3JCMM

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3jcmM00
4LCKA 5GIOC 3J81M 5FLXM 2ALEA 3NK6A 1VQ7F 1S72F 3CC7F 3I56F 1PXWA 2QA4F 1VQOF 2LBXA 3IR9A 1YIJF 2WALA 3V7EA 1CN7A 1VQ6F 3N4ZA 1VQ4F 3HJWC 3CXCF 3CCUF 3LWVC 1K73H 1VQ5F 3CCLF 3CCRF 3VMFB 1M90H 1YI2F 1KQSF 3CC2F 4X3LA 1IPAA 1X52A 4BW0B 2QEXF 3CCMF 3LWOC 2OHWA 2I6DA 1Q81H 3CCSF 1VQKF 1KC8H 1GZ0A 3CCVF 1VQPF 3G4SF 3MCAB 2OTJF 3OW2F 3LWQC 3LWPC 1NJIH 1W2BF 1CK2A 1RLGA 5G4UC 2AIFA 2FC3A 2LBWA 3NVIB 1YITF 2BO1A 3CPWF 1KD1H 1H7MA 5IT9M 2CZWA 1GO0A 3VI6A 1Q86H 4BY9D 3AGKA 3E20B 1GO1A 3NK7A 3SIUA 1RA4A 3JCMM 1X7PA 3OBWA 3G6EF 1VQMF 1JJ2F 3CCQF 3NMUC 2VGNA 3J7AR 3V7QA 3PLAC 3LFOA 3CMEF 1DT9A 3G71F 5EWRA 3HAXD 2OTLF 3CD6F 5A2QM 3N4YA 1NMUB 1K8AH 1VQ8F 1W40A 3CC4F 3NVKE 5GAPK 2VGMA 2HVYD 1QVGF 1YJNF 1Q7YH 1K9MH 3CMAF 3CG6A 3SIVA 3JAMM 2KG4A 3FFMA 5GANK 2KTUA 3CPQA 2QI2A 3CCEF 4TZZA 2JNBA 3CCJF 1VQ9F 1W3EX 1X7OA 1ZWZA 3RA5A 3ON1A 1SDSA 3GYQA 1YJWF 2OZBA 5FJ4C 3OBYA 1E7KA 3PAFA 1VQLF 5EO3A 3RA6A 3O85A 5GIPC 5G4VC 1Q82H 1N8RH 5GINC 3LWRC 2KTVA 3I55F 4NUTA 4C4WC 1M1KH 1VQNF 1T0KB 5DCVA 3WXMB 3J80M 1XBIA 4X3MA 1YJ9F 1QVFF 1YHQF 3E1YA 1W41A 1W42A
chains in the Genus database with same CATH superfamily
3TD4A 5HY0A 3N2KA 5FLXM 1VQ7F 1TUBA 1S72F 3JAWB 1U40A 3C9TA 5IJ9B 2GVIA 3B6NA 4ZHQA 3ERNA 2RB9A 4HNAB 3K12A 1VQ4F 3C8LA 3RYIA 3JARA 3VOBA 4G4YA 5IJ0B 5C8YA 1IPAA 3HKEB 3CCMF 2GLZA 3RYHA 3N2GB 1KC8H 3CCVF 2Z1FA 4M8IA 5LP6A 5CA1A 5HP8A 3WGMA 4DRXA 4O2AA 1Q8RA 1OAPA 3FD6A 4IIJA 2HX0A 3WJQA 5J2UB 2RHOA 3JATB 4BVTA 2VAWA 3LYBA 2HS0A 1TUBB 3EORA 4TV8A 3WPWA 2FC3A 5LYJB 3MBMA 5CB4A 1J7HA 5JCOA 2CZWA 3VI6A 4BY9D 4X1IB 3SIUA 3C9UA 1XV2A 2EWCA 3G6EF 3QUWA 3GTZA 3S02A 1JJ2F 3KJJA 3I3FA 3HWUA 4U3JB 4RQOA 3R0PA 4X1KA 1DT9A 2I6RA 5A2QM 3N4YA 4X1IA 1W55A 3HTNA 4LNUA 5MN5A 4C81A 2AMTA 3RYCB 4DXDA 2Z01A 3L7QA 5LP6C 5EB1B 4BT7A 5CB4B 1W5BA 3IMPA 3JAMM 3CCEF 2QI2A 2H6LA 3VOAA 5JCOC 2GZLA 2JNBA 1NQ3A 5LP6B 3CCJF 4BT6A 5CA0B 4O2AB 5KMGA 2QTPA 1QAHA 4BVSA 5BMVA 5C8YB 4X1YB 4B5CA 1QU9A 5LXTA 3HKEA 2Z1EA 5LOVA 3E22B 4ZHVA 2V9YA 5FNVA 3U0OA 5GINC 4G4VA 2H8CA 4ZK7A 1VQNF 3HKBB 2RHJA 3UT5B 3WXMB 3DDNA 5G4UC 1W42A 1W59A 4LCKA 3ZP4A 1KNJA 4O4JB 3CC7F 2UYNB 3I56F 3RYFA 1PXWA 1VQOF 4DRXB 3MDOA 3CXCF 3LWVC 1W5FA 3CCRF 3VMFB 1M90H 4BT3A 4KWEA 1X52A 4C82A 2L26A 2VAMA 1U3LA 4O4IA 3LWOC 2I6DA 3M4SA 5CA0A 5KMGB 1VQKF 3S0HA 1VQPF 3MCAB 1H47A 5IJ9A 1W2BF 4YJ3A 3JAKA 5ITZB 1RLGA 1U43A 2LBWA 3K2XA 4G4XA 2BTOA 4ZI7B 3CPWF 2RHLA 4LNUB 3ZOPA 3S0YA 3AGKA 3E20B 1GO1A 4C8EA 2UYJA 1RA4A 3CYQA 3JCMM 1X7PA 5J2TA 5LA6A 3P10A 3F0GA 1VQMF 1W57A 3HKDB 5EZYB 2F9ZC 3VO8A 2VGNA 3VYTC 3K0TA 3J7AR 3PLAC 3JVHA 4G4WA 5EIBD 2OTLF 3VIUA 2OTMA 3KE1A 3CC4F 3JALA 3NVKE 2YYEA 3OONA 4I4TA 2ZODA 4O4HB 4IHJA 4IIJB 3N2GA 1YJNF 1Q7YH 1U3PA 3CMAF 3SIVA 1SZQA 4EI8A 2CSLA 2K1SA 5GANK 5HXUA 2KTUA 3CPQA 3IKEA 4F6RB 1JD1A 2HQSC 4E6EA 3F0FA 1XRGA 1FNKA 5EIBC 1W3EX 1X7OA 1ZWZA 2KGWA 4O4LA 5FJ4C 3IEWA 1SA0A 5JH7A 2UZHA 3WGJA 4HNAA 2UYNA 3ELCA 3O85A 4I4TB 4I50B 5JQGB 5G4VC 3JALB 2W8BC 3LWRC 4C4WC 5EZYA 1M1KH 1T0KB 1FNJA 2G9IA 5LA6B 3JASB 3J80M 4X3MA 3WJPA 4XCQA 1YJ9F 4BVQA 1FFXB 1YHQF 5IYZA 1W41A 2HP0A 2IQQA 3KIZA 5LOVB 4ZOLB 5GIOC 2HS4A 3HKCB 3J81M 5B8FA 3NK6A 2ZVYA 5LXTB 4YJ2A 1VH8A 1RLUA 3Q8HA 2QA4F 4TUYB 3IR9A 3V3TA 1CN7A 3V7EA 1VQ6F 2B33A 3CCUF 4X20B 1JFFB 2N48A 4G4ZA 1YI2F 2BTQB 2IG8A 4X3LA 3JATA 1KQSF 5AVMA 5MN6A 2IAFA 4BW0B 3KHNA 2CHSA 2MQEA 4ZHYB 1VK3A 5HP7A 4EI9A 5J2UA 3VTIC 3G4SF 1GX1A 3LMEA 4EB6B 2OTJF 1CK2A 4YJ2B 1VQVA 1IV4A 2AIFA 4ZHWA 2BO1A 3KJKA 3ZP7A 2CHTA 1YQNA 2VAPA 4TV9B 4ZHQB 4EI7A 1W5AA 5IT9M 3JASA 3LDTA 5GONA 1XHOA 3CYPB 3OBWA 3N2KB 3JAWA 2PMPA 5EB0A 5JQGA 4B46A 5HY4A 1OFUA 3LFOA 3G71F 3HAXD 3CD6F 3HKBA 4I55A 1NMUB 1K8AH 1VQ8F 5JVDA 4TV8B 5GAPK 2VGMA 2PHNA 2HVYD 3E22A 4O4LB 3WGKA 5EAZA 4C8GA 3RYHB 4NQ3A 1K9MH 3CG6A 2Z1TA 1RQ7A 2R751 2ZF8A 3TD5A 3P0ZA 3JAKB 5ITZA 3T80A 4YJ3B 4BVRA 3C9RA 4R40B 1T0AA 4FFBA 1CLIA 4C8IA 4EB6A 4NWOB 3RYIB 1Z5VA 3M84A 3ON1A 1Z5WA 1COMA 2AIZP 3GYQA 4O4HA 2RHHA 1YJWF 1TVKB 2OZBA 3F0DA 1VHAA 1FSZA 3OBYA 3PAFA 1E7KA 1JY8A 2ZVZA 5EO3A 2DYYA 4RHAA 4WBNA 1IV3A 1RQ2A 3QHDA 3ZO8A 1W581 5HY1A 3I55F 2KTVA 4NUTA 3RYCA 4U3JA 3VYSC 3FPIA 5MN4A 5DCVA 1IV1A 4WBNB 4TV9A 3WGLA 4ERHA 1QD9A 2FGYA 2ALEA 4BT2A 3S0WA 1TVKA 3ESJA 1IV2A 3QTYA 2HRYA 3UT5A 2LBXA 3S03A 4I50A 1YIJF 2WALA 5KX5B 3C9SA 3N4ZA 3HJWC 1K73H 1VQ5F 3CCLF 2BTUA 3CC2F 3I7TA 2UYKA 5JH7B 2QEXF 4B62A 2OHWA 1Q81H 4X1YA 3CCSF 1GZ0A 2HRUA 5HXZA 3D00A 3M1XA 1YGYA 3VCZA 3RE3A 4TUYA 5CA1B 2ZAUA 3OW2F 3LWQC 3LWPC 1NJIH 3D01A 4BT4A 3BYQA 4O4JA 3MCQA 3S06A 1DBFA 3NVIB 1YITF 4IHJB 1W5EA 3MQWA 2HP0B 1FFXA 1UFYA 1KD1H 1H7MA 1GO0A 1H48A 4O2BA 3TD3A 1Q86H 3NK7A 1R1MA 1UI9A 3FD5A 2CWJA 2P6YA 3CCQF 3NMUC 2NMUA 5FNVB 3DC2A 3K14A 3P4EA 3V7QA 3D54A 3CMEF 5EWRA 5J2TB 5HY2A 5EYPA 1SA0B 4BT5A 3V4DA 2CW4A 5GONB 5BMVB 1W40A 2LCAA 3FBAA 3CB2A 2Q1XA 2R6R1 3WPXA 1QVGF 1ONIA 4ZI7A 4F6RA 3GHZA 4G88A 2KG4A 5LYJA 3FFMA 2HP3A 4X20A 4TZZA 1PF5A 1JN1A 2YXZA 2Z1UA 5KX5A 1JFFA 2Q1YA 1VQ9F 1ODEA 3F6MA 2VXYA 3WGNA 4FFBB 3RA5A 4O4IB 1SDSA 2ZOVA 3F0EA 2HS3A 2DT4A 4PWTA 1X25A 1VQLF 2CVLA 3RA6A 5IJ0A 2UYPA 5HWEA 5GIPC 2H8EA 3JARB 3HKDA 1Q82H 1N8RH 4ZOLA 4U39A 4X1KB 3RYFB 5IYZB 4I55B 2LBTA 4B45A 1KNKA 3IKFA 5JVDB 3HKCA 3VYUC 1XBIA 1QVFF 5EYPB 3E1YA 3WJRA 3IEQA 4O2BB
chains in the Genus database with same CATH topology
4LCKA 5HY0A 5GIOC 3J81M 2FGYA 5FLXM 2ALEA 3NK6A 1VQ7F 1S72F 3CC7F 3I56F 1PXWA 2QA4F 1VQOF 2LBXA 3IR9A 3V3TA 1YIJF 2WALA 3V7EA 1CN7A 1VQ6F 3N4ZA 1VQ4F 3HJWC 3CXCF 3CCUF 3LWVC 1K73H 1VQ5F 3CCLF 3CCRF 3VMFB 1M90H 1YI2F 1KQSF 3CC2F 4X3LA 1IPAA 1X52A 4BW0B 2QEXF 3CCMF 3LWOC 2OHWA 2GLZA 2I6DA 1Q81H 4EI9A 3CCSF 1VQKF 1KC8H 1GZ0A 3CCVF 5HXZA 3D00A 1VQPF 3G4SF 3MCAB 2OTJF 3OW2F 3LWQC 3LWPC 1NJIH 1W2BF 4BVTA 1CK2A 1RLGA 5G4UC 2AIFA 2FC3A 2LBWA 3NVIB 1YITF 2BO1A 4EI7A 3CPWF 1KD1H 1H7MA 5IT9M 2CZWA 1GO0A 3VI6A 1Q86H 4BY9D 3AGKA 3E20B 1GO1A 3NK7A 3SIUA 1RA4A 3JCMM 1X7PA 3OBWA 3G6EF 1VQMF 1JJ2F 3CCQF 3NMUC 5HY4A 2F9ZC 2VGNA 3J7AR 3V7QA 3PLAC 3LFOA 3CMEF 1DT9A 3G71F 5EWRA 3HAXD 5HY2A 2OTLF 3CD6F 5A2QM 3N4YA 1NMUB 1K8AH 1VQ8F 1W40A 3CC4F 3NVKE 5GAPK 2VGMA 2HVYD 1QVGF 1YJNF 4NQ3A 1Q7YH 1K9MH 3CMAF 3CG6A 3SIVA 4EI8A 3JAMM 2KG4A 3FFMA 5HXUA 5GANK 2KTUA 3CPQA 2QI2A 3CCEF 4TZZA 4BVRA 2JNBA 3CCJF 1VQ9F 1W3EX 1X7OA 4BVSA 1ZWZA 3RA5A 3ON1A 1SDSA 3GYQA 1YJWF 2OZBA 5FJ4C 3OBYA 1E7KA 3PAFA 1VQLF 5EO3A 3RA6A 3O85A 5HWEA 5GIPC 5G4VC 1Q82H 1N8RH 5HY1A 5GINC 3LWRC 2KTVA 3I55F 4NUTA 4C4WC 1M1KH 1VQNF 1T0KB 5DCVA 3WXMB 3J80M 1XBIA 4X3MA 1YJ9F 4XCQA 4BVQA 1QVFF 1YHQF 3E1YA 1W41A 1W42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCK A;  5GIO C;  3J81 M;  5FLX M;  2ALE A;  3NK6 A;  1VQ7 F;  1S72 F;  3CC7 F;  3I56 F;  1PXW A;  2QA4 F;  1VQO F;  2LBX A;  3IR9 A;  1YIJ F;  2WAL A;  3V7E A;  1CN7 A;  1VQ6 F;  3N4Z A;  1VQ4 F;  3HJW C;  3CXC F;  3CCU F;  3LWV C;  1K73 H;  1VQ5 F;  3CCL F;  3CCR F;  3VMF B;  1M90 H;  1YI2 F;  1KQS F;  3CC2 F;  4X3L A;  1IPA A;  1X52 A;  4BW0 B;  2QEX F;  3CCM F;  3LWO C;  2OHW A;  2I6D A;  1Q81 H;  3CCS F;  1VQK F;  1KC8 H;  1GZ0 A;  3CCV F;  1VQP F;  3G4S F;  3MCA B;  2OTJ F;  3OW2 F;  3LWQ C;  3LWP C;  1NJI H;  1W2B F;  1CK2 A;  1RLG A;  5G4U C;  2AIF A;  2FC3 A;  2LBW A;  3NVI B;  1YIT F;  2BO1 A;  3CPW F;  1KD1 H;  1H7M A;  5IT9 M;  2CZW A;  1GO0 A;  3VI6 A;  1Q86 H;  4BY9 D;  3AGK A;  3E20 B;  1GO1 A;  3NK7 A;  3SIU A;  1RA4 A;  3JCM M;  1X7P A;  3OBW A;  3G6E F;  1VQM F;  1JJ2 F;  3CCQ F;  3NMU C;  2VGN A;  3J7A R;  3V7Q A;  3PLA C;  3LFO A;  3CME F;  1DT9 A;  3G71 F;  5EWR A;  3HAX D;  2OTL F;  3CD6 F;  5A2Q M;  3N4Y A;  1NMU B;  1K8A H;  1VQ8 F;  1W40 A;  3CC4 F;  3NVK E;  5GAP K;  2VGM A;  2HVY D;  1QVG F;  1YJN F;  1Q7Y H;  1K9M H;  3CMA F;  3CG6 A;  3SIV A;  3JAM M;  2KG4 A;  3FFM A;  5GAN K;  2KTU A;  3CPQ A;  2QI2 A;  3CCE F;  4TZZ A;  2JNB A;  3CCJ F;  1VQ9 F;  1W3E X;  1X7O A;  1ZWZ A;  3RA5 A;  3ON1 A;  1SDS A;  3GYQ A;  1YJW F;  2OZB A;  5FJ4 C;  3OBY A;  1E7K A;  3PAF A;  1VQL F;  5EO3 A;  3RA6 A;  3O85 A;  5GIP C;  5G4V C;  1Q82 H;  1N8R H;  5GIN C;  3LWR C;  2KTV A;  3I55 F;  4NUT A;  4C4W C;  1M1K H;  1VQN F;  1T0K B;  5DCV A;  3WXM B;  3J80 M;  1XBI A;  4X3M A;  1YJ9 F;  1QVF F;  1YHQ F;  3E1Y A;  1W41 A;  1W42 A; 
#chains in the Genus database with same CATH topology
 3TD4 A;  5HY0 A;  3N2K A;  5FLX M;  1VQ7 F;  1TUB A;  1S72 F;  3JAW B;  1U40 A;  3C9T A;  5IJ9 B;  2GVI A;  3B6N A;  4ZHQ A;  3ERN A;  2RB9 A;  4HNA B;  3K12 A;  1VQ4 F;  3C8L A;  3RYI A;  3JAR A;  3VOB A;  4G4Y A;  5IJ0 B;  5C8Y A;  1IPA A;  3HKE B;  3CCM F;  2GLZ A;  3RYH A;  3N2G B;  1KC8 H;  3CCV F;  2Z1F A;  4M8I A;  5LP6 A;  5CA1 A;  5HP8 A;  3WGM A;  4DRX A;  4O2A A;  1Q8R A;  1OAP A;  3FD6 A;  4IIJ A;  2HX0 A;  3WJQ A;  5J2U B;  2RHO A;  3JAT B;  4BVT A;  2VAW A;  3LYB A;  2HS0 A;  1TUB B;  3EOR A;  4TV8 A;  3WPW A;  2FC3 A;  5LYJ B;  3MBM A;  5CB4 A;  1J7H A;  5JCO A;  2CZW A;  3VI6 A;  4BY9 D;  4X1I B;  3SIU A;  3C9U A;  1XV2 A;  2EWC A;  3G6E F;  3QUW A;  3GTZ A;  3S02 A;  1JJ2 F;  3KJJ A;  3I3F A;  3HWU A;  4U3J B;  4RQO A;  3R0P A;  4X1K A;  1DT9 A;  2I6R A;  5A2Q M;  3N4Y A;  4X1I A;  1W55 A;  3HTN A;  4LNU A;  5MN5 A;  4C81 A;  2AMT A;  3RYC B;  4DXD A;  2Z01 A;  3L7Q A;  5LP6 C;  5EB1 B;  4BT7 A;  5CB4 B;  1W5B A;  3IMP A;  3JAM M;  3CCE F;  2QI2 A;  2H6L A;  3VOA A;  5JCO C;  2GZL A;  2JNB A;  1NQ3 A;  5LP6 B;  3CCJ F;  4BT6 A;  5CA0 B;  4O2A B;  5KMG A;  2QTP A;  1QAH A;  4BVS A;  5BMV A;  5C8Y B;  4X1Y B;  4B5C A;  1QU9 A;  5LXT A;  3HKE A;  2Z1E A;  5LOV A;  3E22 B;  4ZHV A;  2V9Y A;  5FNV A;  3U0O A;  5GIN C;  4G4V A;  2H8C A;  4ZK7 A;  1VQN F;  3HKB B;  2RHJ A;  3UT5 B;  3WXM B;  3DDN A;  5G4U C;  1W42 A;  1W59 A;  4LCK A;  3ZP4 A;  1KNJ A;  4O4J B;  3CC7 F;  2UYN B;  3I56 F;  3RYF A;  1PXW A;  1VQO F;  4DRX B;  3MDO A;  3CXC F;  3LWV C;  1W5F A;  3CCR F;  3VMF B;  1M90 H;  4BT3 A;  4KWE A;  1X52 A;  4C82 A;  2L26 A;  2VAM A;  1U3L A;  4O4I A;  3LWO C;  2I6D A;  3M4S A;  5CA0 A;  5KMG B;  1VQK F;  3S0H A;  1VQP F;  3MCA B;  1H47 A;  5IJ9 A;  1W2B F;  4YJ3 A;  3JAK A;  5ITZ B;  1RLG A;  1U43 A;  2LBW A;  3K2X A;  4G4X A;  2BTO A;  4ZI7 B;  3CPW F;  2RHL A;  4LNU B;  3ZOP A;  3S0Y A;  3AGK A;  3E20 B;  1GO1 A;  4C8E A;  2UYJ A;  1RA4 A;  3CYQ A;  3JCM M;  1X7P A;  5J2T A;  5LA6 A;  3P10 A;  3F0G A;  1VQM F;  1W57 A;  3HKD B;  5EZY B;  2F9Z C;  3VO8 A;  2VGN A;  3VYT C;  3K0T A;  3J7A R;  3PLA C;  3JVH A;  4G4W A;  5EIB D;  2OTL F;  3VIU A;  2OTM A;  3KE1 A;  3CC4 F;  3JAL A;  3NVK E;  2YYE A;  3OON A;  4I4T A;  2ZOD A;  4O4H B;  4IHJ A;  4IIJ B;  3N2G A;  1YJN F;  1Q7Y H;  1U3P A;  3CMA F;  3SIV A;  1SZQ A;  4EI8 A;  2CSL A;  2K1S A;  5GAN K;  5HXU A;  2KTU A;  3CPQ A;  3IKE A;  4F6R B;  1JD1 A;  2HQS C;  4E6E A;  3F0F A;  1XRG A;  1FNK A;  5EIB C;  1W3E X;  1X7O A;  1ZWZ A;  2KGW A;  4O4L A;  5FJ4 C;  3IEW A;  1SA0 A;  5JH7 A;  2UZH A;  3WGJ A;  4HNA A;  2UYN A;  3ELC A;  3O85 A;  4I4T B;  4I50 B;  5JQG B;  5G4V C;  3JAL B;  2W8B C;  3LWR C;  4C4W C;  5EZY A;  1M1K H;  1T0K B;  1FNJ A;  2G9I A;  5LA6 B;  3JAS B;  3J80 M;  4X3M A;  3WJP A;  4XCQ A;  1YJ9 F;  4BVQ A;  1FFX B;  1YHQ F;  5IYZ A;  1W41 A;  2HP0 A;  2IQQ A;  3KIZ A;  5LOV B;  4ZOL B;  5GIO C;  2HS4 A;  3HKC B;  3J81 M;  5B8F A;  3NK6 A;  2ZVY A;  5LXT B;  4YJ2 A;  1VH8 A;  1RLU A;  3Q8H A;  2QA4 F;  4TUY B;  3IR9 A;  3V3T A;  1CN7 A;  3V7E A;  1VQ6 F;  2B33 A;  3CCU F;  4X20 B;  1JFF B;  2N48 A;  4G4Z A;  1YI2 F;  2BTQ B;  2IG8 A;  4X3L A;  3JAT A;  1KQS F;  5AVM A;  5MN6 A;  2IAF A;  4BW0 B;  3KHN A;  2CHS A;  2MQE A;  4ZHY B;  1VK3 A;  5HP7 A;  4EI9 A;  5J2U A;  3VTI C;  3G4S F;  1GX1 A;  3LME A;  4EB6 B;  2OTJ F;  1CK2 A;  4YJ2 B;  1VQV A;  1IV4 A;  2AIF A;  4ZHW A;  2BO1 A;  3KJK A;  3ZP7 A;  2CHT A;  1YQN A;  2VAP A;  4TV9 B;  4ZHQ B;  4EI7 A;  1W5A A;  5IT9 M;  3JAS A;  3LDT A;  5GON A;  1XHO A;  3CYP B;  3OBW A;  3N2K B;  3JAW A;  2PMP A;  5EB0 A;  5JQG A;  4B46 A;  5HY4 A;  1OFU A;  3LFO A;  3G71 F;  3HAX D;  3CD6 F;  3HKB A;  4I55 A;  1NMU B;  1K8A H;  1VQ8 F;  5JVD A;  4TV8 B;  5GAP K;  2VGM A;  2PHN A;  2HVY D;  3E22 A;  4O4L B;  3WGK A;  5EAZ A;  4C8G A;  3RYH B;  4NQ3 A;  1K9M H;  3CG6 A;  2Z1T A;  1RQ7 A;  2R75 1;  2ZF8 A;  3TD5 A;  3P0Z A;  3JAK B;  5ITZ A;  3T80 A;  4YJ3 B;  4BVR A;  3C9R A;  4R40 B;  1T0A A;  4FFB A;  1CLI A;  4C8I A;  4EB6 A;  4NWO B;  3RYI B;  1Z5V A;  3M84 A;  3ON1 A;  1Z5W A;  1COM A;  2AIZ P;  3GYQ A;  4O4H A;  2RHH A;  1YJW F;  1TVK B;  2OZB A;  3F0D A;  1VHA A;  1FSZ A;  3OBY A;  3PAF A;  1E7K A;  1JY8 A;  2ZVZ A;  5EO3 A;  2DYY A;  4RHA A;  4WBN A;  1IV3 A;  1RQ2 A;  3QHD A;  3ZO8 A;  1W58 1;  5HY1 A;  3I55 F;  2KTV A;  4NUT A;  3RYC A;  4U3J A;  3VYS C;  3FPI A;  5MN4 A;  5DCV A;  1IV1 A;  4WBN B;  4TV9 A;  3WGL A;  4ERH A;  1QD9 A;  2FGY A;  2ALE A;  4BT2 A;  3S0W A;  1TVK A;  3ESJ A;  1IV2 A;  3QTY A;  2HRY A;  3UT5 A;  2LBX A;  3S03 A;  4I50 A;  1YIJ F;  2WAL A;  5KX5 B;  3C9S A;  3N4Z A;  3HJW C;  1K73 H;  1VQ5 F;  3CCL F;  2BTU A;  3CC2 F;  3I7T A;  2UYK A;  5JH7 B;  2QEX F;  4B62 A;  2OHW A;  1Q81 H;  4X1Y A;  3CCS F;  1GZ0 A;  2HRU A;  5HXZ A;  3D00 A;  3M1X A;  1YGY A;  3VCZ A;  3RE3 A;  4TUY A;  5CA1 B;  2ZAU A;  3OW2 F;  3LWQ C;  3LWP C;  1NJI H;  3D01 A;  4BT4 A;  3BYQ A;  4O4J A;  3MCQ A;  3S06 A;  1DBF A;  3NVI B;  1YIT F;  4IHJ B;  1W5E A;  3MQW A;  2HP0 B;  1FFX A;  1UFY A;  1KD1 H;  1H7M A;  1GO0 A;  1H48 A;  4O2B A;  3TD3 A;  1Q86 H;  3NK7 A;  1R1M A;  1UI9 A;  3FD5 A;  2CWJ A;  2P6Y A;  3CCQ F;  3NMU C;  2NMU A;  5FNV B;  3DC2 A;  3K14 A;  3P4E A;  3V7Q A;  3D54 A;  3CME F;  5EWR A;  5J2T B;  5HY2 A;  5EYP A;  1SA0 B;  4BT5 A;  3V4D A;  2CW4 A;  5GON B;  5BMV B;  1W40 A;  2LCA A;  3FBA A;  3CB2 A;  2Q1X A;  2R6R 1;  3WPX A;  1QVG F;  1ONI A;  4ZI7 A;  4F6R A;  3GHZ A;  4G88 A;  2KG4 A;  5LYJ A;  3FFM A;  2HP3 A;  4X20 A;  4TZZ A;  1PF5 A;  1JN1 A;  2YXZ A;  2Z1U A;  5KX5 A;  1JFF A;  2Q1Y A;  1VQ9 F;  1ODE A;  3F6M A;  2VXY A;  3WGN A;  4FFB B;  3RA5 A;  4O4I B;  1SDS A;  2ZOV A;  3F0E A;  2HS3 A;  2DT4 A;  4PWT A;  1X25 A;  1VQL F;  2CVL A;  3RA6 A;  5IJ0 A;  2UYP A;  5HWE A;  5GIP C;  2H8E A;  3JAR B;  3HKD A;  1Q82 H;  1N8R H;  4ZOL A;  4U39 A;  4X1K B;  3RYF B;  5IYZ B;  4I55 B;  2LBT A;  4B45 A;  1KNK A;  3IKF A;  5JVD B;  3HKC A;  3VYU C;  1XBI A;  1QVF F;  5EYP B;  3E1Y A;  3WJR A;  3IEQ A;  4O2B B; 
#chains in the Genus database with same CATH homology
 4LCK A;  5HY0 A;  5GIO C;  3J81 M;  2FGY A;  5FLX M;  2ALE A;  3NK6 A;  1VQ7 F;  1S72 F;  3CC7 F;  3I56 F;  1PXW A;  2QA4 F;  1VQO F;  2LBX A;  3IR9 A;  3V3T A;  1YIJ F;  2WAL A;  3V7E A;  1CN7 A;  1VQ6 F;  3N4Z A;  1VQ4 F;  3HJW C;  3CXC F;  3CCU F;  3LWV C;  1K73 H;  1VQ5 F;  3CCL F;  3CCR F;  3VMF B;  1M90 H;  1YI2 F;  1KQS F;  3CC2 F;  4X3L A;  1IPA A;  1X52 A;  4BW0 B;  2QEX F;  3CCM F;  3LWO C;  2OHW A;  2GLZ A;  2I6D A;  1Q81 H;  4EI9 A;  3CCS F;  1VQK F;  1KC8 H;  1GZ0 A;  3CCV F;  5HXZ A;  3D00 A;  1VQP F;  3G4S F;  3MCA B;  2OTJ F;  3OW2 F;  3LWQ C;  3LWP C;  1NJI H;  1W2B F;  4BVT A;  1CK2 A;  1RLG A;  5G4U C;  2AIF A;  2FC3 A;  2LBW A;  3NVI B;  1YIT F;  2BO1 A;  4EI7 A;  3CPW F;  1KD1 H;  1H7M A;  5IT9 M;  2CZW A;  1GO0 A;  3VI6 A;  1Q86 H;  4BY9 D;  3AGK A;  3E20 B;  1GO1 A;  3NK7 A;  3SIU A;  1RA4 A;  3JCM M;  1X7P A;  3OBW A;  3G6E F;  1VQM F;  1JJ2 F;  3CCQ F;  3NMU C;  5HY4 A;  2F9Z C;  2VGN A;  3J7A R;  3V7Q A;  3PLA C;  3LFO A;  3CME F;  1DT9 A;  3G71 F;  5EWR A;  3HAX D;  5HY2 A;  2OTL F;  3CD6 F;  5A2Q M;  3N4Y A;  1NMU B;  1K8A H;  1VQ8 F;  1W40 A;  3CC4 F;  3NVK E;  5GAP K;  2VGM A;  2HVY D;  1QVG F;  1YJN F;  4NQ3 A;  1Q7Y H;  1K9M H;  3CMA F;  3CG6 A;  3SIV A;  4EI8 A;  3JAM M;  2KG4 A;  3FFM A;  5HXU A;  5GAN K;  2KTU A;  3CPQ A;  2QI2 A;  3CCE F;  4TZZ A;  4BVR A;  2JNB A;  3CCJ F;  1VQ9 F;  1W3E X;  1X7O A;  4BVS A;  1ZWZ A;  3RA5 A;  3ON1 A;  1SDS A;  3GYQ A;  1YJW F;  2OZB A;  5FJ4 C;  3OBY A;  1E7K A;  3PAF A;  1VQL F;  5EO3 A;  3RA6 A;  3O85 A;  5HWE A;  5GIP C;  5G4V C;  1Q82 H;  1N8R H;  5HY1 A;  5GIN C;  3LWR C;  2KTV A;  3I55 F;  4NUT A;  4C4W C;  1M1K H;  1VQN F;  1T0K B;  5DCV A;  3WXM B;  3J80 M;  1XBI A;  4X3M A;  1YJ9 F;  4XCQ A;  4BVQ A;  1QVF F;  1YHQ F;  3E1Y A;  1W41 A;  1W42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...