2KTUA

Human erf1 c-domain, "closed" conformer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
164
structure length
164
Chain Sequence
NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title NMR assignments of the C-terminal domain of human polypeptide release factor eRF1.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktuA00
3NK7A 3SIUA 3JCMM 3LWQC 1VQKF 1X7PA 1PXWA 2LBWA 1H7MA 3NK6A 2HVYD 3O85A 1Q86H 1QVGF 1SDSA 2AIFA 2VGMA 3HAXD 1CN7A 1RA4A 5A2QM 1GO0A 3CCEF 1VQOF 1YI2F 2QI2A 5GIPC 4LCKA 1VQ4F 2QA4F 5IT9M 3FFMA 3NVIB 1CK2A 3E20B 3J80M 3I56F 4X3LA 3CCSF 1W41A 5G4VC 2WALA 2QEXF 4BY9D 3CCMF 3E1YA 3CMEF 1W42A 3N4ZA 4BW0B 3V7QA 1W3EX 1VQ8F 1VQPF 4C4WC 2JNBA 5FLXM 3CC7F 1YIJF 3IR9A 3V7EA 1VQLF 2KG4A 3G6EF 3RA5A 4X3MA 2VGNA 3CC2F 3CPQA 3I55F 2OZBA 1YJ9F 1E7KA 3VI6A 1YJWF 1N8RH 3J7AR 5EO3A 1KQSF 3SIVA 1KD1H 5GINC 1VQ9F 3J81M 1K9MH 1RLGA 1XBIA 1GO1A 1W2BF 3CCRF 1KC8H 3CC4F 5GIOC 3NMUC 3WXMB 1NJIH 3LWOC 3LWPC 1K8AH 3GYQA 2LBXA 3CMAF 1QVFF 5GANK 1NMUB 3CPWF 3OBWA 3LWRC 3CCLF 2OTLF 3G71F 1W40A 1Q7YH 2ALEA 3PAFA 5EWRA 3CCVF 3HJWC 2I6DA 4TZZA 1YITF 3CCUF 3JAMM 1GZ0A 1ZWZA 3CG6A 3AGKA 5GAPK 1VQ6F 1VQNF 2CZWA 1VQ5F 3ON1A 5DCVA 2KTVA 1JJ2F 1YJNF 1Q82H 3CCQF 2OTJF 3RA6A 1T0KB 3PLAC 1X52A 3OBYA 2BO1A 5FJ4C 5G4UC 3LFOA 2FC3A 3CD6F 1IPAA 3OW2F 1S72F 3MCAB 4NUTA 1YHQF 1M1KH 3N4YA 1VQ7F 1VQMF 1M90H 3CCJF 1Q81H 3CXCF 3G4SF 2OHWA 3LWVC 3VMFB 1DT9A 1K73H 1X7OA 2KTUA 3NVKE
chains in the Genus database with same CATH superfamily
3NK7A 4C8EA 2RHOA 3MQWA 3JCMM 4ZHQA 4X20B 2MQEA 3S03A 4BT3A 3FBAA 3R0PA 5IJ9A 3TD5A 1VK3A 1RA4A 2Z1TA 2F9ZC 3CCEF 3JAKB 1W5BA 1YI2F 3WJRA 1DBFA 3HKEA 5GIPC 4O4HA 3HKBB 4U39A 3KJKA 3CB2A 3MCQA 2RHHA 3NVIB 2ZVZA 2HS4A 3J80M 5ITZB 1Z5WA 2I6RA 2QEXF 2CSLA 5MN4A 1FNKA 4F6RA 3RYFA 1FFXA 3N4ZA 4DXDA 1VQ8F 1Q8RA 5IYZB 3E22B 2JNBA 3N2GA 2PHNA 1COMA 2KG4A 5BMVA 3WGJA 4C81A 4X3MA 4ZHWA 1SZQA 3I55F 1YJWF 4IHJA 1FSZA 2NMUA 5EO3A 3L7QA 4C8IA 1X25A 4X1KA 1RQ2A 3HWUA 1VQ9F 4O2AB 4E6EA 4I50A 3IKEA 2HRUA 1W2BF 3CCRF 2HP0A 4RQOA 4ERHA 5J2TB 5LA6A 3WXMB 4BVTA 3LWOC 3VYSC 3F0DA 3VCZA 1K8AH 4WBNA 3CMAF 3C9UA 1T0AA 3ZO8A 1YQNA 2P6YA 5EYPB 2EWCA 4ZHVA 1W40A 1YGYA 1IV4A 3HTNA 3Q8HA 3PAFA 5EWRA 5GONB 3HKCA 5HY4A 3HJWC 3CYQA 3DDNA 4EB6A 2I6DA 1SA0A 1JFFB 2HX0A 2AIZP 3M84A 5CA0B 3C9RA 2Z01A 2PMPA 3I7TA 3AGKA 3WGMA 1R1MA 4I55B 1TUBB 4ZK7A 3F0FA 5J2UB 5LYJB 2OTJF 5MN5A 2YXZA 2W8BC 4YJ2B 1X52A 5LXTA 5G4UC 1IV2A 4NUTA 3N4YA 1PF5A 3CCJF 1Q81H 3CXCF 2HS0A 3S0YA 4LNUA 3FD5A 3VMFB 3WGLA 2CHTA 3F6MA 4EI7A 1X7OA 1K73H 1W59A 4O4IA 4U3JA 5EB1B 5MN6A 3N2KA 4FFBB 3SIUA 1X7PA 4C8GA 5CA1A 2V9YA 3RYIB 5HY1A 2VAPA 3C8LA 4BT4A 5EIBD 3OONA 2HVYD 4G4WA 2FGYA 3VO8A 2BTQB 1W55A 1QVGF 3HAXD 5JQGA 1QU9A 3RYCA 2GLZA 4G4ZA 4B45A 3ZP7A 4TV8A 4DRXB 1TVKB 2DYYA 3S06A 2Q1XA 3I56F 4ZHQB 5HP8A 2RB9A 3HKDA 1W42A 4G4YA 3U0OA 1OFUA 4BW0B 5IJ9B 5HY0A 1ONIA 3V7EA 3VTIC 3WJPA 3HKEB 4O4HB 1W5FA 3MBMA 2Z1UA 3CC2F 1W5EA 2Q1YA 1E7KA 3WJQA 4B5CA 1XV2A 2VAMA 4IIJA 1KD1H 3F0GA 5IJ0A 3JARB 4YJ3A 4F6RB 1KC8H 2N48A 4TUYA 4TV9A 4BVRA 5HP7A 1FFXB 2RHLA 3EORA 5HXZA 1NJIH 2ZAUA 3LWPC 1GX1A 3N2GB 2LBXA 1QVFF 1NMUB 5BMVB 3CPWF 3OBWA 3CCLF 1UFYA 4HNAA 3JASA 2DT4A 3JALA 2ALEA 4IHJB 3I3FA 4TZZA 4X1KB 5KX5A 1YITF 4I4TA 3VYTC 3ZOPA 4I50B 3UT5A 2HP0B 2LBTA 3P4EA 4B46A 1ODEA 5LA6B 1VQ5F 1U40A 1W57A 3ON1A 5JCOC 3B6NA 3LMEA 1Q82H 4WBNB 5LP6A 4O4JB 3E22A 2UYPA 3IMPA 3LFOA 2FC3A 3CD6F 1JN1A 1IPAA 4NWOB 2Z1FA 4ZHYB 3JATB 1VQ7F 3WPWA 3ELCA 3HKCB 3K12A 1VQMF 1M90H 3S0WA 4EB6B 3G4SF 1SA0B 2HRYA 1IV3A 2GZLA 2RHJA 2BTOA 4ZI7B 2BTUA 3LWQC 1VQKF 4O4LA 4PWTA 2LBWA 1KNKA 3TD4A 2ZOVA 1H7MA 1U43A 1VQVA 1Z5VA 3NK6A 5LXTB 3CYPB 1IV1A 3O85A 1Q86H 1SDSA 2CHSA 2VGMA 2H8EA 1GO0A 3M1XA 2QI2A 2R6R1 4LNUB 5GONA 4LCKA 3VOBA 3FFMA 3RYHB 5JVDA 2VXYA 4X1IA 1CK2A 4O4IB 4U3JB 3E20B 4NQ3A 3N2KB 2ZVYA 1W41A 4X1YA 5CA1B 2WALA 5G4VC 3C9TA 3DC2A 3CCMF 5FNVB 2UZHA 2ZF8A 3CMEF 5HWEA 3ZP4A 5LYJA 3JVHA 4BT7A 1CLIA 4ZOLA 1VQPF 1U3LA 4C82A 2K1SA 2UYNA 3C9SA 3CC7F 3F0EA 1YIJF 5JQGB 3KE1A 3RA5A 1RQ7A 5EZYB 1JD1A 2G9IA 2VGNA 4O2BA 3RYCB 3CPQA 3VOAA 3P10A 5LOVA 1YJ9F 1KQSF 3SIVA 2HP3A 5C8YB 1FNJA 5GINC 1JY8A 5CB4A 3KHNA 1K9MH 4B62A 1XBIA 3T80A 5JH7A 1GO1A 4FFBA 3HKDB 3NMUC 5KMGA 3JAWA 5GANK 3WPXA 3LWRC 2H8CA 2OTLF 3G71F 1VH8A 4BT5A 1OAPA 4G4VA 4IIJB 3CCUF 3JAMM 4RHAA 1GZ0A 1ZWZA 3CG6A 1NQ3A 5IJ0B 4YJ3B 5GAPK 3VYUC 4BT2A 1VQNF 4TUYB 2CZWA 4TV9B 3RYFB 4M8IA 3S02A 4X20A 2CW4A 3IKFA 3CCQF 3RA6A 1T0KB 3QUWA 3S0HA 3ERNA 2UYJA 2BO1A 3WGNA 3GTZA 3TD3A 4HNAB 3JASB 1S72F 1XRGA 3BYQA 3JAKA 3JALB 4R40B 3IEQA 3FPIA 4BVQA 2OTMA 3HKBA 5KX5B 2OHWA 2LCAA 4I4TB 3RE3A 1DT9A 3UT5B 4XCQA 2KTUA 5ITZA 3NVKE 3JARA 3M4SA 1PXWA 2R751 1KNJA 2AMTA 5EIBC 5LP6B 1CN7A 2AIFA 2VAWA 5IYZA 5A2QM 2GVIA 3KIZA 1VQOF 3WGKA 1QAHA 1VQ4F 2QA4F 5IT9M 3FD6A 5HXUA 1U3PA 3GHZA 1UI9A 4X3LA 4O2AA 3CCSF 4BY9D 3K0TA 4O4LB 3E1YA 1RLUA 4BT6A 3VIUA 5J2TA 3V4DA 1W581 3V7QA 1W3EX 1W5AA 3ESJA 3K2XA 4C4WC 4O4JA 5FLXM 3IR9A 1VQLF 3MDOA 5AVMA 4EI8A 3G6EF 5EYPA 3JATA 2CWJA 1J7HA 5JVDB 3K14A 2OZBA 2KGWA 5EB0A 4X1IB 3V3TA 3VI6A 1N8RH 3J7AR 2CVLA 2IG8A 2L26A 1JFFA 3J81M 1H47A 5CA0A 4X1YB 1RLGA 4ZI7A 3CC4F 5GIOC 2HQSC 4I55A 4BVSA 1TUBA 4G4XA 3KJJA 2H6LA 2HS3A 4ZOLB 5J2UA 3GYQA 2ZODA 2UYNB 3QHDA 4YJ2A 5HY2A 2UYKA 4O2BB 5LOVB 1Q7YH 3D01A 3CCVF 1QD9A 3RYHA 2Z1EA 3LDTA 4G88A 2IQQA 4TV8B 1H48A 5CB4B 5JH7B 1VQ6F 5JCOA 4EI9A 5KMGB 3JAWB 5DCVA 2KTVA 5FNVA 1JJ2F 1YJNF 2B33A 3RYIA 5EAZA 3PLAC 2IAFA 3OBYA 5B8FA 5FJ4C 3LYBA 5LP6C 3OW2F 1M1KH 3MCAB 1YHQF 5EZYA 2QTPA 3D54A 3D00A 3IEWA 1XHOA 2YYEA 1VHAA 3P0ZA 3LWVC 3QTYA 5C8YA 4KWEA 4DRXA 1TVKA
chains in the Genus database with same CATH topology
3NK7A 3SIUA 3JCMM 3LWQC 1VQKF 1X7PA 1PXWA 2LBWA 5HY1A 1H7MA 3NK6A 2HVYD 2FGYA 3O85A 1Q86H 1QVGF 1SDSA 2AIFA 2VGMA 3HAXD 1CN7A 1RA4A 5A2QM 1GO0A 2F9ZC 3CCEF 1VQOF 1YI2F 2QI2A 5GIPC 4LCKA 1VQ4F 2QA4F 5IT9M 3FFMA 2GLZA 3NVIB 1CK2A 5HXUA 3E20B 4NQ3A 3J80M 3I56F 4X3LA 3CCSF 1W41A 5G4VC 2WALA 2QEXF 4BY9D 3CCMF 3E1YA 3CMEF 5HWEA 1W42A 3N4ZA 4BW0B 3V7QA 1W3EX 1VQ8F 1VQPF 5HY0A 4C4WC 2JNBA 5FLXM 3CC7F 1YIJF 3IR9A 3V7EA 1VQLF 2KG4A 4EI8A 3G6EF 3RA5A 4X3MA 2VGNA 3CC2F 3CPQA 3I55F 2OZBA 1YJ9F 1E7KA 3V3TA 3VI6A 1YJWF 1N8RH 3J7AR 5EO3A 1KQSF 3SIVA 1KD1H 5GINC 1VQ9F 3J81M 1K9MH 1RLGA 1XBIA 1GO1A 1W2BF 3CCRF 1KC8H 4BVRA 5GIOC 3CC4F 3NMUC 4BVSA 3WXMB 4BVTA 5HXZA 3LWOC 1NJIH 3LWPC 1K8AH 3GYQA 2LBXA 3CMAF 1QVFF 5GANK 1NMUB 5HY2A 3CPWF 3OBWA 3LWRC 3CCLF 2OTLF 3G71F 1W40A 5HY4A 1Q7YH 2ALEA 3PAFA 5EWRA 3CCVF 3HJWC 2I6DA 4TZZA 1YITF 3CCUF 3JAMM 1GZ0A 1ZWZA 3CG6A 3AGKA 5GAPK 1VQ6F 1VQNF 4EI9A 2CZWA 1VQ5F 3ON1A 5DCVA 2KTVA 1JJ2F 1YJNF 1Q82H 3CCQF 2OTJF 3RA6A 1T0KB 3PLAC 1X52A 3OBYA 2BO1A 5FJ4C 5G4UC 3LFOA 2FC3A 3CD6F 1IPAA 3OW2F 1S72F 3MCAB 4NUTA 1YHQF 1M1KH 3N4YA 1VQ7F 1VQMF 1M90H 3CCJF 1Q81H 3D00A 3CXCF 3G4SF 4BVQA 2OHWA 3LWVC 3VMFB 1DT9A 4EI7A 1K73H 1X7OA 4XCQA 2KTUA 3NVKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK7 A;  3SIU A;  3JCM M;  3LWQ C;  1VQK F;  1X7P A;  1PXW A;  2LBW A;  1H7M A;  3NK6 A;  2HVY D;  3O85 A;  1Q86 H;  1QVG F;  1SDS A;  2AIF A;  2VGM A;  3HAX D;  1CN7 A;  1RA4 A;  5A2Q M;  1GO0 A;  3CCE F;  1VQO F;  1YI2 F;  2QI2 A;  5GIP C;  4LCK A;  1VQ4 F;  2QA4 F;  5IT9 M;  3FFM A;  3NVI B;  1CK2 A;  3E20 B;  3J80 M;  3I56 F;  4X3L A;  3CCS F;  1W41 A;  5G4V C;  2WAL A;  2QEX F;  4BY9 D;  3CCM F;  3E1Y A;  3CME F;  1W42 A;  3N4Z A;  4BW0 B;  3V7Q A;  1W3E X;  1VQ8 F;  1VQP F;  4C4W C;  2JNB A;  5FLX M;  3CC7 F;  1YIJ F;  3IR9 A;  3V7E A;  1VQL F;  2KG4 A;  3G6E F;  3RA5 A;  4X3M A;  2VGN A;  3CC2 F;  3CPQ A;  3I55 F;  2OZB A;  1YJ9 F;  1E7K A;  3VI6 A;  1YJW F;  1N8R H;  3J7A R;  5EO3 A;  1KQS F;  3SIV A;  1KD1 H;  5GIN C;  1VQ9 F;  3J81 M;  1K9M H;  1RLG A;  1XBI A;  1GO1 A;  1W2B F;  3CCR F;  1KC8 H;  3CC4 F;  5GIO C;  3NMU C;  3WXM B;  1NJI H;  3LWO C;  3LWP C;  1K8A H;  3GYQ A;  2LBX A;  3CMA F;  1QVF F;  5GAN K;  1NMU B;  3CPW F;  3OBW A;  3LWR C;  3CCL F;  2OTL F;  3G71 F;  1W40 A;  1Q7Y H;  2ALE A;  3PAF A;  5EWR A;  3CCV F;  3HJW C;  2I6D A;  4TZZ A;  1YIT F;  3CCU F;  3JAM M;  1GZ0 A;  1ZWZ A;  3CG6 A;  3AGK A;  5GAP K;  1VQ6 F;  1VQN F;  2CZW A;  1VQ5 F;  3ON1 A;  5DCV A;  2KTV A;  1JJ2 F;  1YJN F;  1Q82 H;  3CCQ F;  2OTJ F;  3RA6 A;  1T0K B;  3PLA C;  1X52 A;  3OBY A;  2BO1 A;  5FJ4 C;  5G4U C;  3LFO A;  2FC3 A;  3CD6 F;  1IPA A;  3OW2 F;  1S72 F;  3MCA B;  4NUT A;  1YHQ F;  1M1K H;  3N4Y A;  1VQ7 F;  1VQM F;  1M90 H;  3CCJ F;  1Q81 H;  3CXC F;  3G4S F;  2OHW A;  3LWV C;  3VMF B;  1DT9 A;  1K73 H;  1X7O A;  2KTU A;  3NVK E; 
#chains in the Genus database with same CATH topology
 3NK7 A;  4C8E A;  2RHO A;  3MQW A;  3JCM M;  4ZHQ A;  4X20 B;  2MQE A;  3S03 A;  4BT3 A;  3FBA A;  3R0P A;  5IJ9 A;  3TD5 A;  1VK3 A;  1RA4 A;  2Z1T A;  2F9Z C;  3CCE F;  3JAK B;  1W5B A;  1YI2 F;  3WJR A;  1DBF A;  3HKE A;  5GIP C;  4O4H A;  3HKB B;  4U39 A;  3KJK A;  3CB2 A;  3MCQ A;  2RHH A;  3NVI B;  2ZVZ A;  2HS4 A;  3J80 M;  5ITZ B;  1Z5W A;  2I6R A;  2QEX F;  2CSL A;  5MN4 A;  1FNK A;  4F6R A;  3RYF A;  1FFX A;  3N4Z A;  4DXD A;  1VQ8 F;  1Q8R A;  5IYZ B;  3E22 B;  2JNB A;  3N2G A;  2PHN A;  1COM A;  2KG4 A;  5BMV A;  3WGJ A;  4C81 A;  4X3M A;  4ZHW A;  1SZQ A;  3I55 F;  1YJW F;  4IHJ A;  1FSZ A;  2NMU A;  5EO3 A;  3L7Q A;  4C8I A;  1X25 A;  4X1K A;  1RQ2 A;  3HWU A;  1VQ9 F;  4O2A B;  4E6E A;  4I50 A;  3IKE A;  2HRU A;  1W2B F;  3CCR F;  2HP0 A;  4RQO A;  4ERH A;  5J2T B;  5LA6 A;  3WXM B;  4BVT A;  3LWO C;  3VYS C;  3F0D A;  3VCZ A;  1K8A H;  4WBN A;  3CMA F;  3C9U A;  1T0A A;  3ZO8 A;  1YQN A;  2P6Y A;  5EYP B;  2EWC A;  4ZHV A;  1W40 A;  1YGY A;  1IV4 A;  3HTN A;  3Q8H A;  3PAF A;  5EWR A;  5GON B;  3HKC A;  5HY4 A;  3HJW C;  3CYQ A;  3DDN A;  4EB6 A;  2I6D A;  1SA0 A;  1JFF B;  2HX0 A;  2AIZ P;  3M84 A;  5CA0 B;  3C9R A;  2Z01 A;  2PMP A;  3I7T A;  3AGK A;  3WGM A;  1R1M A;  4I55 B;  1TUB B;  4ZK7 A;  3F0F A;  5J2U B;  5LYJ B;  2OTJ F;  5MN5 A;  2YXZ A;  2W8B C;  4YJ2 B;  1X52 A;  5LXT A;  5G4U C;  1IV2 A;  4NUT A;  3N4Y A;  1PF5 A;  3CCJ F;  1Q81 H;  3CXC F;  2HS0 A;  3S0Y A;  4LNU A;  3FD5 A;  3VMF B;  3WGL A;  2CHT A;  3F6M A;  4EI7 A;  1X7O A;  1K73 H;  1W59 A;  4O4I A;  4U3J A;  5EB1 B;  5MN6 A;  3N2K A;  4FFB B;  3SIU A;  1X7P A;  4C8G A;  5CA1 A;  2V9Y A;  3RYI B;  5HY1 A;  2VAP A;  3C8L A;  4BT4 A;  5EIB D;  3OON A;  2HVY D;  4G4W A;  2FGY A;  3VO8 A;  2BTQ B;  1W55 A;  1QVG F;  3HAX D;  5JQG A;  1QU9 A;  3RYC A;  2GLZ A;  4G4Z A;  4B45 A;  3ZP7 A;  4TV8 A;  4DRX B;  1TVK B;  2DYY A;  3S06 A;  2Q1X A;  3I56 F;  4ZHQ B;  5HP8 A;  2RB9 A;  3HKD A;  1W42 A;  4G4Y A;  3U0O A;  1OFU A;  4BW0 B;  5IJ9 B;  5HY0 A;  1ONI A;  3V7E A;  3VTI C;  3WJP A;  3HKE B;  4O4H B;  1W5F A;  3MBM A;  2Z1U A;  3CC2 F;  1W5E A;  2Q1Y A;  1E7K A;  3WJQ A;  4B5C A;  1XV2 A;  2VAM A;  4IIJ A;  1KD1 H;  3F0G A;  5IJ0 A;  3JAR B;  4YJ3 A;  4F6R B;  1KC8 H;  2N48 A;  4TUY A;  4TV9 A;  4BVR A;  5HP7 A;  1FFX B;  2RHL A;  3EOR A;  5HXZ A;  1NJI H;  2ZAU A;  3LWP C;  1GX1 A;  3N2G B;  2LBX A;  1QVF F;  1NMU B;  5BMV B;  3CPW F;  3OBW A;  3CCL F;  1UFY A;  4HNA A;  3JAS A;  2DT4 A;  3JAL A;  2ALE A;  4IHJ B;  3I3F A;  4TZZ A;  4X1K B;  5KX5 A;  1YIT F;  4I4T A;  3VYT C;  3ZOP A;  4I50 B;  3UT5 A;  2HP0 B;  2LBT A;  3P4E A;  4B46 A;  1ODE A;  5LA6 B;  1VQ5 F;  1U40 A;  1W57 A;  3ON1 A;  5JCO C;  3B6N A;  3LME A;  1Q82 H;  4WBN B;  5LP6 A;  4O4J B;  3E22 A;  2UYP A;  3IMP A;  3LFO A;  2FC3 A;  3CD6 F;  1JN1 A;  1IPA A;  4NWO B;  2Z1F A;  4ZHY B;  3JAT B;  1VQ7 F;  3WPW A;  3ELC A;  3HKC B;  3K12 A;  1VQM F;  1M90 H;  3S0W A;  4EB6 B;  3G4S F;  1SA0 B;  2HRY A;  1IV3 A;  2GZL A;  2RHJ A;  2BTO A;  4ZI7 B;  2BTU A;  3LWQ C;  1VQK F;  4O4L A;  4PWT A;  2LBW A;  1KNK A;  3TD4 A;  2ZOV A;  1H7M A;  1U43 A;  1VQV A;  1Z5V A;  3NK6 A;  5LXT B;  3CYP B;  1IV1 A;  3O85 A;  1Q86 H;  1SDS A;  2CHS A;  2VGM A;  2H8E A;  1GO0 A;  3M1X A;  2QI2 A;  2R6R 1;  4LNU B;  5GON A;  4LCK A;  3VOB A;  3FFM A;  3RYH B;  5JVD A;  2VXY A;  4X1I A;  1CK2 A;  4O4I B;  4U3J B;  3E20 B;  4NQ3 A;  3N2K B;  2ZVY A;  1W41 A;  4X1Y A;  5CA1 B;  2WAL A;  5G4V C;  3C9T A;  3DC2 A;  3CCM F;  5FNV B;  2UZH A;  2ZF8 A;  3CME F;  5HWE A;  3ZP4 A;  5LYJ A;  3JVH A;  4BT7 A;  1CLI A;  4ZOL A;  1VQP F;  1U3L A;  4C82 A;  2K1S A;  2UYN A;  3C9S A;  3CC7 F;  3F0E A;  1YIJ F;  5JQG B;  3KE1 A;  3RA5 A;  1RQ7 A;  5EZY B;  1JD1 A;  2G9I A;  2VGN A;  4O2B A;  3RYC B;  3CPQ A;  3VOA A;  3P10 A;  5LOV A;  1YJ9 F;  1KQS F;  3SIV A;  2HP3 A;  5C8Y B;  1FNJ A;  5GIN C;  1JY8 A;  5CB4 A;  3KHN A;  1K9M H;  4B62 A;  1XBI A;  3T80 A;  5JH7 A;  1GO1 A;  4FFB A;  3HKD B;  3NMU C;  5KMG A;  3JAW A;  5GAN K;  3WPX A;  3LWR C;  2H8C A;  2OTL F;  3G71 F;  1VH8 A;  4BT5 A;  1OAP A;  4G4V A;  4IIJ B;  3CCU F;  3JAM M;  4RHA A;  1GZ0 A;  1ZWZ A;  3CG6 A;  1NQ3 A;  5IJ0 B;  4YJ3 B;  5GAP K;  3VYU C;  4BT2 A;  1VQN F;  4TUY B;  2CZW A;  4TV9 B;  3RYF B;  4M8I A;  3S02 A;  4X20 A;  2CW4 A;  3IKF A;  3CCQ F;  3RA6 A;  1T0K B;  3QUW A;  3S0H A;  3ERN A;  2UYJ A;  2BO1 A;  3WGN A;  3GTZ A;  3TD3 A;  4HNA B;  3JAS B;  1S72 F;  1XRG A;  3BYQ A;  3JAK A;  3JAL B;  4R40 B;  3IEQ A;  3FPI A;  4BVQ A;  2OTM A;  3HKB A;  5KX5 B;  2OHW A;  2LCA A;  4I4T B;  3RE3 A;  1DT9 A;  3UT5 B;  4XCQ A;  2KTU A;  5ITZ A;  3NVK E;  3JAR A;  3M4S A;  1PXW A;  2R75 1;  1KNJ A;  2AMT A;  5EIB C;  5LP6 B;  1CN7 A;  2AIF A;  2VAW A;  5IYZ A;  5A2Q M;  2GVI A;  3KIZ A;  1VQO F;  3WGK A;  1QAH A;  1VQ4 F;  2QA4 F;  5IT9 M;  3FD6 A;  5HXU A;  1U3P A;  3GHZ A;  1UI9 A;  4X3L A;  4O2A A;  3CCS F;  4BY9 D;  3K0T A;  4O4L B;  3E1Y A;  1RLU A;  4BT6 A;  3VIU A;  5J2T A;  3V4D A;  1W58 1;  3V7Q A;  1W3E X;  1W5A A;  3ESJ A;  3K2X A;  4C4W C;  4O4J A;  5FLX M;  3IR9 A;  1VQL F;  3MDO A;  5AVM A;  4EI8 A;  3G6E F;  5EYP A;  3JAT A;  2CWJ A;  1J7H A;  5JVD B;  3K14 A;  2OZB A;  2KGW A;  5EB0 A;  4X1I B;  3V3T A;  3VI6 A;  1N8R H;  3J7A R;  2CVL A;  2IG8 A;  2L26 A;  1JFF A;  3J81 M;  1H47 A;  5CA0 A;  4X1Y B;  1RLG A;  4ZI7 A;  3CC4 F;  5GIO C;  2HQS C;  4I55 A;  4BVS A;  1TUB A;  4G4X A;  3KJJ A;  2H6L A;  2HS3 A;  4ZOL B;  5J2U A;  3GYQ A;  2ZOD A;  2UYN B;  3QHD A;  4YJ2 A;  5HY2 A;  2UYK A;  4O2B B;  5LOV B;  1Q7Y H;  3D01 A;  3CCV F;  1QD9 A;  3RYH A;  2Z1E A;  3LDT A;  4G88 A;  2IQQ A;  4TV8 B;  1H48 A;  5CB4 B;  5JH7 B;  1VQ6 F;  5JCO A;  4EI9 A;  5KMG B;  3JAW B;  5DCV A;  2KTV A;  5FNV A;  1JJ2 F;  1YJN F;  2B33 A;  3RYI A;  5EAZ A;  3PLA C;  2IAF A;  3OBY A;  5B8F A;  5FJ4 C;  3LYB A;  5LP6 C;  3OW2 F;  1M1K H;  3MCA B;  1YHQ F;  5EZY A;  2QTP A;  3D54 A;  3D00 A;  3IEW A;  1XHO A;  2YYE A;  1VHA A;  3P0Z A;  3LWV C;  3QTY A;  5C8Y A;  4KWE A;  4DRX A;  1TVK A; 
#chains in the Genus database with same CATH homology
 3NK7 A;  3SIU A;  3JCM M;  3LWQ C;  1VQK F;  1X7P A;  1PXW A;  2LBW A;  5HY1 A;  1H7M A;  3NK6 A;  2HVY D;  2FGY A;  3O85 A;  1Q86 H;  1QVG F;  1SDS A;  2AIF A;  2VGM A;  3HAX D;  1CN7 A;  1RA4 A;  5A2Q M;  1GO0 A;  2F9Z C;  3CCE F;  1VQO F;  1YI2 F;  2QI2 A;  5GIP C;  4LCK A;  1VQ4 F;  2QA4 F;  5IT9 M;  3FFM A;  2GLZ A;  3NVI B;  1CK2 A;  5HXU A;  3E20 B;  4NQ3 A;  3J80 M;  3I56 F;  4X3L A;  3CCS F;  1W41 A;  5G4V C;  2WAL A;  2QEX F;  4BY9 D;  3CCM F;  3E1Y A;  3CME F;  5HWE A;  1W42 A;  3N4Z A;  4BW0 B;  3V7Q A;  1W3E X;  1VQ8 F;  1VQP F;  5HY0 A;  4C4W C;  2JNB A;  5FLX M;  3CC7 F;  1YIJ F;  3IR9 A;  3V7E A;  1VQL F;  2KG4 A;  4EI8 A;  3G6E F;  3RA5 A;  4X3M A;  2VGN A;  3CC2 F;  3CPQ A;  3I55 F;  2OZB A;  1YJ9 F;  1E7K A;  3V3T A;  3VI6 A;  1YJW F;  1N8R H;  3J7A R;  5EO3 A;  1KQS F;  3SIV A;  1KD1 H;  5GIN C;  1VQ9 F;  3J81 M;  1K9M H;  1RLG A;  1XBI A;  1GO1 A;  1W2B F;  3CCR F;  1KC8 H;  4BVR A;  5GIO C;  3CC4 F;  3NMU C;  4BVS A;  3WXM B;  4BVT A;  5HXZ A;  3LWO C;  1NJI H;  3LWP C;  1K8A H;  3GYQ A;  2LBX A;  3CMA F;  1QVF F;  5GAN K;  1NMU B;  5HY2 A;  3CPW F;  3OBW A;  3LWR C;  3CCL F;  2OTL F;  3G71 F;  1W40 A;  5HY4 A;  1Q7Y H;  2ALE A;  3PAF A;  5EWR A;  3CCV F;  3HJW C;  2I6D A;  4TZZ A;  1YIT F;  3CCU F;  3JAM M;  1GZ0 A;  1ZWZ A;  3CG6 A;  3AGK A;  5GAP K;  1VQ6 F;  1VQN F;  4EI9 A;  2CZW A;  1VQ5 F;  3ON1 A;  5DCV A;  2KTV A;  1JJ2 F;  1YJN F;  1Q82 H;  3CCQ F;  2OTJ F;  3RA6 A;  1T0K B;  3PLA C;  1X52 A;  3OBY A;  2BO1 A;  5FJ4 C;  5G4U C;  3LFO A;  2FC3 A;  3CD6 F;  1IPA A;  3OW2 F;  1S72 F;  3MCA B;  4NUT A;  1YHQ F;  1M1K H;  3N4Y A;  1VQ7 F;  1VQM F;  1M90 H;  3CCJ F;  1Q81 H;  3D00 A;  3CXC F;  3G4S F;  4BVQ A;  2OHW A;  3LWV C;  3VMF B;  1DT9 A;  4EI7 A;  1K73 H;  1X7O A;  4XCQ A;  2KTU A;  3NVK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...