2KTUA

Human erf1 c-domain, "closed" conformer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
164
structure length
164
Chain Sequence
NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR assignments of the C-terminal domain of human polypeptide release factor eRF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
total genus 28
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktuA00
1VQ8F 2VGNA 1QVFF 3WXMB 5GINC 1X7OA 4X3MA 3LWQC 3CMEF 1NJIH 1VQ9F 4BW0B 2OZBA 3E1YA 1T0KB 2QI2A 1W40A 1VQ6F 3VMFB 3E20B 1KQSF 1ZWZA 1KD1H 1W2BF 2QA4F 1RA4A 4TZZA 3CC4F 3CC7F 1W3EX 2OHWA 1W41A 2WALA 5GANK 3CPWF 2OTJF 3CG6A 3I55F 3NK7A 5G4UC 2AIFA 1VQNF 2LBWA 3CC2F 3CCUF 2KTUA 1GO0A 1N8RH 3CCQF 3GYQA 3LWPC 3CCRF 1YJ9F 1Q81H 3OW2F 3CCEF 1KC8H 3JAMM 5GIPC 3LWOC 3NVKE 1DT9A 4LCKA 3G71F 3RA6A 5EO3A 1YITF 3LFOA 1VQPF 1E7KA 1H7MA 3OBWA 3NMUC 4BY9D 1IPAA 4C4WC 1QVGF 2KTVA 2BO1A 3N4ZA 1Q86H 1JJ2F 1YJNF 1W42A 5FJ4C 1PXWA 3CMAF 1VQOF 1M90H 5GAPK 2VGMA 1SDSA 5IT9M 3AGKA 3NK6A 3IR9A 3J7AR 1YJWF 3HAXD 5G4VC 2LBXA 1VQ7F 3PAFA 3V7QA 1RLGA 1GZ0A 3O85A 3CCVF 1YHQF 3G6EF 2I6DA 1YI2F 1VQ4F 3CCSF 1VQ5F 1Q7YH 3FFMA 3VI6A 3OBYA 4NUTA 5FLXM 1CN7A 5DCVA 3ON1A 2KG4A 3RA5A 1CK2A 3CPQA 3J81M 1K73H 3LWRC 3G4SF 2ALEA 3LWVC 3CCMF 2OTLF 1NMUB 1X52A 5A2QM 3J80M 3MCAB 1XBIA 3SIUA 3N4YA 1M1KH 2HVYD 2QEXF 4X3LA 3CXCF 1Q82H 1K8AH 3CCLF 1X7PA 3CCJF 3HJWC 1S72F 1VQLF 2JNBA 1VQMF 3CD6F 3NVIB 3PLAC 3JCMM 2FC3A 1VQKF 1GO1A 5GIOC 3SIVA 1YIJF 1K9MH 3V7EA 2CZWA 3I56F 5EWRA
chains in the Genus database with same CATH superfamily
3S0HA 3S02A 2ZODA 4ZHWA 3HKDA 4IIJB 4X3MA 3LWQC 3CMEF 1GX1A 1W55A 4FFBB 5CA0B 2BTQB 1VQ9F 2UYNB 5JVDB 4BW0B 5HY0A 3WGMA 1H48A 3E22B 1W40A 5EAZA 3VMFB 2CSLA 3WPXA 5FNVB 1KD1H 2ZF8A 5CB4A 1X25A 3UT5B 4G4VA 4I50A 1H47A 3HKDB 5LOVB 4C8GA 4TZZA 4C81A 2RHLA 5MN5A 1W41A 3CG6A 3I55F 5KMGA 5G4UC 3M4SA 1Z5VA 1VQNF 5IJ9A 4BT6A 5GONB 4IIJA 3HKBA 2P6YA 1OFUA 1N8RH 2UYKA 4I55A 1CLIA 3S06A 3E22A 3S0YA 3CCEF 3HKCA 5GIPC 2V9YA 1DT9A 4ZOLA 4B45A 3HKEA 1YITF 3LFOA 3VOAA 2Z1UA 5HY4A 3TD4A 3OBWA 5KX5B 4BY9D 3L7QA 2HS3A 3S03A 3JASB 4TV8A 2KTVA 5IJ0B 1Z5WA 1Q86H 3VYTC 3RYCB 2VGMA 5IT9M 3IEWA 4X20A 2YYEA 3NK6A 5B8FA 5IJ0A 3JASA 2F9ZC 4M8IA 1VQ7F 1W5AA 3V7QA 3HTNA 5C8YB 5LP6A 5LOVA 4ZHQB 1VQ4F 3CYPB 3UT5A 5CA1A 3TD3A 2YXZA 1IV3A 2Q1YA 1JY8A 3K12A 5DCVA 2MQEA 4TV9B 3ZOPA 1J7HA 1CK2A 5EYPA 3QTYA 1K73H 4ERHA 3C9SA 2ALEA 5HXUA 4YJ3A 4IHJA 2PHNA 3HKCB 3MCAB 3N4YA 4BT2A 1KNJA 4F6RB 1X7PA 3KIZA 4O4LB 1S72F 1VQLF 5MN4A 3CD6F 3PLAC 5JVDA 3HKBB 3JCMM 2FC3A 3FPIA 4B5CA 2HP3A 1FSZA 4O4JB 3FBAA 3DC2A 5GIOC 3VOBA 1U43A 2OZBA 4G4ZA 3D01A 2VGNA 5ITZA 1QVFF 3RYIA 2Z01A 1X7OA 4IHJB 2ZVZA 2ZOVA 5CA1B 5JH7B 2OTMA 4O2BB 2VAPA 3IEQA 4NWOB 1Q8RA 1W5EA 2HQSC 3WGLA 4TV9A 2HRUA 5JCOA 1T0KB 2I6RA 3WJPA 1NQ3A 4BT4A 3LDTA 5EIBD 1RLUA 1W2BF 2RHHA 1U40A 3LMEA 1YQNA 4HNAA 1TUBA 2OHWA 3CPWF 5GANK 3RYHA 5EB1B 3JARA 1FFXA 1FNJA 4WBNA 3CCUF 4BVQA 1DBFA 1OAPA 1GO0A 1SA0A 1W581 4ZI7B 3VYUC 5EZYB 5HY2A 3FD6A 4X1IB 4ZHQA 3MQWA 3CCRF 1YJ9F 1ODEA 4C82A 5MN6A 1W5BA 5JQGB 2GVIA 4LCKA 1VH8A 1H7MA 2HP0B 3HKEB 3JAKB 1VQVA 3RYFB 1IPAA 4RHAA 2CHTA 4C4WC 2HRYA 1QVGF 1FFXB 1JN1A 4X1YA 3JARB 1VK3A 4LNUB 5KMGB 1JJ2F 1U3PA 3JAWA 3VTIC 3CMAF 1VQOF 3V4DA 5GAPK 1SDSA 5J2TA 3GHZA 3J7AR 5CB4B 5G4VC 5EB0A 4EB6B 4U3JA 4O4LA 2K1SA 3F6MA 3JATA 1W57A 3G6EF 4DXDA 2I6DA 4G4WA 4DRXB 3CCSF 5LXTB 4FFBA 4BVSA 4X1KB 3N2KB 2VAWA 3ZO8A 3RA5A 4PWTA 1XHOA 3CPQA 3WJQA 5LA6B 2ZAUA 3LWRC 4O4HA 3P4EA 2OTLF 3T80A 3JATB 3FD5A 1XBIA 3KE1A 3TD5A 2H6LA 2IQQA 4EI9A 1FNKA 5LXTA 4F6RA 2QEXF 4X3LA 3I3FA 4R40B 3CXCF 5HY1A 2G9IA 5IYZB 5C8YA 3NVIB 2DT4A 2L26A 1IV1A 3B6NA 2H8CA 4BT3A 4LNUA 2IG8A 3QHDA 5CA0A 2QTPA 4YJ3B 2UZHA 3ERNA 2RB9A 2R751 3SIVA 3VYSC 1VQ8F 5HP7A 3RYCA 5GINC 2KGWA 3QUWA 4O2AA 4O4IB 3S0WA 4TUYB 2HP0A 3E1YA 3JAKA 2RHJA 2CWJA 2CW4A 3R0PA 3E20B 3KJKA 1KQSF 2HS0A 4ZOLB 1IV2A 5JQGA 2QA4F 2BTOA 1W3EX 4BT7A 2OTJF 2AIFA 4HNAB 3KJJA 4EI7A 3WPWA 5KX5A 3K14A 3GYQA 3IKEA 4ZHVA 4O4JA 3VCZA 2RHOA 3ESJA 1Q81H 3OW2F 3ELCA 3JAMM 2BTUA 3CYQA 3G71F 3BYQA 3C9UA 3C9RA 3RA6A 3WJRA 1E7KA 4G4YA 4YJ2A 1QAHA 1RQ7A 1JFFA 2UYJA 2GLZA 3N4ZA 4DRXA 2Z1EA 3M84A 1YJNF 5FJ4C 2LBTA 3Q8HA 4YJ2B 3U0OA 3AGKA 3C8LA 4EB6A 1YGYA 2UYPA 3HAXD 3C9TA 5J2UA 1JD1A 3N2GB 3F0DA 3PAFA 1RLGA 1GZ0A 4BT5A 5LYJA 3K2XA 2CHSA 1VQ5F 5EIBC 5EYPB 4NUTA 1ONIA 1IV4A 4BVRA 2Z1TA 3D54A 4B62A 5HXZA 3ZP7A 2VAMA 3OONA 3G4SF 2LCAA 3LWVC 3CCMF 1X52A 3J80M 4E6EA 2Q1XA 3RYFA 4XCQA 3DDNA 3GTZA 1M1KH 2HVYD 4X1IA 1Q82H 1K8AH 3VIUA 4G88A 3CCJF 3WGNA 5LP6B 4TUYA 1GO1A 1KNKA 3RYHB 3V7EA 4I55B 5EWRA 1TUBB 4B46A 3JALA 5AVMA 3WXMB 1COMA 4WBNB 3WGJA 3M1XA 4TV8B 5LA6A 1NJIH 1UFYA 1VHAA 5ITZB 5LYJB 2CVLA 2QI2A 1VQ6F 1ZWZA 3MBMA 5EZYA 3F0EA 5IYZA 1RA4A 4ZHYB 3CC4F 3CC7F 4U3JB 4EI8A 2WALA 2NMUA 2UYNA 3N2GA 2H8EA 3NK7A 2B33A 2W8BC 5HP8A 4KWEA 2LBWA 3IMPA 4U39A 3CC2F 5HWEA 2KTUA 3RYIB 5IJ9B 2DYYA 3CCQF 1T0AA 4BVTA 3LWPC 4X1YB 1JFFB 1KC8H 3N2KA 3LWOC 3NVKE 3MDOA 4I50B 5J2UB 3P0ZA 5JH7A 5EO3A 3D00A 3MCQA 2GZLA 1VQPF 3NMUC 4NQ3A 2HX0A 3JAWB 4X1KA 2PMPA 3HWUA 3JVHA 1TVKB 2BO1A 5J2TB 1W42A 4X20B 2N48A 1PXWA 1QU9A 4C8IA 1PF5A 1SA0B 1M90H 3F0FA 4I4TB 1XRGA 1W5FA 2IAFA 1YJWF 2AMTA 2LBXA 4G4XA 2VXYA 2ZVYA 1UI9A 3CB2A 3K0TA 3O85A 3F0GA 3I7TA 3WGKA 3CCVF 1YHQF 2R6R1 2Z1FA 3KHNA 1YI2F 1Q7YH 3FFMA 1R1MA 3VI6A 3OBYA 5FLXM 1CN7A 3ZP4A 5BMVB 4RQOA 3ON1A 1W59A 2KG4A 3JALB 1XV2A 2FGYA 3J81M 4O2BA 2HS4A 3LYBA 3IKFA 1NMUB 1RQ2A 5BMVA 5JCOC 5A2QM 1SZQA 3VO8A 2EWCA 5GONA 3SIUA 3EORA 3V3TA 2AIZP 3P10A 3RE3A 3CCLF 1U3LA 5LP6C 3HJWC 4ZI7A 2JNBA 1VQMF 1TVKA 4C8EA 1VQKF 4O2AB 4O4IA 1QD9A 4O4HB 4ZK7A 5FNVA 1YIJF 1K9MH 2CZWA 3I56F 3IR9A 4I4TA
chains in the Genus database with same CATH topology
1VQ8F 2VGNA 1QVFF 3WXMB 5GINC 1X7OA 4X3MA 3LWQC 3CMEF 1NJIH 1VQ9F 4BW0B 5HY0A 2OZBA 3E1YA 1T0KB 2QI2A 1W40A 1VQ6F 3VMFB 3E20B 1KQSF 1ZWZA 1KD1H 1W2BF 2QA4F 1RA4A 4TZZA 3CC4F 3CC7F 1W3EX 4EI8A 2OHWA 1W41A 2WALA 5GANK 3CPWF 2OTJF 3CG6A 3NK7A 3I55F 5G4UC 2AIFA 1VQNF 2LBWA 3CC2F 4EI7A 5HWEA 3CCUF 4BVQA 2KTUA 1GO0A 1N8RH 3CCQF 5HY2A 3GYQA 4BVTA 3LWPC 3CCRF 1YJ9F 1Q81H 3OW2F 3CCEF 1KC8H 3JAMM 5GIPC 3LWOC 3NVKE 1DT9A 4LCKA 3G71F 3RA6A 5EO3A 3D00A 1YITF 3LFOA 1VQPF 1E7KA 5HY4A 1H7MA 3OBWA 3NMUC 4NQ3A 4BY9D 1IPAA 4C4WC 1QVGF 2GLZA 2KTVA 2BO1A 3N4ZA 1Q86H 1JJ2F 1YJNF 1W42A 5FJ4C 1PXWA 3CMAF 1VQOF 1M90H 5GAPK 2VGMA 1SDSA 5IT9M 3AGKA 3NK6A 3IR9A 3J7AR 1YJWF 3HAXD 2F9ZC 5G4VC 2LBXA 1VQ7F 3PAFA 3V7QA 1RLGA 1GZ0A 3O85A 3CCVF 1YHQF 3G6EF 2I6DA 1YI2F 1VQ4F 3CCSF 1VQ5F 1Q7YH 3FFMA 3VI6A 3OBYA 4BVSA 4NUTA 5FLXM 4BVRA 1CN7A 5DCVA 3ON1A 2KG4A 3RA5A 5HXZA 1CK2A 2FGYA 3CPQA 3J81M 1K73H 3LWRC 3G4SF 2ALEA 5HXUA 3LWVC 3CCMF 2OTLF 1NMUB 1X52A 5A2QM 3J80M 3MCAB 1XBIA 3SIUA 4EI9A 4XCQA 3N4YA 1M1KH 2HVYD 2QEXF 4X3LA 3CXCF 3V3TA 1Q82H 1K8AH 3CCLF 5HY1A 1X7PA 3CCJF 3HJWC 1S72F 1VQLF 2JNBA 1VQMF 3CD6F 3NVIB 3PLAC 3JCMM 2FC3A 1VQKF 1GO1A 5GIOC 3SIVA 1YIJF 1K9MH 3V7EA 2CZWA 3I56F 5EWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 F;  2VGN A;  1QVF F;  3WXM B;  5GIN C;  1X7O A;  4X3M A;  3LWQ C;  3CME F;  1NJI H;  1VQ9 F;  4BW0 B;  2OZB A;  3E1Y A;  1T0K B;  2QI2 A;  1W40 A;  1VQ6 F;  3VMF B;  3E20 B;  1KQS F;  1ZWZ A;  1KD1 H;  1W2B F;  2QA4 F;  1RA4 A;  4TZZ A;  3CC4 F;  3CC7 F;  1W3E X;  2OHW A;  1W41 A;  2WAL A;  5GAN K;  3CPW F;  2OTJ F;  3CG6 A;  3I55 F;  3NK7 A;  5G4U C;  2AIF A;  1VQN F;  2LBW A;  3CC2 F;  3CCU F;  2KTU A;  1GO0 A;  1N8R H;  3CCQ F;  3GYQ A;  3LWP C;  3CCR F;  1YJ9 F;  1Q81 H;  3OW2 F;  3CCE F;  1KC8 H;  3JAM M;  5GIP C;  3LWO C;  3NVK E;  1DT9 A;  4LCK A;  3G71 F;  3RA6 A;  5EO3 A;  1YIT F;  3LFO A;  1VQP F;  1E7K A;  1H7M A;  3OBW A;  3NMU C;  4BY9 D;  1IPA A;  4C4W C;  1QVG F;  2KTV A;  2BO1 A;  3N4Z A;  1Q86 H;  1JJ2 F;  1YJN F;  1W42 A;  5FJ4 C;  1PXW A;  3CMA F;  1VQO F;  1M90 H;  5GAP K;  2VGM A;  1SDS A;  5IT9 M;  3AGK A;  3NK6 A;  3IR9 A;  3J7A R;  1YJW F;  3HAX D;  5G4V C;  2LBX A;  1VQ7 F;  3PAF A;  3V7Q A;  1RLG A;  1GZ0 A;  3O85 A;  3CCV F;  1YHQ F;  3G6E F;  2I6D A;  1YI2 F;  1VQ4 F;  3CCS F;  1VQ5 F;  1Q7Y H;  3FFM A;  3VI6 A;  3OBY A;  4NUT A;  5FLX M;  1CN7 A;  5DCV A;  3ON1 A;  2KG4 A;  3RA5 A;  1CK2 A;  3CPQ A;  3J81 M;  1K73 H;  3LWR C;  3G4S F;  2ALE A;  3LWV C;  3CCM F;  2OTL F;  1NMU B;  1X52 A;  5A2Q M;  3J80 M;  3MCA B;  1XBI A;  3SIU A;  3N4Y A;  1M1K H;  2HVY D;  2QEX F;  4X3L A;  3CXC F;  1Q82 H;  1K8A H;  3CCL F;  1X7P A;  3CCJ F;  3HJW C;  1S72 F;  1VQL F;  2JNB A;  1VQM F;  3CD6 F;  3NVI B;  3PLA C;  3JCM M;  2FC3 A;  1VQK F;  1GO1 A;  5GIO C;  3SIV A;  1YIJ F;  1K9M H;  3V7E A;  2CZW A;  3I56 F;  5EWR A; 
#chains in the Genus database with same CATH topology
 3S0H A;  3S02 A;  2ZOD A;  4ZHW A;  3HKD A;  4IIJ B;  4X3M A;  3LWQ C;  3CME F;  1GX1 A;  1W55 A;  4FFB B;  5CA0 B;  2BTQ B;  1VQ9 F;  2UYN B;  5JVD B;  4BW0 B;  5HY0 A;  3WGM A;  1H48 A;  3E22 B;  1W40 A;  5EAZ A;  3VMF B;  2CSL A;  3WPX A;  5FNV B;  1KD1 H;  2ZF8 A;  5CB4 A;  1X25 A;  3UT5 B;  4G4V A;  4I50 A;  1H47 A;  3HKD B;  5LOV B;  4C8G A;  4TZZ A;  4C81 A;  2RHL A;  5MN5 A;  1W41 A;  3CG6 A;  3I55 F;  5KMG A;  5G4U C;  3M4S A;  1Z5V A;  1VQN F;  5IJ9 A;  4BT6 A;  5GON B;  4IIJ A;  3HKB A;  2P6Y A;  1OFU A;  1N8R H;  2UYK A;  4I55 A;  1CLI A;  3S06 A;  3E22 A;  3S0Y A;  3CCE F;  3HKC A;  5GIP C;  2V9Y A;  1DT9 A;  4ZOL A;  4B45 A;  3HKE A;  1YIT F;  3LFO A;  3VOA A;  2Z1U A;  5HY4 A;  3TD4 A;  3OBW A;  5KX5 B;  4BY9 D;  3L7Q A;  2HS3 A;  3S03 A;  3JAS B;  4TV8 A;  2KTV A;  5IJ0 B;  1Z5W A;  1Q86 H;  3VYT C;  3RYC B;  2VGM A;  5IT9 M;  3IEW A;  4X20 A;  2YYE A;  3NK6 A;  5B8F A;  5IJ0 A;  3JAS A;  2F9Z C;  4M8I A;  1VQ7 F;  1W5A A;  3V7Q A;  3HTN A;  5C8Y B;  5LP6 A;  5LOV A;  4ZHQ B;  1VQ4 F;  3CYP B;  3UT5 A;  5CA1 A;  3TD3 A;  2YXZ A;  1IV3 A;  2Q1Y A;  1JY8 A;  3K12 A;  5DCV A;  2MQE A;  4TV9 B;  3ZOP A;  1J7H A;  1CK2 A;  5EYP A;  3QTY A;  1K73 H;  4ERH A;  3C9S A;  2ALE A;  5HXU A;  4YJ3 A;  4IHJ A;  2PHN A;  3HKC B;  3MCA B;  3N4Y A;  4BT2 A;  1KNJ A;  4F6R B;  1X7P A;  3KIZ A;  4O4L B;  1S72 F;  1VQL F;  5MN4 A;  3CD6 F;  3PLA C;  5JVD A;  3HKB B;  3JCM M;  2FC3 A;  3FPI A;  4B5C A;  2HP3 A;  1FSZ A;  4O4J B;  3FBA A;  3DC2 A;  5GIO C;  3VOB A;  1U43 A;  2OZB A;  4G4Z A;  3D01 A;  2VGN A;  5ITZ A;  1QVF F;  3RYI A;  2Z01 A;  1X7O A;  4IHJ B;  2ZVZ A;  2ZOV A;  5CA1 B;  5JH7 B;  2OTM A;  4O2B B;  2VAP A;  3IEQ A;  4NWO B;  1Q8R A;  1W5E A;  2HQS C;  3WGL A;  4TV9 A;  2HRU A;  5JCO A;  1T0K B;  2I6R A;  3WJP A;  1NQ3 A;  4BT4 A;  3LDT A;  5EIB D;  1RLU A;  1W2B F;  2RHH A;  1U40 A;  3LME A;  1YQN A;  4HNA A;  1TUB A;  2OHW A;  3CPW F;  5GAN K;  3RYH A;  5EB1 B;  3JAR A;  1FFX A;  1FNJ A;  4WBN A;  3CCU F;  4BVQ A;  1DBF A;  1OAP A;  1GO0 A;  1SA0 A;  1W58 1;  4ZI7 B;  3VYU C;  5EZY B;  5HY2 A;  3FD6 A;  4X1I B;  4ZHQ A;  3MQW A;  3CCR F;  1YJ9 F;  1ODE A;  4C82 A;  5MN6 A;  1W5B A;  5JQG B;  2GVI A;  4LCK A;  1VH8 A;  1H7M A;  2HP0 B;  3HKE B;  3JAK B;  1VQV A;  3RYF B;  1IPA A;  4RHA A;  2CHT A;  4C4W C;  2HRY A;  1QVG F;  1FFX B;  1JN1 A;  4X1Y A;  3JAR B;  1VK3 A;  4LNU B;  5KMG B;  1JJ2 F;  1U3P A;  3JAW A;  3VTI C;  3CMA F;  1VQO F;  3V4D A;  5GAP K;  1SDS A;  5J2T A;  3GHZ A;  3J7A R;  5CB4 B;  5G4V C;  5EB0 A;  4EB6 B;  4U3J A;  4O4L A;  2K1S A;  3F6M A;  3JAT A;  1W57 A;  3G6E F;  4DXD A;  2I6D A;  4G4W A;  4DRX B;  3CCS F;  5LXT B;  4FFB A;  4BVS A;  4X1K B;  3N2K B;  2VAW A;  3ZO8 A;  3RA5 A;  4PWT A;  1XHO A;  3CPQ A;  3WJQ A;  5LA6 B;  2ZAU A;  3LWR C;  4O4H A;  3P4E A;  2OTL F;  3T80 A;  3JAT B;  3FD5 A;  1XBI A;  3KE1 A;  3TD5 A;  2H6L A;  2IQQ A;  4EI9 A;  1FNK A;  5LXT A;  4F6R A;  2QEX F;  4X3L A;  3I3F A;  4R40 B;  3CXC F;  5HY1 A;  2G9I A;  5IYZ B;  5C8Y A;  3NVI B;  2DT4 A;  2L26 A;  1IV1 A;  3B6N A;  2H8C A;  4BT3 A;  4LNU A;  2IG8 A;  3QHD A;  5CA0 A;  2QTP A;  4YJ3 B;  2UZH A;  3ERN A;  2RB9 A;  2R75 1;  3SIV A;  3VYS C;  1VQ8 F;  5HP7 A;  3RYC A;  5GIN C;  2KGW A;  3QUW A;  4O2A A;  4O4I B;  3S0W A;  4TUY B;  2HP0 A;  3E1Y A;  3JAK A;  2RHJ A;  2CWJ A;  2CW4 A;  3R0P A;  3E20 B;  3KJK A;  1KQS F;  2HS0 A;  4ZOL B;  1IV2 A;  5JQG A;  2QA4 F;  2BTO A;  1W3E X;  4BT7 A;  2OTJ F;  2AIF A;  4HNA B;  3KJJ A;  4EI7 A;  3WPW A;  5KX5 A;  3K14 A;  3GYQ A;  3IKE A;  4ZHV A;  4O4J A;  3VCZ A;  2RHO A;  3ESJ A;  1Q81 H;  3OW2 F;  3ELC A;  3JAM M;  2BTU A;  3CYQ A;  3G71 F;  3BYQ A;  3C9U A;  3C9R A;  3RA6 A;  3WJR A;  1E7K A;  4G4Y A;  4YJ2 A;  1QAH A;  1RQ7 A;  1JFF A;  2UYJ A;  2GLZ A;  3N4Z A;  4DRX A;  2Z1E A;  3M84 A;  1YJN F;  5FJ4 C;  2LBT A;  3Q8H A;  4YJ2 B;  3U0O A;  3AGK A;  3C8L A;  4EB6 A;  1YGY A;  2UYP A;  3HAX D;  3C9T A;  5J2U A;  1JD1 A;  3N2G B;  3F0D A;  3PAF A;  1RLG A;  1GZ0 A;  4BT5 A;  5LYJ A;  3K2X A;  2CHS A;  1VQ5 F;  5EIB C;  5EYP B;  4NUT A;  1ONI A;  1IV4 A;  4BVR A;  2Z1T A;  3D54 A;  4B62 A;  5HXZ A;  3ZP7 A;  2VAM A;  3OON A;  3G4S F;  2LCA A;  3LWV C;  3CCM F;  1X52 A;  3J80 M;  4E6E A;  2Q1X A;  3RYF A;  4XCQ A;  3DDN A;  3GTZ A;  1M1K H;  2HVY D;  4X1I A;  1Q82 H;  1K8A H;  3VIU A;  4G88 A;  3CCJ F;  3WGN A;  5LP6 B;  4TUY A;  1GO1 A;  1KNK A;  3RYH B;  3V7E A;  4I55 B;  5EWR A;  1TUB B;  4B46 A;  3JAL A;  5AVM A;  3WXM B;  1COM A;  4WBN B;  3WGJ A;  3M1X A;  4TV8 B;  5LA6 A;  1NJI H;  1UFY A;  1VHA A;  5ITZ B;  5LYJ B;  2CVL A;  2QI2 A;  1VQ6 F;  1ZWZ A;  3MBM A;  5EZY A;  3F0E A;  5IYZ A;  1RA4 A;  4ZHY B;  3CC4 F;  3CC7 F;  4U3J B;  4EI8 A;  2WAL A;  2NMU A;  2UYN A;  3N2G A;  2H8E A;  3NK7 A;  2B33 A;  2W8B C;  5HP8 A;  4KWE A;  2LBW A;  3IMP A;  4U39 A;  3CC2 F;  5HWE A;  2KTU A;  3RYI B;  5IJ9 B;  2DYY A;  3CCQ F;  1T0A A;  4BVT A;  3LWP C;  4X1Y B;  1JFF B;  1KC8 H;  3N2K A;  3LWO C;  3NVK E;  3MDO A;  4I50 B;  5J2U B;  3P0Z A;  5JH7 A;  5EO3 A;  3D00 A;  3MCQ A;  2GZL A;  1VQP F;  3NMU C;  4NQ3 A;  2HX0 A;  3JAW B;  4X1K A;  2PMP A;  3HWU A;  3JVH A;  1TVK B;  2BO1 A;  5J2T B;  1W42 A;  4X20 B;  2N48 A;  1PXW A;  1QU9 A;  4C8I A;  1PF5 A;  1SA0 B;  1M90 H;  3F0F A;  4I4T B;  1XRG A;  1W5F A;  2IAF A;  1YJW F;  2AMT A;  2LBX A;  4G4X A;  2VXY A;  2ZVY A;  1UI9 A;  3CB2 A;  3K0T A;  3O85 A;  3F0G A;  3I7T A;  3WGK A;  3CCV F;  1YHQ F;  2R6R 1;  2Z1F A;  3KHN A;  1YI2 F;  1Q7Y H;  3FFM A;  1R1M A;  3VI6 A;  3OBY A;  5FLX M;  1CN7 A;  3ZP4 A;  5BMV B;  4RQO A;  3ON1 A;  1W59 A;  2KG4 A;  3JAL B;  1XV2 A;  2FGY A;  3J81 M;  4O2B A;  2HS4 A;  3LYB A;  3IKF A;  1NMU B;  1RQ2 A;  5BMV A;  5JCO C;  5A2Q M;  1SZQ A;  3VO8 A;  2EWC A;  5GON A;  3SIU A;  3EOR A;  3V3T A;  2AIZ P;  3P10 A;  3RE3 A;  3CCL F;  1U3L A;  5LP6 C;  3HJW C;  4ZI7 A;  2JNB A;  1VQM F;  1TVK A;  4C8E A;  1VQK F;  4O2A B;  4O4I A;  1QD9 A;  4O4H B;  4ZK7 A;  5FNV A;  1YIJ F;  1K9M H;  2CZW A;  3I56 F;  3IR9 A;  4I4T A; 
#chains in the Genus database with same CATH homology
 1VQ8 F;  2VGN A;  1QVF F;  3WXM B;  5GIN C;  1X7O A;  4X3M A;  3LWQ C;  3CME F;  1NJI H;  1VQ9 F;  4BW0 B;  5HY0 A;  2OZB A;  3E1Y A;  1T0K B;  2QI2 A;  1W40 A;  1VQ6 F;  3VMF B;  3E20 B;  1KQS F;  1ZWZ A;  1KD1 H;  1W2B F;  2QA4 F;  1RA4 A;  4TZZ A;  3CC4 F;  3CC7 F;  1W3E X;  4EI8 A;  2OHW A;  1W41 A;  2WAL A;  5GAN K;  3CPW F;  2OTJ F;  3CG6 A;  3NK7 A;  3I55 F;  5G4U C;  2AIF A;  1VQN F;  2LBW A;  3CC2 F;  4EI7 A;  5HWE A;  3CCU F;  4BVQ A;  2KTU A;  1GO0 A;  1N8R H;  3CCQ F;  5HY2 A;  3GYQ A;  4BVT A;  3LWP C;  3CCR F;  1YJ9 F;  1Q81 H;  3OW2 F;  3CCE F;  1KC8 H;  3JAM M;  5GIP C;  3LWO C;  3NVK E;  1DT9 A;  4LCK A;  3G71 F;  3RA6 A;  5EO3 A;  3D00 A;  1YIT F;  3LFO A;  1VQP F;  1E7K A;  5HY4 A;  1H7M A;  3OBW A;  3NMU C;  4NQ3 A;  4BY9 D;  1IPA A;  4C4W C;  1QVG F;  2GLZ A;  2KTV A;  2BO1 A;  3N4Z A;  1Q86 H;  1JJ2 F;  1YJN F;  1W42 A;  5FJ4 C;  1PXW A;  3CMA F;  1VQO F;  1M90 H;  5GAP K;  2VGM A;  1SDS A;  5IT9 M;  3AGK A;  3NK6 A;  3IR9 A;  3J7A R;  1YJW F;  3HAX D;  2F9Z C;  5G4V C;  2LBX A;  1VQ7 F;  3PAF A;  3V7Q A;  1RLG A;  1GZ0 A;  3O85 A;  3CCV F;  1YHQ F;  3G6E F;  2I6D A;  1YI2 F;  1VQ4 F;  3CCS F;  1VQ5 F;  1Q7Y H;  3FFM A;  3VI6 A;  3OBY A;  4BVS A;  4NUT A;  5FLX M;  4BVR A;  1CN7 A;  5DCV A;  3ON1 A;  2KG4 A;  3RA5 A;  5HXZ A;  1CK2 A;  2FGY A;  3CPQ A;  3J81 M;  1K73 H;  3LWR C;  3G4S F;  2ALE A;  5HXU A;  3LWV C;  3CCM F;  2OTL F;  1NMU B;  1X52 A;  5A2Q M;  3J80 M;  3MCA B;  1XBI A;  3SIU A;  4EI9 A;  4XCQ A;  3N4Y A;  1M1K H;  2HVY D;  2QEX F;  4X3L A;  3CXC F;  3V3T A;  1Q82 H;  1K8A H;  3CCL F;  5HY1 A;  1X7P A;  3CCJ F;  3HJW C;  1S72 F;  1VQL F;  2JNB A;  1VQM F;  3CD6 F;  3NVI B;  3PLA C;  3JCM M;  2FC3 A;  1VQK F;  1GO1 A;  5GIO C;  3SIV A;  1YIJ F;  1K9M H;  3V7E A;  2CZW A;  3I56 F;  5EWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...