3RE3A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from francisella tularensis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
148
Chain Sequence
b'NAMSFRIGHGYDVHKFTSAKQNIIIGGVEIAYHLDGDVLIHALCDAILGALGLGDIGKHFKNIDSKFFLAEIKKMLDKKQYSISNIDCTIIAQAPKMLPHIEKMRACLANILEIQISQINIKATTTERLGFIGREEGIATHVVCLLYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Francisella tularensis subsp. tularensis
publication title Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis
rcsb
total genus 39
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3re3A00
3F0DA 1KNJA 3K14A 5B8FA 3B6NA 2GZLA 3KE1A 3IEWA 1VHAA 1U40A 1H47A 3EORA 3Q8HA 3F0FA 1VH8A 3FBAA 2UZHA 3ESJA 1YQNA 1IV2A 1U3LA 3JVHA 1JN1A 4C8IA 4C81A 3GHZA 3RE3A 3IEQA 4C82A 1W57A 3T80A 3F0EA 3FPIA 3IKEA 3F0GA 4C8EA 1IV1A 1H48A 3K2XA 3P0ZA 3IKFA 2PMPA 1U43A 3ELCA 1W55A 3MBMA 3ERNA 4C8GA 1GX1A 1JY8A 1U3PA 1IV3A 1IV4A 1KNKA 2AMTA 3F6MA 3P10A 3QHDA 1T0AA
chains in the Genus database with same CATH superfamily
2G9IA 3JAKA 4PWTA 3CC4F 4I50B 1PF5A 3JCMM 3FD6A 3MCQA 5GINC 3PLAC 4EI8A 2OZBA 3HJWC 4ZHQB 1OFUA 3TD3A 2L26A 3D54A 3JVHA 1RLGA 2Z1TA 3GHZA 3LWPC 3IEQA 3WGLA 4BT5A 2Z1FA 1UI9A 3WJRA 3MBMA 1W5FA 5GIOC 2ZODA 3E22A 2CW4A 3C9SA 1E7KA 4I50A 4IIJB 1NMUB 2BO1A 1TVKA 1TUBB 2UZHA 2CSLA 3TD5A 1Z5WA 5CA0A 4ZHQA 3M84A 1Q7YH 1FFXA 3IKEA 3RYIA 3TD4A 4BW0B 4DRXB 1QVGF 3O85A 3KHNA 4C4WC 4FFBA 4ZHVA 4IHJB 4G4YA 5AVMA 5G4VC 5JVDA 3WJQA 2LBWA 5MN5A 5MN4A 3LMEA 3VYUC 1JFFB 2EWCA 5HY1A 5FJ4C 3OW2F 4DXDA 1TVKB 5LOVA 1KQSF 5JQGA 4ZI7A 1YJWF 2VAMA 3VCZA 2GLZA 4WBNB 5EAZA 2PHNA 3G71F 5J2UB 3RYIB 3RYHA 1X25A 4DRXA 4ZOLA 4TV9A 2OHWA 3HWUA 1X52A 2I6RA 3MQWA 4FFBB 1Q86H 5B8FA 1QAHA 1Q8RA 3ZOPA 5JCOC 3RA5A 5EB1B 1U40A 3KJJA 3UT5A 1VQNF 5HY4A 2KG4A 3R0PA 3S0YA 4G4ZA 1M90H 1ODEA 1FNKA 1YJNF 1X7PA 3F0EA 3CXCF 3UT5B 4XCQA 2HX0A 3LWRC 3S0HA 5LYJB 2NMUA 1ZWZA 2FGYA 1VQVA 4BT6A 4TV9B 4TUYA 2ZOVA 1SA0B 2ZF8A 3RA6A 3RYFB 4O4JB 3CCLF 5ITZA 5LA6A 3FBAA 3WGNA 3I3FA 2HP0B 2JNBA 4EI9A 1QVFF 2OTJF 1JD1A 3WGKA 2R6R1 5J2TA 1SDSA 5KMGB 5EZYB 1FSZA 5HXUA 1CK2A 2HRUA 4YJ2B 3DDNA 3HKDB 5IJ9B 5CB4A 2ALEA 2HP0A 4G4VA 1VQLF 3LDTA 4O4IA 3CCUF 2FC3A 2RHLA 2VXYA 1GX1A 5EO3A 3S03A 1VQ4F 2LBXA 5A2QM 1Q82H 2OTMA 2QI2A 2H8EA 4X1YB 3CCJF 4EB6B 4YJ2A 3C9RA 4TUYB 4U3JB 2ZAUA 3P4EA 3CYPB 3LYBA 2LCAA 5GIPC 1NJIH 3HKEB 1CLIA 3ON1A 5KX5B 1OAPA 4X1IB 2IG8A 2HS0A 3CC7F 2IQQA 2Z01A 4U3JA 2DT4A 3IMPA 1RLUA 3CB2A 1YI2F 5GAPK 5DCVA 3CCEF 1PXWA 1JY8A 3HKEA 3N2GA 1IV4A 1NQ3A 4O4IB 1VQ5F 5LXTB 5FNVA 2KGWA 1XBIA 3JASA 3QTYA 2H6LA 3VO8A 1W40A 3IEWA 4EB6A 1W59A 2CZWA 5IYZB 4ZHWA 5BMVA 1VH8A 5LP6A 1W581 3G6EF 5FNVB 3CCQF 5MN6A 1W2BF 3G4SF 3ZP7A 4F6RA 1KC8H 3VIUA 5CA1B 3J80M 2UYNB 1DT9A 4I55B 4C8EA 5IJ0A 5KX5A 3V4DA 4O4HA 1W41A 2Q1YA 3VOBA 2BTOA 1RQ7A 2AMTA 3JAKB 2AIFA 3S0WA 1T0KB 3ZP4A 1K9MH 3WPWA 5G4UC 2ZVYA 1YQNA 5C8YB 5IYZA 2QA4F 4O4LA 3GYQA 3HAXD 3PAFA 1W57A 4YJ3B 3HKCA 4LCKA 3LWQC 1RA4A 2QEXF 1JJ2F 3ELCA 4ZHYB 3CC2F 1YJ9F 1U3PA 1KNKA 2DYYA 3N2KB 4O2BA 1QU9A 3N4ZA 3M4SA 4TV8B 2RB9A 4R40B 2BTQB 1XHOA 2V9YA 3NMUC 2HS3A 3I7TA 4B46A 3WPXA 1GZ0A 1H47A 3N2KA 4B62A 5HY0A 1N8RH 5HWEA 3CYQA 3E1YA 3MDOA 2KTUA 2VAPA 4C81A 4U39A 5EB0A 3D01A 3VI6A 3E20B 2B33A 4O4LB 1K8AH 2F9ZC 1VQ6F 1VQMF 3HKCB 1H48A 1W55A 3ERNA 1M1KH 1TUBA 1RQ2A 5JVDB 4C8IA 5IT9M 3CCVF 3F0DA 5CA0B 4O2BB 3K14A 2GZLA 3V7EA 4M8IA 1H7MA 1QD9A 3CPQA 4ZI7B 3NVIB 3U0OA 1IV2A 4WBNA 2ZVZA 4TZZA 4IHJA 4IIJA 2CVLA 3F0GA 1S72F 4ZOLB 2H8CA 5EIBD 5EYPB 1VQ8F 2N48A 2UYJA 3VYSC 3M1XA 4BVSA 1FNJA 5JQGB 2OTLF 3CG6A 2VAWA 3ZO8A 4O2AB 3JAWB 3J81M 3CMEF 3CMAF 1U3LA 4G4WA 3SIVA 3QUWA 1JFFA 5LP6C 1VQOF 4RHAA 5EWRA 4RQOA 4B45A 2GVIA 5LYJA 1FFXB 4E6EA 3JAWA 3FFMA 3VOAA 1IPAA 3SIUA 3P10A 3OBWA 1ONIA 5EYPA 3MCAB 3CCSF 3OONA 4O4JA 2W8BC 3V3TA 5J2UA 3CPWF 3GTZA 5HY2A 5GANK 3I56F 3ESJA 4BT7A 5J2TB 1COMA 3WGMA 4BT3A 2RHJA 4O2AA 3RE3A 3WXMB 3JALB 5LOVB 4X3MA 1GO1A 5IJ9A 3CCRF 2CHSA 3K2XA 4BT4A 1XV2A 4LNUA 1VK3A 4I4TB 2RHOA 3RYCA 5LA6B 4BVQA 3JALA 3RYHB 3CD6F 5JH7A 3OBYA 3LFOA 4X1KB 1VQKF 5EZYA 1DBFA 1W5AA 3EORA 3JATB 2Z1EA 2AIZP 4NUTA 3HKDA 3VTIC 3IR9A 4BVRA 2BTUA 5JCOA 4X1KA 4C82A 1SA0A 3RYFA 3C9UA 3VYTC 3FPIA 4X1YA 2P6YA 3JATA 1IV1A 1R1MA 1VQ7F 3N2GB 1U43A 5LXTA 2Z1UA 4NQ3A 3NK6A 1IV3A 5GONA 4LNUB 3QHDA 2UYKA 1T0AA 4X20B 4I4TA 3J7AR 2RHHA 3RYCB 4ZK7A 3KIZA 3KE1A 5CB4B 5JH7B 3K12A 2LBTA 1W42A 1J7HA 3JARA 4BVTA 4X1IA 3LWVC 1X7OA 5GONB 3F0FA 4X20A 2CHTA 1K73H 2VGNA 5ITZB 2MQEA 3KJKA 2YYEA 3T80A 3I55F 1GO0A 3DC2A 4B5CA 5KMGA 3JASB 3C9TA 3P0ZA 4G4XA 4C8GA 4X3LA 1YGYA 3L7QA 3NK7A 5BMVB 1XRGA 2I6DA 4BT2A 2QTPA 3B6NA 3S02A 1VQPF 1Q81H 3WGJA 3NVKE 1VHAA 3WJPA 3Q8HA 4G88A 5IJ0B 3JARB 4O4HB 5HP8A 2HP3A 2UYPA 3HKBA 1SZQA 2CWJA 1W5EA 4BY9D 3BYQA 5EIBC 1W5BA 4ERHA 3IKFA 2K1SA 2Q1XA 4F6RB 2YXZA 2KTVA 3S06A 4HNAA 5C8YA 2UYNA 1KNJA 2IAFA 2HRYA 3C8LA 5HP7A 2VGMA 3N4YA 4YJ3A 4KWEA 3VMFB 1Z5VA 3FD5A 3V7QA 1KD1H 4HNAB 3LWOC 1CN7A 1YITF 1YHQF 5LP6B 1YIJF 1JN1A 3AGKA 5HXZA 1UFYA 3CCMF 3JAMM 2HQSC 4TV8A 3D00A 3HKBB 3K0TA 4EI7A 5CA1A 2HS4A 4NWOB 2HVYD 4I55A 2PMPA 1W3EX 3E22B 3HTNA 2R751 5FLXM 1VQ9F 2WALA 3F6MA
chains in the Genus database with same CATH topology
3F0DA 1KNJA 3K14A 5B8FA 3B6NA 2GZLA 3KE1A 3IEWA 1VHAA 1U40A 1H47A 3EORA 3Q8HA 3F0FA 1VH8A 3FBAA 2UZHA 3ESJA 1YQNA 1IV2A 1U3LA 3JVHA 1JN1A 4C8IA 4C81A 3GHZA 3RE3A 3IEQA 4C82A 1W57A 3T80A 3F0EA 3FPIA 3IKEA 3F0GA 4C8EA 1IV1A 1H48A 3K2XA 3P0ZA 3IKFA 2PMPA 1U43A 3ELCA 1W55A 3MBMA 3ERNA 4C8GA 1GX1A 1JY8A 1U3PA 1IV3A 1IV4A 1KNKA 2AMTA 3F6MA 3P10A 3QHDA 1T0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0D A;  1KNJ A;  3K14 A;  5B8F A;  3B6N A;  2GZL A;  3KE1 A;  3IEW A;  1VHA A;  1U40 A;  1H47 A;  3EOR A;  3Q8H A;  3F0F A;  1VH8 A;  3FBA A;  2UZH A;  3ESJ A;  1YQN A;  1IV2 A;  1U3L A;  3JVH A;  1JN1 A;  4C8I A;  4C81 A;  3GHZ A;  3RE3 A;  3IEQ A;  4C82 A;  1W57 A;  3T80 A;  3F0E A;  3FPI A;  3IKE A;  3F0G A;  4C8E A;  1IV1 A;  1H48 A;  3K2X A;  3P0Z A;  3IKF A;  2PMP A;  1U43 A;  3ELC A;  1W55 A;  3MBM A;  3ERN A;  4C8G A;  1GX1 A;  1JY8 A;  1U3P A;  1IV3 A;  1IV4 A;  1KNK A;  2AMT A;  3F6M A;  3P10 A;  3QHD A;  1T0A A; 
#chains in the Genus database with same CATH topology
 2G9I A;  3JAK A;  4PWT A;  3CC4 F;  4I50 B;  1PF5 A;  3JCM M;  3FD6 A;  3MCQ A;  5GIN C;  3PLA C;  4EI8 A;  2OZB A;  3HJW C;  4ZHQ B;  1OFU A;  3TD3 A;  2L26 A;  3D54 A;  3JVH A;  1RLG A;  2Z1T A;  3GHZ A;  3LWP C;  3IEQ A;  3WGL A;  4BT5 A;  2Z1F A;  1UI9 A;  3WJR A;  3MBM A;  1W5F A;  5GIO C;  2ZOD A;  3E22 A;  2CW4 A;  3C9S A;  1E7K A;  4I50 A;  4IIJ B;  1NMU B;  2BO1 A;  1TVK A;  1TUB B;  2UZH A;  2CSL A;  3TD5 A;  1Z5W A;  5CA0 A;  4ZHQ A;  3M84 A;  1Q7Y H;  1FFX A;  3IKE A;  3RYI A;  3TD4 A;  4BW0 B;  4DRX B;  1QVG F;  3O85 A;  3KHN A;  4C4W C;  4FFB A;  4ZHV A;  4IHJ B;  4G4Y A;  5AVM A;  5G4V C;  5JVD A;  3WJQ A;  2LBW A;  5MN5 A;  5MN4 A;  3LME A;  3VYU C;  1JFF B;  2EWC A;  5HY1 A;  5FJ4 C;  3OW2 F;  4DXD A;  1TVK B;  5LOV A;  1KQS F;  5JQG A;  4ZI7 A;  1YJW F;  2VAM A;  3VCZ A;  2GLZ A;  4WBN B;  5EAZ A;  2PHN A;  3G71 F;  5J2U B;  3RYI B;  3RYH A;  1X25 A;  4DRX A;  4ZOL A;  4TV9 A;  2OHW A;  3HWU A;  1X52 A;  2I6R A;  3MQW A;  4FFB B;  1Q86 H;  5B8F A;  1QAH A;  1Q8R A;  3ZOP A;  5JCO C;  3RA5 A;  5EB1 B;  1U40 A;  3KJJ A;  3UT5 A;  1VQN F;  5HY4 A;  2KG4 A;  3R0P A;  3S0Y A;  4G4Z A;  1M90 H;  1ODE A;  1FNK A;  1YJN F;  1X7P A;  3F0E A;  3CXC F;  3UT5 B;  4XCQ A;  2HX0 A;  3LWR C;  3S0H A;  5LYJ B;  2NMU A;  1ZWZ A;  2FGY A;  1VQV A;  4BT6 A;  4TV9 B;  4TUY A;  2ZOV A;  1SA0 B;  2ZF8 A;  3RA6 A;  3RYF B;  4O4J B;  3CCL F;  5ITZ A;  5LA6 A;  3FBA A;  3WGN A;  3I3F A;  2HP0 B;  2JNB A;  4EI9 A;  1QVF F;  2OTJ F;  1JD1 A;  3WGK A;  2R6R 1;  5J2T A;  1SDS A;  5KMG B;  5EZY B;  1FSZ A;  5HXU A;  1CK2 A;  2HRU A;  4YJ2 B;  3DDN A;  3HKD B;  5IJ9 B;  5CB4 A;  2ALE A;  2HP0 A;  4G4V A;  1VQL F;  3LDT A;  4O4I A;  3CCU F;  2FC3 A;  2RHL A;  2VXY A;  1GX1 A;  5EO3 A;  3S03 A;  1VQ4 F;  2LBX A;  5A2Q M;  1Q82 H;  2OTM A;  2QI2 A;  2H8E A;  4X1Y B;  3CCJ F;  4EB6 B;  4YJ2 A;  3C9R A;  4TUY B;  4U3J B;  2ZAU A;  3P4E A;  3CYP B;  3LYB A;  2LCA A;  5GIP C;  1NJI H;  3HKE B;  1CLI A;  3ON1 A;  5KX5 B;  1OAP A;  4X1I B;  2IG8 A;  2HS0 A;  3CC7 F;  2IQQ A;  2Z01 A;  4U3J A;  2DT4 A;  3IMP A;  1RLU A;  3CB2 A;  1YI2 F;  5GAP K;  5DCV A;  3CCE F;  1PXW A;  1JY8 A;  3HKE A;  3N2G A;  1IV4 A;  1NQ3 A;  4O4I B;  1VQ5 F;  5LXT B;  5FNV A;  2KGW A;  1XBI A;  3JAS A;  3QTY A;  2H6L A;  3VO8 A;  1W40 A;  3IEW A;  4EB6 A;  1W59 A;  2CZW A;  5IYZ B;  4ZHW A;  5BMV A;  1VH8 A;  5LP6 A;  1W58 1;  3G6E F;  5FNV B;  3CCQ F;  5MN6 A;  1W2B F;  3G4S F;  3ZP7 A;  4F6R A;  1KC8 H;  3VIU A;  5CA1 B;  3J80 M;  2UYN B;  1DT9 A;  4I55 B;  4C8E A;  5IJ0 A;  5KX5 A;  3V4D A;  4O4H A;  1W41 A;  2Q1Y A;  3VOB A;  2BTO A;  1RQ7 A;  2AMT A;  3JAK B;  2AIF A;  3S0W A;  1T0K B;  3ZP4 A;  1K9M H;  3WPW A;  5G4U C;  2ZVY A;  1YQN A;  5C8Y B;  5IYZ A;  2QA4 F;  4O4L A;  3GYQ A;  3HAX D;  3PAF A;  1W57 A;  4YJ3 B;  3HKC A;  4LCK A;  3LWQ C;  1RA4 A;  2QEX F;  1JJ2 F;  3ELC A;  4ZHY B;  3CC2 F;  1YJ9 F;  1U3P A;  1KNK A;  2DYY A;  3N2K B;  4O2B A;  1QU9 A;  3N4Z A;  3M4S A;  4TV8 B;  2RB9 A;  4R40 B;  2BTQ B;  1XHO A;  2V9Y A;  3NMU C;  2HS3 A;  3I7T A;  4B46 A;  3WPX A;  1GZ0 A;  1H47 A;  3N2K A;  4B62 A;  5HY0 A;  1N8R H;  5HWE A;  3CYQ A;  3E1Y A;  3MDO A;  2KTU A;  2VAP A;  4C81 A;  4U39 A;  5EB0 A;  3D01 A;  3VI6 A;  3E20 B;  2B33 A;  4O4L B;  1K8A H;  2F9Z C;  1VQ6 F;  1VQM F;  3HKC B;  1H48 A;  1W55 A;  3ERN A;  1M1K H;  1TUB A;  1RQ2 A;  5JVD B;  4C8I A;  5IT9 M;  3CCV F;  3F0D A;  5CA0 B;  4O2B B;  3K14 A;  2GZL A;  3V7E A;  4M8I A;  1H7M A;  1QD9 A;  3CPQ A;  4ZI7 B;  3NVI B;  3U0O A;  1IV2 A;  4WBN A;  2ZVZ A;  4TZZ A;  4IHJ A;  4IIJ A;  2CVL A;  3F0G A;  1S72 F;  4ZOL B;  2H8C A;  5EIB D;  5EYP B;  1VQ8 F;  2N48 A;  2UYJ A;  3VYS C;  3M1X A;  4BVS A;  1FNJ A;  5JQG B;  2OTL F;  3CG6 A;  2VAW A;  3ZO8 A;  4O2A B;  3JAW B;  3J81 M;  3CME F;  3CMA F;  1U3L A;  4G4W A;  3SIV A;  3QUW A;  1JFF A;  5LP6 C;  1VQO F;  4RHA A;  5EWR A;  4RQO A;  4B45 A;  2GVI A;  5LYJ A;  1FFX B;  4E6E A;  3JAW A;  3FFM A;  3VOA A;  1IPA A;  3SIU A;  3P10 A;  3OBW A;  1ONI A;  5EYP A;  3MCA B;  3CCS F;  3OON A;  4O4J A;  2W8B C;  3V3T A;  5J2U A;  3CPW F;  3GTZ A;  5HY2 A;  5GAN K;  3I56 F;  3ESJ A;  4BT7 A;  5J2T B;  1COM A;  3WGM A;  4BT3 A;  2RHJ A;  4O2A A;  3RE3 A;  3WXM B;  3JAL B;  5LOV B;  4X3M A;  1GO1 A;  5IJ9 A;  3CCR F;  2CHS A;  3K2X A;  4BT4 A;  1XV2 A;  4LNU A;  1VK3 A;  4I4T B;  2RHO A;  3RYC A;  5LA6 B;  4BVQ A;  3JAL A;  3RYH B;  3CD6 F;  5JH7 A;  3OBY A;  3LFO A;  4X1K B;  1VQK F;  5EZY A;  1DBF A;  1W5A A;  3EOR A;  3JAT B;  2Z1E A;  2AIZ P;  4NUT A;  3HKD A;  3VTI C;  3IR9 A;  4BVR A;  2BTU A;  5JCO A;  4X1K A;  4C82 A;  1SA0 A;  3RYF A;  3C9U A;  3VYT C;  3FPI A;  4X1Y A;  2P6Y A;  3JAT A;  1IV1 A;  1R1M A;  1VQ7 F;  3N2G B;  1U43 A;  5LXT A;  2Z1U A;  4NQ3 A;  3NK6 A;  1IV3 A;  5GON A;  4LNU B;  3QHD A;  2UYK A;  1T0A A;  4X20 B;  4I4T A;  3J7A R;  2RHH A;  3RYC B;  4ZK7 A;  3KIZ A;  3KE1 A;  5CB4 B;  5JH7 B;  3K12 A;  2LBT A;  1W42 A;  1J7H A;  3JAR A;  4BVT A;  4X1I A;  3LWV C;  1X7O A;  5GON B;  3F0F A;  4X20 A;  2CHT A;  1K73 H;  2VGN A;  5ITZ B;  2MQE A;  3KJK A;  2YYE A;  3T80 A;  3I55 F;  1GO0 A;  3DC2 A;  4B5C A;  5KMG A;  3JAS B;  3C9T A;  3P0Z A;  4G4X A;  4C8G A;  4X3L A;  1YGY A;  3L7Q A;  3NK7 A;  5BMV B;  1XRG A;  2I6D A;  4BT2 A;  2QTP A;  3B6N A;  3S02 A;  1VQP F;  1Q81 H;  3WGJ A;  3NVK E;  1VHA A;  3WJP A;  3Q8H A;  4G88 A;  5IJ0 B;  3JAR B;  4O4H B;  5HP8 A;  2HP3 A;  2UYP A;  3HKB A;  1SZQ A;  2CWJ A;  1W5E A;  4BY9 D;  3BYQ A;  5EIB C;  1W5B A;  4ERH A;  3IKF A;  2K1S A;  2Q1X A;  4F6R B;  2YXZ A;  2KTV A;  3S06 A;  4HNA A;  5C8Y A;  2UYN A;  1KNJ A;  2IAF A;  2HRY A;  3C8L A;  5HP7 A;  2VGM A;  3N4Y A;  4YJ3 A;  4KWE A;  3VMF B;  1Z5V A;  3FD5 A;  3V7Q A;  1KD1 H;  4HNA B;  3LWO C;  1CN7 A;  1YIT F;  1YHQ F;  5LP6 B;  1YIJ F;  1JN1 A;  3AGK A;  5HXZ A;  1UFY A;  3CCM F;  3JAM M;  2HQS C;  4TV8 A;  3D00 A;  3HKB B;  3K0T A;  4EI7 A;  5CA1 A;  2HS4 A;  4NWO B;  2HVY D;  4I55 A;  2PMP A;  1W3E X;  3E22 B;  3HTN A;  2R75 1;  5FLX M;  1VQ9 F;  2WAL A;  3F6M A; 
#chains in the Genus database with same CATH homology
 3F0D A;  1KNJ A;  3K14 A;  5B8F A;  3B6N A;  2GZL A;  3KE1 A;  3IEW A;  1VHA A;  1U40 A;  1H47 A;  3EOR A;  3Q8H A;  3F0F A;  1VH8 A;  3FBA A;  2UZH A;  3ESJ A;  1YQN A;  1IV2 A;  1U3L A;  3JVH A;  1JN1 A;  4C8I A;  4C81 A;  3GHZ A;  3RE3 A;  3IEQ A;  4C82 A;  1W57 A;  3T80 A;  3F0E A;  3FPI A;  3IKE A;  3F0G A;  4C8E A;  1IV1 A;  1H48 A;  3K2X A;  3P0Z A;  3IKF A;  2PMP A;  1U43 A;  3ELC A;  1W55 A;  3MBM A;  3ERN A;  4C8G A;  1GX1 A;  1JY8 A;  1U3P A;  1IV3 A;  1IV4 A;  1KNK A;  2AMT A;  3F6M A;  3P10 A;  3QHD A;  1T0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...