2CHSA

Crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE
publication title Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 28
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2chsA00
1JD1A 2CWJA 2CW4A 2IG8A 2CHSA 1QU9A 3D01A 3LMEA 3ZO8A 1J7HA 2CHTA 3M4SA 3ZOPA 1X25A 1NQ3A 2UYJA 2UYKA 1XRGA 3ZP7A 4ZK7A 5HP7A 3KJKA 3R0PA 1QD9A 1UI9A 2UYPA 3L7QA 1ODEA 2B33A 4NWOB 3QUWA 3K0TA 1DBFA 3GTZA 1FNJA 2CVLA 1UFYA 1XHOA 3ZP4A 1FNKA 1COMA 2CSLA 3I7TA 2OTMA 3MQWA 3V4DA 2EWCA 1QAHA 5HP8A 3LYBA 1PF5A 3K12A 2UYNA 3M1XA 2UYNB 1ONIA 3I3FA 3KJJA 3VCZA 2DYYA
chains in the Genus database with same CATH superfamily
3WGJA 2GZLA 3JARA 2VGNA 2Z01A 1W41A 2YXZA 2HS3A 4X20B 3ZP7A 5KX5B 3HJWC 3C9SA 2BTUA 3RYIA 4NWOB 1YJ9F 1YJNF 3WJQA 3ZP4A 1XHOA 2RHJA 3RA6A 1Q86H 1M1KH 1VQLF 3PLAC 3K14A 3T80A 3C9TA 3O85A 3CYPB 1JY8A 2IQQA 4X1IA 3WJPA 3HKBA 4C4WC 3LWQC 3HKCB 3KJJA 3LYBA 3WGNA 1W57A 5EZYB 5JH7B 5GAPK 1E7KA 5IT9M 1FFXB 1SA0A 3DDNA 3MCQA 3UT5B 5DCVA 5LA6B 2GLZA 3N2KB 3VOBA 5IYZB 4E6EA 3WGLA 2RB9A 2F9ZC 3F0FA 2HQSC 1FNKA 2L26A 4IHJA 1KNJA 5KMGA 2Q1YA 1ZWZA 4ZOLA 2Z1FA 1N8RH 3Q8HA 5EAZA 1RLGA 1IPAA 5EIBC 1IV1A 4EI8A 4WBNB 3VCZA 4B45A 3JAKA 4O4LB 5LP6C 4I4TB 1VK3A 1JJ2F 5EB0A 2KG4A 4BVRA 5CA1B 2Q1XA 1FNJA 3F0EA 4YJ3B 3RE3A 1VQVA 3G71F 1W40A 4G4WA 4TUYB 4TV8B 5ITZA 1K8AH 3D00A 2QTPA 2HS4A 1W2BF 3NK7A 1TUBB 1W5AA 3ZO8A 4KWEA 2RHLA 2N48A 5EWRA 4F6RB 2KGWA 3PAFA 3JAWA 2UZHA 4U3JA 4C82A 3ZOPA 5JVDA 1X25A 3CCUF 2VAMA 3N2GA 4O4IA 3TD4A 4B5CA 3LWPC 1UI9A 1Z5VA 3JVHA 5HY2A 5GONB 3LWOC 4X1KA 3K0TA 2G9IA 3U0OA 4HNAB 2FC3A 1KC8H 1UFYA 1GX1A 3RYFB 3S0HA 1RA4A 1Q7YH 3N4YA 1U43A 1W3EX 5FLXM 1ONIA 2HX0A 4C8IA 3CCRF 3J80M 3G4SF 3JALB 2OZBA 5G4VC 3LMEA 1J7HA 1VQ7F 3IMPA 5IJ0A 2VAPA 3R0PA 1VQ9F 3K2XA 4TV9A 3S0YA 5J2UA 3LWVC 3ESJA 2P6YA 3CCMF 1GO1A 3WGKA 3CXCF 3VIUA 1S72F 5JCOC 3J81M 1VHAA 2HRUA 4BW0B 3OW2F 5C8YA 3CC7F 4BY9D 4ZHQB 1W59A 1XV2A 5CA0A 1RLUA 3CCLF 4BVTA 3BYQA 2H8EA 5JH7A 3OBWA 3RA5A 2HP3A 3JASA 3KHNA 1YI2F 2JNBA 3UT5A 3TD3A 3WGMA 2QI2A 4YJ2A 4M8IA 3LDTA 5LXTB 3P4EA 3ELCA 1GZ0A 2NMUA 3KIZA 4IIJA 3CPWF 2VGMA 3B6NA 3LFOA 5LYJA 2Z1TA 1OFUA 2VXYA 1U3LA 2LBTA 3RYCB 3P0ZA 4O4HA 1QVFF 2IAFA 4X3LA 4X1YB 3V3TA 3M1XA 4WBNA 4O2AB 4O4LA 3IKFA 2CZWA 2CWJA 4I50B 2CHSA 4FFBA 1TVKA 3TD5A 1VQNF 2RHHA 3M84A 1YJWF 2UYKA 5CB4A 5CA1A 3JAMM 3RYHB 1Q8RA 2KTVA 5AVMA 5IJ9B 3ERNA 2B33A 4DRXB 3J7AR 1JFFB 3C8LA 3F6MA 5FNVB 5LOVB 3DC2A 4ZI7A 3JATA 4TV8A 3CB2A 5BMVB 2OHWA 4O4JB 1QAHA 3HKDB 2UYNA 2HP0B 3MBMA 1X7OA 1T0KB 4NQ3A 5EYPA 1PXWA 4O2BA 4EB6B 3JARB 5HXZA 2CHTA 1NQ3A 5LP6A 3NMUC 4LNUA 3E22A 1Z5WA 3RYIB 1W581 4G4ZA 1VQMF 4C81A 3OONA 1U40A 2LBWA 5JQGA 2EWCA 3FD6A 1PF5A 3K12A 2I6RA 3F0GA 1SZQA 4X1IB 3HKBB 5HY0A 1JD1A 3HKEA 1QU9A 2ZVZA 4B62A 5HY4A 3WJRA 3CC4F 1SA0B 2HRYA 5EO3A 3MCAB 3S03A 1KD1H 2ZF8A 4EI9A 3C9UA 1VQPF 3NVIB 5J2TA 1FSZA 4C8EA 3FFMA 4I55A 2AIFA 1YITF 4IHJB 2PMPA 3QHDA 1VQOF 5B8FA 2YYEA 5EIBD 2GVIA 5KMGB 1YIJF 4ZOLB 1VQ8F 3CG6A 3JAKB 1VQ4F 1CN7A 1T0AA 4X20A 1X7PA 2I6DA 5KX5A 2UYJA 1W5EA 3MDOA 3VMFB 1QD9A 2W8BC 3VO8A 3GTZA 4B46A 1U3PA 3S0WA 4LCKA 2OTMA 3LWRC 1W5FA 5JCOA 2LCAA 3ON1A 4BT4A 4G4XA 3CCSF 2WALA 3FBAA 5ITZB 3CCEF 3HKCA 5EZYA 4C8GA 3HAXD 4XCQA 1FFXA 1VQKF 4EI7A 5JVDB 3JAWB 5LA6A 3WPXA 3KE1A 4ZHVA 3EORA 3N2KA 4RQOA 3CMAF 3N2GB 2FGYA 5IYZA 2UYPA 5FNVA 1ODEA 5LOVA 1X52A 3OBYA 4X1KB 4X3MA 2QA4F 1JN1A 1KNKA 2CSLA 1W5BA 4TZZA 1XBIA 1K73H 1NJIH 2RHOA 1VH8A 3AGKA 3I3FA 2AMTA 1R1MA 1W55A 2DYYA 2V9YA 2ZODA 3D01A 2HVYD 3NVKE 1H48A 4I4TA 3M4SA 3CYQA 3N4ZA 5IJ0B 3KJKA 4ZHWA 1IV4A 4TV9B 3WXMB 5J2UB 5GINC 3HTNA 2CVLA 4YJ3A 4ZHYB 2Z1UA 5C8YB 1IV2A 2AIZP 4TUYA 1VQ6F 1RQ7A 2DT4A 1CK2A 5HP8A 1VQ5F 5CA0B 3F0DA 5MN4A 3VYSC 1TUBA 3CC2F 3JASB 4F6RA 3D54A 1OAPA 1YGYA 3FPIA 3I56F 2OTLF 2ZVYA 4YJ2B 3CCQF 3CD6F 4ZK7A 5EB1B 1K9MH 2MQEA 1YHQF 5GONA 5HXUA 2ZAUA 3VTIC 4HNAA 3CPQA 3RYFA 5MN5A 3VI6A 2OTJF 4IIJB 3V7EA 3I7TA 5LYJB 4ERHA 3S06A 3VYTC 3IKEA 2HS0A 4O4HB 3VYUC 2Z1EA 1CLIA 2R6R1 3IR9A 3GHZA 3V7QA 2ALEA 3NK6A 3JALA 2IG8A 4G4VA 4U39A 3SIVA 1W42A 4FFBB 1TVKB 5G4UC 4BVQA 5HP7A 2KTUA 5CB4B 3E20B 1H47A 5GIOC 2PHNA 4BT5A 5GIPC 2QEXF 3QTYA 4ZHQA 4ZI7B 3JATB 3P10A 2VAWA 2ZOVA 2UYNB 3CCJF 1IV3A 5EYPB 4O2BB 4BT3A 3IEWA 2H8CA 4R40B 3JCMM 5LXTA 5LP6B 1RQ2A 4LNUB 3C9RA 3E22B 1DBFA 1KQSF 4BVSA 4G88A 5A2QM 3RYCA 2BTQB 1COMA 1NMUB 3MQWA 3S02A 1QVGF 2BO1A 1H7MA 2BTOA 5JQGB 1Q82H 2K1SA 4X1YA 5FJ4C 5GANK 4DXDA 4O2AA 4PWTA 2R751 3GYQA 4I50A 2CW4A 3HKEB 1M90H 5HY1A 3SIUA 3G6EF 3CCVF 4G4YA 3RYHA 1XRGA 4U3JB 1DT9A 1Q81H 5IJ9A 2H6LA 4DRXA 5HWEA 1JFFA 2LBXA 3L7QA 4BT6A 4O4IB 3FD5A 3QUWA 3WPWA 3HWUA 3VOAA 5J2TB 1SDSA 3I55F 4NUTA 1YQNA 5BMVA 4I55B 3V4DA 4RHAA 4O4JA 3CMEF 4BT7A 4BT2A 3HKDA 2HP0A 1GO0A 5MN6A 3IEQA 3E1YA 4EB6A
chains in the Genus database with same CATH topology
1JD1A 2CWJA 2CW4A 2IG8A 2CHSA 1QU9A 3D01A 3LMEA 3ZO8A 1J7HA 2CHTA 3M4SA 3ZOPA 1X25A 1NQ3A 2UYJA 2UYKA 1XRGA 3ZP7A 4ZK7A 5HP7A 3KJKA 3R0PA 1QD9A 1UI9A 2UYPA 3L7QA 1ODEA 2B33A 4NWOB 3QUWA 3K0TA 1DBFA 3GTZA 1FNJA 2CVLA 1UFYA 1XHOA 3ZP4A 1FNKA 1COMA 2CSLA 3I7TA 2OTMA 3MQWA 3V4DA 2EWCA 1QAHA 5HP8A 3LYBA 1PF5A 3K12A 2UYNA 3M1XA 2UYNB 1ONIA 3I3FA 3KJJA 3VCZA 2DYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JD1 A;  2CWJ A;  2CW4 A;  2IG8 A;  2CHS A;  1QU9 A;  3D01 A;  3LME A;  3ZO8 A;  1J7H A;  2CHT A;  3M4S A;  3ZOP A;  1X25 A;  1NQ3 A;  2UYJ A;  2UYK A;  1XRG A;  3ZP7 A;  4ZK7 A;  5HP7 A;  3KJK A;  3R0P A;  1QD9 A;  1UI9 A;  2UYP A;  3L7Q A;  1ODE A;  2B33 A;  4NWO B;  3QUW A;  3K0T A;  1DBF A;  3GTZ A;  1FNJ A;  2CVL A;  1UFY A;  1XHO A;  3ZP4 A;  1FNK A;  1COM A;  2CSL A;  3I7T A;  2OTM A;  3MQW A;  3V4D A;  2EWC A;  1QAH A;  5HP8 A;  3LYB A;  1PF5 A;  3K12 A;  2UYN A;  3M1X A;  2UYN B;  1ONI A;  3I3F A;  3KJJ A;  3VCZ A;  2DYY A; 
#chains in the Genus database with same CATH topology
 3WGJ A;  2GZL A;  3JAR A;  2VGN A;  2Z01 A;  1W41 A;  2YXZ A;  2HS3 A;  4X20 B;  3ZP7 A;  5KX5 B;  3HJW C;  3C9S A;  2BTU A;  3RYI A;  4NWO B;  1YJ9 F;  1YJN F;  3WJQ A;  3ZP4 A;  1XHO A;  2RHJ A;  3RA6 A;  1Q86 H;  1M1K H;  1VQL F;  3PLA C;  3K14 A;  3T80 A;  3C9T A;  3O85 A;  3CYP B;  1JY8 A;  2IQQ A;  4X1I A;  3WJP A;  3HKB A;  4C4W C;  3LWQ C;  3HKC B;  3KJJ A;  3LYB A;  3WGN A;  1W57 A;  5EZY B;  5JH7 B;  5GAP K;  1E7K A;  5IT9 M;  1FFX B;  1SA0 A;  3DDN A;  3MCQ A;  3UT5 B;  5DCV A;  5LA6 B;  2GLZ A;  3N2K B;  3VOB A;  5IYZ B;  4E6E A;  3WGL A;  2RB9 A;  2F9Z C;  3F0F A;  2HQS C;  1FNK A;  2L26 A;  4IHJ A;  1KNJ A;  5KMG A;  2Q1Y A;  1ZWZ A;  4ZOL A;  2Z1F A;  1N8R H;  3Q8H A;  5EAZ A;  1RLG A;  1IPA A;  5EIB C;  1IV1 A;  4EI8 A;  4WBN B;  3VCZ A;  4B45 A;  3JAK A;  4O4L B;  5LP6 C;  4I4T B;  1VK3 A;  1JJ2 F;  5EB0 A;  2KG4 A;  4BVR A;  5CA1 B;  2Q1X A;  1FNJ A;  3F0E A;  4YJ3 B;  3RE3 A;  1VQV A;  3G71 F;  1W40 A;  4G4W A;  4TUY B;  4TV8 B;  5ITZ A;  1K8A H;  3D00 A;  2QTP A;  2HS4 A;  1W2B F;  3NK7 A;  1TUB B;  1W5A A;  3ZO8 A;  4KWE A;  2RHL A;  2N48 A;  5EWR A;  4F6R B;  2KGW A;  3PAF A;  3JAW A;  2UZH A;  4U3J A;  4C82 A;  3ZOP A;  5JVD A;  1X25 A;  3CCU F;  2VAM A;  3N2G A;  4O4I A;  3TD4 A;  4B5C A;  3LWP C;  1UI9 A;  1Z5V A;  3JVH A;  5HY2 A;  5GON B;  3LWO C;  4X1K A;  3K0T A;  2G9I A;  3U0O A;  4HNA B;  2FC3 A;  1KC8 H;  1UFY A;  1GX1 A;  3RYF B;  3S0H A;  1RA4 A;  1Q7Y H;  3N4Y A;  1U43 A;  1W3E X;  5FLX M;  1ONI A;  2HX0 A;  4C8I A;  3CCR F;  3J80 M;  3G4S F;  3JAL B;  2OZB A;  5G4V C;  3LME A;  1J7H A;  1VQ7 F;  3IMP A;  5IJ0 A;  2VAP A;  3R0P A;  1VQ9 F;  3K2X A;  4TV9 A;  3S0Y A;  5J2U A;  3LWV C;  3ESJ A;  2P6Y A;  3CCM F;  1GO1 A;  3WGK A;  3CXC F;  3VIU A;  1S72 F;  5JCO C;  3J81 M;  1VHA A;  2HRU A;  4BW0 B;  3OW2 F;  5C8Y A;  3CC7 F;  4BY9 D;  4ZHQ B;  1W59 A;  1XV2 A;  5CA0 A;  1RLU A;  3CCL F;  4BVT A;  3BYQ A;  2H8E A;  5JH7 A;  3OBW A;  3RA5 A;  2HP3 A;  3JAS A;  3KHN A;  1YI2 F;  2JNB A;  3UT5 A;  3TD3 A;  3WGM A;  2QI2 A;  4YJ2 A;  4M8I A;  3LDT A;  5LXT B;  3P4E A;  3ELC A;  1GZ0 A;  2NMU A;  3KIZ A;  4IIJ A;  3CPW F;  2VGM A;  3B6N A;  3LFO A;  5LYJ A;  2Z1T A;  1OFU A;  2VXY A;  1U3L A;  2LBT A;  3RYC B;  3P0Z A;  4O4H A;  1QVF F;  2IAF A;  4X3L A;  4X1Y B;  3V3T A;  3M1X A;  4WBN A;  4O2A B;  4O4L A;  3IKF A;  2CZW A;  2CWJ A;  4I50 B;  2CHS A;  4FFB A;  1TVK A;  3TD5 A;  1VQN F;  2RHH A;  3M84 A;  1YJW F;  2UYK A;  5CB4 A;  5CA1 A;  3JAM M;  3RYH B;  1Q8R A;  2KTV A;  5AVM A;  5IJ9 B;  3ERN A;  2B33 A;  4DRX B;  3J7A R;  1JFF B;  3C8L A;  3F6M A;  5FNV B;  5LOV B;  3DC2 A;  4ZI7 A;  3JAT A;  4TV8 A;  3CB2 A;  5BMV B;  2OHW A;  4O4J B;  1QAH A;  3HKD B;  2UYN A;  2HP0 B;  3MBM A;  1X7O A;  1T0K B;  4NQ3 A;  5EYP A;  1PXW A;  4O2B A;  4EB6 B;  3JAR B;  5HXZ A;  2CHT A;  1NQ3 A;  5LP6 A;  3NMU C;  4LNU A;  3E22 A;  1Z5W A;  3RYI B;  1W58 1;  4G4Z A;  1VQM F;  4C81 A;  3OON A;  1U40 A;  2LBW A;  5JQG A;  2EWC A;  3FD6 A;  1PF5 A;  3K12 A;  2I6R A;  3F0G A;  1SZQ A;  4X1I B;  3HKB B;  5HY0 A;  1JD1 A;  3HKE A;  1QU9 A;  2ZVZ A;  4B62 A;  5HY4 A;  3WJR A;  3CC4 F;  1SA0 B;  2HRY A;  5EO3 A;  3MCA B;  3S03 A;  1KD1 H;  2ZF8 A;  4EI9 A;  3C9U A;  1VQP F;  3NVI B;  5J2T A;  1FSZ A;  4C8E A;  3FFM A;  4I55 A;  2AIF A;  1YIT F;  4IHJ B;  2PMP A;  3QHD A;  1VQO F;  5B8F A;  2YYE A;  5EIB D;  2GVI A;  5KMG B;  1YIJ F;  4ZOL B;  1VQ8 F;  3CG6 A;  3JAK B;  1VQ4 F;  1CN7 A;  1T0A A;  4X20 A;  1X7P A;  2I6D A;  5KX5 A;  2UYJ A;  1W5E A;  3MDO A;  3VMF B;  1QD9 A;  2W8B C;  3VO8 A;  3GTZ A;  4B46 A;  1U3P A;  3S0W A;  4LCK A;  2OTM A;  3LWR C;  1W5F A;  5JCO A;  2LCA A;  3ON1 A;  4BT4 A;  4G4X A;  3CCS F;  2WAL A;  3FBA A;  5ITZ B;  3CCE F;  3HKC A;  5EZY A;  4C8G A;  3HAX D;  4XCQ A;  1FFX A;  1VQK F;  4EI7 A;  5JVD B;  3JAW B;  5LA6 A;  3WPX A;  3KE1 A;  4ZHV A;  3EOR A;  3N2K A;  4RQO A;  3CMA F;  3N2G B;  2FGY A;  5IYZ A;  2UYP A;  5FNV A;  1ODE A;  5LOV A;  1X52 A;  3OBY A;  4X1K B;  4X3M A;  2QA4 F;  1JN1 A;  1KNK A;  2CSL A;  1W5B A;  4TZZ A;  1XBI A;  1K73 H;  1NJI H;  2RHO A;  1VH8 A;  3AGK A;  3I3F A;  2AMT A;  1R1M A;  1W55 A;  2DYY A;  2V9Y A;  2ZOD A;  3D01 A;  2HVY D;  3NVK E;  1H48 A;  4I4T A;  3M4S A;  3CYQ A;  3N4Z A;  5IJ0 B;  3KJK A;  4ZHW A;  1IV4 A;  4TV9 B;  3WXM B;  5J2U B;  5GIN C;  3HTN A;  2CVL A;  4YJ3 A;  4ZHY B;  2Z1U A;  5C8Y B;  1IV2 A;  2AIZ P;  4TUY A;  1VQ6 F;  1RQ7 A;  2DT4 A;  1CK2 A;  5HP8 A;  1VQ5 F;  5CA0 B;  3F0D A;  5MN4 A;  3VYS C;  1TUB A;  3CC2 F;  3JAS B;  4F6R A;  3D54 A;  1OAP A;  1YGY A;  3FPI A;  3I56 F;  2OTL F;  2ZVY A;  4YJ2 B;  3CCQ F;  3CD6 F;  4ZK7 A;  5EB1 B;  1K9M H;  2MQE A;  1YHQ F;  5GON A;  5HXU A;  2ZAU A;  3VTI C;  4HNA A;  3CPQ A;  3RYF A;  5MN5 A;  3VI6 A;  2OTJ F;  4IIJ B;  3V7E A;  3I7T A;  5LYJ B;  4ERH A;  3S06 A;  3VYT C;  3IKE A;  2HS0 A;  4O4H B;  3VYU C;  2Z1E A;  1CLI A;  2R6R 1;  3IR9 A;  3GHZ A;  3V7Q A;  2ALE A;  3NK6 A;  3JAL A;  2IG8 A;  4G4V A;  4U39 A;  3SIV A;  1W42 A;  4FFB B;  1TVK B;  5G4U C;  4BVQ A;  5HP7 A;  2KTU A;  5CB4 B;  3E20 B;  1H47 A;  5GIO C;  2PHN A;  4BT5 A;  5GIP C;  2QEX F;  3QTY A;  4ZHQ A;  4ZI7 B;  3JAT B;  3P10 A;  2VAW A;  2ZOV A;  2UYN B;  3CCJ F;  1IV3 A;  5EYP B;  4O2B B;  4BT3 A;  3IEW A;  2H8C A;  4R40 B;  3JCM M;  5LXT A;  5LP6 B;  1RQ2 A;  4LNU B;  3C9R A;  3E22 B;  1DBF A;  1KQS F;  4BVS A;  4G88 A;  5A2Q M;  3RYC A;  2BTQ B;  1COM A;  1NMU B;  3MQW A;  3S02 A;  1QVG F;  2BO1 A;  1H7M A;  2BTO A;  5JQG B;  1Q82 H;  2K1S A;  4X1Y A;  5FJ4 C;  5GAN K;  4DXD A;  4O2A A;  4PWT A;  2R75 1;  3GYQ A;  4I50 A;  2CW4 A;  3HKE B;  1M90 H;  5HY1 A;  3SIU A;  3G6E F;  3CCV F;  4G4Y A;  3RYH A;  1XRG A;  4U3J B;  1DT9 A;  1Q81 H;  5IJ9 A;  2H6L A;  4DRX A;  5HWE A;  1JFF A;  2LBX A;  3L7Q A;  4BT6 A;  4O4I B;  3FD5 A;  3QUW A;  3WPW A;  3HWU A;  3VOA A;  5J2T B;  1SDS A;  3I55 F;  4NUT A;  1YQN A;  5BMV A;  4I55 B;  3V4D A;  4RHA A;  4O4J A;  3CME F;  4BT7 A;  4BT2 A;  3HKD A;  2HP0 A;  1GO0 A;  5MN6 A;  3IEQ A;  3E1Y A;  4EB6 A; 
#chains in the Genus database with same CATH homology
 1JD1 A;  2CWJ A;  2CW4 A;  2IG8 A;  2CHS A;  1QU9 A;  3D01 A;  3LME A;  3ZO8 A;  1J7H A;  2CHT A;  3M4S A;  3ZOP A;  1X25 A;  1NQ3 A;  2UYJ A;  2UYK A;  1XRG A;  3ZP7 A;  4ZK7 A;  5HP7 A;  3KJK A;  3R0P A;  1QD9 A;  1UI9 A;  2UYP A;  3L7Q A;  1ODE A;  2B33 A;  4NWO B;  3QUW A;  3K0T A;  1DBF A;  3GTZ A;  1FNJ A;  2CVL A;  1UFY A;  1XHO A;  3ZP4 A;  1FNK A;  1COM A;  2CSL A;  3I7T A;  2OTM A;  3MQW A;  3V4D A;  2EWC A;  1QAH A;  5HP8 A;  3LYB A;  1PF5 A;  3K12 A;  2UYN A;  3M1X A;  2UYN B;  1ONI A;  3I3F A;  3KJJ A;  3VCZ A;  2DYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...