2KTUA

Human erf1 c-domain, "closed" conformer
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
164
structure length
164
Chain Sequence
NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title NMR assignments of the C-terminal domain of human polypeptide release factor eRF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 28
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktuA00
2QEXF 3CCJF 2BO1A 3I55F 3CXCF 1E7KA 1W40A 2VGNA 3V7EA 1YI2F 5GIOC 4BW0B 3JAMM 1Q82H 3LWOC 3LWPC 3OBYA 4LCKA 1Q7YH 3CCLF 3FFMA 3I56F 1ZWZA 1H7MA 3ON1A 1K8AH 3PLAC 3N4ZA 2OHWA 4X3MA 1YITF 3LWRC 1VQOF 1VQMF 1KD1H 1X52A 3NK7A 3G6EF 4C4WC 2I6DA 1XBIA 3E1YA 2OTLF 1KQSF 1W3EX 2VGMA 3O85A 3OBWA 3SIVA 3PAFA 2JNBA 3NVKE 3CC7F 1VQ9F 2OZBA 1Q86H 2CZWA 2KTVA 4BY9D 3CPQA 2QI2A 3NMUC 1VQ5F 1IPAA 2LBXA 4TZZA 3NK6A 3G4SF 3CD6F 3HAXD 5G4UC 5FJ4C 4X3LA 1QVFF 1NJIH 3CCUF 3RA5A 1DT9A 3LFOA 1W42A 3CCVF 2OTJF 1JJ2F 5GANK 1VQ8F 3VI6A 1W41A 1VQ7F 3WXMB 1CN7A 2AIFA 3GYQA 3E20B 3LWQC 5GINC 1YIJF 2KG4A 1VQ4F 1T0KB 5FLXM 3CC2F 1RA4A 1K9MH 3NVIB 5EWRA 5G4VC 1VQ6F 3OW2F 2WALA 3LWVC 5A2QM 2QA4F 1YJ9F 1VQKF 3CPWF 3J80M 3VMFB 3G71F 3JCMM 1X7PA 1QVGF 1M1KH 1K73H 1GO0A 1S72F 3CMEF 1VQNF 1YHQF 1VQPF 2KTUA 1YJNF 3CG6A 1W2BF 1GO1A 1KC8H 5DCVA 2LBWA 1N8RH 3CC4F 3SIUA 3RA6A 5EO3A 3CCQF 1X7OA 1SDSA 3J7AR 5GIPC 3CCEF 1M90H 1PXWA 5IT9M 5GAPK 4NUTA 1YJWF 3CMAF 3CCMF 3IR9A 2ALEA 3HJWC 2HVYD 3MCAB 3J81M 1CK2A 3CCSF 3V7QA 3CCRF 1GZ0A 3N4YA 1NMUB 2FC3A 1Q81H 1VQLF 3AGKA 1RLGA
chains in the Genus database with same CATH superfamily
1PF5A 2UYKA 2Z1EA 5KMGB 5LOVB 1X25A 2VGNA 4ZHVA 3ESJA 3V7EA 3LWPC 2UYPA 5KX5A 2ZAUA 3IKFA 3HKEB 4O2BA 2MQEA 3FFMA 2ZOVA 3N2GB 2HP0B 3QUWA 4DRXB 3I7TA 4F6RB 3K0TA 1VQMF 1VQOF 1JD1A 4FFBA 3E1YA 4TV8B 4IIJB 3OONA 3OBWA 2BTOA 5JH7A 2JNBA 3NVKE 4I55A 3CC7F 3VYUC 5JQGA 2CZWA 2KTVA 4BVQA 4BY9D 3CPQA 1Z5WA 5J2TA 5LA6B 3NMUC 2HP3A 1IPAA 2LBXA 3NK6A 5G4UC 2QTPA 3BYQA 1COMA 3DDNA 5HY0A 5MN6A 2CHTA 5LP6B 1W42A 3CYQA 5HXZA 3C9SA 3KJJA 3VYSC 3CCVF 2R751 1OFUA 3GHZA 3S0YA 2HRYA 5HP7A 3F0FA 4BT3A 4G4VA 3DC2A 4R40B 4RHAA 3HKBB 4IHJB 3VTIC 1T0KB 1JY8A 2BTUA 2H6LA 2HS3A 4G4ZA 5EWRA 3JAWA 2WALA 1T0AA 5AVMA 4EI9A 3M84A 4C8GA 4RQOA 2VAWA 3WPWA 3VMFB 1GO0A 1S72F 3CMEF 4B45A 1DBFA 4ZI7B 3CG6A 1W2BF 3ZO8A 1TUBB 3HKEA 2L26A 3HKDA 3VOBA 1KC8H 1SA0B 1N8RH 3N2GA 3CC4F 3ZOPA 2BTQB 3VYTC 1W57A 2HQSC 3SIUA 2HP0A 3CCQF 3LYBA 4B46A 1M90H 2K1SA 4DRXA 4EI8A 3VO8A 2RHLA 2VAPA 4TV8A 2HVYD 3QHDA 1CK2A 3ZP4A 2UYNB 1FNJA 4HNAB 4PWTA 2Z01A 3ZP7A 1RLGA 5EB1B 2UYJA 1SZQA 3CCJF 3E22B 1W5AA 2BO1A 3CXCF 5C8YA 4BVSA 1E7KA 4NWOB 4BW0B 3VOAA 3OBYA 4WBNA 1Q7YH 5IJ9B 3I56F 1ZWZA 3ON1A 1K8AH 3PLAC 4C82A 3N4ZA 2YYEA 3K14A 3D54A 3V3TA 4O2AB 3WGJA 5LP6A 4C4WC 3MBMA 3JVHA 3JAWB 4KWEA 1RQ7A 2OTLF 4M8IA 2VXYA 5J2UA 1KQSF 5FNVB 2VGMA 4X1IB 3SIVA 3Q8HA 3HKBA 4IHJA 4O4LB 4YJ2B 1VQ9F 3HTNA 4C8EA 2HS4A 4O4JA 3U0OA 1QAHA 1Q8RA 2RHOA 3HKDB 1VQ5F 5EIBD 3VCZA 3G4SF 3JALB 4X3LA 1NJIH 2IG8A 4BVRA 3LFOA 2ZVZA 4ZI7A 3S0WA 1TUBA 2OTJF 1JJ2F 3EORA 3IEWA 1SA0A 1W41A 4EB6B 3F6MA 5HXUA 4E6EA 4I4TB 5EZYA 2AIFA 4TV9B 5LYJB 4X1YB 4G4XA 3MCQA 3NVIB 1VQ4F 1K9MH 1RA4A 2EWCA 5C8YB 5HP8A 3D01A 5G4VC 3P0ZA 1VQ6F 2NMUA 3OW2F 1JN1A 2UYNA 3LWVC 1ONIA 4WBNB 2H8EA 3JATB 2LCAA 4HNAA 3J80M 3D00A 1IV2A 1X7PA 1W5EA 3WGLA 3E22A 3WJPA 1W5BA 1YHQF 3IKEA 2ZODA 1XV2A 2Q1XA 2KTUA 4O4HB 2N48A 1GO1A 5J2UB 5IJ9A 2LBWA 2H8CA 4NQ3A 3JARB 5DCVA 3RYFA 3B6NA 3P4EA 1UFYA 1X7OA 2RB9A 5HWEA 3J7AR 5CA0B 3CCEF 4O2AA 1PXWA 3T80A 4BT6A 5IT9M 4O4JB 4C8IA 5BMVB 3CMAF 2I6RA 2ALEA 2DT4A 2VAMA 3CB2A 3MCAB 3CCSF 3GTZA 1QU9A 5FNVA 4X1IA 5LXTB 3N4YA 3K12A 1Z5VA 4BT5A 1YGYA 3M1XA 3MDOA 3WGNA 4O4LA 4YJ2A 2FC3A 1Q81H 3AGKA 3S03A 1RLUA 3FD6A 5IJ0B 4B62A 2ZVYA 3RE3A 1YI2F 5GIOC 1W581 1W5FA 5EZYB 3FBAA 3JALA 5GONB 5MN5A 1YITF 2PHNA 3G6EF 3C9UA 3NK7A 5HY2A 1XBIA 2Q1YA 5HY4A 4EB6A 4I4TA 1VHAA 2F9ZC 2R6R1 3PAFA 4TV9A 3IMPA 5LYJA 4X1YA 2GVIA 4O4IB 3RYHB 4X20B 2OZBA 1Q86H 1VQVA 3M4SA 2IAFA 4BT7A 4U39A 2G9IA 3JATA 2W8BC 1JFFB 3RYFB 1GX1A 1XRGA 4I50B 4ZHWA 2GZLA 2CVLA 2OTMA 3CCUF 2CWJA 4ZOLB 3KHNA 2HX0A 4O4HA 4G88A 3JARA 1VQ8F 3JASB 5EYPB 1CN7A 3C8LA 3E20B 3LMEA 1UI9A 4G4YA 5CA0A 3RYCB 3LWQC 4LNUA 1W55A 1YIJF 5BMVA 1U3LA 3FD5A 1YQNA 5LXTA 1VK3A 1IV3A 1RQ2A 1YJ9F 1U43A 5B8FA 1IV4A 3G71F 3JCMM 1M1KH 4DXDA 5IJ0A 1K73H 2P6YA 1ODEA 1VQPF 2ZF8A 3TD3A 1YJNF 4EI7A 1VH8A 2AIZP 1W59A 3QTYA 2V9YA 5GONA 1FNKA 1QD9A 3S06A 5EO3A 4ZK7A 5CA1B 5EB0A 5JVDB 5GIPC 5CB4B 1NQ3A 4NUTA 3LDTA 3I3FA 4G4WA 2KGWA 4ZHQB 1KNJA 1CLIA 3J81M 3HKCB 4X1KB 1NMUB 3UT5B 4O4IA 3RYHA 4X20A 1VQLF 2UZHA 1U40A 2QEXF 3I55F 3S0HA 4BT2A 1W40A 3MQWA 1Q82H 3JAMM 1FFXA 3LWOC 1JFFA 4LCKA 2Z1FA 3P10A 3CCLF 4YJ3B 4I50A 1H7MA 4U3JB 2PMPA 4LNUB 5IYZB 2OHWA 1KNKA 1TVKB 3K2XA 4X3MA 3FPIA 4ZOLA 5EAZA 5ITZA 3LWRC 3N2KB 1KD1H 1X52A 2I6DA 2RHJA 3JAKB 3JASA 1W3EX 4TUYB 3O85A 5EYPA 2CHSA 3S02A 3RYCA 3HWUA 3L7QA 4XCQA 2RHHA 2Z1TA 2QI2A 3RYIA 1OAPA 2DYYA 3TD5A 4TZZA 3HAXD 5KX5B 3ELCA 3CD6F 4O2BB 5FJ4C 4B5CA 3WJRA 1QVFF 5EIBC 3CYPB 3RA5A 3ERNA 1DT9A 2HRUA 3WGMA 3VIUA 5KMGA 5LOVA 2LBTA 2Z1UA 3R0PA 4FFBB 5JCOC 5GANK 3WGKA 3VI6A 1VQ7F 1IV1A 3WXMB 3GYQA 5CA1A 5JVDA 2CW4A 5JH7B 1R1MA 4I55B 1XHOA 5CB4A 5GINC 2KG4A 5FLXM 5JQGB 3CC2F 4F6RA 4ZHQA 2IQQA 3F0GA 5J2TB 1FFXB 3IEQA 3HKCA 5A2QM 5HY1A 3KIZA 4X1KA 2QA4F 4IIJA 1FSZA 1VQKF 3CPWF 5LP6C 3UT5A 1H48A 3F0EA 5MN4A 3WPXA 3TD4A 1QVGF 5ITZB 2HS0A 5JCOA 2AMTA 1VQNF 2GLZA 4C81A 5LA6A 4YJ3A 1U3PA 4ZHYB 3V4DA 4U3JA 5IYZA 3RA6A 3F0DA 1SDSA 2FGYA 1TVKA 3KE1A 3WJQA 3N2KA 5GAPK 1YJWF 2CSLA 3RYIB 3CCMF 3IR9A 3JAKA 3HJWC 4ERHA 4BVTA 3V7QA 4TUYA 1GZ0A 3CCRF 3C9TA 4BT4A 2B33A 1J7HA 1H47A 3C9RA 2YXZA 3KJKA
chains in the Genus database with same CATH topology
2QEXF 3CCJF 2BO1A 3I55F 3CXCF 4BVSA 1E7KA 1W40A 2VGNA 3V7EA 1YI2F 5GIOC 4BW0B 3JAMM 1Q82H 3LWOC 3LWPC 3OBYA 4LCKA 1Q7YH 3CCLF 3FFMA 3I56F 1ZWZA 1H7MA 3ON1A 1K8AH 3PLAC 3N4ZA 2OHWA 4X3MA 1YITF 3V3TA 3LWRC 1VQOF 1VQMF 1KD1H 1X52A 3NK7A 3G6EF 4C4WC 2I6DA 5HY2A 1XBIA 3E1YA 2OTLF 5HY4A 1KQSF 1W3EX 2VGMA 3O85A 3OBWA 2F9ZC 3SIVA 3PAFA 2JNBA 3NVKE 3CC7F 1VQ9F 4XCQA 2OZBA 1Q86H 2CZWA 2KTVA 4BVQA 4BY9D 3CPQA 2QI2A 3NMUC 1VQ5F 1IPAA 2LBXA 4TZZA 3NK6A 3G4SF 3CD6F 3HAXD 5G4UC 5FJ4C 4X3LA 5HY0A 1QVFF 1NJIH 3CCUF 3RA5A 1DT9A 4BVRA 3LFOA 1W42A 5HXZA 3CCVF 2OTJF 1JJ2F 5GANK 1VQ8F 3VI6A 1W41A 1VQ7F 5HXUA 3WXMB 1CN7A 2AIFA 3GYQA 3E20B 3LWQC 5GINC 1YIJF 2KG4A 1VQ4F 1T0KB 5FLXM 3CC2F 1RA4A 1K9MH 3NVIB 5EWRA 5G4VC 1VQ6F 3OW2F 2WALA 3LWVC 5A2QM 5HY1A 2QA4F 4EI9A 1YJ9F 1VQKF 3CPWF 3J80M 3D00A 3VMFB 3G71F 3JCMM 1X7PA 1QVGF 1M1KH 1K73H 1GO0A 1S72F 3CMEF 1VQNF 1YHQF 2GLZA 1VQPF 2KTUA 1YJNF 3CG6A 4EI7A 1W2BF 1GO1A 1KC8H 5DCVA 2LBWA 4NQ3A 1N8RH 3CC4F 3SIUA 3RA6A 5EO3A 3CCQF 1X7OA 5HWEA 2FGYA 1SDSA 3J7AR 5GIPC 3CCEF 1M90H 1PXWA 4EI8A 5IT9M 5GAPK 4NUTA 1YJWF 3CMAF 3CCMF 3IR9A 2ALEA 3HJWC 2HVYD 3MCAB 3J81M 1CK2A 4BVTA 3V7QA 3CCRF 1GZ0A 3CCSF 3N4YA 1NMUB 2FC3A 1Q81H 1VQLF 3AGKA 1RLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX F;  3CCJ F;  2BO1 A;  3I55 F;  3CXC F;  1E7K A;  1W40 A;  2VGN A;  3V7E A;  1YI2 F;  5GIO C;  4BW0 B;  3JAM M;  1Q82 H;  3LWO C;  3LWP C;  3OBY A;  4LCK A;  1Q7Y H;  3CCL F;  3FFM A;  3I56 F;  1ZWZ A;  1H7M A;  3ON1 A;  1K8A H;  3PLA C;  3N4Z A;  2OHW A;  4X3M A;  1YIT F;  3LWR C;  1VQO F;  1VQM F;  1KD1 H;  1X52 A;  3NK7 A;  3G6E F;  4C4W C;  2I6D A;  1XBI A;  3E1Y A;  2OTL F;  1KQS F;  1W3E X;  2VGM A;  3O85 A;  3OBW A;  3SIV A;  3PAF A;  2JNB A;  3NVK E;  3CC7 F;  1VQ9 F;  2OZB A;  1Q86 H;  2CZW A;  2KTV A;  4BY9 D;  3CPQ A;  2QI2 A;  3NMU C;  1VQ5 F;  1IPA A;  2LBX A;  4TZZ A;  3NK6 A;  3G4S F;  3CD6 F;  3HAX D;  5G4U C;  5FJ4 C;  4X3L A;  1QVF F;  1NJI H;  3CCU F;  3RA5 A;  1DT9 A;  3LFO A;  1W42 A;  3CCV F;  2OTJ F;  1JJ2 F;  5GAN K;  1VQ8 F;  3VI6 A;  1W41 A;  1VQ7 F;  3WXM B;  1CN7 A;  2AIF A;  3GYQ A;  3E20 B;  3LWQ C;  5GIN C;  1YIJ F;  2KG4 A;  1VQ4 F;  1T0K B;  5FLX M;  3CC2 F;  1RA4 A;  1K9M H;  3NVI B;  5EWR A;  5G4V C;  1VQ6 F;  3OW2 F;  2WAL A;  3LWV C;  5A2Q M;  2QA4 F;  1YJ9 F;  1VQK F;  3CPW F;  3J80 M;  3VMF B;  3G71 F;  3JCM M;  1X7P A;  1QVG F;  1M1K H;  1K73 H;  1GO0 A;  1S72 F;  3CME F;  1VQN F;  1YHQ F;  1VQP F;  2KTU A;  1YJN F;  3CG6 A;  1W2B F;  1GO1 A;  1KC8 H;  5DCV A;  2LBW A;  1N8R H;  3CC4 F;  3SIU A;  3RA6 A;  5EO3 A;  3CCQ F;  1X7O A;  1SDS A;  3J7A R;  5GIP C;  3CCE F;  1M90 H;  1PXW A;  5IT9 M;  5GAP K;  4NUT A;  1YJW F;  3CMA F;  3CCM F;  3IR9 A;  2ALE A;  3HJW C;  2HVY D;  3MCA B;  3J81 M;  1CK2 A;  3CCS F;  3V7Q A;  3CCR F;  1GZ0 A;  3N4Y A;  1NMU B;  2FC3 A;  1Q81 H;  1VQL F;  3AGK A;  1RLG A; 
#chains in the Genus database with same CATH topology
 1PF5 A;  2UYK A;  2Z1E A;  5KMG B;  5LOV B;  1X25 A;  2VGN A;  4ZHV A;  3ESJ A;  3V7E A;  3LWP C;  2UYP A;  5KX5 A;  2ZAU A;  3IKF A;  3HKE B;  4O2B A;  2MQE A;  3FFM A;  2ZOV A;  3N2G B;  2HP0 B;  3QUW A;  4DRX B;  3I7T A;  4F6R B;  3K0T A;  1VQM F;  1VQO F;  1JD1 A;  4FFB A;  3E1Y A;  4TV8 B;  4IIJ B;  3OON A;  3OBW A;  2BTO A;  5JH7 A;  2JNB A;  3NVK E;  4I55 A;  3CC7 F;  3VYU C;  5JQG A;  2CZW A;  2KTV A;  4BVQ A;  4BY9 D;  3CPQ A;  1Z5W A;  5J2T A;  5LA6 B;  3NMU C;  2HP3 A;  1IPA A;  2LBX A;  3NK6 A;  5G4U C;  2QTP A;  3BYQ A;  1COM A;  3DDN A;  5HY0 A;  5MN6 A;  2CHT A;  5LP6 B;  1W42 A;  3CYQ A;  5HXZ A;  3C9S A;  3KJJ A;  3VYS C;  3CCV F;  2R75 1;  1OFU A;  3GHZ A;  3S0Y A;  2HRY A;  5HP7 A;  3F0F A;  4BT3 A;  4G4V A;  3DC2 A;  4R40 B;  4RHA A;  3HKB B;  4IHJ B;  3VTI C;  1T0K B;  1JY8 A;  2BTU A;  2H6L A;  2HS3 A;  4G4Z A;  5EWR A;  3JAW A;  2WAL A;  1T0A A;  5AVM A;  4EI9 A;  3M84 A;  4C8G A;  4RQO A;  2VAW A;  3WPW A;  3VMF B;  1GO0 A;  1S72 F;  3CME F;  4B45 A;  1DBF A;  4ZI7 B;  3CG6 A;  1W2B F;  3ZO8 A;  1TUB B;  3HKE A;  2L26 A;  3HKD A;  3VOB A;  1KC8 H;  1SA0 B;  1N8R H;  3N2G A;  3CC4 F;  3ZOP A;  2BTQ B;  3VYT C;  1W57 A;  2HQS C;  3SIU A;  2HP0 A;  3CCQ F;  3LYB A;  4B46 A;  1M90 H;  2K1S A;  4DRX A;  4EI8 A;  3VO8 A;  2RHL A;  2VAP A;  4TV8 A;  2HVY D;  3QHD A;  1CK2 A;  3ZP4 A;  2UYN B;  1FNJ A;  4HNA B;  4PWT A;  2Z01 A;  3ZP7 A;  1RLG A;  5EB1 B;  2UYJ A;  1SZQ A;  3CCJ F;  3E22 B;  1W5A A;  2BO1 A;  3CXC F;  5C8Y A;  4BVS A;  1E7K A;  4NWO B;  4BW0 B;  3VOA A;  3OBY A;  4WBN A;  1Q7Y H;  5IJ9 B;  3I56 F;  1ZWZ A;  3ON1 A;  1K8A H;  3PLA C;  4C82 A;  3N4Z A;  2YYE A;  3K14 A;  3D54 A;  3V3T A;  4O2A B;  3WGJ A;  5LP6 A;  4C4W C;  3MBM A;  3JVH A;  3JAW B;  4KWE A;  1RQ7 A;  2OTL F;  4M8I A;  2VXY A;  5J2U A;  1KQS F;  5FNV B;  2VGM A;  4X1I B;  3SIV A;  3Q8H A;  3HKB A;  4IHJ A;  4O4L B;  4YJ2 B;  1VQ9 F;  3HTN A;  4C8E A;  2HS4 A;  4O4J A;  3U0O A;  1QAH A;  1Q8R A;  2RHO A;  3HKD B;  1VQ5 F;  5EIB D;  3VCZ A;  3G4S F;  3JAL B;  4X3L A;  1NJI H;  2IG8 A;  4BVR A;  3LFO A;  2ZVZ A;  4ZI7 A;  3S0W A;  1TUB A;  2OTJ F;  1JJ2 F;  3EOR A;  3IEW A;  1SA0 A;  1W41 A;  4EB6 B;  3F6M A;  5HXU A;  4E6E A;  4I4T B;  5EZY A;  2AIF A;  4TV9 B;  5LYJ B;  4X1Y B;  4G4X A;  3MCQ A;  3NVI B;  1VQ4 F;  1K9M H;  1RA4 A;  2EWC A;  5C8Y B;  5HP8 A;  3D01 A;  5G4V C;  3P0Z A;  1VQ6 F;  2NMU A;  3OW2 F;  1JN1 A;  2UYN A;  3LWV C;  1ONI A;  4WBN B;  2H8E A;  3JAT B;  2LCA A;  4HNA A;  3J80 M;  3D00 A;  1IV2 A;  1X7P A;  1W5E A;  3WGL A;  3E22 A;  3WJP A;  1W5B A;  1YHQ F;  3IKE A;  2ZOD A;  1XV2 A;  2Q1X A;  2KTU A;  4O4H B;  2N48 A;  1GO1 A;  5J2U B;  5IJ9 A;  2LBW A;  2H8C A;  4NQ3 A;  3JAR B;  5DCV A;  3RYF A;  3B6N A;  3P4E A;  1UFY A;  1X7O A;  2RB9 A;  5HWE A;  3J7A R;  5CA0 B;  3CCE F;  4O2A A;  1PXW A;  3T80 A;  4BT6 A;  5IT9 M;  4O4J B;  4C8I A;  5BMV B;  3CMA F;  2I6R A;  2ALE A;  2DT4 A;  2VAM A;  3CB2 A;  3MCA B;  3CCS F;  3GTZ A;  1QU9 A;  5FNV A;  4X1I A;  5LXT B;  3N4Y A;  3K12 A;  1Z5V A;  4BT5 A;  1YGY A;  3M1X A;  3MDO A;  3WGN A;  4O4L A;  4YJ2 A;  2FC3 A;  1Q81 H;  3AGK A;  3S03 A;  1RLU A;  3FD6 A;  5IJ0 B;  4B62 A;  2ZVY A;  3RE3 A;  1YI2 F;  5GIO C;  1W58 1;  1W5F A;  5EZY B;  3FBA A;  3JAL A;  5GON B;  5MN5 A;  1YIT F;  2PHN A;  3G6E F;  3C9U A;  3NK7 A;  5HY2 A;  1XBI A;  2Q1Y A;  5HY4 A;  4EB6 A;  4I4T A;  1VHA A;  2F9Z C;  2R6R 1;  3PAF A;  4TV9 A;  3IMP A;  5LYJ A;  4X1Y A;  2GVI A;  4O4I B;  3RYH B;  4X20 B;  2OZB A;  1Q86 H;  1VQV A;  3M4S A;  2IAF A;  4BT7 A;  4U39 A;  2G9I A;  3JAT A;  2W8B C;  1JFF B;  3RYF B;  1GX1 A;  1XRG A;  4I50 B;  4ZHW A;  2GZL A;  2CVL A;  2OTM A;  3CCU F;  2CWJ A;  4ZOL B;  3KHN A;  2HX0 A;  4O4H A;  4G88 A;  3JAR A;  1VQ8 F;  3JAS B;  5EYP B;  1CN7 A;  3C8L A;  3E20 B;  3LME A;  1UI9 A;  4G4Y A;  5CA0 A;  3RYC B;  3LWQ C;  4LNU A;  1W55 A;  1YIJ F;  5BMV A;  1U3L A;  3FD5 A;  1YQN A;  5LXT A;  1VK3 A;  1IV3 A;  1RQ2 A;  1YJ9 F;  1U43 A;  5B8F A;  1IV4 A;  3G71 F;  3JCM M;  1M1K H;  4DXD A;  5IJ0 A;  1K73 H;  2P6Y A;  1ODE A;  1VQP F;  2ZF8 A;  3TD3 A;  1YJN F;  4EI7 A;  1VH8 A;  2AIZ P;  1W59 A;  3QTY A;  2V9Y A;  5GON A;  1FNK A;  1QD9 A;  3S06 A;  5EO3 A;  4ZK7 A;  5CA1 B;  5EB0 A;  5JVD B;  5GIP C;  5CB4 B;  1NQ3 A;  4NUT A;  3LDT A;  3I3F A;  4G4W A;  2KGW A;  4ZHQ B;  1KNJ A;  1CLI A;  3J81 M;  3HKC B;  4X1K B;  1NMU B;  3UT5 B;  4O4I A;  3RYH A;  4X20 A;  1VQL F;  2UZH A;  1U40 A;  2QEX F;  3I55 F;  3S0H A;  4BT2 A;  1W40 A;  3MQW A;  1Q82 H;  3JAM M;  1FFX A;  3LWO C;  1JFF A;  4LCK A;  2Z1F A;  3P10 A;  3CCL F;  4YJ3 B;  4I50 A;  1H7M A;  4U3J B;  2PMP A;  4LNU B;  5IYZ B;  2OHW A;  1KNK A;  1TVK B;  3K2X A;  4X3M A;  3FPI A;  4ZOL A;  5EAZ A;  5ITZ A;  3LWR C;  3N2K B;  1KD1 H;  1X52 A;  2I6D A;  2RHJ A;  3JAK B;  3JAS A;  1W3E X;  4TUY B;  3O85 A;  5EYP A;  2CHS A;  3S02 A;  3RYC A;  3HWU A;  3L7Q A;  4XCQ A;  2RHH A;  2Z1T A;  2QI2 A;  3RYI A;  1OAP A;  2DYY A;  3TD5 A;  4TZZ A;  3HAX D;  5KX5 B;  3ELC A;  3CD6 F;  4O2B B;  5FJ4 C;  4B5C A;  3WJR A;  1QVF F;  5EIB C;  3CYP B;  3RA5 A;  3ERN A;  1DT9 A;  2HRU A;  3WGM A;  3VIU A;  5KMG A;  5LOV A;  2LBT A;  2Z1U A;  3R0P A;  4FFB B;  5JCO C;  5GAN K;  3WGK A;  3VI6 A;  1VQ7 F;  1IV1 A;  3WXM B;  3GYQ A;  5CA1 A;  5JVD A;  2CW4 A;  5JH7 B;  1R1M A;  4I55 B;  1XHO A;  5CB4 A;  5GIN C;  2KG4 A;  5FLX M;  5JQG B;  3CC2 F;  4F6R A;  4ZHQ A;  2IQQ A;  3F0G A;  5J2T B;  1FFX B;  3IEQ A;  3HKC A;  5A2Q M;  5HY1 A;  3KIZ A;  4X1K A;  2QA4 F;  4IIJ A;  1FSZ A;  1VQK F;  3CPW F;  5LP6 C;  3UT5 A;  1H48 A;  3F0E A;  5MN4 A;  3WPX A;  3TD4 A;  1QVG F;  5ITZ B;  2HS0 A;  5JCO A;  2AMT A;  1VQN F;  2GLZ A;  4C81 A;  5LA6 A;  4YJ3 A;  1U3P A;  4ZHY B;  3V4D A;  4U3J A;  5IYZ A;  3RA6 A;  3F0D A;  1SDS A;  2FGY A;  1TVK A;  3KE1 A;  3WJQ A;  3N2K A;  5GAP K;  1YJW F;  2CSL A;  3RYI B;  3CCM F;  3IR9 A;  3JAK A;  3HJW C;  4ERH A;  4BVT A;  3V7Q A;  4TUY A;  1GZ0 A;  3CCR F;  3C9T A;  4BT4 A;  2B33 A;  1J7H A;  1H47 A;  3C9R A;  2YXZ A;  3KJK A; 
#chains in the Genus database with same CATH homology
 2QEX F;  3CCJ F;  2BO1 A;  3I55 F;  3CXC F;  4BVS A;  1E7K A;  1W40 A;  2VGN A;  3V7E A;  1YI2 F;  5GIO C;  4BW0 B;  3JAM M;  1Q82 H;  3LWO C;  3LWP C;  3OBY A;  4LCK A;  1Q7Y H;  3CCL F;  3FFM A;  3I56 F;  1ZWZ A;  1H7M A;  3ON1 A;  1K8A H;  3PLA C;  3N4Z A;  2OHW A;  4X3M A;  1YIT F;  3V3T A;  3LWR C;  1VQO F;  1VQM F;  1KD1 H;  1X52 A;  3NK7 A;  3G6E F;  4C4W C;  2I6D A;  5HY2 A;  1XBI A;  3E1Y A;  2OTL F;  5HY4 A;  1KQS F;  1W3E X;  2VGM A;  3O85 A;  3OBW A;  2F9Z C;  3SIV A;  3PAF A;  2JNB A;  3NVK E;  3CC7 F;  1VQ9 F;  4XCQ A;  2OZB A;  1Q86 H;  2CZW A;  2KTV A;  4BVQ A;  4BY9 D;  3CPQ A;  2QI2 A;  3NMU C;  1VQ5 F;  1IPA A;  2LBX A;  4TZZ A;  3NK6 A;  3G4S F;  3CD6 F;  3HAX D;  5G4U C;  5FJ4 C;  4X3L A;  5HY0 A;  1QVF F;  1NJI H;  3CCU F;  3RA5 A;  1DT9 A;  4BVR A;  3LFO A;  1W42 A;  5HXZ A;  3CCV F;  2OTJ F;  1JJ2 F;  5GAN K;  1VQ8 F;  3VI6 A;  1W41 A;  1VQ7 F;  5HXU A;  3WXM B;  1CN7 A;  2AIF A;  3GYQ A;  3E20 B;  3LWQ C;  5GIN C;  1YIJ F;  2KG4 A;  1VQ4 F;  1T0K B;  5FLX M;  3CC2 F;  1RA4 A;  1K9M H;  3NVI B;  5EWR A;  5G4V C;  1VQ6 F;  3OW2 F;  2WAL A;  3LWV C;  5A2Q M;  5HY1 A;  2QA4 F;  4EI9 A;  1YJ9 F;  1VQK F;  3CPW F;  3J80 M;  3D00 A;  3VMF B;  3G71 F;  3JCM M;  1X7P A;  1QVG F;  1M1K H;  1K73 H;  1GO0 A;  1S72 F;  3CME F;  1VQN F;  1YHQ F;  2GLZ A;  1VQP F;  2KTU A;  1YJN F;  3CG6 A;  4EI7 A;  1W2B F;  1GO1 A;  1KC8 H;  5DCV A;  2LBW A;  4NQ3 A;  1N8R H;  3CC4 F;  3SIU A;  3RA6 A;  5EO3 A;  3CCQ F;  1X7O A;  5HWE A;  2FGY A;  1SDS A;  3J7A R;  5GIP C;  3CCE F;  1M90 H;  1PXW A;  4EI8 A;  5IT9 M;  5GAP K;  4NUT A;  1YJW F;  3CMA F;  3CCM F;  3IR9 A;  2ALE A;  3HJW C;  2HVY D;  3MCA B;  3J81 M;  1CK2 A;  4BVT A;  3V7Q A;  3CCR F;  1GZ0 A;  3CCS F;  3N4Y A;  1NMU B;  2FC3 A;  1Q81 H;  1VQL F;  3AGK A;  1RLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...