2KTUA

Human erf1 c-domain, "closed" conformer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
164
structure length
164
Chain Sequence
b'NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor subunit 1
molecule tags Translation
source organism Homo sapiens
publication title NMR assignments of the C-terminal domain of human polypeptide release factor eRF1.
pubmed doi rcsb
total genus 28
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktuA00
1KQSF 3CCEF 1W3EX 3E20B 5GIPC 3LWPC 3CCMF 1VQMF 2QI2A 1T0KB 4X3LA 1Q86H 5IT9M 5FLXM 5GAPK 3J81M 2CZWA 3G6EF 3I56F 1H7MA 1VQ5F 3LWVC 1RA4A 5GINC 5GANK 3LWRC 5EO3A 1ZWZA 5FJ4C 3RA5A 2VGNA 1VQLF 3VI6A 1VQOF 3V7QA 1VQ7F 1VQPF 3NK6A 1RLGA 3CCLF 1W41A 1IPAA 3LWQC 1N8RH 3VMFB 1W2BF 1W40A 1YJ9F 4LCKA 1Q7YH 3J7AR 3CC7F 1K9MH 2QA4F 4TZZA 1DT9A 3WXMB 4BW0B 5DCVA 2OHWA 1PXWA 3I55F 1Q81H 3NK7A 3CMEF 2AIFA 1YI2F 1K8AH 1X7PA 3J80M 1SDSA 1YHQF 1NJIH 3ON1A 1GZ0A 1VQKF 3FFMA 5A2QM 1GO0A 2OTJF 1YITF 5EWRA 5G4VC 3SIVA 3OBWA 3CPWF 2HVYD 2OZBA 2FC3A 3CC4F 1S72F 1KC8H 1K73H 1JJ2F 3HAXD 1CN7A 5GIOC 3G71F 3G4SF 3MCAB 1VQ9F 1CK2A 2LBXA 2BO1A 3N4YA 3JAMM 3CC2F 3CMAF 3JCMM 2WALA 1X52A 4X3MA 2ALEA 1VQNF 3SIUA 3CD6F 1YIJF 1KD1H 3LWOC 3CXCF 1VQ4F 3CCSF 5G4UC 3LFOA 2VGMA 1GO1A 1YJNF 2KTVA 1QVFF 3HJWC 3CCRF 3PLAC 1M1KH 2LBWA 4NUTA 2KTUA 3NVKE 3AGKA 3NMUC 3E1YA 3OBYA 1NMUB 2QEXF 3CCUF 3O85A 3NVIB 1VQ8F 1M90H 3OW2F 1YJWF 2I6DA 1Q82H 3CPQA 3RA6A 3IR9A 4BY9D 2KG4A 3CG6A 1W42A 3CCVF 3CCJF 3PAFA 1E7KA 1VQ6F 1QVGF 3V7EA 1X7OA 3GYQA 3CCQF 2JNBA 3N4ZA 2OTLF 1XBIA 4C4WC
chains in the Genus database with same CATH superfamily
3JAWB 3F0DA 5GIPC 3LWPC 3CCMF 2HQSC 3OONA 3IKFA 1T0KB 2LCAA 3J81M 4BT3A 3RYHB 2IAFA 1QAHA 2YXZA 1OAPA 5J2UB 5GANK 3LWRC 1GX1A 1ZWZA 2GVIA 5BMVA 5FJ4C 1RQ2A 1JN1A 2LBTA 2B33A 3JVHA 1VK3A 3HKCB 2AIZP 1W59A 1W41A 3V3TA 3WJPA 5CB4A 1W2BF 1Q7YH 4YJ2B 3RYCB 1OFUA 3VTIC 2W8BC 1K9MH 3ESJA 3RYHA 4BVSA 3WXMB 3C8LA 5DCVA 5J2TB 5JQGA 5BMVB 2PHNA 3CMEF 2AIFA 1SA0A 4B46A 3MDOA 1IV1A 3JATB 1ODEA 1VQKF 4PWTA 5A2QM 5HXZA 5G4VC 3SIVA 3OBWA 2DYYA 1IV2A 1IV4A 1XRGA 3HWUA 3S03A 2FC3A 3CC4F 1U3LA 1Q8RA 4WBNA 4O4IB 4O4LB 5GIOC 3QUWA 3G71F 1VQ9F 2G9IA 3JAKA 3CC2F 3CB2A 2HRUA 1VHAA 1Z5WA 4ZHWA 5HY2A 2RHOA 1VQNF 2H8EA 1KD1H 4O4JA 3LWOC 1VQ4F 4BVRA 4WBNB 1YJNF 4G4ZA 3RYIB 5KMGA 3CCRF 1R1MA 3IEWA 1M1KH 4M8IA 3AGKA 3JATA 3NMUC 3IMPA 3QHDA 4X20A 5C8YA 3O85A 5IYZA 5CA0A 2VXYA 5CA1A 5KX5B 4G88A 3F0EA 3S02A 1DBFA 4R40B 3IR9A 3C9SA 3CCJF 5EB1B 5HP7A 3V4DA 3TD4A 4O4LA 5GONB 2Z1UA 3N4ZA 3S0YA 2OTLF 1XBIA 1XV2A 4TV9A 3E20B 4NWOB 5MN5A 4U39A 5IYZB 2QTPA 4X3LA 2R6R1 5GAPK 1CLIA 1U43A 4DXDA 5ITZB 1H7MA 3LWVC 2IQQA 3T80A 3C9RA 1FSZA 3IKEA 5EIBC 1VQLF 2ZODA 3QTYA 3LYBA 3ZP7A 4U3JA 4EB6B 1RLGA 2RHJA 3RYFA 3WGMA 4EI8A 3LWQC 1VQVA 2Q1YA 2VAMA 5LP6A 3N2GB 2VAPA 4X1YA 3K12A 4DRXA 3CC7F 4TUYB 2FGYA 5HY4A 4B62A 5LYJB 5LA6B 5ITZA 1W5BA 4O2AA 2OHWA 1PXWA 1KNJA 5FNVA 3I55F 3F0FA 3NK7A 5B8FA 3E22B 4RQOA 5HY0A 3ELCA 3S0WA 4ZHQA 1J7HA 1X7PA 1TUBA 4ZHYB 2N48A 5HY1A 5LOVA 3J80M 1NJIH 3LMEA 2GLZA 1GZ0A 2Q1XA 3MBMA 4LNUB 3RYFB 4HNAB 3FFMA 1X25A 2OTMA 1GO0A 1UFYA 2F9ZC 4I55B 5EWRA 4BVQA 2DT4A 2OTJF 4X1YB 4X1KA 2HP0A 3CPWF 1KNKA 5AVMA 3M84A 3N2KA 1QU9A 4FFBB 5JVDA 3KJJA 1K73H 1JJ2F 1CN7A 3VYTC 3TD5A 2K1SA 5LXTB 2I6RA 3VOAA 3MCAB 4ZHQB 2CHSA 1COMA 2CWJA 3JAMM 1YQNA 3WGJA 3K2XA 3CMAF 3N2GA 3ZOPA 1YGYA 4TUYA 4X1KB 3CD6F 4TV8B 2HP0B 3ZP4A 5LA6A 5IJ0A 3K0TA 2RB9A 4O2AB 5G4UC 3D54A 4KWEA 3JALA 4G4WA 4O4HB 3DC2A 3FPIA 3WPWA 4E6EA 3HKBB 3HKEB 2LBWA 4NUTA 2KTUA 1NMUB 4HNAA 3NVIB 4BT5A 1VQ8F 3OW2F 5MN6A 5HP8A 3CYPB 3CPQA 3P4EA 4YJ3B 5EAZA 3I3FA 3JASB 2ZVZA 3CG6A 4BVTA 5JVDB 1JFFB 3PAFA 1VQ6F 4IHJB 3V7EA 1X7OA 5JQGB 2UYNB 2JNBA 1KQSF 3CCEF 3HKCA 2HRYA 5EYPB 3HKEA 4EI9A 1VQMF 2ZVYA 2HS4A 3GHZA 4C8EA 1W57A 5IT9M 2CSLA 5IJ9B 4YJ3A 5EB0A 4B5CA 2HX0A 2ZAUA 1RA4A 2BTOA 1JFFA 2PMPA 2ZOVA 3IEQA 4O4IA 5GINC 3RA5A 2VGNA 5HWEA 2KGWA 1PF5A 5JH7A 1SZQA 4I50A 3HKBA 1VQOF 3V7QA 1VQ7F 3VCZA 2RHHA 3CCLF 2HP3A 2H8CA 2AMTA 4ZK7A 1YJ9F 3VYSC 2HS3A 5IJ9A 4O4JB 5JCOA 4TZZA 2IG8A 3VOBA 4BW0B 3K14A 3S0HA 4O2BA 4I4TA 1Q81H 3WGLA 1W5FA 5KMGB 1RQ7A 3DDNA 1H48A 1K8AH 1SDSA 1YHQF 4F6RA 5CA0B 2BTQB 2R751 2V9YA 3ZO8A 1NQ3A 2HVYD 2OZBA 1S72F 1FFXB 2ZF8A 1KC8H 3D00A 5EZYB 3HAXD 1FNKA 3HKDA 4I4TB 4XCQA 3TD3A 4I50B 3B6NA 3BYQA 3KHNA 2LBXA 2BO1A 1IV3A 3R0PA 1TVKB 4NQ3A 4X20B 5C8YB 3D01A 3F6MA 1FNJA 2YYEA 4RHAA 3JCMM 3M1XA 5CB4B 3VO8A 2ALEA 4ERHA 3SIUA 3RYCA 4YJ2A 1H47A 1W55A 1YIJF 3CXCF 3CCSF 1FFXA 2GZLA 3JARA 1GO1A 5EZYA 4B45A 2KTVA 2Z1EA 1SA0B 2Z1TA 3PLAC 4EB6A 3NVKE 3KJKA 4BT2A 3E1YA 4X1IA 4F6RB 2QEXF 5LP6B 3M4SA 1M90H 1T0AA 1YJWF 4DRXB 3WJQA 3RA6A 3MQWA 4ZI7B 2UYPA 2CVLA 3FD5A 4IIJA 1E7KA 5LP6C 4BT6A 1W5AA 1QVGF 3HKDB 3E22A 3I7TA 4U3JB 3RYIA 1TUBB 1W3EX 1TVKA 3JAKB 2QI2A 3LDTA 4I55A 4ZOLB 5KX5A 2H6LA 1Q86H 1Z5VA 5FLXM 5LYJA 2CZWA 3UT5A 3WGKA 4ZI7A 3N2KB 3I56F 3G6EF 1VQ5F 1XHOA 5JCOC 3HTNA 3Q8HA 4IIJB 3JARB 2NMUA 5EO3A 5LXTA 5GONA 2L26A 1ONIA 3VI6A 2CHTA 3NK6A 1VQPF 3KE1A 1W581 1IPAA 4X1IB 1N8RH 3VIUA 5CA1B 3VMFB 1RLUA 1W40A 4LCKA 3EORA 3J7AR 3FBAA 5MN4A 4TV8A 4FFBA 2QA4F 3ERNA 1UI9A 5IJ0B 1DT9A 3GTZA 4G4XA 3JALB 3RE3A 2CW4A 2UZHA 1YI2F 2VAWA 4TV9B 3VYUC 3ON1A 3FD6A 3KIZA 3S06A 2UYKA 1YITF 4ZOLA 2Z01A 3WPXA 2P6YA 3F0GA 3UT5B 4G4YA 3JASA 1QD9A 2HS0A 4O4HA 5HXUA 4C8GA 3WJRA 3CYQA 2UYNA 4C82A 1JY8A 3G4SF 1CK2A 4G4VA 2BTUA 5EYPA 3N4YA 3JAWA 4EI7A 3U0OA 1W5EA 3WGNA 2WALA 4BT4A 4ZHVA 1X52A 4X3MA 1U3PA 4C81A 3C9TA 4IHJA 3L7QA 3LFOA 2VGMA 5FNVB 1QVFF 5JH7B 2RHLA 3HJWC 5EIBD 5LOVB 2UYJA 3C9UA 3OBYA 4LNUA 3CCUF 1JD1A 2MQEA 1U40A 3MCQA 2I6DA 3P0ZA 4C8IA 1Q82H 2Z1FA 3P10A 5J2UA 4BY9D 2KG4A 1W42A 3CCVF 1VH8A 4O2BB 2EWCA 5J2TA 4BT7A 3GYQA 3CCQF 4C4WC
chains in the Genus database with same CATH topology
1KQSF 3CCEF 1W3EX 3E20B 5GIPC 3LWPC 4EI9A 3CCMF 1VQMF 2QI2A 1T0KB 4X3LA 1Q86H 5IT9M 5FLXM 5GAPK 3J81M 2CZWA 3G6EF 3I56F 1H7MA 1VQ5F 3LWVC 1RA4A 5GINC 5GANK 3LWRC 5EO3A 1ZWZA 5FJ4C 3RA5A 2VGNA 5HWEA 1VQLF 3VI6A 1VQOF 3V7QA 1VQ7F 1VQPF 3NK6A 1RLGA 3CCLF 4EI8A 3V3TA 1W41A 1IPAA 3LWQC 1N8RH 3VMFB 1W2BF 1W40A 1YJ9F 4LCKA 1Q7YH 3J7AR 3CC7F 2FGYA 1K9MH 5HY4A 4BVSA 2QA4F 4TZZA 1DT9A 3WXMB 4BW0B 5DCVA 2OHWA 1PXWA 3I55F 1Q81H 3NK7A 5HY0A 3CMEF 2AIFA 1YI2F 1K8AH 1X7PA 3J80M 5HY1A 1SDSA 1YHQF 1NJIH 3ON1A 2GLZA 1GZ0A 1VQKF 3FFMA 5A2QM 1GO0A 5HXZA 2F9ZC 1YITF 2OTJF 5EWRA 4BVQA 5G4VC 3SIVA 3OBWA 3CPWF 2HVYD 2OZBA 2FC3A 3CC4F 1S72F 1KC8H 1K73H 1JJ2F 3D00A 3HAXD 1CN7A 5HXUA 5GIOC 4XCQA 3G71F 3G4SF 3MCAB 1VQ9F 1CK2A 2LBXA 2BO1A 3N4YA 4NQ3A 3JAMM 3CC2F 4EI7A 3CMAF 3JCMM 2WALA 5HY2A 1X52A 4X3MA 2ALEA 1VQNF 3SIUA 3CD6F 1YIJF 1KD1H 3LWOC 3CXCF 1VQ4F 3CCSF 5G4UC 3LFOA 2VGMA 1GO1A 4BVRA 1YJNF 2KTVA 1QVFF 3HJWC 3CCRF 3PLAC 1M1KH 2LBWA 4NUTA 2KTUA 3NVKE 3AGKA 3NMUC 3E1YA 3OBYA 1NMUB 2QEXF 3CCUF 3O85A 3NVIB 1VQ8F 1M90H 3OW2F 1YJWF 2I6DA 1Q82H 3CPQA 3RA6A 3IR9A 4BY9D 2KG4A 3CG6A 1W42A 4BVTA 3CCVF 3CCJF 3PAFA 1E7KA 1VQ6F 1QVGF 3V7EA 1X7OA 3GYQA 3CCQF 2JNBA 3N4ZA 2OTLF 1XBIA 4C4WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS F;  3CCE F;  1W3E X;  3E20 B;  5GIP C;  3LWP C;  3CCM F;  1VQM F;  2QI2 A;  1T0K B;  4X3L A;  1Q86 H;  5IT9 M;  5FLX M;  5GAP K;  3J81 M;  2CZW A;  3G6E F;  3I56 F;  1H7M A;  1VQ5 F;  3LWV C;  1RA4 A;  5GIN C;  5GAN K;  3LWR C;  5EO3 A;  1ZWZ A;  5FJ4 C;  3RA5 A;  2VGN A;  1VQL F;  3VI6 A;  1VQO F;  3V7Q A;  1VQ7 F;  1VQP F;  3NK6 A;  1RLG A;  3CCL F;  1W41 A;  1IPA A;  3LWQ C;  1N8R H;  3VMF B;  1W2B F;  1W40 A;  1YJ9 F;  4LCK A;  1Q7Y H;  3J7A R;  3CC7 F;  1K9M H;  2QA4 F;  4TZZ A;  1DT9 A;  3WXM B;  4BW0 B;  5DCV A;  2OHW A;  1PXW A;  3I55 F;  1Q81 H;  3NK7 A;  3CME F;  2AIF A;  1YI2 F;  1K8A H;  1X7P A;  3J80 M;  1SDS A;  1YHQ F;  1NJI H;  3ON1 A;  1GZ0 A;  1VQK F;  3FFM A;  5A2Q M;  1GO0 A;  2OTJ F;  1YIT F;  5EWR A;  5G4V C;  3SIV A;  3OBW A;  3CPW F;  2HVY D;  2OZB A;  2FC3 A;  3CC4 F;  1S72 F;  1KC8 H;  1K73 H;  1JJ2 F;  3HAX D;  1CN7 A;  5GIO C;  3G71 F;  3G4S F;  3MCA B;  1VQ9 F;  1CK2 A;  2LBX A;  2BO1 A;  3N4Y A;  3JAM M;  3CC2 F;  3CMA F;  3JCM M;  2WAL A;  1X52 A;  4X3M A;  2ALE A;  1VQN F;  3SIU A;  3CD6 F;  1YIJ F;  1KD1 H;  3LWO C;  3CXC F;  1VQ4 F;  3CCS F;  5G4U C;  3LFO A;  2VGM A;  1GO1 A;  1YJN F;  2KTV A;  1QVF F;  3HJW C;  3CCR F;  3PLA C;  1M1K H;  2LBW A;  4NUT A;  2KTU A;  3NVK E;  3AGK A;  3NMU C;  3E1Y A;  3OBY A;  1NMU B;  2QEX F;  3CCU F;  3O85 A;  3NVI B;  1VQ8 F;  1M90 H;  3OW2 F;  1YJW F;  2I6D A;  1Q82 H;  3CPQ A;  3RA6 A;  3IR9 A;  4BY9 D;  2KG4 A;  3CG6 A;  1W42 A;  3CCV F;  3CCJ F;  3PAF A;  1E7K A;  1VQ6 F;  1QVG F;  3V7E A;  1X7O A;  3GYQ A;  3CCQ F;  2JNB A;  3N4Z A;  2OTL F;  1XBI A;  4C4W C; 
#chains in the Genus database with same CATH topology
 3JAW B;  3F0D A;  5GIP C;  3LWP C;  3CCM F;  2HQS C;  3OON A;  3IKF A;  1T0K B;  2LCA A;  3J81 M;  4BT3 A;  3RYH B;  2IAF A;  1QAH A;  2YXZ A;  1OAP A;  5J2U B;  5GAN K;  3LWR C;  1GX1 A;  1ZWZ A;  2GVI A;  5BMV A;  5FJ4 C;  1RQ2 A;  1JN1 A;  2LBT A;  2B33 A;  3JVH A;  1VK3 A;  3HKC B;  2AIZ P;  1W59 A;  1W41 A;  3V3T A;  3WJP A;  5CB4 A;  1W2B F;  1Q7Y H;  4YJ2 B;  3RYC B;  1OFU A;  3VTI C;  2W8B C;  1K9M H;  3ESJ A;  3RYH A;  4BVS A;  3WXM B;  3C8L A;  5DCV A;  5J2T B;  5JQG A;  5BMV B;  2PHN A;  3CME F;  2AIF A;  1SA0 A;  4B46 A;  3MDO A;  1IV1 A;  3JAT B;  1ODE A;  1VQK F;  4PWT A;  5A2Q M;  5HXZ A;  5G4V C;  3SIV A;  3OBW A;  2DYY A;  1IV2 A;  1IV4 A;  1XRG A;  3HWU A;  3S03 A;  2FC3 A;  3CC4 F;  1U3L A;  1Q8R A;  4WBN A;  4O4I B;  4O4L B;  5GIO C;  3QUW A;  3G71 F;  1VQ9 F;  2G9I A;  3JAK A;  3CC2 F;  3CB2 A;  2HRU A;  1VHA A;  1Z5W A;  4ZHW A;  5HY2 A;  2RHO A;  1VQN F;  2H8E A;  1KD1 H;  4O4J A;  3LWO C;  1VQ4 F;  4BVR A;  4WBN B;  1YJN F;  4G4Z A;  3RYI B;  5KMG A;  3CCR F;  1R1M A;  3IEW A;  1M1K H;  4M8I A;  3AGK A;  3JAT A;  3NMU C;  3IMP A;  3QHD A;  4X20 A;  5C8Y A;  3O85 A;  5IYZ A;  5CA0 A;  2VXY A;  5CA1 A;  5KX5 B;  4G88 A;  3F0E A;  3S02 A;  1DBF A;  4R40 B;  3IR9 A;  3C9S A;  3CCJ F;  5EB1 B;  5HP7 A;  3V4D A;  3TD4 A;  4O4L A;  5GON B;  2Z1U A;  3N4Z A;  3S0Y A;  2OTL F;  1XBI A;  1XV2 A;  4TV9 A;  3E20 B;  4NWO B;  5MN5 A;  4U39 A;  5IYZ B;  2QTP A;  4X3L A;  2R6R 1;  5GAP K;  1CLI A;  1U43 A;  4DXD A;  5ITZ B;  1H7M A;  3LWV C;  2IQQ A;  3T80 A;  3C9R A;  1FSZ A;  3IKE A;  5EIB C;  1VQL F;  2ZOD A;  3QTY A;  3LYB A;  3ZP7 A;  4U3J A;  4EB6 B;  1RLG A;  2RHJ A;  3RYF A;  3WGM A;  4EI8 A;  3LWQ C;  1VQV A;  2Q1Y A;  2VAM A;  5LP6 A;  3N2G B;  2VAP A;  4X1Y A;  3K12 A;  4DRX A;  3CC7 F;  4TUY B;  2FGY A;  5HY4 A;  4B62 A;  5LYJ B;  5LA6 B;  5ITZ A;  1W5B A;  4O2A A;  2OHW A;  1PXW A;  1KNJ A;  5FNV A;  3I55 F;  3F0F A;  3NK7 A;  5B8F A;  3E22 B;  4RQO A;  5HY0 A;  3ELC A;  3S0W A;  4ZHQ A;  1J7H A;  1X7P A;  1TUB A;  4ZHY B;  2N48 A;  5HY1 A;  5LOV A;  3J80 M;  1NJI H;  3LME A;  2GLZ A;  1GZ0 A;  2Q1X A;  3MBM A;  4LNU B;  3RYF B;  4HNA B;  3FFM A;  1X25 A;  2OTM A;  1GO0 A;  1UFY A;  2F9Z C;  4I55 B;  5EWR A;  4BVQ A;  2DT4 A;  2OTJ F;  4X1Y B;  4X1K A;  2HP0 A;  3CPW F;  1KNK A;  5AVM A;  3M84 A;  3N2K A;  1QU9 A;  4FFB B;  5JVD A;  3KJJ A;  1K73 H;  1JJ2 F;  1CN7 A;  3VYT C;  3TD5 A;  2K1S A;  5LXT B;  2I6R A;  3VOA A;  3MCA B;  4ZHQ B;  2CHS A;  1COM A;  2CWJ A;  3JAM M;  1YQN A;  3WGJ A;  3K2X A;  3CMA F;  3N2G A;  3ZOP A;  1YGY A;  4TUY A;  4X1K B;  3CD6 F;  4TV8 B;  2HP0 B;  3ZP4 A;  5LA6 A;  5IJ0 A;  3K0T A;  2RB9 A;  4O2A B;  5G4U C;  3D54 A;  4KWE A;  3JAL A;  4G4W A;  4O4H B;  3DC2 A;  3FPI A;  3WPW A;  4E6E A;  3HKB B;  3HKE B;  2LBW A;  4NUT A;  2KTU A;  1NMU B;  4HNA A;  3NVI B;  4BT5 A;  1VQ8 F;  3OW2 F;  5MN6 A;  5HP8 A;  3CYP B;  3CPQ A;  3P4E A;  4YJ3 B;  5EAZ A;  3I3F A;  3JAS B;  2ZVZ A;  3CG6 A;  4BVT A;  5JVD B;  1JFF B;  3PAF A;  1VQ6 F;  4IHJ B;  3V7E A;  1X7O A;  5JQG B;  2UYN B;  2JNB A;  1KQS F;  3CCE F;  3HKC A;  2HRY A;  5EYP B;  3HKE A;  4EI9 A;  1VQM F;  2ZVY A;  2HS4 A;  3GHZ A;  4C8E A;  1W57 A;  5IT9 M;  2CSL A;  5IJ9 B;  4YJ3 A;  5EB0 A;  4B5C A;  2HX0 A;  2ZAU A;  1RA4 A;  2BTO A;  1JFF A;  2PMP A;  2ZOV A;  3IEQ A;  4O4I A;  5GIN C;  3RA5 A;  2VGN A;  5HWE A;  2KGW A;  1PF5 A;  5JH7 A;  1SZQ A;  4I50 A;  3HKB A;  1VQO F;  3V7Q A;  1VQ7 F;  3VCZ A;  2RHH A;  3CCL F;  2HP3 A;  2H8C A;  2AMT A;  4ZK7 A;  1YJ9 F;  3VYS C;  2HS3 A;  5IJ9 A;  4O4J B;  5JCO A;  4TZZ A;  2IG8 A;  3VOB A;  4BW0 B;  3K14 A;  3S0H A;  4O2B A;  4I4T A;  1Q81 H;  3WGL A;  1W5F A;  5KMG B;  1RQ7 A;  3DDN A;  1H48 A;  1K8A H;  1SDS A;  1YHQ F;  4F6R A;  5CA0 B;  2BTQ B;  2R75 1;  2V9Y A;  3ZO8 A;  1NQ3 A;  2HVY D;  2OZB A;  1S72 F;  1FFX B;  2ZF8 A;  1KC8 H;  3D00 A;  5EZY B;  3HAX D;  1FNK A;  3HKD A;  4I4T B;  4XCQ A;  3TD3 A;  4I50 B;  3B6N A;  3BYQ A;  3KHN A;  2LBX A;  2BO1 A;  1IV3 A;  3R0P A;  1TVK B;  4NQ3 A;  4X20 B;  5C8Y B;  3D01 A;  3F6M A;  1FNJ A;  2YYE A;  4RHA A;  3JCM M;  3M1X A;  5CB4 B;  3VO8 A;  2ALE A;  4ERH A;  3SIU A;  3RYC A;  4YJ2 A;  1H47 A;  1W55 A;  1YIJ F;  3CXC F;  3CCS F;  1FFX A;  2GZL A;  3JAR A;  1GO1 A;  5EZY A;  4B45 A;  2KTV A;  2Z1E A;  1SA0 B;  2Z1T A;  3PLA C;  4EB6 A;  3NVK E;  3KJK A;  4BT2 A;  3E1Y A;  4X1I A;  4F6R B;  2QEX F;  5LP6 B;  3M4S A;  1M90 H;  1T0A A;  1YJW F;  4DRX B;  3WJQ A;  3RA6 A;  3MQW A;  4ZI7 B;  2UYP A;  2CVL A;  3FD5 A;  4IIJ A;  1E7K A;  5LP6 C;  4BT6 A;  1W5A A;  1QVG F;  3HKD B;  3E22 A;  3I7T A;  4U3J B;  3RYI A;  1TUB B;  1W3E X;  1TVK A;  3JAK B;  2QI2 A;  3LDT A;  4I55 A;  4ZOL B;  5KX5 A;  2H6L A;  1Q86 H;  1Z5V A;  5FLX M;  5LYJ A;  2CZW A;  3UT5 A;  3WGK A;  4ZI7 A;  3N2K B;  3I56 F;  3G6E F;  1VQ5 F;  1XHO A;  5JCO C;  3HTN A;  3Q8H A;  4IIJ B;  3JAR B;  2NMU A;  5EO3 A;  5LXT A;  5GON A;  2L26 A;  1ONI A;  3VI6 A;  2CHT A;  3NK6 A;  1VQP F;  3KE1 A;  1W58 1;  1IPA A;  4X1I B;  1N8R H;  3VIU A;  5CA1 B;  3VMF B;  1RLU A;  1W40 A;  4LCK A;  3EOR A;  3J7A R;  3FBA A;  5MN4 A;  4TV8 A;  4FFB A;  2QA4 F;  3ERN A;  1UI9 A;  5IJ0 B;  1DT9 A;  3GTZ A;  4G4X A;  3JAL B;  3RE3 A;  2CW4 A;  2UZH A;  1YI2 F;  2VAW A;  4TV9 B;  3VYU C;  3ON1 A;  3FD6 A;  3KIZ A;  3S06 A;  2UYK A;  1YIT F;  4ZOL A;  2Z01 A;  3WPX A;  2P6Y A;  3F0G A;  3UT5 B;  4G4Y A;  3JAS A;  1QD9 A;  2HS0 A;  4O4H A;  5HXU A;  4C8G A;  3WJR A;  3CYQ A;  2UYN A;  4C82 A;  1JY8 A;  3G4S F;  1CK2 A;  4G4V A;  2BTU A;  5EYP A;  3N4Y A;  3JAW A;  4EI7 A;  3U0O A;  1W5E A;  3WGN A;  2WAL A;  4BT4 A;  4ZHV A;  1X52 A;  4X3M A;  1U3P A;  4C81 A;  3C9T A;  4IHJ A;  3L7Q A;  3LFO A;  2VGM A;  5FNV B;  1QVF F;  5JH7 B;  2RHL A;  3HJW C;  5EIB D;  5LOV B;  2UYJ A;  3C9U A;  3OBY A;  4LNU A;  3CCU F;  1JD1 A;  2MQE A;  1U40 A;  3MCQ A;  2I6D A;  3P0Z A;  4C8I A;  1Q82 H;  2Z1F A;  3P10 A;  5J2U A;  4BY9 D;  2KG4 A;  1W42 A;  3CCV F;  1VH8 A;  4O2B B;  2EWC A;  5J2T A;  4BT7 A;  3GYQ A;  3CCQ F;  4C4W C; 
#chains in the Genus database with same CATH homology
 1KQS F;  3CCE F;  1W3E X;  3E20 B;  5GIP C;  3LWP C;  4EI9 A;  3CCM F;  1VQM F;  2QI2 A;  1T0K B;  4X3L A;  1Q86 H;  5IT9 M;  5FLX M;  5GAP K;  3J81 M;  2CZW A;  3G6E F;  3I56 F;  1H7M A;  1VQ5 F;  3LWV C;  1RA4 A;  5GIN C;  5GAN K;  3LWR C;  5EO3 A;  1ZWZ A;  5FJ4 C;  3RA5 A;  2VGN A;  5HWE A;  1VQL F;  3VI6 A;  1VQO F;  3V7Q A;  1VQ7 F;  1VQP F;  3NK6 A;  1RLG A;  3CCL F;  4EI8 A;  3V3T A;  1W41 A;  1IPA A;  3LWQ C;  1N8R H;  3VMF B;  1W2B F;  1W40 A;  1YJ9 F;  4LCK A;  1Q7Y H;  3J7A R;  3CC7 F;  2FGY A;  1K9M H;  5HY4 A;  4BVS A;  2QA4 F;  4TZZ A;  1DT9 A;  3WXM B;  4BW0 B;  5DCV A;  2OHW A;  1PXW A;  3I55 F;  1Q81 H;  3NK7 A;  5HY0 A;  3CME F;  2AIF A;  1YI2 F;  1K8A H;  1X7P A;  3J80 M;  5HY1 A;  1SDS A;  1YHQ F;  1NJI H;  3ON1 A;  2GLZ A;  1GZ0 A;  1VQK F;  3FFM A;  5A2Q M;  1GO0 A;  5HXZ A;  2F9Z C;  1YIT F;  2OTJ F;  5EWR A;  4BVQ A;  5G4V C;  3SIV A;  3OBW A;  3CPW F;  2HVY D;  2OZB A;  2FC3 A;  3CC4 F;  1S72 F;  1KC8 H;  1K73 H;  1JJ2 F;  3D00 A;  3HAX D;  1CN7 A;  5HXU A;  5GIO C;  4XCQ A;  3G71 F;  3G4S F;  3MCA B;  1VQ9 F;  1CK2 A;  2LBX A;  2BO1 A;  3N4Y A;  4NQ3 A;  3JAM M;  3CC2 F;  4EI7 A;  3CMA F;  3JCM M;  2WAL A;  5HY2 A;  1X52 A;  4X3M A;  2ALE A;  1VQN F;  3SIU A;  3CD6 F;  1YIJ F;  1KD1 H;  3LWO C;  3CXC F;  1VQ4 F;  3CCS F;  5G4U C;  3LFO A;  2VGM A;  1GO1 A;  4BVR A;  1YJN F;  2KTV A;  1QVF F;  3HJW C;  3CCR F;  3PLA C;  1M1K H;  2LBW A;  4NUT A;  2KTU A;  3NVK E;  3AGK A;  3NMU C;  3E1Y A;  3OBY A;  1NMU B;  2QEX F;  3CCU F;  3O85 A;  3NVI B;  1VQ8 F;  1M90 H;  3OW2 F;  1YJW F;  2I6D A;  1Q82 H;  3CPQ A;  3RA6 A;  3IR9 A;  4BY9 D;  2KG4 A;  3CG6 A;  1W42 A;  4BVT A;  3CCV F;  3CCJ F;  3PAF A;  1E7K A;  1VQ6 F;  1QVG F;  3V7E A;  1X7O A;  3GYQ A;  3CCQ F;  2JNB A;  3N4Z A;  2OTL F;  1XBI A;  4C4W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...