3RE3A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from francisella tularensis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
148
Chain Sequence
NAMSFRIGHGYDVHKFTSAKQNIIIGGVEIAYHLDGDVLIHALCDAILGALGLGDIGKHFKNIDSKFFLAEIKKMLDKKQYSISNIDCTIIAQAPKMLPHIEKMRACLANILEIQISQINIKATTTERLGFIGREEGIATHVVCLLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 39
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3re3A00
3EORA 1U43A 4C8EA 2PMPA 1U3PA 1W55A 2UZHA 3K2XA 3RE3A 1H47A 3IKFA 3B6NA 3P10A 3ERNA 3FBAA 3F0DA 1IV4A 4C81A 3IKEA 3Q8HA 3F6MA 1IV2A 1T0AA 3F0EA 1IV3A 3QHDA 2AMTA 3ELCA 3IEWA 3F0GA 3KE1A 3T80A 1KNJA 3P0ZA 1JN1A 1W57A 3GHZA 3MBMA 4C82A 3JVHA 1VH8A 1KNKA 1YQNA 1U40A 2GZLA 3F0FA 4C8GA 3IEQA 1GX1A 4C8IA 1VHAA 5B8FA 3FPIA 1U3LA 3ESJA 3K14A 1IV1A 1JY8A 1H48A
chains in the Genus database with same CATH superfamily
2IQQA 3JAKB 3WGNA 4O2BB 1YGYA 1VQPF 3CMAF 1VQ9F 4C4WC 5IJ9A 2QI2A 3D00A 5FNVB 5A2QM 3AGKA 3HKEB 1VQ8F 4U3JA 3MQWA 3N4YA 1W59A 1ONIA 4BVRA 4NWOB 3NVIB 3VYSC 2Q1XA 3F0GA 4X20B 1KQSF 3E1YA 1CK2A 5HP8A 1XRGA 4O4LA 2H8CA 3VTIC 4ZHWA 4C82A 3FD5A 3KJJA 4TZZA 2DYYA 1VHAA 5G4UC 4ZHQB 5LP6A 5EZYA 2HS0A 4KWEA 1PXWA 1TUBA 1QU9A 3C9RA 2CSLA 3LWOC 2VAWA 4TV9B 4O2BA 4EI7A 5JVDB 3ZP4A 3C8LA 4FFBB 3ZOPA 1KD1H 3CXCF 2HRYA 3V4DA 1FNJA 3WJQA 4YJ2B 2BTUA 5JQGA 3IEWA 3G6EF 1YHQF 2KTUA 3PAFA 3U0OA 5C8YB 3RYFB 1COMA 2HVYD 4G4ZA 2MQEA 3KHNA 4X20A 1XV2A 1JN1A 3RYCA 1SZQA 2GZLA 5IT9M 5B8FA 3LWQC 3I55F 1U3LA 4ZHYB 3G71F 3EORA 2RHJA 1JFFA 4ZHQA 3SIVA 3N4ZA 5EIBD 4X1YB 1UFYA 2R6R1 4G88A 3P10A 4TV9A 3F0DA 3VOAA 3CG6A 4O4IB 3RYHA 4EB6B 2RB9A 2OZBA 1W581 1KNJA 5IJ0B 2Q1YA 4I50A 1NMUB 3I56F 2Z1EA 5LXTA 2LCAA 2RHOA 4O2AB 3NMUC 3JAWA 2JNBA 2IG8A 1GX1A 2G9IA 1VQKF 3VYTC 1YJWF 4X1KA 2PMPA 3CC4F 1VK3A 3VIUA 3K2XA 5EAZA 3MCQA 5G4VC 4X1YA 3LWPC 4B5CA 2HS3A 1Q82H 5HXZA 3ELCA 2L26A 2N48A 5EYPB 4U39A 5EWRA 3FD6A 4O4IA 4EB6A 3CPWF 4LCKA 5IJ0A 3JVHA 2AIFA 3F0FA 3QTYA 1CLIA 4C8IA 2CHTA 2YXZA 4IHJB 1W5EA 3CC7F 3OW2F 3V7QA 5EO3A 4I55A 2UZHA 3IR9A 3NK7A 3ZO8A 1FFXA 3UT5B 4WBNB 4DRXB 3HAXD 4O4JB 2OTJF 5J2TB 4XCQA 3JATB 3CMEF 1E7KA 3J81M 2VXYA 2OTLF 1W5BA 4O4LB 4ZK7A 5J2UA 1SA0A 2CW4A 3I3FA 1RQ7A 1KNKA 1U40A 3WPWA 1QVGF 2VGMA 2WALA 3OBYA 3ESJA 3FPIA 1KC8H 1TUBB 3L7QA 4IHJA 1NQ3A 2ZVZA 1W55A 1RQ2A 2BTQB 2K1SA 3J80M 1T0KB 3O85A 3LYBA 3VO8A 2R751 3UT5A 4C81A 5ITZA 4WBNA 3N2GB 4DRXA 5JQGB 4O4JA 5J2TA 5AVMA 3JATA 3T80A 5LYJA 3KJKA 1OAPA 3VOBA 3RYCB 1X7PA 2ZODA 5GIPC 2Z1TA 4HNAA 2CZWA 5IYZA 4BW0B 5CB4B 1X25A 2HQSC 4RQOA 5LP6C 1JFFB 1X7OA 5EIBC 1U43A 1RLUA 1VQMF 3RYHB 1W3EX 3IKEA 5CA0A 3CYPB 3N2GA 4I50B 3LMEA 5HY1A 5GONB 5LXTB 1JD1A 3P0ZA 2F9ZC 1M1KH 3S03A 1QAHA 5FLXM 3JAWB 1YQNA 5HY4A 5HY2A 4BT2A 2VAPA 4X1KB 3K14A 4BT7A 3S0WA 2H6LA 3N2KB 5CB4A 1RLGA 3HWUA 5GAPK 4BY9D 3E20B 1W42A 2LBTA 3V7EA 1DBFA 4BVTA 2KG4A 5MN6A 3VYUC 4EI8A 3ZP7A 4B62A 4TV8B 2HS4A 3C9UA 2V9YA 5GONA 5HY0A 2FC3A 5HWEA 2LBXA 3LWVC 3IEQA 5FJ4C 2UYPA 1VQOF 1Q8RA 4C8EA 3D01A 4I55B 2UYNB 4O4HA 1FFXB 3N2KA 3JALA 1IV4A 4EI9A 3DC2A 3WGLA 5KMGB 4ERHA 4B45A 1GO0A 5J2UB 1SA0B 5LA6B 5MN4A 1TVKA 5JCOA 4TV8A 2QA4F 2Z01A 3SIUA 3WXMB 4BT3A 2PHNA 5DCVA 1YI2F 1YJNF 2ZOVA 3S06A 2RHLA 1VQLF 4NUTA 2UYNA 3CB2A 3CCVF 3IKFA 4ZI7A 5ITZB 3B6NA 3CCJF 3FBAA 4I4TB 5GANK 3NVKE 1RA4A 5LYJB 5KMGA 2QEXF 2OHWA 3TD4A 4X1IB 1VQNF 1ZWZA 3E22A 3WJRA 5LA6A 4HNAB 5HP7A 3M4SA 1DT9A 5IYZB 2ZVYA 3CCMF 3C9TA 2HP3A 1IV1A 4ZHVA 3CYQA 1Q81H 2CWJA 5EB0A 1Q7YH 1U3PA 3VMFB 2ZAUA 1FNKA 3JAMM 3BYQA 1VQ6F 3LFOA 4TUYB 3S0YA 1Z5WA 5CA0B 2ALEA 4I4TA 3K0TA 1IV3A 3CPQA 3CCQF 1W40A 1OFUA 3HTNA 2RHHA 1K8AH 3HKCA 4X1IA 3RA6A 4ZOLA 1XBIA 3I7TA 4IIJB 5KX5A 2VAMA 4BT5A 2EWCA 1W5AA 1VQ7F 3CCUF 5EB1B 1QD9A 3GYQA 1JY8A 1CN7A 4E6EA 3CCSF 2OTMA 3OONA 1NJIH 1W41A 4TUYA 3TD5A 3GTZA 3WGMA 4BT4A 2AIZP 1K9MH 3KE1A 3S02A 3RA5A 2CHSA 3GHZA 3MBMA 1X52A 1SDSA 1M90H 3P4EA 3HKDA 4IIJA 5BMVB 3CD6F 4O4HB 2LBWA 1YIJF 1UI9A 1VQVA 4M8IA 3PLAC 3R0PA 2Z1UA 3JAKA 3MCAB 2CVLA 2H8EA 1W2BF 3WGKA 4F6RB 3JALB 3G4SF 3RE3A 5FNVA 1J7HA 3JASB 3HKEA 5JH7B 3KIZA 4G4VA 1S72F 1IV2A 4NQ3A 2AMTA 3OBWA 4PWTA 1K73H 1TVKB 4B46A 1Z5VA 1Q86H 2VGNA 4BVQA 5HXUA 4DXDA 4YJ3B 3F6MA 5BMVA 5MN5A 5GIOC 1GZ0A 3HJWC 3FFMA 4ZI7B 1H47A 2YYEA 5JVDA 2GLZA 2I6RA 2UYKA 4F6RA 3HKBB 3M84A 3DDNA 3S0HA 1JJ2F 4FFBA 4R40B 3JASA 1T0AA 1ODEA 3F0EA 3J7AR 1PF5A 5JH7A 3D54A 4YJ2A 1VQ4F 3E22B 5C8YA 5JCOC 5LOVB 2KTVA 3RYFA 5CA1B 3K12A 2HP0B 4C8GA 3MDOA 2BTOA 1W5FA 2GVIA 3WGJA 4RHAA 4YJ3A 1GO1A 2BO1A 3RYIB 3JARB 1QVFF 2W8BC 3TD3A 3Q8HA 3CCLF 3JCMM 2DT4A 3HKBA 3VI6A 3M1XA 3V3TA 2FGYA 4BT6A 3NK6A 4G4YA 1H7MA 3HKCB 4LNUB 4BVSA 2QTPA 3WJPA 2KGWA 4ZOLB 4X3MA 1YITF 5KX5B 5LOVA 3QUWA 1VH8A 3WPXA 2B33A 5CA1A 2HP0A 2NMUA 4O2AA 1VQ5F 3C9SA 3CCRF 5IJ9B 5GINC 3ERNA 1XHOA 1IPAA 3LWRC 2UYJA 3CCEF 1FSZA 4U3JB 2HX0A 1N8RH 4X3LA 3RYIA 3JARA 4G4WA 3QHDA 3VCZA 2HRUA 1YJ9F 2ZF8A 1R1MA 5EYPA 3CC2F 2Z1FA 2I6DA 1W57A 4LNUA 2IAFA 2P6YA 3ON1A 4G4XA 3HKDB 3IMPA 5LP6B 5EZYB 3LDTA 1H48A
chains in the Genus database with same CATH topology
3EORA 1U43A 4C8EA 2PMPA 1U3PA 1W55A 2UZHA 3K2XA 3RE3A 1H47A 3IKFA 3B6NA 3P10A 3ERNA 3FBAA 3F0DA 1IV4A 4C81A 3IKEA 3Q8HA 3F6MA 1IV2A 1T0AA 3F0EA 1IV3A 3QHDA 2AMTA 3ELCA 3IEWA 3F0GA 3KE1A 3T80A 1KNJA 3P0ZA 1JN1A 1W57A 3GHZA 3MBMA 4C82A 3JVHA 1VH8A 1KNKA 1YQNA 1U40A 2GZLA 3F0FA 4C8GA 3IEQA 1GX1A 4C8IA 1VHAA 5B8FA 3FPIA 1U3LA 3ESJA 3K14A 1IV1A 1JY8A 1H48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOR A;  1U43 A;  4C8E A;  2PMP A;  1U3P A;  1W55 A;  2UZH A;  3K2X A;  3RE3 A;  1H47 A;  3IKF A;  3B6N A;  3P10 A;  3ERN A;  3FBA A;  3F0D A;  1IV4 A;  4C81 A;  3IKE A;  3Q8H A;  3F6M A;  1IV2 A;  1T0A A;  3F0E A;  1IV3 A;  3QHD A;  2AMT A;  3ELC A;  3IEW A;  3F0G A;  3KE1 A;  3T80 A;  1KNJ A;  3P0Z A;  1JN1 A;  1W57 A;  3GHZ A;  3MBM A;  4C82 A;  3JVH A;  1VH8 A;  1KNK A;  1YQN A;  1U40 A;  2GZL A;  3F0F A;  4C8G A;  3IEQ A;  1GX1 A;  4C8I A;  1VHA A;  5B8F A;  3FPI A;  1U3L A;  3ESJ A;  3K14 A;  1IV1 A;  1JY8 A;  1H48 A; 
#chains in the Genus database with same CATH topology
 2IQQ A;  3JAK B;  3WGN A;  4O2B B;  1YGY A;  1VQP F;  3CMA F;  1VQ9 F;  4C4W C;  5IJ9 A;  2QI2 A;  3D00 A;  5FNV B;  5A2Q M;  3AGK A;  3HKE B;  1VQ8 F;  4U3J A;  3MQW A;  3N4Y A;  1W59 A;  1ONI A;  4BVR A;  4NWO B;  3NVI B;  3VYS C;  2Q1X A;  3F0G A;  4X20 B;  1KQS F;  3E1Y A;  1CK2 A;  5HP8 A;  1XRG A;  4O4L A;  2H8C A;  3VTI C;  4ZHW A;  4C82 A;  3FD5 A;  3KJJ A;  4TZZ A;  2DYY A;  1VHA A;  5G4U C;  4ZHQ B;  5LP6 A;  5EZY A;  2HS0 A;  4KWE A;  1PXW A;  1TUB A;  1QU9 A;  3C9R A;  2CSL A;  3LWO C;  2VAW A;  4TV9 B;  4O2B A;  4EI7 A;  5JVD B;  3ZP4 A;  3C8L A;  4FFB B;  3ZOP A;  1KD1 H;  3CXC F;  2HRY A;  3V4D A;  1FNJ A;  3WJQ A;  4YJ2 B;  2BTU A;  5JQG A;  3IEW A;  3G6E F;  1YHQ F;  2KTU A;  3PAF A;  3U0O A;  5C8Y B;  3RYF B;  1COM A;  2HVY D;  4G4Z A;  2MQE A;  3KHN A;  4X20 A;  1XV2 A;  1JN1 A;  3RYC A;  1SZQ A;  2GZL A;  5IT9 M;  5B8F A;  3LWQ C;  3I55 F;  1U3L A;  4ZHY B;  3G71 F;  3EOR A;  2RHJ A;  1JFF A;  4ZHQ A;  3SIV A;  3N4Z A;  5EIB D;  4X1Y B;  1UFY A;  2R6R 1;  4G88 A;  3P10 A;  4TV9 A;  3F0D A;  3VOA A;  3CG6 A;  4O4I B;  3RYH A;  4EB6 B;  2RB9 A;  2OZB A;  1W58 1;  1KNJ A;  5IJ0 B;  2Q1Y A;  4I50 A;  1NMU B;  3I56 F;  2Z1E A;  5LXT A;  2LCA A;  2RHO A;  4O2A B;  3NMU C;  3JAW A;  2JNB A;  2IG8 A;  1GX1 A;  2G9I A;  1VQK F;  3VYT C;  1YJW F;  4X1K A;  2PMP A;  3CC4 F;  1VK3 A;  3VIU A;  3K2X A;  5EAZ A;  3MCQ A;  5G4V C;  4X1Y A;  3LWP C;  4B5C A;  2HS3 A;  1Q82 H;  5HXZ A;  3ELC A;  2L26 A;  2N48 A;  5EYP B;  4U39 A;  5EWR A;  3FD6 A;  4O4I A;  4EB6 A;  3CPW F;  4LCK A;  5IJ0 A;  3JVH A;  2AIF A;  3F0F A;  3QTY A;  1CLI A;  4C8I A;  2CHT A;  2YXZ A;  4IHJ B;  1W5E A;  3CC7 F;  3OW2 F;  3V7Q A;  5EO3 A;  4I55 A;  2UZH A;  3IR9 A;  3NK7 A;  3ZO8 A;  1FFX A;  3UT5 B;  4WBN B;  4DRX B;  3HAX D;  4O4J B;  2OTJ F;  5J2T B;  4XCQ A;  3JAT B;  3CME F;  1E7K A;  3J81 M;  2VXY A;  2OTL F;  1W5B A;  4O4L B;  4ZK7 A;  5J2U A;  1SA0 A;  2CW4 A;  3I3F A;  1RQ7 A;  1KNK A;  1U40 A;  3WPW A;  1QVG F;  2VGM A;  2WAL A;  3OBY A;  3ESJ A;  3FPI A;  1KC8 H;  1TUB B;  3L7Q A;  4IHJ A;  1NQ3 A;  2ZVZ A;  1W55 A;  1RQ2 A;  2BTQ B;  2K1S A;  3J80 M;  1T0K B;  3O85 A;  3LYB A;  3VO8 A;  2R75 1;  3UT5 A;  4C81 A;  5ITZ A;  4WBN A;  3N2G B;  4DRX A;  5JQG B;  4O4J A;  5J2T A;  5AVM A;  3JAT A;  3T80 A;  5LYJ A;  3KJK A;  1OAP A;  3VOB A;  3RYC B;  1X7P A;  2ZOD A;  5GIP C;  2Z1T A;  4HNA A;  2CZW A;  5IYZ A;  4BW0 B;  5CB4 B;  1X25 A;  2HQS C;  4RQO A;  5LP6 C;  1JFF B;  1X7O A;  5EIB C;  1U43 A;  1RLU A;  1VQM F;  3RYH B;  1W3E X;  3IKE A;  5CA0 A;  3CYP B;  3N2G A;  4I50 B;  3LME A;  5HY1 A;  5GON B;  5LXT B;  1JD1 A;  3P0Z A;  2F9Z C;  1M1K H;  3S03 A;  1QAH A;  5FLX M;  3JAW B;  1YQN A;  5HY4 A;  5HY2 A;  4BT2 A;  2VAP A;  4X1K B;  3K14 A;  4BT7 A;  3S0W A;  2H6L A;  3N2K B;  5CB4 A;  1RLG A;  3HWU A;  5GAP K;  4BY9 D;  3E20 B;  1W42 A;  2LBT A;  3V7E A;  1DBF A;  4BVT A;  2KG4 A;  5MN6 A;  3VYU C;  4EI8 A;  3ZP7 A;  4B62 A;  4TV8 B;  2HS4 A;  3C9U A;  2V9Y A;  5GON A;  5HY0 A;  2FC3 A;  5HWE A;  2LBX A;  3LWV C;  3IEQ A;  5FJ4 C;  2UYP A;  1VQO F;  1Q8R A;  4C8E A;  3D01 A;  4I55 B;  2UYN B;  4O4H A;  1FFX B;  3N2K A;  3JAL A;  1IV4 A;  4EI9 A;  3DC2 A;  3WGL A;  5KMG B;  4ERH A;  4B45 A;  1GO0 A;  5J2U B;  1SA0 B;  5LA6 B;  5MN4 A;  1TVK A;  5JCO A;  4TV8 A;  2QA4 F;  2Z01 A;  3SIU A;  3WXM B;  4BT3 A;  2PHN A;  5DCV A;  1YI2 F;  1YJN F;  2ZOV A;  3S06 A;  2RHL A;  1VQL F;  4NUT A;  2UYN A;  3CB2 A;  3CCV F;  3IKF A;  4ZI7 A;  5ITZ B;  3B6N A;  3CCJ F;  3FBA A;  4I4T B;  5GAN K;  3NVK E;  1RA4 A;  5LYJ B;  5KMG A;  2QEX F;  2OHW A;  3TD4 A;  4X1I B;  1VQN F;  1ZWZ A;  3E22 A;  3WJR A;  5LA6 A;  4HNA B;  5HP7 A;  3M4S A;  1DT9 A;  5IYZ B;  2ZVY A;  3CCM F;  3C9T A;  2HP3 A;  1IV1 A;  4ZHV A;  3CYQ A;  1Q81 H;  2CWJ A;  5EB0 A;  1Q7Y H;  1U3P A;  3VMF B;  2ZAU A;  1FNK A;  3JAM M;  3BYQ A;  1VQ6 F;  3LFO A;  4TUY B;  3S0Y A;  1Z5W A;  5CA0 B;  2ALE A;  4I4T A;  3K0T A;  1IV3 A;  3CPQ A;  3CCQ F;  1W40 A;  1OFU A;  3HTN A;  2RHH A;  1K8A H;  3HKC A;  4X1I A;  3RA6 A;  4ZOL A;  1XBI A;  3I7T A;  4IIJ B;  5KX5 A;  2VAM A;  4BT5 A;  2EWC A;  1W5A A;  1VQ7 F;  3CCU F;  5EB1 B;  1QD9 A;  3GYQ A;  1JY8 A;  1CN7 A;  4E6E A;  3CCS F;  2OTM A;  3OON A;  1NJI H;  1W41 A;  4TUY A;  3TD5 A;  3GTZ A;  3WGM A;  4BT4 A;  2AIZ P;  1K9M H;  3KE1 A;  3S02 A;  3RA5 A;  2CHS A;  3GHZ A;  3MBM A;  1X52 A;  1SDS A;  1M90 H;  3P4E A;  3HKD A;  4IIJ A;  5BMV B;  3CD6 F;  4O4H B;  2LBW A;  1YIJ F;  1UI9 A;  1VQV A;  4M8I A;  3PLA C;  3R0P A;  2Z1U A;  3JAK A;  3MCA B;  2CVL A;  2H8E A;  1W2B F;  3WGK A;  4F6R B;  3JAL B;  3G4S F;  3RE3 A;  5FNV A;  1J7H A;  3JAS B;  3HKE A;  5JH7 B;  3KIZ A;  4G4V A;  1S72 F;  1IV2 A;  4NQ3 A;  2AMT A;  3OBW A;  4PWT A;  1K73 H;  1TVK B;  4B46 A;  1Z5V A;  1Q86 H;  2VGN A;  4BVQ A;  5HXU A;  4DXD A;  4YJ3 B;  3F6M A;  5BMV A;  5MN5 A;  5GIO C;  1GZ0 A;  3HJW C;  3FFM A;  4ZI7 B;  1H47 A;  2YYE A;  5JVD A;  2GLZ A;  2I6R A;  2UYK A;  4F6R A;  3HKB B;  3M84 A;  3DDN A;  3S0H A;  1JJ2 F;  4FFB A;  4R40 B;  3JAS A;  1T0A A;  1ODE A;  3F0E A;  3J7A R;  1PF5 A;  5JH7 A;  3D54 A;  4YJ2 A;  1VQ4 F;  3E22 B;  5C8Y A;  5JCO C;  5LOV B;  2KTV A;  3RYF A;  5CA1 B;  3K12 A;  2HP0 B;  4C8G A;  3MDO A;  2BTO A;  1W5F A;  2GVI A;  3WGJ A;  4RHA A;  4YJ3 A;  1GO1 A;  2BO1 A;  3RYI B;  3JAR B;  1QVF F;  2W8B C;  3TD3 A;  3Q8H A;  3CCL F;  3JCM M;  2DT4 A;  3HKB A;  3VI6 A;  3M1X A;  3V3T A;  2FGY A;  4BT6 A;  3NK6 A;  4G4Y A;  1H7M A;  3HKC B;  4LNU B;  4BVS A;  2QTP A;  3WJP A;  2KGW A;  4ZOL B;  4X3M A;  1YIT F;  5KX5 B;  5LOV A;  3QUW A;  1VH8 A;  3WPX A;  2B33 A;  5CA1 A;  2HP0 A;  2NMU A;  4O2A A;  1VQ5 F;  3C9S A;  3CCR F;  5IJ9 B;  5GIN C;  3ERN A;  1XHO A;  1IPA A;  3LWR C;  2UYJ A;  3CCE F;  1FSZ A;  4U3J B;  2HX0 A;  1N8R H;  4X3L A;  3RYI A;  3JAR A;  4G4W A;  3QHD A;  3VCZ A;  2HRU A;  1YJ9 F;  2ZF8 A;  1R1M A;  5EYP A;  3CC2 F;  2Z1F A;  2I6D A;  1W57 A;  4LNU A;  2IAF A;  2P6Y A;  3ON1 A;  4G4X A;  3HKD B;  3IMP A;  5LP6 B;  5EZY B;  3LDT A;  1H48 A; 
#chains in the Genus database with same CATH homology
 3EOR A;  1U43 A;  4C8E A;  2PMP A;  1U3P A;  1W55 A;  2UZH A;  3K2X A;  3RE3 A;  1H47 A;  3IKF A;  3B6N A;  3P10 A;  3ERN A;  3FBA A;  3F0D A;  1IV4 A;  4C81 A;  3IKE A;  3Q8H A;  3F6M A;  1IV2 A;  1T0A A;  3F0E A;  1IV3 A;  3QHD A;  2AMT A;  3ELC A;  3IEW A;  3F0G A;  3KE1 A;  3T80 A;  1KNJ A;  3P0Z A;  1JN1 A;  1W57 A;  3GHZ A;  3MBM A;  4C82 A;  3JVH A;  1VH8 A;  1KNK A;  1YQN A;  1U40 A;  2GZL A;  3F0F A;  4C8G A;  3IEQ A;  1GX1 A;  4C8I A;  1VHA A;  5B8F A;  3FPI A;  1U3L A;  3ESJ A;  3K14 A;  1IV1 A;  1JY8 A;  1H48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...