3RE3A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from francisella tularensis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
148
Chain Sequence
NAMSFRIGHGYDVHKFTSAKQNIIIGGVEIAYHLDGDVLIHALCDAILGALGLGDIGKHFKNIDSKFFLAEIKKMLDKKQYSISNIDCTIIAQAPKMLPHIEKMRACLANILEIQISQINIKATTTERLGFIGREEGIATHVVCLLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 39
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3re3A00
1U43A 3IKEA 4C8IA 1W55A 2PMPA 4C8EA 2GZLA 4C8GA 3Q8HA 1GX1A 3IKFA 1IV4A 3QHDA 3IEWA 1H48A 1W57A 4C82A 3IEQA 1IV1A 3K2XA 5B8FA 3KE1A 3B6NA 1IV3A 2AMTA 3MBMA 3ELCA 1KNJA 1U40A 3FPIA 3EORA 3F0DA 3FBAA 1JY8A 3ERNA 3T80A 4C81A 3GHZA 1U3LA 3P10A 1IV2A 1VHAA 1KNKA 1H47A 1VH8A 3F0GA 1U3PA 1YQNA 3P0ZA 1JN1A 3RE3A 3ESJA 3F0EA 3K14A 2UZHA 1T0AA 3JVHA 3F6MA 3F0FA
chains in the Genus database with same CATH superfamily
1K9MH 5EWRA 1CK2A 5CA1B 2UYKA 2Z1UA 3HKEB 5JCOA 2PHNA 2CHSA 1IV4A 1H48A 4E6EA 3K2XA 3CPWF 2CW4A 4O2AA 5B8FA 1T0KB 2HP0B 2JNBA 4O2BA 3MBMA 3WGJA 3GYQA 4BVQA 3JAKA 1VQOF 1QD9A 2RHLA 5LA6B 5LP6A 5JQGA 2VGNA 1NMUB 4X1KA 3WGLA 4BT2A 2ALEA 3UT5A 1S72F 3RYHB 5CA0A 4X1YA 3UT5B 4C8IA 3CCSF 2L26A 1UI9A 5HWEA 3HWUA 3M84A 4O2AB 1VQLF 1VQ4F 3JAKB 3S03A 2ZOVA 3VYTC 3N2GA 3KE1A 4LNUB 1IV3A 1UFYA 5KMGB 2UYNB 1XBIA 2VAPA 3FPIA 4BT5A 5CA1A 2P6YA 3CCMF 3I56F 1U3LA 4ZK7A 1Q8RA 3OBYA 5IYZA 1JN1A 4BW0B 2CVLA 1PF5A 4X1IA 1VQ9F 4F6RB 5FNVA 2DYYA 3C9UA 3IKEA 3V7QA 1VQNF 5JCOC 2UYNA 3LWPC 4O4JA 5EZYA 4DRXA 3FFMA 1KC8H 4O4HB 3CYPB 3G71F 3GTZA 3S0YA 2CSLA 3VOAA 3VCZA 3FBAA 1XHOA 1KQSF 3E1YA 1M90H 4X1YB 5ITZA 1GO0A 3F0EA 3K14A 1TUBB 1VQVA 3JVHA 2HS3A 2NMUA 3TD4A 3WXMB 3CCRF 2YXZA 4ZHQB 4FFBB 3TD5A 5IYZB 3WGMA 3CCJF 4BY9D 3KJKA 3QHDA 3L7QA 1RA4A 3RYFB 1YIJF 1JFFB 1SZQA 2LCAA 2Z1EA 5GAPK 1VQPF 5C8YB 2OZBA 2LBXA 5MN5A 2Z1TA 4I50B 3ESJA 1QAHA 4BT3A 1IPAA 3MDOA 3F6MA 4O4LA 4TV9A 3JAMM 4ZHVA 4ZOLA 1FNKA 4G4ZA 1NJIH 2PMPA 5LP6C 4U3JB 3WJRA 4EI9A 1JFFA 4IIJA 5A2QM 3N2GB 5GONB 4TUYA 2CZWA 5EYPB 3ZP4A 2OTJF 3JASB 2UYJA 1X7OA 1CLIA 3RA6A 4BVRA 4DRXB 2FGYA 4BT6A 1W581 5FJ4C 3CD6F 1YITF 1KD1H 4LCKA 1DBFA 3JAWB 5G4UC 3NVIB 3CYQA 4X3LA 5LP6B 1W3EX 4I55B 1W5AA 4X1IB 3CC2F 4BVTA 4X1KB 3LWOC 1QU9A 1VQMF 3HJWC 5C8YA 2G9IA 3G6EF 5J2TA 2AMTA 1W40A 4U3JA 3GHZA 4IIJB 1IV2A 1K8AH 4O4LB 3CB2A 4I50A 3ZP7A 4ERHA 3CXCF 3E20B 3P10A 4G4YA 1TUBA 3NMUC 4ZHWA 1GX1A 1VQ6F 2Z01A 3CG6A 4NQ3A 3HKDB 3OBWA 4HNAB 4YJ3A 3RYFA 5JH7A 2IAFA 2B33A 2RHHA 2I6DA 3F0DA 2BTUA 2WALA 1QVFF 1VHAA 5FNVB 2I6RA 3OONA 4BT4A 2AIFA 1TVKB 3P4EA 3RYHA 3VIUA 4X20A 1X52A 3KJJA 1Q86H 3RYIA 3JAWA 4XCQA 3JATA 1TVKA 5EIBD 1VQKF 4IHJA 2YYEA 3J80M 3PLAC 2AIZP 3IKFA 4WBNB 1E7KA 2LBWA 1W57A 4TUYB 4C82A 3IEQA 3CCVF 4O2BB 1YHQF 5EYPA 1RQ2A 3WGNA 3QTYA 2N48A 4FFBA 1VK3A 1GZ0A 2BTOA 3T80A 1JJ2F 5IT9M 2EWCA 1Q7YH 2HQSC 3F0GA 3P0ZA 1OFUA 1W5EA 3VYUC 5EB0A 3V4DA 3DDNA 3N4ZA 5CA0B 1W2BF 3CCLF 1VQ8F 3LYBA 1W55A 5GIOC 3VMFB 1SA0B 3TD3A 3KIZA 2H6LA 3IEWA 5KMGA 3MCQA 4BVSA 4ZI7B 2QTPA 2BO1A 1RLGA 1H7MA 4EB6A 3I3FA 3V7EA 4B45A 3G4SF 4WBNA 1RQ7A 4BT7A 2KGWA 1YQNA 5HP8A 3RE3A 3JATB 1GO1A 5HP7A 2UZHA 2ZF8A 3V3TA 5CB4A 4TZZA 1VQ7F 3CC4F 1FNJA 2HS0A 3N2KB 1JD1A 1W41A 2RHJA 4YJ2B 1XRGA 3C9RA 5AVMA 4O4IA 3RYCA 5IJ9B 5J2UB 1PXWA 4I55A 1U40A 5LOVB 4HNAA 3EORA 4YJ3B 5HY2A 3SIVA 1SA0A 3CPQA 1YI2F 4M8IA 3IMPA 2W8BC 3NK6A 4G4XA 4TV9B 3D00A 3RYIB 3CMEF 3HTNA 1XV2A 2RB9A 2OHWA 4EI8A 4PWTA 1NQ3A 5BMVB 3Q8HA 3I55F 5JVDB 3LWQC 5J2TB 5GONA 3WPXA 3B6NA 3ELCA 1KNJA 3IR9A 3O85A 3VI6A 2HRUA 5EZYB 4ZHQA 3HKDA 4NUTA 3ZO8A 1W59A 2ZVYA 3C9TA 4ZOLB 3VO8A 2KG4A 4EI7A 3F0FA 4C4WC 5GINC 1ZWZA 2QI2A 1FSZA 3LFOA 2FC3A 3KHNA 5KX5B 2HVYD 1W5FA 2CWJA 1X7PA 1FFXB 5LA6A 2KTVA 4G4VA 2OTMA 3RA5A 3HKCB 5EB1B 1IV1A 3JASA 3CCEF 5KX5A 3BYQA 3HKBB 4YJ2A 3S0HA 3S06A 2VXYA 2ZAUA 5J2UA 3ERNA 3S02A 3HKCA 3AGKA 2HRYA 4X20B 1VH8A 2VAWA 1CN7A 2MQEA 2K1SA 5EO3A 5LYJA 4IHJB 3LWVC 3N2KA 4F6RA 3VTIC 3LDTA 2V9YA 3D54A 2UYPA 4R40B 5MN4A 1VQ5F 3SIUA 1U43A 3K0TA 3M4SA 3K12A 3E22B 4DXDA 2Z1FA 4KWEA 5GANK 1Z5WA 3HKBA 5JH7B 5DCVA 5JVDA 5BMVA 3M1XA 4RQOA 5EAZA 4C81A 2HS4A 1ONIA 3LMEA 5EIBC 1Q81H 4G88A 4I4TA 3OW2F 3HAXD 1U3PA 5IJ0A 5G4VC 1Q82H 3E22A 5ITZB 5HY4A 3WPWA 3C8LA 3WGKA 3CCUF 2R6R1 5LXTA 3C9SA 3D01A 3VYSC 2H8EA 1X25A 2HP0A 5IJ9A 4EB6B 3S0WA 2Q1YA 2QEXF 3MCAB 2ZVZA 4NWOB 2LBTA 1JY8A 2KTUA 1W42A 4O4IB 5HY1A 1OAPA 5HXZA 3JALB 2GLZA 2IQQA 4TV8B 5LXTB 2QA4F 1YJNF 5HY0A 2IG8A 1SDSA 3J7AR 3WJQA 2VAMA 3FD5A 1ODEA 5LYJB 3R0PA 3JALA 1R1MA 4G4WA 3WJPA 4C8EA 2GZLA 3JARA 3JCMM 2ZODA 4X3MA 1QVGF 5IJ0B 1W5BA 1DT9A 1Z5VA 5LOVA 4O4JB 4B62A 4B5CA 1YJWF 2OTLF 1FFXA 3I7TA 1M1KH 4O4HA 3U0OA 3NK7A 2GVIA 1RLUA 3ZOPA 1H47A 2CHTA 3QUWA 1J7HA 2DT4A 4RHAA 3N4YA 5CB4B 1T0AA 5GIPC 5MN6A 2RHOA 4I4TB 1YGYA 3CCQF 3PAFA 4C8GA 2F9ZC 4LNUA 2HX0A 5JQGB 2VGMA 5HXUA 3CC7F 4ZHYB 3RYCB 4ZI7A 3FD6A 3ON1A 5FLXM 1COMA 2H8CA 3MQWA 2BTQB 3DC2A 1N8RH 3HKEA 3VOBA 3JARB 2HP3A 4U39A 4B46A 1KNKA 3J81M 3NVKE 2Q1XA 3CMAF 1K73H 1YJ9F 3LWRC 4TV8A 2R751
chains in the Genus database with same CATH topology
1U43A 3IKEA 4C8IA 1W55A 2PMPA 4C8EA 2GZLA 4C8GA 3Q8HA 1GX1A 3IKFA 1IV4A 3QHDA 3IEWA 1H48A 1W57A 4C82A 3IEQA 1IV1A 3K2XA 5B8FA 3KE1A 3B6NA 1IV3A 2AMTA 3MBMA 3ELCA 1KNJA 1U40A 3FPIA 3EORA 3F0DA 3FBAA 1JY8A 3ERNA 3T80A 4C81A 3GHZA 1U3LA 3P10A 1IV2A 1VHAA 1KNKA 1H47A 1VH8A 3F0GA 1U3PA 1YQNA 3P0ZA 1JN1A 3RE3A 3ESJA 3F0EA 3K14A 2UZHA 1T0AA 3JVHA 3F6MA 3F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U43 A;  3IKE A;  4C8I A;  1W55 A;  2PMP A;  4C8E A;  2GZL A;  4C8G A;  3Q8H A;  1GX1 A;  3IKF A;  1IV4 A;  3QHD A;  3IEW A;  1H48 A;  1W57 A;  4C82 A;  3IEQ A;  1IV1 A;  3K2X A;  5B8F A;  3KE1 A;  3B6N A;  1IV3 A;  2AMT A;  3MBM A;  3ELC A;  1KNJ A;  1U40 A;  3FPI A;  3EOR A;  3F0D A;  3FBA A;  1JY8 A;  3ERN A;  3T80 A;  4C81 A;  3GHZ A;  1U3L A;  3P10 A;  1IV2 A;  1VHA A;  1KNK A;  1H47 A;  1VH8 A;  3F0G A;  1U3P A;  1YQN A;  3P0Z A;  1JN1 A;  3RE3 A;  3ESJ A;  3F0E A;  3K14 A;  2UZH A;  1T0A A;  3JVH A;  3F6M A;  3F0F A; 
#chains in the Genus database with same CATH topology
 1K9M H;  5EWR A;  1CK2 A;  5CA1 B;  2UYK A;  2Z1U A;  3HKE B;  5JCO A;  2PHN A;  2CHS A;  1IV4 A;  1H48 A;  4E6E A;  3K2X A;  3CPW F;  2CW4 A;  4O2A A;  5B8F A;  1T0K B;  2HP0 B;  2JNB A;  4O2B A;  3MBM A;  3WGJ A;  3GYQ A;  4BVQ A;  3JAK A;  1VQO F;  1QD9 A;  2RHL A;  5LA6 B;  5LP6 A;  5JQG A;  2VGN A;  1NMU B;  4X1K A;  3WGL A;  4BT2 A;  2ALE A;  3UT5 A;  1S72 F;  3RYH B;  5CA0 A;  4X1Y A;  3UT5 B;  4C8I A;  3CCS F;  2L26 A;  1UI9 A;  5HWE A;  3HWU A;  3M84 A;  4O2A B;  1VQL F;  1VQ4 F;  3JAK B;  3S03 A;  2ZOV A;  3VYT C;  3N2G A;  3KE1 A;  4LNU B;  1IV3 A;  1UFY A;  5KMG B;  2UYN B;  1XBI A;  2VAP A;  3FPI A;  4BT5 A;  5CA1 A;  2P6Y A;  3CCM F;  3I56 F;  1U3L A;  4ZK7 A;  1Q8R A;  3OBY A;  5IYZ A;  1JN1 A;  4BW0 B;  2CVL A;  1PF5 A;  4X1I A;  1VQ9 F;  4F6R B;  5FNV A;  2DYY A;  3C9U A;  3IKE A;  3V7Q A;  1VQN F;  5JCO C;  2UYN A;  3LWP C;  4O4J A;  5EZY A;  4DRX A;  3FFM A;  1KC8 H;  4O4H B;  3CYP B;  3G71 F;  3GTZ A;  3S0Y A;  2CSL A;  3VOA A;  3VCZ A;  3FBA A;  1XHO A;  1KQS F;  3E1Y A;  1M90 H;  4X1Y B;  5ITZ A;  1GO0 A;  3F0E A;  3K14 A;  1TUB B;  1VQV A;  3JVH A;  2HS3 A;  2NMU A;  3TD4 A;  3WXM B;  3CCR F;  2YXZ A;  4ZHQ B;  4FFB B;  3TD5 A;  5IYZ B;  3WGM A;  3CCJ F;  4BY9 D;  3KJK A;  3QHD A;  3L7Q A;  1RA4 A;  3RYF B;  1YIJ F;  1JFF B;  1SZQ A;  2LCA A;  2Z1E A;  5GAP K;  1VQP F;  5C8Y B;  2OZB A;  2LBX A;  5MN5 A;  2Z1T A;  4I50 B;  3ESJ A;  1QAH A;  4BT3 A;  1IPA A;  3MDO A;  3F6M A;  4O4L A;  4TV9 A;  3JAM M;  4ZHV A;  4ZOL A;  1FNK A;  4G4Z A;  1NJI H;  2PMP A;  5LP6 C;  4U3J B;  3WJR A;  4EI9 A;  1JFF A;  4IIJ A;  5A2Q M;  3N2G B;  5GON B;  4TUY A;  2CZW A;  5EYP B;  3ZP4 A;  2OTJ F;  3JAS B;  2UYJ A;  1X7O A;  1CLI A;  3RA6 A;  4BVR A;  4DRX B;  2FGY A;  4BT6 A;  1W58 1;  5FJ4 C;  3CD6 F;  1YIT F;  1KD1 H;  4LCK A;  1DBF A;  3JAW B;  5G4U C;  3NVI B;  3CYQ A;  4X3L A;  5LP6 B;  1W3E X;  4I55 B;  1W5A A;  4X1I B;  3CC2 F;  4BVT A;  4X1K B;  3LWO C;  1QU9 A;  1VQM F;  3HJW C;  5C8Y A;  2G9I A;  3G6E F;  5J2T A;  2AMT A;  1W40 A;  4U3J A;  3GHZ A;  4IIJ B;  1IV2 A;  1K8A H;  4O4L B;  3CB2 A;  4I50 A;  3ZP7 A;  4ERH A;  3CXC F;  3E20 B;  3P10 A;  4G4Y A;  1TUB A;  3NMU C;  4ZHW A;  1GX1 A;  1VQ6 F;  2Z01 A;  3CG6 A;  4NQ3 A;  3HKD B;  3OBW A;  4HNA B;  4YJ3 A;  3RYF A;  5JH7 A;  2IAF A;  2B33 A;  2RHH A;  2I6D A;  3F0D A;  2BTU A;  2WAL A;  1QVF F;  1VHA A;  5FNV B;  2I6R A;  3OON A;  4BT4 A;  2AIF A;  1TVK B;  3P4E A;  3RYH A;  3VIU A;  4X20 A;  1X52 A;  3KJJ A;  1Q86 H;  3RYI A;  3JAW A;  4XCQ A;  3JAT A;  1TVK A;  5EIB D;  1VQK F;  4IHJ A;  2YYE A;  3J80 M;  3PLA C;  2AIZ P;  3IKF A;  4WBN B;  1E7K A;  2LBW A;  1W57 A;  4TUY B;  4C82 A;  3IEQ A;  3CCV F;  4O2B B;  1YHQ F;  5EYP A;  1RQ2 A;  3WGN A;  3QTY A;  2N48 A;  4FFB A;  1VK3 A;  1GZ0 A;  2BTO A;  3T80 A;  1JJ2 F;  5IT9 M;  2EWC A;  1Q7Y H;  2HQS C;  3F0G A;  3P0Z A;  1OFU A;  1W5E A;  3VYU C;  5EB0 A;  3V4D A;  3DDN A;  3N4Z A;  5CA0 B;  1W2B F;  3CCL F;  1VQ8 F;  3LYB A;  1W55 A;  5GIO C;  3VMF B;  1SA0 B;  3TD3 A;  3KIZ A;  2H6L A;  3IEW A;  5KMG A;  3MCQ A;  4BVS A;  4ZI7 B;  2QTP A;  2BO1 A;  1RLG A;  1H7M A;  4EB6 A;  3I3F A;  3V7E A;  4B45 A;  3G4S F;  4WBN A;  1RQ7 A;  4BT7 A;  2KGW A;  1YQN A;  5HP8 A;  3RE3 A;  3JAT B;  1GO1 A;  5HP7 A;  2UZH A;  2ZF8 A;  3V3T A;  5CB4 A;  4TZZ A;  1VQ7 F;  3CC4 F;  1FNJ A;  2HS0 A;  3N2K B;  1JD1 A;  1W41 A;  2RHJ A;  4YJ2 B;  1XRG A;  3C9R A;  5AVM A;  4O4I A;  3RYC A;  5IJ9 B;  5J2U B;  1PXW A;  4I55 A;  1U40 A;  5LOV B;  4HNA A;  3EOR A;  4YJ3 B;  5HY2 A;  3SIV A;  1SA0 A;  3CPQ A;  1YI2 F;  4M8I A;  3IMP A;  2W8B C;  3NK6 A;  4G4X A;  4TV9 B;  3D00 A;  3RYI B;  3CME F;  3HTN A;  1XV2 A;  2RB9 A;  2OHW A;  4EI8 A;  4PWT A;  1NQ3 A;  5BMV B;  3Q8H A;  3I55 F;  5JVD B;  3LWQ C;  5J2T B;  5GON A;  3WPX A;  3B6N A;  3ELC A;  1KNJ A;  3IR9 A;  3O85 A;  3VI6 A;  2HRU A;  5EZY B;  4ZHQ A;  3HKD A;  4NUT A;  3ZO8 A;  1W59 A;  2ZVY A;  3C9T A;  4ZOL B;  3VO8 A;  2KG4 A;  4EI7 A;  3F0F A;  4C4W C;  5GIN C;  1ZWZ A;  2QI2 A;  1FSZ A;  3LFO A;  2FC3 A;  3KHN A;  5KX5 B;  2HVY D;  1W5F A;  2CWJ A;  1X7P A;  1FFX B;  5LA6 A;  2KTV A;  4G4V A;  2OTM A;  3RA5 A;  3HKC B;  5EB1 B;  1IV1 A;  3JAS A;  3CCE F;  5KX5 A;  3BYQ A;  3HKB B;  4YJ2 A;  3S0H A;  3S06 A;  2VXY A;  2ZAU A;  5J2U A;  3ERN A;  3S02 A;  3HKC A;  3AGK A;  2HRY A;  4X20 B;  1VH8 A;  2VAW A;  1CN7 A;  2MQE A;  2K1S A;  5EO3 A;  5LYJ A;  4IHJ B;  3LWV C;  3N2K A;  4F6R A;  3VTI C;  3LDT A;  2V9Y A;  3D54 A;  2UYP A;  4R40 B;  5MN4 A;  1VQ5 F;  3SIU A;  1U43 A;  3K0T A;  3M4S A;  3K12 A;  3E22 B;  4DXD A;  2Z1F A;  4KWE A;  5GAN K;  1Z5W A;  3HKB A;  5JH7 B;  5DCV A;  5JVD A;  5BMV A;  3M1X A;  4RQO A;  5EAZ A;  4C81 A;  2HS4 A;  1ONI A;  3LME A;  5EIB C;  1Q81 H;  4G88 A;  4I4T A;  3OW2 F;  3HAX D;  1U3P A;  5IJ0 A;  5G4V C;  1Q82 H;  3E22 A;  5ITZ B;  5HY4 A;  3WPW A;  3C8L A;  3WGK A;  3CCU F;  2R6R 1;  5LXT A;  3C9S A;  3D01 A;  3VYS C;  2H8E A;  1X25 A;  2HP0 A;  5IJ9 A;  4EB6 B;  3S0W A;  2Q1Y A;  2QEX F;  3MCA B;  2ZVZ A;  4NWO B;  2LBT A;  1JY8 A;  2KTU A;  1W42 A;  4O4I B;  5HY1 A;  1OAP A;  5HXZ A;  3JAL B;  2GLZ A;  2IQQ A;  4TV8 B;  5LXT B;  2QA4 F;  1YJN F;  5HY0 A;  2IG8 A;  1SDS A;  3J7A R;  3WJQ A;  2VAM A;  3FD5 A;  1ODE A;  5LYJ B;  3R0P A;  3JAL A;  1R1M A;  4G4W A;  3WJP A;  4C8E A;  2GZL A;  3JAR A;  3JCM M;  2ZOD A;  4X3M A;  1QVG F;  5IJ0 B;  1W5B A;  1DT9 A;  1Z5V A;  5LOV A;  4O4J B;  4B62 A;  4B5C A;  1YJW F;  2OTL F;  1FFX A;  3I7T A;  1M1K H;  4O4H A;  3U0O A;  3NK7 A;  2GVI A;  1RLU A;  3ZOP A;  1H47 A;  2CHT A;  3QUW A;  1J7H A;  2DT4 A;  4RHA A;  3N4Y A;  5CB4 B;  1T0A A;  5GIP C;  5MN6 A;  2RHO A;  4I4T B;  1YGY A;  3CCQ F;  3PAF A;  4C8G A;  2F9Z C;  4LNU A;  2HX0 A;  5JQG B;  2VGM A;  5HXU A;  3CC7 F;  4ZHY B;  3RYC B;  4ZI7 A;  3FD6 A;  3ON1 A;  5FLX M;  1COM A;  2H8C A;  3MQW A;  2BTQ B;  3DC2 A;  1N8R H;  3HKE A;  3VOB A;  3JAR B;  2HP3 A;  4U39 A;  4B46 A;  1KNK A;  3J81 M;  3NVK E;  2Q1X A;  3CMA F;  1K73 H;  1YJ9 F;  3LWR C;  4TV8 A;  2R75 1; 
#chains in the Genus database with same CATH homology
 1U43 A;  3IKE A;  4C8I A;  1W55 A;  2PMP A;  4C8E A;  2GZL A;  4C8G A;  3Q8H A;  1GX1 A;  3IKF A;  1IV4 A;  3QHD A;  3IEW A;  1H48 A;  1W57 A;  4C82 A;  3IEQ A;  1IV1 A;  3K2X A;  5B8F A;  3KE1 A;  3B6N A;  1IV3 A;  2AMT A;  3MBM A;  3ELC A;  1KNJ A;  1U40 A;  3FPI A;  3EOR A;  3F0D A;  3FBA A;  1JY8 A;  3ERN A;  3T80 A;  4C81 A;  3GHZ A;  1U3L A;  3P10 A;  1IV2 A;  1VHA A;  1KNK A;  1H47 A;  1VH8 A;  3F0G A;  1U3P A;  1YQN A;  3P0Z A;  1JN1 A;  3RE3 A;  3ESJ A;  3F0E A;  3K14 A;  2UZH A;  1T0A A;  3JVH A;  3F6M A;  3F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...