3RE3A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from francisella tularensis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
148
Chain Sequence
NAMSFRIGHGYDVHKFTSAKQNIIIGGVEIAYHLDGDVLIHALCDAILGALGLGDIGKHFKNIDSKFFLAEIKKMLDKKQYSISNIDCTIIAQAPKMLPHIEKMRACLANILEIQISQINIKATTTERLGFIGREEGIATHVVCLLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 39
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3re3A00
3MBMA 4C8IA 3F6MA 1VHAA 3ELCA 3Q8HA 5B8FA 4C8GA 3ESJA 3B6NA 1GX1A 1KNJA 3EORA 3K14A 3QHDA 3P0ZA 4C8EA 1KNKA 3ERNA 2GZLA 1IV1A 3F0EA 3F0FA 3KE1A 3P10A 3IKFA 1JY8A 1W57A 3F0DA 3IEWA 4C82A 3F0GA 1U43A 1U3PA 3IKEA 3K2XA 1IV2A 3T80A 1JN1A 1IV3A 2UZHA 3FBAA 1U3LA 3FPIA 3RE3A 1VH8A 1H48A 1T0AA 2PMPA 3IEQA 1U40A 3GHZA 3JVHA 1IV4A 4C81A 1YQNA 2AMTA 1W55A 1H47A
chains in the Genus database with same CATH superfamily
5CA0B 1PXWA 4C8IA 3MCQA 4X20A 1FNJA 2Z1FA 3IR9A 3N2KB 5BMVB 4TUYA 5KX5B 3RYCA 2RB9A 3JATB 2HP0B 2UYNA 3QHDA 4U3JA 1JFFA 3F0FA 2BO1A 1GZ0A 3JALB 3FFMA 4RHAA 1JN1A 3OBYA 2RHOA 2I6DA 3E22A 5CA1B 3WJPA 1VQ7F 4ZI7A 5LP6B 4O4LA 5J2UB 1Z5WA 3V7EA 4LCKA 1QVGF 1QD9A 3RA5A 3VYUC 1YGYA 1FFXB 3FD6A 4BT3A 5ITZA 3O85A 1GO0A 5CB4B 1VK3A 3N2GA 4C82A 1YITF 4X1IB 4ZHQB 2DT4A 4X1KA 3T80A 3ZO8A 1VQ5F 3WGKA 3I56F 3WGJA 3M84A 3LWQC 3S0HA 2CSLA 5JH7A 4KWEA 3CCMF 3VI6A 5LXTA 2FC3A 3LWPC 1W41A 3I3FA 5EYPA 4ZHYB 4BT2A 2VAWA 3WJRA 3F0DA 3JAWA 3HTNA 2KGWA 5KMGB 5IJ0A 1FNKA 5AVMA 2CHTA 5HY0A 3E1YA 1IV3A 1X25A 1RQ7A 2PMPA 3CCVF 1JD1A 1UFYA 2Z1EA 3GHZA 2P6YA 3UT5B 2ZVYA 2HS4A 3VIUA 3RYHA 2IAFA 4WBNA 4C4WC 4EI7A 2VAMA 2KTUA 2AIFA 2QA4F 5GINC 5MN4A 1DBFA 5EIBD 3CCEF 5J2TB 4G4XA 2QI2A 3WJQA 2HS0A 2R6R1 3OONA 5EAZA 1Q7YH 5EZYA 2LBXA 3TD3A 1COMA 1U3LA 5GANK 3LWVC 3WGMA 1XHOA 1IV4A 1W55A 1VQVA 3CC7F 1TUBB 4BY9D 4B46A 3HKBB 3JAKB 4ZK7A 1W5FA 5GONB 4X1YB 4EB6B 4I55A 5GAPK 3KIZA 5IT9M 2OTLF 3KHNA 1CN7A 3C9SA 4X20B 2GZLA 3F0EA 1VQOF 3GTZA 1E7KA 3IEWA 4TUYB 4YJ3A 3CCJF 4DXDA 1VQMF 1W581 1ZWZA 3RYCB 1T0KB 5FJ4C 2UYNB 2VGMA 4U3JB 1JFFB 2IG8A 4I50A 3KJKA 3G6EF 3CCSF 1RLGA 2ZODA 3QUWA 2ZOVA 1SA0A 1YJ9F 3E22B 3VO8A 4G4WA 4BT7A 4XCQA 3DC2A 2EWCA 2HRYA 2N48A 4ZI7B 4BVRA 3PAFA 4O4LB 1Z5VA 3J80M 1VQKF 4G88A 1W3EX 1KQSF 4G4ZA 3VOBA 3S06A 1X7OA 1GO1A 3M1XA 4PWTA 4R40B 2H8CA 2PHNA 4F6RA 3CCLF 5ITZB 2JNBA 2GLZA 3E20B 3FBAA 3N2GB 1YIJF 4E6EA 5FLXM 5HP7A 1ONIA 4BVSA 1W5BA 2HS3A 4HNAA 4X1KB 3CC2F 3ON1A 2CW4A 4O4JA 5A2QM 1VHAA 5B8FA 3U0OA 3WXMB 4BT5A 5HWEA 5JCOC 4LNUA 5G4VC 1KNJA 3K14A 3VOAA 2HP3A 3VCZA 5JH7B 3S0YA 2FGYA 1CK2A 5LA6A 3IKFA 2W8BC 4IHJA 5LXTB 3CPQA 4IIJA 2Q1XA 1XRGA 5EYPB 4YJ2A 1QVFF 2ALEA 3C9RA 5HXZA 2QTPA 4I4TA 3RYIA 1W2BF 3JAWB 3CD6F 2ZAUA 2CHSA 4BVQA 5EB0A 2AMTA 4B45A 5IJ0B 1H47A 3HJWC 1NQ3A 2CZWA 2AIZP 3NVKE 1K9MH 5HY1A 3J81M 1DT9A 3S02A 1VQ4F 4TV9A 3VMFB 4ERHA 1M1KH 5DCVA 1OAPA 4B62A 2RHHA 3CXCF 2OTMA 3RYHB 4WBNB 3LWRC 2WALA 4O2AA 4BT6A 2KTVA 5JQGA 3VYTC 1XBIA 4NWOB 2Z1UA 5LOVA 4ZHVA 3QTYA 4BT4A 1H48A 1QAHA 3JASA 3J7AR 3SIVA 3MCAB 1PF5A 5EZYB 2V9YA 3N4YA 3HKCA 1VQPF 4ZOLA 1XV2A 3CG6A 3KJJA 3MDOA 2I6RA 2IQQA 2BTQB 1YI2F 3WGLA 3I7TA 3LFOA 5FNVA 2BTUA 4I55B 3LDTA 5GIOC 4O2BA 1X7PA 2L26A 3HKEA 1VQ9F 2UYPA 1Q82H 1SZQA 1M90H 1T0AA 4YJ3B 2GVIA 5EO3A 4EI8A 1U40A 1QU9A 2HVYD 3MBMA 4I50B 2H6LA 2ZF8A 3G4SF 3D00A 1NMUB 1SA0B 3HKDA 5IYZA 1SDSA 2OHWA 3VTIC 5IJ9B 1VQNF 3BYQA 1IPAA 4FFBA 5HP8A 3P4EA 3V7QA 5LYJA 3I55F 5HXUA 5C8YA 3JAMM 3K12A 4O4HA 3HWUA 3AGKA 4F6RB 4C81A 1YQNA 2B33A 3LWOC 5JVDA 4TV8A 3F6MA 3NK7A 3TD4A 1H7MA 1TVKA 3C9UA 5IJ9A 4HNAB 3N4ZA 1NJIH 3L7QA 4O4JB 1KNKA 5HY4A 2NMUA 3S03A 5EB1B 3PLAC 1ODEA 1RLUA 1X52A 4LNUB 1U3PA 2UYKA 2RHJA 2UZHA 3CYPB 5LA6B 4IHJB 4IIJB 2G9IA 4YJ2B 3MQWA 3VYSC 3JVHA 5GIPC 4O4IA 4B5CA 2F9ZC 3M4SA 3WPWA 5MN6A 4I4TB 1KD1H 3RYIB 3FD5A 5G4UC 2DYYA 3IMPA 3WPXA 3ESJA 1K73H 3JARA 1VQ8F 2H8EA 2K1SA 3KE1A 4TV9B 1JY8A 2HRUA 2VXYA 3RA6A 1R1MA 3RYFA 3C8LA 3CMAF 5CA0A 2YYEA 3V4DA 3R0PA 4O2AB 5EWRA 5JQGB 3NVIB 2MQEA 4DRXB 2OZBA 3N2KA 5BMVA 5LOVB 1FSZA 5KX5A 3JATA 2YXZA 2HP0A 3JASB 4NUTA 4BW0B 1J7HA 3HKCB 1GX1A 3JALA 4ZOLB 2QEXF 3CB2A 3D54A 1YJNF 5CA1A 3CCUF 1W59A 3C9TA 2RHLA 1Q81H 2BTOA 4DRXA 5LP6A 2CVLA 5J2UA 5FNVB 2KG4A 5HY2A 1Q86H 4O2BB 3DDNA 3ZP4A 3HKEB 4M8IA 2OTJF 1FFXA 3ZOPA 3NMUC 3CPWF 5CB4A 4C8GA 4BVTA 4X1IA 3ZP7A 4ZHQA 3TD5A 3CMEF 4EI9A 3V3TA 3CCQF 1IV1A 3JCMM 3SIUA 2ZVZA 3HKDB 1S72F 5IYZB 1IV2A 4FFBB 2Z1TA 3OBWA 3D01A 3CC4F 5LYJB 4RQOA 5C8YB 4O4HB 3LYBA 4G4YA 5EIBC 1RQ2A 2LCAA 1N8RH 3ELCA 4ZHWA 1VQLF 1JJ2F 1YJWF 3GYQA 5JVDB 4TV8B 3B6NA 3EORA 5KMGA 4C8EA 1TVKB 3ERNA 3P10A 3NK6A 1W57A 2Z01A 2LBWA 1KC8H 1U43A 5LP6C 3UT5A 5MN5A 3FPIA 3RE3A 3IEQA 1W42A 3HAXD 3CCRF 3LMEA 3CYQA 1OFUA 4X3LA 2Q1YA 2CWJA 1RA4A 3WGNA 5J2TA 4TZZA 3Q8HA 1VQ6F 4NQ3A 4O4IB 1YHQF 2R751 5JCOA 2VGNA 1W5EA 1W5AA 3P0ZA 4G4VA 2VAPA 3OW2F 1CLIA 3F0GA 1Q8RA 3IKEA 3JARB 3K2XA 4X3MA 2LBTA 3G71F 2HX0A 3S0WA 1TUBA 3HKBA 3JAKA 1W40A 2UYJA 1VH8A 3K0TA 5GONA 2HQSC 4X1YA 4EB6A 4U39A 1K8AH 1UI9A 3RYFB
chains in the Genus database with same CATH topology
3MBMA 4C8IA 3F6MA 1VHAA 3ELCA 3Q8HA 5B8FA 4C8GA 3ESJA 3B6NA 1GX1A 1KNJA 3EORA 3K14A 3QHDA 3P0ZA 4C8EA 1KNKA 3ERNA 2GZLA 1IV1A 3F0EA 3F0FA 3KE1A 3P10A 3IKFA 1JY8A 1W57A 3F0DA 3IEWA 4C82A 3F0GA 1U43A 1U3PA 3IKEA 3K2XA 1IV2A 3T80A 1JN1A 1IV3A 2UZHA 3FBAA 1U3LA 3FPIA 3RE3A 1VH8A 1H48A 1T0AA 2PMPA 3IEQA 1U40A 3GHZA 3JVHA 1IV4A 4C81A 1YQNA 2AMTA 1W55A 1H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBM A;  4C8I A;  3F6M A;  1VHA A;  3ELC A;  3Q8H A;  5B8F A;  4C8G A;  3ESJ A;  3B6N A;  1GX1 A;  1KNJ A;  3EOR A;  3K14 A;  3QHD A;  3P0Z A;  4C8E A;  1KNK A;  3ERN A;  2GZL A;  1IV1 A;  3F0E A;  3F0F A;  3KE1 A;  3P10 A;  3IKF A;  1JY8 A;  1W57 A;  3F0D A;  3IEW A;  4C82 A;  3F0G A;  1U43 A;  1U3P A;  3IKE A;  3K2X A;  1IV2 A;  3T80 A;  1JN1 A;  1IV3 A;  2UZH A;  3FBA A;  1U3L A;  3FPI A;  3RE3 A;  1VH8 A;  1H48 A;  1T0A A;  2PMP A;  3IEQ A;  1U40 A;  3GHZ A;  3JVH A;  1IV4 A;  4C81 A;  1YQN A;  2AMT A;  1W55 A;  1H47 A; 
#chains in the Genus database with same CATH topology
 5CA0 B;  1PXW A;  4C8I A;  3MCQ A;  4X20 A;  1FNJ A;  2Z1F A;  3IR9 A;  3N2K B;  5BMV B;  4TUY A;  5KX5 B;  3RYC A;  2RB9 A;  3JAT B;  2HP0 B;  2UYN A;  3QHD A;  4U3J A;  1JFF A;  3F0F A;  2BO1 A;  1GZ0 A;  3JAL B;  3FFM A;  4RHA A;  1JN1 A;  3OBY A;  2RHO A;  2I6D A;  3E22 A;  5CA1 B;  3WJP A;  1VQ7 F;  4ZI7 A;  5LP6 B;  4O4L A;  5J2U B;  1Z5W A;  3V7E A;  4LCK A;  1QVG F;  1QD9 A;  3RA5 A;  3VYU C;  1YGY A;  1FFX B;  3FD6 A;  4BT3 A;  5ITZ A;  3O85 A;  1GO0 A;  5CB4 B;  1VK3 A;  3N2G A;  4C82 A;  1YIT F;  4X1I B;  4ZHQ B;  2DT4 A;  4X1K A;  3T80 A;  3ZO8 A;  1VQ5 F;  3WGK A;  3I56 F;  3WGJ A;  3M84 A;  3LWQ C;  3S0H A;  2CSL A;  5JH7 A;  4KWE A;  3CCM F;  3VI6 A;  5LXT A;  2FC3 A;  3LWP C;  1W41 A;  3I3F A;  5EYP A;  4ZHY B;  4BT2 A;  2VAW A;  3WJR A;  3F0D A;  3JAW A;  3HTN A;  2KGW A;  5KMG B;  5IJ0 A;  1FNK A;  5AVM A;  2CHT A;  5HY0 A;  3E1Y A;  1IV3 A;  1X25 A;  1RQ7 A;  2PMP A;  3CCV F;  1JD1 A;  1UFY A;  2Z1E A;  3GHZ A;  2P6Y A;  3UT5 B;  2ZVY A;  2HS4 A;  3VIU A;  3RYH A;  2IAF A;  4WBN A;  4C4W C;  4EI7 A;  2VAM A;  2KTU A;  2AIF A;  2QA4 F;  5GIN C;  5MN4 A;  1DBF A;  5EIB D;  3CCE F;  5J2T B;  4G4X A;  2QI2 A;  3WJQ A;  2HS0 A;  2R6R 1;  3OON A;  5EAZ A;  1Q7Y H;  5EZY A;  2LBX A;  3TD3 A;  1COM A;  1U3L A;  5GAN K;  3LWV C;  3WGM A;  1XHO A;  1IV4 A;  1W55 A;  1VQV A;  3CC7 F;  1TUB B;  4BY9 D;  4B46 A;  3HKB B;  3JAK B;  4ZK7 A;  1W5F A;  5GON B;  4X1Y B;  4EB6 B;  4I55 A;  5GAP K;  3KIZ A;  5IT9 M;  2OTL F;  3KHN A;  1CN7 A;  3C9S A;  4X20 B;  2GZL A;  3F0E A;  1VQO F;  3GTZ A;  1E7K A;  3IEW A;  4TUY B;  4YJ3 A;  3CCJ F;  4DXD A;  1VQM F;  1W58 1;  1ZWZ A;  3RYC B;  1T0K B;  5FJ4 C;  2UYN B;  2VGM A;  4U3J B;  1JFF B;  2IG8 A;  4I50 A;  3KJK A;  3G6E F;  3CCS F;  1RLG A;  2ZOD A;  3QUW A;  2ZOV A;  1SA0 A;  1YJ9 F;  3E22 B;  3VO8 A;  4G4W A;  4BT7 A;  4XCQ A;  3DC2 A;  2EWC A;  2HRY A;  2N48 A;  4ZI7 B;  4BVR A;  3PAF A;  4O4L B;  1Z5V A;  3J80 M;  1VQK F;  4G88 A;  1W3E X;  1KQS F;  4G4Z A;  3VOB A;  3S06 A;  1X7O A;  1GO1 A;  3M1X A;  4PWT A;  4R40 B;  2H8C A;  2PHN A;  4F6R A;  3CCL F;  5ITZ B;  2JNB A;  2GLZ A;  3E20 B;  3FBA A;  3N2G B;  1YIJ F;  4E6E A;  5FLX M;  5HP7 A;  1ONI A;  4BVS A;  1W5B A;  2HS3 A;  4HNA A;  4X1K B;  3CC2 F;  3ON1 A;  2CW4 A;  4O4J A;  5A2Q M;  1VHA A;  5B8F A;  3U0O A;  3WXM B;  4BT5 A;  5HWE A;  5JCO C;  4LNU A;  5G4V C;  1KNJ A;  3K14 A;  3VOA A;  2HP3 A;  3VCZ A;  5JH7 B;  3S0Y A;  2FGY A;  1CK2 A;  5LA6 A;  3IKF A;  2W8B C;  4IHJ A;  5LXT B;  3CPQ A;  4IIJ A;  2Q1X A;  1XRG A;  5EYP B;  4YJ2 A;  1QVF F;  2ALE A;  3C9R A;  5HXZ A;  2QTP A;  4I4T A;  3RYI A;  1W2B F;  3JAW B;  3CD6 F;  2ZAU A;  2CHS A;  4BVQ A;  5EB0 A;  2AMT A;  4B45 A;  5IJ0 B;  1H47 A;  3HJW C;  1NQ3 A;  2CZW A;  2AIZ P;  3NVK E;  1K9M H;  5HY1 A;  3J81 M;  1DT9 A;  3S02 A;  1VQ4 F;  4TV9 A;  3VMF B;  4ERH A;  1M1K H;  5DCV A;  1OAP A;  4B62 A;  2RHH A;  3CXC F;  2OTM A;  3RYH B;  4WBN B;  3LWR C;  2WAL A;  4O2A A;  4BT6 A;  2KTV A;  5JQG A;  3VYT C;  1XBI A;  4NWO B;  2Z1U A;  5LOV A;  4ZHV A;  3QTY A;  4BT4 A;  1H48 A;  1QAH A;  3JAS A;  3J7A R;  3SIV A;  3MCA B;  1PF5 A;  5EZY B;  2V9Y A;  3N4Y A;  3HKC A;  1VQP F;  4ZOL A;  1XV2 A;  3CG6 A;  3KJJ A;  3MDO A;  2I6R A;  2IQQ A;  2BTQ B;  1YI2 F;  3WGL A;  3I7T A;  3LFO A;  5FNV A;  2BTU A;  4I55 B;  3LDT A;  5GIO C;  4O2B A;  1X7P A;  2L26 A;  3HKE A;  1VQ9 F;  2UYP A;  1Q82 H;  1SZQ A;  1M90 H;  1T0A A;  4YJ3 B;  2GVI A;  5EO3 A;  4EI8 A;  1U40 A;  1QU9 A;  2HVY D;  3MBM A;  4I50 B;  2H6L A;  2ZF8 A;  3G4S F;  3D00 A;  1NMU B;  1SA0 B;  3HKD A;  5IYZ A;  1SDS A;  2OHW A;  3VTI C;  5IJ9 B;  1VQN F;  3BYQ A;  1IPA A;  4FFB A;  5HP8 A;  3P4E A;  3V7Q A;  5LYJ A;  3I55 F;  5HXU A;  5C8Y A;  3JAM M;  3K12 A;  4O4H A;  3HWU A;  3AGK A;  4F6R B;  4C81 A;  1YQN A;  2B33 A;  3LWO C;  5JVD A;  4TV8 A;  3F6M A;  3NK7 A;  3TD4 A;  1H7M A;  1TVK A;  3C9U A;  5IJ9 A;  4HNA B;  3N4Z A;  1NJI H;  3L7Q A;  4O4J B;  1KNK A;  5HY4 A;  2NMU A;  3S03 A;  5EB1 B;  3PLA C;  1ODE A;  1RLU A;  1X52 A;  4LNU B;  1U3P A;  2UYK A;  2RHJ A;  2UZH A;  3CYP B;  5LA6 B;  4IHJ B;  4IIJ B;  2G9I A;  4YJ2 B;  3MQW A;  3VYS C;  3JVH A;  5GIP C;  4O4I A;  4B5C A;  2F9Z C;  3M4S A;  3WPW A;  5MN6 A;  4I4T B;  1KD1 H;  3RYI B;  3FD5 A;  5G4U C;  2DYY A;  3IMP A;  3WPX A;  3ESJ A;  1K73 H;  3JAR A;  1VQ8 F;  2H8E A;  2K1S A;  3KE1 A;  4TV9 B;  1JY8 A;  2HRU A;  2VXY A;  3RA6 A;  1R1M A;  3RYF A;  3C8L A;  3CMA F;  5CA0 A;  2YYE A;  3V4D A;  3R0P A;  4O2A B;  5EWR A;  5JQG B;  3NVI B;  2MQE A;  4DRX B;  2OZB A;  3N2K A;  5BMV A;  5LOV B;  1FSZ A;  5KX5 A;  3JAT A;  2YXZ A;  2HP0 A;  3JAS B;  4NUT A;  4BW0 B;  1J7H A;  3HKC B;  1GX1 A;  3JAL A;  4ZOL B;  2QEX F;  3CB2 A;  3D54 A;  1YJN F;  5CA1 A;  3CCU F;  1W59 A;  3C9T A;  2RHL A;  1Q81 H;  2BTO A;  4DRX A;  5LP6 A;  2CVL A;  5J2U A;  5FNV B;  2KG4 A;  5HY2 A;  1Q86 H;  4O2B B;  3DDN A;  3ZP4 A;  3HKE B;  4M8I A;  2OTJ F;  1FFX A;  3ZOP A;  3NMU C;  3CPW F;  5CB4 A;  4C8G A;  4BVT A;  4X1I A;  3ZP7 A;  4ZHQ A;  3TD5 A;  3CME F;  4EI9 A;  3V3T A;  3CCQ F;  1IV1 A;  3JCM M;  3SIU A;  2ZVZ A;  3HKD B;  1S72 F;  5IYZ B;  1IV2 A;  4FFB B;  2Z1T A;  3OBW A;  3D01 A;  3CC4 F;  5LYJ B;  4RQO A;  5C8Y B;  4O4H B;  3LYB A;  4G4Y A;  5EIB C;  1RQ2 A;  2LCA A;  1N8R H;  3ELC A;  4ZHW A;  1VQL F;  1JJ2 F;  1YJW F;  3GYQ A;  5JVD B;  4TV8 B;  3B6N A;  3EOR A;  5KMG A;  4C8E A;  1TVK B;  3ERN A;  3P10 A;  3NK6 A;  1W57 A;  2Z01 A;  2LBW A;  1KC8 H;  1U43 A;  5LP6 C;  3UT5 A;  5MN5 A;  3FPI A;  3RE3 A;  3IEQ A;  1W42 A;  3HAX D;  3CCR F;  3LME A;  3CYQ A;  1OFU A;  4X3L A;  2Q1Y A;  2CWJ A;  1RA4 A;  3WGN A;  5J2T A;  4TZZ A;  3Q8H A;  1VQ6 F;  4NQ3 A;  4O4I B;  1YHQ F;  2R75 1;  5JCO A;  2VGN A;  1W5E A;  1W5A A;  3P0Z A;  4G4V A;  2VAP A;  3OW2 F;  1CLI A;  3F0G A;  1Q8R A;  3IKE A;  3JAR B;  3K2X A;  4X3M A;  2LBT A;  3G71 F;  2HX0 A;  3S0W A;  1TUB A;  3HKB A;  3JAK A;  1W40 A;  2UYJ A;  1VH8 A;  3K0T A;  5GON A;  2HQS C;  4X1Y A;  4EB6 A;  4U39 A;  1K8A H;  1UI9 A;  3RYF B; 
#chains in the Genus database with same CATH homology
 3MBM A;  4C8I A;  3F6M A;  1VHA A;  3ELC A;  3Q8H A;  5B8F A;  4C8G A;  3ESJ A;  3B6N A;  1GX1 A;  1KNJ A;  3EOR A;  3K14 A;  3QHD A;  3P0Z A;  4C8E A;  1KNK A;  3ERN A;  2GZL A;  1IV1 A;  3F0E A;  3F0F A;  3KE1 A;  3P10 A;  3IKF A;  1JY8 A;  1W57 A;  3F0D A;  3IEW A;  4C82 A;  3F0G A;  1U43 A;  1U3P A;  3IKE A;  3K2X A;  1IV2 A;  3T80 A;  1JN1 A;  1IV3 A;  2UZH A;  3FBA A;  1U3L A;  3FPI A;  3RE3 A;  1VH8 A;  1H48 A;  1T0A A;  2PMP A;  3IEQ A;  1U40 A;  3GHZ A;  3JVH A;  1IV4 A;  4C81 A;  1YQN A;  2AMT A;  1W55 A;  1H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...