3RE3A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from francisella tularensis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
148
Chain Sequence
NAMSFRIGHGYDVHKFTSAKQNIIIGGVEIAYHLDGDVLIHALCDAILGALGLGDIGKHFKNIDSKFFLAEIKKMLDKKQYSISNIDCTIIAQAPKMLPHIEKMRACLANILEIQISQINIKATTTERLGFIGREEGIATHVVCLLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 39
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3re3A00
3K14A 1U43A 1JN1A 1U3LA 4C81A 1KNKA 1IV3A 1W57A 3GHZA 1JY8A 1T0AA 3IKFA 3K2XA 4C8IA 1H48A 1IV2A 3ERNA 1IV4A 1U40A 3ELCA 4C82A 1VHAA 2UZHA 4C8EA 3F0DA 3F0EA 3IEQA 2PMPA 3EORA 3FBAA 1YQNA 3F6MA 3QHDA 3F0FA 3Q8HA 3B6NA 2AMTA 3IEWA 3FPIA 2GZLA 1IV1A 1W55A 3JVHA 1VH8A 3MBMA 4C8GA 1H47A 3F0GA 3RE3A 3ESJA 5B8FA 1GX1A 1KNJA 1U3PA 3P0ZA 3T80A 3IKEA 3KE1A 3P10A
chains in the Genus database with same CATH superfamily
5G4VC 2V9YA 1Q81H 2IAFA 2CVLA 5BMVB 3K0TA 3CMEF 4EI8A 4EB6A 1VQ7F 3NVIB 2UYKA 3C9RA 4BT7A 3S03A 3CCRF 5GINC 4I50B 1X7OA 2VAPA 2KG4A 5J2TB 2Z1FA 4X1KB 1VQOF 2VXYA 3V7EA 3MQWA 2PHNA 2I6DA 2OZBA 3RE3A 3FD5A 5GIOC 3CCUF 2RHLA 5KX5B 3VOBA 2K1SA 1PXWA 1U43A 1IPAA 3TD3A 1JJ2F 4X1IB 5ITZA 3CCQF 4E6EA 4C8IA 3S0HA 1COMA 3J81M 3IEQA 5HY2A 3N2GA 4O2AA 3RYIA 2ZVYA 1VK3A 2H6LA 1R1MA 2N48A 1GZ0A 5EB0A 3JAKB 1W5EA 1TUBB 1IV1A 1W55A 3CPWF 3QUWA 4ERHA 4YJ2A 4I4TB 1RQ7A 3M4SA 1W5FA 3VCZA 4ZOLB 2HVYD 5JQGA 3HKEA 4HNAA 5EYPA 1QVGF 3KE1A 1FFXA 1FSZA 3KJKA 4IHJB 1T0KB 1W59A 3LFOA 3TD4A 4ZHQA 4EB6B 3ERNA 4TUYA 5CA1A 3HKDA 3F0EA 5J2UA 3N4YA 4BVTA 5AVMA 3I3FA 4C4WC 5LOVA 3F0FA 5EIBC 3CCVF 5JH7A 1VH8A 4PWTA 4X3LA 5HP8A 5LA6A 3SIUA 5DCVA 4O4JA 4YJ3A 3VTIC 4BW0B 3CC2F 1UFYA 2HQSC 3G4SF 3S0WA 4R40B 3GHZA 5CB4A 2HRYA 2G9IA 1OAPA 1KC8H 1IV2A 5EB1B 4C82A 1VHAA 4O2AB 5FNVA 4NWOB 3RYIB 1CN7A 2ZODA 1W40A 2L26A 5HY0A 4YJ2B 3ZO8A 1Z5WA 4O4IB 4G88A 2RHOA 4WBNA 1DBFA 3D54A 2KTVA 2YXZA 4BT5A 5JQGB 3HKEB 4O4HA 4TV8A 5IJ9A 5EYPB 3IKEA 1FFXB 1VQ5F 3JALA 4DRXA 3L7QA 3IMPA 1XBIA 4TUYB 5CA1B 3HKDB 2QEXF 3GTZA 3HTNA 5J2UB 2HP3A 3C9SA 4BT4A 5LOVB 3E22B 3CCLF 1PF5A 5JH7B 3D01A 1DT9A 2NMUA 3CG6A 5LA6B 4EI7A 5GONB 4YJ3B 3T80A 4I55A 5LP6C 2Z1UA 2LBTA 4ZHYB 5CB4B 3K2XA 1JY8A 4U39A 5FNVB 3ELCA 1SA0B 1Q86H 2OTLF 2JNBA 5IJ0B 3WJQA 3WPXA 1X25A 3HJWC 4BY9D 4WBNB 3VOAA 3S06A 3MCAB 4F6RA 4TV8B 3VYTC 1GX1A 5EWRA 2HRUA 1KNJA 5JCOC 4X3MA 5FLXM 3N2KA 1J7HA 3JALB 1QVFF 2GLZA 3FD6A 2CW4A 2VGMA 4FFBA 1K73H 3LWVC 3KHNA 2I6RA 5MN6A 3RA5A 3ZP7A 1IV4A 1U40A 3G71F 3CB2A 3ON1A 3F0DA 3R0PA 4DXDA 1YQNA 3CYPB 1VQNF 4ZHWA 1XV2A 2BTQB 3VYUC 5FJ4C 3E1YA 2IG8A 5IYZA 5A2QM 3NVKE 2HP0A 3IR9A 4ZI7A 2OTMA 3J80M 3OBYA 4M8IA 2ALEA 2OHWA 3AGKA 3JASA 3CYQA 4I55B 3LWQC 3KIZA 1Z5VA 5HP7A 4C81A 4O2BA 3RYHA 3M1XA 3LMEA 3N4ZA 3WXMB 4LNUA 3E20B 2BO1A 3B6NA 2VAMA 4X1YA 4BT2A 3CXCF 2B33A 4C8GA 2FC3A 4RQOA 5JVDA 1CK2A 2LCAA 3FFMA 3S0YA 2CHTA 3LDTA 2Z1TA 3N2KB 2Q1XA 3WGKA 3UT5A 4TZZA 1W2BF 5EZYA 5HWEA 1H7MA 1YJNF 5ITZB 3IKFA 1ONIA 5MN4A 4G4XA 3CC7F 4C8EA 3NK6A 3N2GB 4TV9A 1JFFA 3DC2A 2ZOVA 4B46A 2AMTA 5IYZB 1NMUB 2F9ZC 2H8EA 3JVHA 3WGMA 1W3EX 2Z1EA 3QTYA 4ZI7B 3OW2F 3JASB 1M1KH 1Q82H 4HNAB 1U3PA 3NK7A 2RHHA 3VYSC 1RLUA 5C8YA 3RYHB 2RHJA 4ZHQB 3JARA 1H48A 4LCKA 1UI9A 4KWEA 3CCJF 3LYBA 1E7KA 3FBAA 4I50A 3V3TA 3WGLA 3Q8HA 3S02A 4X1YB 1RA4A 1QU9A 3O85A 2GZLA 4BT6A 1XRGA 3SIVA 5JVDB 3MCQA 1H47A 3D00A 1VQ6F 2ZVZA 2CSLA 3V4DA 3VI6A 4G4WA 1K9MH 5GANK 3GYQA 4O4JB 3P0ZA 3UT5B 3G6EF 4BVQA 5EZYB 3OBWA 2BTOA 1VQVA 3K14A 3JATA 1U3LA 1GO1A 2HS0A 3WPWA 1XHOA 2YYEA 3WGJA 4TV9B 1JFFB 4ZK7A 2AIFA 3VIUA 3V7QA 3NMUC 2UYPA 2LBWA 3JAWA 1QAHA 5CA0A 1Q7YH 3ESJA 1W41A 3LWPC 3I56F 3PAFA 4O4HB 5IJ9B 2WALA 2CHSA 2UYJA 5C8YB 1YGYA 4IHJA 3P10A 4XCQA 3RA6A 2UYNA 3JARB 3WGNA 4DRXB 5GAPK 5IT9M 1IV3A 1T0AA 5MN5A 3RYCA 1ODEA 3OONA 2AIZP 1KQSF 1W5BA 4EI9A 3CCMF 4BVRA 3QHDA 3CC4F 3CMAF 3FPIA 3KJJA 3LWOC 3WJRA 5EO3A 3RYFA 3I55F 1VQKF 1FNJA 2ZF8A 5B8FA 3BYQA 2DYYA 2Z01A 1W581 1VQPF 1KD1H 2BTUA 3M84A 1YJWF 4BVSA 2ZAUA 3JATB 1TVKA 1Q8RA 2QTPA 1W57A 2QI2A 3HKCA 4G4YA 5GIPC 1YHQF 3I7TA 5LYJA 2CWJA 1GO0A 2PMPA 5HXUA 2FGYA 1FNKA 2KTUA 5HY4A 3CD6F 1YJ9F 3JAWB 4G4ZA 4X20A 4O4IA 5CA0B 3HWUA 1M90H 4G4VA 4F6RB 2EWCA 1SZQA 4O4LA 1JD1A 3K12A 5KMGA 2UYNB 4FFBB 3C9UA 5HY1A 3PLAC 1NJIH 3RYCB 2CZWA 3JAMM 3HKBA 4U3JA 2OTJF 3MDOA 1S72F 3C8LA 2VAWA 3E22A 3F6MA 3ZP4A 2VGNA 3MBMA 3P4EA 3RYFB 1ZWZA 1SDSA 1NQ3A 2HP0B 3F0GA 3J7AR 2R751 2W8BC 5LXTA 1VQ8F 1OFUA 5GONA 1X7PA 5LP6A 3ZOPA 3VMFB 1CLIA 4IIJA 1TVKB 4BT3A 2R6R1 3WJPA 3CCSF 3DDNA 3HKCB 4ZHVA 4O2BB 1KNKA 5LYJB 1W5AA 1N8RH 5BMVA 1RLGA 4NUTA 1SA0A 4LNUB 3TD5A 2H8CA 2IQQA 3CCEF 4B45A 4B5CA 1K8AH 5IJ0A 3IEWA 5J2TA 4X20B 5EIBD 3LWRC 4X1KA 2DT4A 2HS3A 4O4LB 3JCMM 5JCOA 2HX0A 1YI2F 3HAXD 5KMGB 2Q1YA 5KX5A 1JN1A 1VQMF 3C9TA 3VO8A 1YIJF 3HKBB 4X1IA 4U3JB 4NQ3A 4RHAA 2UZHA 2P6YA 2MQEA 4B62A 3EORA 1YITF 3CPQA 2RB9A 3JAKA 5EAZA 1TUBA 3U0OA 1VQLF 1VQ4F 1X52A 1VQ9F 2QA4F 5LXTB 4I4TA 2LBXA 5G4UC 5LP6B 5HXZA 4ZOLA 2GVIA 2KGWA 1QD9A 4IIJB 1W42A 1RQ2A 2HS4A
chains in the Genus database with same CATH topology
3K14A 1U43A 1JN1A 1U3LA 4C81A 1KNKA 1IV3A 1W57A 3GHZA 1JY8A 1T0AA 3IKFA 3K2XA 4C8IA 1H48A 1IV2A 3ERNA 1IV4A 1U40A 3ELCA 4C82A 1VHAA 2UZHA 4C8EA 3F0DA 3F0EA 3IEQA 2PMPA 3EORA 3FBAA 1YQNA 3F6MA 3QHDA 3F0FA 3Q8HA 3B6NA 2AMTA 3IEWA 3FPIA 2GZLA 1IV1A 1W55A 3JVHA 1VH8A 3MBMA 4C8GA 1H47A 3F0GA 3RE3A 3ESJA 5B8FA 1GX1A 1KNJA 1U3PA 3P0ZA 3T80A 3IKEA 3KE1A 3P10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K14 A;  1U43 A;  1JN1 A;  1U3L A;  4C81 A;  1KNK A;  1IV3 A;  1W57 A;  3GHZ A;  1JY8 A;  1T0A A;  3IKF A;  3K2X A;  4C8I A;  1H48 A;  1IV2 A;  3ERN A;  1IV4 A;  1U40 A;  3ELC A;  4C82 A;  1VHA A;  2UZH A;  4C8E A;  3F0D A;  3F0E A;  3IEQ A;  2PMP A;  3EOR A;  3FBA A;  1YQN A;  3F6M A;  3QHD A;  3F0F A;  3Q8H A;  3B6N A;  2AMT A;  3IEW A;  3FPI A;  2GZL A;  1IV1 A;  1W55 A;  3JVH A;  1VH8 A;  3MBM A;  4C8G A;  1H47 A;  3F0G A;  3RE3 A;  3ESJ A;  5B8F A;  1GX1 A;  1KNJ A;  1U3P A;  3P0Z A;  3T80 A;  3IKE A;  3KE1 A;  3P10 A; 
#chains in the Genus database with same CATH topology
 5G4V C;  2V9Y A;  1Q81 H;  2IAF A;  2CVL A;  5BMV B;  3K0T A;  3CME F;  4EI8 A;  4EB6 A;  1VQ7 F;  3NVI B;  2UYK A;  3C9R A;  4BT7 A;  3S03 A;  3CCR F;  5GIN C;  4I50 B;  1X7O A;  2VAP A;  2KG4 A;  5J2T B;  2Z1F A;  4X1K B;  1VQO F;  2VXY A;  3V7E A;  3MQW A;  2PHN A;  2I6D A;  2OZB A;  3RE3 A;  3FD5 A;  5GIO C;  3CCU F;  2RHL A;  5KX5 B;  3VOB A;  2K1S A;  1PXW A;  1U43 A;  1IPA A;  3TD3 A;  1JJ2 F;  4X1I B;  5ITZ A;  3CCQ F;  4E6E A;  4C8I A;  3S0H A;  1COM A;  3J81 M;  3IEQ A;  5HY2 A;  3N2G A;  4O2A A;  3RYI A;  2ZVY A;  1VK3 A;  2H6L A;  1R1M A;  2N48 A;  1GZ0 A;  5EB0 A;  3JAK B;  1W5E A;  1TUB B;  1IV1 A;  1W55 A;  3CPW F;  3QUW A;  4ERH A;  4YJ2 A;  4I4T B;  1RQ7 A;  3M4S A;  1W5F A;  3VCZ A;  4ZOL B;  2HVY D;  5JQG A;  3HKE A;  4HNA A;  5EYP A;  1QVG F;  3KE1 A;  1FFX A;  1FSZ A;  3KJK A;  4IHJ B;  1T0K B;  1W59 A;  3LFO A;  3TD4 A;  4ZHQ A;  4EB6 B;  3ERN A;  4TUY A;  5CA1 A;  3HKD A;  3F0E A;  5J2U A;  3N4Y A;  4BVT A;  5AVM A;  3I3F A;  4C4W C;  5LOV A;  3F0F A;  5EIB C;  3CCV F;  5JH7 A;  1VH8 A;  4PWT A;  4X3L A;  5HP8 A;  5LA6 A;  3SIU A;  5DCV A;  4O4J A;  4YJ3 A;  3VTI C;  4BW0 B;  3CC2 F;  1UFY A;  2HQS C;  3G4S F;  3S0W A;  4R40 B;  3GHZ A;  5CB4 A;  2HRY A;  2G9I A;  1OAP A;  1KC8 H;  1IV2 A;  5EB1 B;  4C82 A;  1VHA A;  4O2A B;  5FNV A;  4NWO B;  3RYI B;  1CN7 A;  2ZOD A;  1W40 A;  2L26 A;  5HY0 A;  4YJ2 B;  3ZO8 A;  1Z5W A;  4O4I B;  4G88 A;  2RHO A;  4WBN A;  1DBF A;  3D54 A;  2KTV A;  2YXZ A;  4BT5 A;  5JQG B;  3HKE B;  4O4H A;  4TV8 A;  5IJ9 A;  5EYP B;  3IKE A;  1FFX B;  1VQ5 F;  3JAL A;  4DRX A;  3L7Q A;  3IMP A;  1XBI A;  4TUY B;  5CA1 B;  3HKD B;  2QEX F;  3GTZ A;  3HTN A;  5J2U B;  2HP3 A;  3C9S A;  4BT4 A;  5LOV B;  3E22 B;  3CCL F;  1PF5 A;  5JH7 B;  3D01 A;  1DT9 A;  2NMU A;  3CG6 A;  5LA6 B;  4EI7 A;  5GON B;  4YJ3 B;  3T80 A;  4I55 A;  5LP6 C;  2Z1U A;  2LBT A;  4ZHY B;  5CB4 B;  3K2X A;  1JY8 A;  4U39 A;  5FNV B;  3ELC A;  1SA0 B;  1Q86 H;  2OTL F;  2JNB A;  5IJ0 B;  3WJQ A;  3WPX A;  1X25 A;  3HJW C;  4BY9 D;  4WBN B;  3VOA A;  3S06 A;  3MCA B;  4F6R A;  4TV8 B;  3VYT C;  1GX1 A;  5EWR A;  2HRU A;  1KNJ A;  5JCO C;  4X3M A;  5FLX M;  3N2K A;  1J7H A;  3JAL B;  1QVF F;  2GLZ A;  3FD6 A;  2CW4 A;  2VGM A;  4FFB A;  1K73 H;  3LWV C;  3KHN A;  2I6R A;  5MN6 A;  3RA5 A;  3ZP7 A;  1IV4 A;  1U40 A;  3G71 F;  3CB2 A;  3ON1 A;  3F0D A;  3R0P A;  4DXD A;  1YQN A;  3CYP B;  1VQN F;  4ZHW A;  1XV2 A;  2BTQ B;  3VYU C;  5FJ4 C;  3E1Y A;  2IG8 A;  5IYZ A;  5A2Q M;  3NVK E;  2HP0 A;  3IR9 A;  4ZI7 A;  2OTM A;  3J80 M;  3OBY A;  4M8I A;  2ALE A;  2OHW A;  3AGK A;  3JAS A;  3CYQ A;  4I55 B;  3LWQ C;  3KIZ A;  1Z5V A;  5HP7 A;  4C81 A;  4O2B A;  3RYH A;  3M1X A;  3LME A;  3N4Z A;  3WXM B;  4LNU A;  3E20 B;  2BO1 A;  3B6N A;  2VAM A;  4X1Y A;  4BT2 A;  3CXC F;  2B33 A;  4C8G A;  2FC3 A;  4RQO A;  5JVD A;  1CK2 A;  2LCA A;  3FFM A;  3S0Y A;  2CHT A;  3LDT A;  2Z1T A;  3N2K B;  2Q1X A;  3WGK A;  3UT5 A;  4TZZ A;  1W2B F;  5EZY A;  5HWE A;  1H7M A;  1YJN F;  5ITZ B;  3IKF A;  1ONI A;  5MN4 A;  4G4X A;  3CC7 F;  4C8E A;  3NK6 A;  3N2G B;  4TV9 A;  1JFF A;  3DC2 A;  2ZOV A;  4B46 A;  2AMT A;  5IYZ B;  1NMU B;  2F9Z C;  2H8E A;  3JVH A;  3WGM A;  1W3E X;  2Z1E A;  3QTY A;  4ZI7 B;  3OW2 F;  3JAS B;  1M1K H;  1Q82 H;  4HNA B;  1U3P A;  3NK7 A;  2RHH A;  3VYS C;  1RLU A;  5C8Y A;  3RYH B;  2RHJ A;  4ZHQ B;  3JAR A;  1H48 A;  4LCK A;  1UI9 A;  4KWE A;  3CCJ F;  3LYB A;  1E7K A;  3FBA A;  4I50 A;  3V3T A;  3WGL A;  3Q8H A;  3S02 A;  4X1Y B;  1RA4 A;  1QU9 A;  3O85 A;  2GZL A;  4BT6 A;  1XRG A;  3SIV A;  5JVD B;  3MCQ A;  1H47 A;  3D00 A;  1VQ6 F;  2ZVZ A;  2CSL A;  3V4D A;  3VI6 A;  4G4W A;  1K9M H;  5GAN K;  3GYQ A;  4O4J B;  3P0Z A;  3UT5 B;  3G6E F;  4BVQ A;  5EZY B;  3OBW A;  2BTO A;  1VQV A;  3K14 A;  3JAT A;  1U3L A;  1GO1 A;  2HS0 A;  3WPW A;  1XHO A;  2YYE A;  3WGJ A;  4TV9 B;  1JFF B;  4ZK7 A;  2AIF A;  3VIU A;  3V7Q A;  3NMU C;  2UYP A;  2LBW A;  3JAW A;  1QAH A;  5CA0 A;  1Q7Y H;  3ESJ A;  1W41 A;  3LWP C;  3I56 F;  3PAF A;  4O4H B;  5IJ9 B;  2WAL A;  2CHS A;  2UYJ A;  5C8Y B;  1YGY A;  4IHJ A;  3P10 A;  4XCQ A;  3RA6 A;  2UYN A;  3JAR B;  3WGN A;  4DRX B;  5GAP K;  5IT9 M;  1IV3 A;  1T0A A;  5MN5 A;  3RYC A;  1ODE A;  3OON A;  2AIZ P;  1KQS F;  1W5B A;  4EI9 A;  3CCM F;  4BVR A;  3QHD A;  3CC4 F;  3CMA F;  3FPI A;  3KJJ A;  3LWO C;  3WJR A;  5EO3 A;  3RYF A;  3I55 F;  1VQK F;  1FNJ A;  2ZF8 A;  5B8F A;  3BYQ A;  2DYY A;  2Z01 A;  1W58 1;  1VQP F;  1KD1 H;  2BTU A;  3M84 A;  1YJW F;  4BVS A;  2ZAU A;  3JAT B;  1TVK A;  1Q8R A;  2QTP A;  1W57 A;  2QI2 A;  3HKC A;  4G4Y A;  5GIP C;  1YHQ F;  3I7T A;  5LYJ A;  2CWJ A;  1GO0 A;  2PMP A;  5HXU A;  2FGY A;  1FNK A;  2KTU A;  5HY4 A;  3CD6 F;  1YJ9 F;  3JAW B;  4G4Z A;  4X20 A;  4O4I A;  5CA0 B;  3HWU A;  1M90 H;  4G4V A;  4F6R B;  2EWC A;  1SZQ A;  4O4L A;  1JD1 A;  3K12 A;  5KMG A;  2UYN B;  4FFB B;  3C9U A;  5HY1 A;  3PLA C;  1NJI H;  3RYC B;  2CZW A;  3JAM M;  3HKB A;  4U3J A;  2OTJ F;  3MDO A;  1S72 F;  3C8L A;  2VAW A;  3E22 A;  3F6M A;  3ZP4 A;  2VGN A;  3MBM A;  3P4E A;  3RYF B;  1ZWZ A;  1SDS A;  1NQ3 A;  2HP0 B;  3F0G A;  3J7A R;  2R75 1;  2W8B C;  5LXT A;  1VQ8 F;  1OFU A;  5GON A;  1X7P A;  5LP6 A;  3ZOP A;  3VMF B;  1CLI A;  4IIJ A;  1TVK B;  4BT3 A;  2R6R 1;  3WJP A;  3CCS F;  3DDN A;  3HKC B;  4ZHV A;  4O2B B;  1KNK A;  5LYJ B;  1W5A A;  1N8R H;  5BMV A;  1RLG A;  4NUT A;  1SA0 A;  4LNU B;  3TD5 A;  2H8C A;  2IQQ A;  3CCE F;  4B45 A;  4B5C A;  1K8A H;  5IJ0 A;  3IEW A;  5J2T A;  4X20 B;  5EIB D;  3LWR C;  4X1K A;  2DT4 A;  2HS3 A;  4O4L B;  3JCM M;  5JCO A;  2HX0 A;  1YI2 F;  3HAX D;  5KMG B;  2Q1Y A;  5KX5 A;  1JN1 A;  1VQM F;  3C9T A;  3VO8 A;  1YIJ F;  3HKB B;  4X1I A;  4U3J B;  4NQ3 A;  4RHA A;  2UZH A;  2P6Y A;  2MQE A;  4B62 A;  3EOR A;  1YIT F;  3CPQ A;  2RB9 A;  3JAK A;  5EAZ A;  1TUB A;  3U0O A;  1VQL F;  1VQ4 F;  1X52 A;  1VQ9 F;  2QA4 F;  5LXT B;  4I4T A;  2LBX A;  5G4U C;  5LP6 B;  5HXZ A;  4ZOL A;  2GVI A;  2KGW A;  1QD9 A;  4IIJ B;  1W42 A;  1RQ2 A;  2HS4 A; 
#chains in the Genus database with same CATH homology
 3K14 A;  1U43 A;  1JN1 A;  1U3L A;  4C81 A;  1KNK A;  1IV3 A;  1W57 A;  3GHZ A;  1JY8 A;  1T0A A;  3IKF A;  3K2X A;  4C8I A;  1H48 A;  1IV2 A;  3ERN A;  1IV4 A;  1U40 A;  3ELC A;  4C82 A;  1VHA A;  2UZH A;  4C8E A;  3F0D A;  3F0E A;  3IEQ A;  2PMP A;  3EOR A;  3FBA A;  1YQN A;  3F6M A;  3QHD A;  3F0F A;  3Q8H A;  3B6N A;  2AMT A;  3IEW A;  3FPI A;  2GZL A;  1IV1 A;  1W55 A;  3JVH A;  1VH8 A;  3MBM A;  4C8G A;  1H47 A;  3F0G A;  3RE3 A;  3ESJ A;  5B8F A;  1GX1 A;  1KNJ A;  1U3P A;  3P0Z A;  3T80 A;  3IKE A;  3KE1 A;  3P10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...