIFA 3GBSA 3WTBA 4YALA 1UAYA 1V11A 3KKPA 5EKUA 5AUOB 1DFGA 3T94A 1YDMA 3AKDA 1T4MA 4RZSA 2C54A 2DFVA 2IS4A 2IU6A 4IJVA 2CFIA 2WOOA 1THMA 4PTLA 4ZAXA 1R8SA 2Z6UA 4PZDA 2WSBA 1WMBA 4JT9A 3FDXA 4B7ZA 2XJ4A 4TMZA 2HF8A 2WU8A 4R71A 3GEBA 1IZ7A 5TXGA 2RGDA 3UTDA 4NAVA 4M55A 4E15A 4TMTA 3C3AA 3M1YA 4JVLA 4M1EA 3LCUA 1E92A 4E2ZA 1DDGA 2IBSA 2Z98A 3UPTA 3ZD6A 2QHXA 3SJCA 4KNWA 2KYRA 1W75A 3AV3A 3DH0A 5IZ4A 1W42A 2MMCA 2YHIB 1FU7A 3BWMA 2DHDA 5TS3A 3M3HA 3MRSA 2E82A 1UDAA 1E0KA 1E69A 3IUQA 1F48A 5CIWA 3WYFA 4MR9B 1U4OA 2MHCA 3R9XA 3IKJA 2RBKA 1PWYE 4JJZA 1QFMA 3TD3A 1W59A 1S8OA 3EEFA 1G8YA 3EC1A 4HB2A 3FMFA 4OUKX 5IAEA 3G2LA 1OLSB 1S2GA 5CH8A 5KYUA 2DJIA 1ZJWA 4CLHA 2P5TB 4CR7A 1I14A 4XR9A 5I01A 2B5OA 4Y2RA 2HBYA 2MR5A 2IAFA 3KQUA 3UFXA 1WOYA 2Q62A 3JQ8A 3QQPA 4EG8A 3L8YA 4Z1MD 4YS6A 3HWUA 3I34X 5E3JA 3X1MA 2J3MA 3NW9A 2A0KA 3ACBA 3QE2A 4R1MA 3W2TA 5JAZA 1JDBB 2GN4A 1KDPA 2P5UA 3PT5A 3T5PA 3C3JA 1P1BA 4EPRA 4FILA 1U6IA 4I5IA 1YS4A 3BH6A 4WCDA 5EESA 4DXAA 2IS6A 2SICE 1JYSA 1PQUA 1U0FA 5FYQA 3F47A 3IJ5A 1KYZA 2CBGA 3H2YA 2A92A 3U3RA 1IN7A 2GRAA 2PL5A 3LWVC 1QONA 2XDWA 1HNNA 4MPTA 3Q4GA 3M3DA 4DCUA 1G3RA 1UXJA 2Z1NA 4QFCA 4PIVA 2C4MA 3SHVA 2CSXA 1RYYA 1C0PA 3N5CA 4PTZA 1YBMA 4RM3A 3C3XA 3F78A 3QVTA 3NEJA 3FOCA 4M86A 1LVHA 4UXJA 4D97A 5BQ3A 3KOUA 1BX0A 1X1AA 3E9YA 2H1FA 3QE4A 5TGTA 4XYGA 5LBIA 3D3QA 4B6OA 1H8HD 4J0GA 1VPWA 3A36A 4OP1A 3RFFA 2FW0A 1M2FA 3LDHA 1C81A 4FU0A 3H18A 4WY8A 4BDTA 1F6WA 3NGXA 3O73A 3QKIA 4ETWA 3PWZA 2ZUWA 3Q8LA 1FTQA 1SCQA 3O75A 4CKBA 1GFZA 1YL7A 3TW6A 3VMFB 2G9UA 4OUDA 2V74B 4ENVA 3UTCA 4PLZA 1OX5A 4M1MA 4GNKA 3DV0A 1YNOA 2JBAA 3H2JA 4N9WA 4P3OA 4NHOA 3JWPA 4QUGA 1DTWA 2FW8A 2A3NA 3UZUA 4BNYA 3CB4A 4PLWA 2X23A 3PFIA 3GYQA 4QTXA 1HL3A 3FVWA 4RA6B 3PAFA 1XFAA 1GFIA 5D7BA 4B6PA 5LU8A 4RIGA 3JPYA 3OSZA 2H2GA 2VXCA 3DBIA 3PUKA 1EU1A 3QI2A 4QG3A 4UTXA 5HWSA 2J0QA 3MJVA 1DAEA 3UMRA 1IBCA 2ERYA 3PNMA 5B58T 3V7YA 1II8A 2QRKA 2ZIWB 3O3OB 2XCIA 3J80A 4B3BA 4P36A 3RWMB 2FMTA 1RXEA 1QX3A 3JATA 4S1TA 3EBPA 4BY9D 1AIPA 2QSYA 1WCXA 3ANLA 1KO5A 1MJNA 5JD6A 1CQXA 3FW1A 4OCZA 1MP0A 4EL5A 5CDUA 3UA3A 1SBCA 4JVOA 2IODA 4K6FA 4LFAB 2WYIA 3WLEA 4BEJA 4OU5A 2BFEA 1BMFD 2BZ0A 4Z4HA 3CX7A 1D9ZA 3KZVA 3FZQA 4M2LA 1GXSB 4OY3A 4HXFB 1E79A 5EWMA 1NT2A 1DV2A 4M54A 2C7RA 1K0FA 4AICA 3E20B 4RTJA 3UBTA 1MPXA 3BDAA 4E46A 1EM6A 5H5JA 3ZDXB 2JLQA 4LEIA 1CIVA 1LBQA 3GGGA 1NRIA 2LGJA 1YE5A 5ICSA 2DQYA 2B1IA 4A15A 4BQNA 2JH9A 2HIHA 3D8BA 4WZAA 5T4HA 4MV6A 3W6NA 1C1YA 1KI1A 1P2GA 3RKUA 3TOCA 1WB9A 1DBRA 4MYCA 3IPCA 3WFIA 1CQWA 1J8FA 2HF2A 4ZXFA 2HMWA 4I6JA 4EUEA 4AJ1A 1K7CA 3UY4A 5JY1A 1RWNA 1VHAA 1PF5A 4NKRA 4WKBA 5K01A 2EFHB 1H2XA 4YAWA 3STTA 3N2KB 3NBFA 4N5NA 5KWEA 4ZOLB 1N2OA 4QLAA 2WYWA 2C5AA 1Y7IA 2NVWA 1HPLA 3KQQA 4PNHA 1M2NA 3TEFA 3UWMA 3WMGA 5CHYA 4WMLA 2BFNA 1RAHA 4B62A 2NTEA 5LCXA 2H4HA 2WFAA 2YYSA 4LIPD 2V3CC 1CULC 1HDGO 2DAPA 4M0LA 5IAGA 4AZ0B 2D4AA 4QOIA 1AZLA 3PYLA 4ZZ3A 1QOQB 3VNRA 2QTTA 1XSEA 5DE3A 4GMXA 5JJLA 1YKSA 4HGZA 3UCXA 2PA3A 2VXYA 1UCFA 5B2EA 4P0PB 1ODKA 3PQDA 3CLVA 3C4VA 2IYOA 3F6RA 3UB3A 4B6JA 4GVLA 3B78A 4UJ3A 1EHYA 4MP8A 3P8ZA 4TWBA 2IA5A 4BKMA 4RVFA 1PEYA 3FYUC 2NUAB 1A72A 4A6PA 3L0IB 2CL7X 1KTVA 3E53A 1UP6A 3IC5A 3ZKWB 4BFCA 1L7OA 3INGA 1HE5A 2OLKA 2J3IA 2PMKA 4Z9BA 4RL4A 3R24A 1V95A 3D2BA 4X61A 1A5BB 2BFDA 5F1YA 1TZMA 1QLWA 2C4KA 1FLAA 4S0ZA 3S0YA 5LA6F 4MWGA 2WWYA 1Y4DE 2ZSEA 1KIAA 5TSDA 3H4VA 3W9UA 3VTIC 3V80A 5FBKA 3IAXA 1ADCA 5DTMA 1H3EA 5SZIA 2AZXA 2BBOA 4JUCA 4EAAA 1G2IA 4JJ4A 1O4WA 3L1HA 2NWQA 1E3QA 1W47A 2IRWA 3GJXC 4NJMB 1YRHA 4YLGA 3QLTA 3RTDA 3VJLA 2VP4A 3Q98A 4D4GA 3CPWF 3W2IA 3D6FA 5ES4B 1EX6A 4FM9A 3I64A 3G89A 1X87A 5LYJA 5J2TA 1Z6ZA 2PQ0A 2XXJA 3DHYA 4K9DA 3SJ7A 3U7QA 5EKTA 4XX0B 1BE6A 5L3SB 3MS2A 2LDXA 4JQZA 4BNTA 3HNRA 1DX6A 5C1DA 1SUWA 4LMRA 4BO3A 4DCGA 8AT1A 4BP1A 3OQIA 3OMXA 3K9WA 1NV8A 2JI4A 3L7LA 1E8MA 3H5RA 3I9NA 4L0MA 1X52A 1AG9A 2P9JA 5DMHA 4DLLA 2OTCA 5LQKA 3E2IA 4H9GA 1OXVA 1AMOA 5AW6A 1ZH6A 2OHFA 3GBPA 5JOQA 3AIKA 3P9QA 5A3QA 1RVV1 2PPVA 3ORSA 1XMIA 2FZ4A 4PO3X 4URHA 3V1KA 4ATNA 3R3VA 1CUDA 5EZQA 4GYKA 3ZE6A 1OC4A 5EJ4A 3VZPA 8ABPA 4IV5A 4PHTA 2MQEA 4QBFA 3ZVLA 4YRZA 5CG2A 3EPHA 5ESRA 1MO2A 3D3WA 2DZDA 1MX9A 3E3OA 1ONOA 4YRQA 5CITA 4BV8A 3QY9A 2G1UA 1MLDA 4K6KA 3RA5A 5LM3A 4CLDA 1JQJC 2RHJA 1OLXA 3BF8A 5DJ5A 4RFVA 3CIFA 4ZVLA 1NW5A 3CGGA 3THXA 2FWNA 4V1CA 4FYMA 2ZTMA 4HUQB 5LSAA 4FP9A 2IEYA 2I3BA 1DNPA 2Y1CA 3SS7X 3IO3A 4MMYB 2W0MA 4RV4A 5JXJA 1NVAA 3MDOA 4EKGA 4QULA 4FTWA 4JT8A 2UUCB 1UOPA 2RHHA 4XARA 3RASA 5L7TA 1U3LA 1W2BF 1J8DA 1RXYA 3QKSA 1M8FA 1U8ZA 1XA3A 4H4EA 1PSDA 3AZOA 4FVTA 5DISB 4IILA 3IAAA 2HSJA 4CF7A 2IBMA 3LAWA 3NHAA 2DBZA 4E5MA 3AP2A 4QT0A 2DHRA 5IF3A 1W4CA 3NPMA 4NJOA 2IYUA 4K26A 5KTYA 3WQBA 4NPAA 5AVUA 3QSGA 1EG2A 2ZIGA 3CPSA 3GMSA 4M9ZA 4RPLA 2G1JA 1NMQA 2G0TA 3AHGA 2CFSA 3QRWA 1FDUA 4XLTA 3K2EA 1NVFA 1NUSA 1I2BA 4K9PA 2ODTX 2JLSA 3TIXB 1JXQA 2QSZA 3WRVA 3MWKA 3M5CA 4RHCA 2ISQA 3QF4A 1W36D 1YRYE 3NM5A 2WTXA 1E3IA 4URUR 4B5CA 3AYZB 1BMQA 4LISA 4TZTA 1L5HA 3I73A 2QMHA 1YS2X 3NCTA 1OH7A 2C0CA 1PXWA 4B40A 3WLRA 2J3EA 2JPDA 3C3DA 3QUQA 4FDMA 5F12A 3TZEA 4RKRA 4MUMA 1RLMA 5TQ2A 2EKBA 4JKYA 3G82C 3FTFA 3UMSA 4CODB 3C4JA 3LL7A 1OZGA 3AMVA 3X3HA 3FD6A 1X0XA 5TARA 3TL2A 4N7BA 4YI5A 4ZK2A 4LHYA 1NONA 4DJEC 5TNXA 1VGRA 2C8LA 2AC7A 5JZVA 1JNXX 3DULA 2QE7A 1MC8A 2DHCA 1LU9A