3JCMM

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3jcmM00
1CK2A 2I6DA 5FLXM 3OW2F 1Q81H 1X7OA 1GO0A 1YIJF 3IR9A 1S72F 3NK7A 1XBIA 3CMEF 2HVYD 3JAMM 5GIOC 2LBWA 1VQ5F 2WALA 3CCEF 3J7AR 2JNBA 2FC3A 1H7MA 3E1YA 2BO1A 5EWRA 1Q82H 1CN7A 3HAXD 3G4SF 1W3EX 2CZWA 2QEXF 2QI2A 1JJ2F 1VQMF 1RLGA 4C4WC 5DCVA 1VQPF 1KD1H 1K9MH 1NMUB 3OBYA 5G4VC 1Q86H 3O85A 2VGNA 5FJ4C 2QA4F 3NVKE 3N4ZA 3OBWA 4LCKA 5GIPC 2OTLF 3CD6F 1W2BF 1VQ6F 4X3LA 3RA5A 2OTJF 3AGKA 1YHQF 2VGMA 1N8RH 3VMFB 1T0KB 1GO1A 3SIVA 1Q7YH 1VQNF 1DT9A 3CXCF 1VQKF 3LWOC 1VQ8F 1M90H 3RA6A 1KC8H 1ZWZA 3SIUA 1YITF 3CC4F 1W41A 3CPWF 3PAFA 1VQ9F 4X3MA 2AIFA 5EO3A 1YJNF 3CPQA 3CCJF 1K73H 1PXWA 1SDSA 1W42A 1VQ4F 1VQ7F 1YI2F 1QVFF 5GAPK 3LWPC 3CC2F 3CCMF 5GANK 1X52A 3LWQC 3CCVF 5IT9M 5GINC 1VQLF 2OZBA 3G71F 3I55F 3WXMB 2OHWA 1W40A 3J81M 2KTVA 5A2QM 1QVGF 2KG4A 3GYQA 3V7QA 3CCSF 3PLAC 3LFOA 3CG6A 1VQOF 3LWVC 3V7EA 1IPAA 1KQSF 4TZZA 1E7KA 4BW0B 3NK6A 3VI6A 4BY9D 1YJ9F 2ALEA 1K8AH 1YJWF 3I56F 3G6EF 3E20B 3MCAB 3N4YA 3ON1A 3FFMA 5G4UC 3CCUF 3NVIB 3CCLF 3CCQF 3J80M 1X7PA 2KTUA 3LWRC 1M1KH 1GZ0A 4NUTA 1NJIH 2LBXA 3HJWC 1RA4A 3CCRF 3NMUC 3JCMM 3CC7F 3CMAF
chains in the Genus database with same CATH superfamily
2I6DA 4XCQA 3WPWA 3MQWA 3DDNA 4YJ2B 3NK7A 1XBIA 3K2XA 3RYIB 3CMEF 2HVYD 1U43A 2LBWA 2JNBA 3VCZA 2L26A 1FFXA 2BO1A 3V3TA 1Q82H 3P4EA 1VHAA 3VTIC 1W3EX 2CZWA 4BT6A 1FFXB 3LDTA 4O4LA 3F6MA 5DCVA 1KD1H 5J2TA 3O85A 4BVQA 2Z1UA 2QA4F 2Q1XA 3OBWA 3U0OA 5HP7A 4O4LB 3UT5A 3VYUC 5GIPC 3I3FA 5EAZA 1VQ6F 5HXUA 5J2TB 5MN4A 2H6LA 1UI9A 2GZLA 2QTPA 3HTNA 3KE1A 1N8RH 3UT5B 2I6RA 1Q7YH 3C9UA 2VAMA 4NQ3A 3F0FA 1VQ8F 2LCAA 1IV4A 1KC8H 3ZOPA 2HP0A 2BTOA 4BVTA 3CC4F 2P6YA 3MBMA 3PAFA 4LNUA 1J7HA 2AIFA 4B5CA 3MDOA 1QD9A 5EO3A 3M84A 2HP0B 5EZYA 3JAKA 3JARA 1VQ4F 4LNUB 3WPXA 1VQ7F 2F9ZC 3LWPC 3M4SA 1Z5WA 1R1MA 5EZYB 5GANK 3JAKB 4G4XA 3JARB 1U3LA 2OHWA 4ZK7A 4EI7A 2KTVA 2Z1FA 3V7EA 2B33A 3JALA 1IPAA 3S02A 3VYTC 3B6NA 2ALEA 3IEWA 3JALB 3I56F 2ZAUA 3MCAB 3S0HA 4G4ZA 3WJQA 3GTZA 2FGYA 1W5EA 2H8CA 1M1KH 3HKBA 1GZ0A 1NJIH 3HJWC 3CCRF 1PF5A 3RYCA 2H8EA 1CK2A 2UYPA 2HX0A 1Q81H 4U39A 3HKBB 3IR9A 3TD3A 3WGNA 3E22A 4DXDA 3RYCB 4RHAA 5GIOC 2RHOA 2WALA 4X1IA 2IQQA 4TUYA 4ZHWA 5IYZA 5FNVA 5EWRA 3E22B 3IKFA 3M1XA 2GLZA 1CN7A 3EORA 3DC2A 4G4VA 3G4SF 4O4HA 2QEXF 4X1IB 4TUYB 3F0DA 5IYZB 5FNVB 4C4WC 2HRUA 5LYJA 2UYNA 3JAWA 4O4HB 3S06A 1VK3A 3WGJA 3FPIA 4X1YA 4B46A 3CD6F 5HY2A 4RQOA 5LYJB 1W2BF 4X3LA 5CA1A 2R751 2UYNB 3JAWB 2VGMA 3D00A 3P0ZA 2UYKA 4TV9A 2MQEA 1RQ7A 4X1YB 2HP3A 4X20A 3SIVA 2GVIA 1DT9A 2EWCA 3C9SA 1VQNF 5CA1B 5LA6A 5LP6C 4TV9B 3IKEA 3OONA 3TD4A 1ZWZA 4X20B 4R40B 1YITF 3QUWA 2CHSA 5LA6B 5EIBD 4BT7A 5EB1B 2AIZP 5KMGA 3KIZA 1SA0A 2VAPA 1K73H 1PXWA 1IV2A 3K0TA 1H48A 2Q1YA 2CHTA 1FNJA 5CA0A 4BT5A 4ERHA 5KMGB 2RHLA 3ELCA 5CB4A 1SA0B 1NQ3A 3LWQC 5C8YA 1W59A 3IMPA 5IT9M 2HRYA 3FD6A 5CA0B 3G71F 3K14A 4G4WA 1QVGF 3PLAC 5CB4B 2RB9A 3GYQA 3CCSF 3KJKA 3CG6A 3LFOA 5C8YB 1VQOF 2K1SA 3LMEA 2ZVYA 4U3JA 2OTMA 1E7KA 4BW0B 1YJ9F 5IJ0A 5LP6A 3G6EF 2PMPA 1U40A 3FFMA 4U3JB 5ITZA 3CCLF 4IIJA 1GX1A 1W55A 1X7PA 3J80M 4G4YA 5IJ0B 1T0AA 3LWRC 5LP6B 4PWTA 4C8IA 2UZHA 3HKEA 3IEQA 5G4UC 4O2AA 4B45A 5ITZB 4IIJB 4WBNA 3OW2F 2N48A 2W8BC 3S0WA 1W581 3D54A 3QTYA 2CVLA 3VOBA 1RQ2A 1JFFA 5JH7A 3C9RA 3HKEB 1VQ5F 4O2AB 3CCEF 4KWEA 4WBNB 1H7MA 2DYYA 2Z01A 1RLUA 3HAXD 1JFFB 4C81A 5JH7B 5HY4A 1KNJA 3L7QA 5KX5A 1JJ2F 3WGKA 4BVRA 4ZHYB 3S0YA 1ONIA 1DBFA 2V9YA 1NMUB 3F0GA 2RHJA 5G4VC 1TVKA 1W5AA 5KX5B 4TV8A 3NVKE 1QU9A 1UFYA 4LCKA 4C8GA 5JCOC 2OTLF 3RA5A 3HWUA 2OTJF 1TVKB 3RYFA 1VQVA 3WJPA 5MN6A 4TV8B 2BTUA 4BVSA 1YQNA 1T0KB 5B8FA 2HS0A 3ERNA 3CXCF 3HKDA 3WJRA 3LWOC 4I50A 3QHDA 4O4JA 3R0PA 3RYFB 1QAHA 4EI8A 4BT2A 2ZVZA 2HS3A 5JQGA 5BMVA 3HKDB 2G9IA 2CSLA 4I50B 4X3MA 4O4JB 3ZP4A 2CW4A 4HNAA 3CB2A 3CPQA 4DRXA 1W57A 1W42A 4O4IA 5BMVB 5JQGB 2AMTA 1YI2F 4C8EA 4IHJA 2ZF8A 3C8LA 1FNKA 1SZQA 5GAPK 1QVFF 4HNAB 2PHNA 3CC2F 3CCMF 5IJ9A 1X52A 4DRXB 5HY1A 4O4IB 3N2KA 3P10A 1OAPA 3N2GA 3S03A 4IHJB 1VQLF 3I55F 5A2QM 2R6R1 3V7QA 2HQSC 4X1KA 5IJ9B 1JY8A 3N2KB 3N2GB 1KQSF 3RE3A 4ZOLA 2VXYA 3VYSC 3GHZA 3VI6A 4B62A 4F6RA 4X1KB 3T80A 4I4TA 4ZI7A 1YJWF 1K8AH 3ZO8A 3N4YA 4ZOLB 3ON1A 3CCUF 3WGLA 3NVIB 3CCQF 2KTUA 5HP8A 5GONA 3ZP7A 4F6RB 4I4TB 4ZI7B 1OFUA 3LYBA 3NMUC 2VAWA 3ESJA 5EIBC 3JCMM 3RYHA 5FLXM 4NWOB 3CYQA 2IG8A 4FFBA 1X7OA 4O2BA 5GONB 1YIJF 1GO0A 1W5FA 5EYPA 2KGWA 1S72F 3VIUA 2HS4A 3JAMM 3RYHB 1ODEA 3TD5A 3J7AR 2Z1TA 3CYPB 2FC3A 4FFBB 3JVHA 3E1YA 4O2BB 4BT4A 2IAFA 5EYPB 1H47A 1VH8A 3KHNA 1COMA 4I55A 1KNKA 3KJJA 2QI2A 3VO8A 1VQMF 1RLGA 3D01A 3Q8HA 1VQPF 1K9MH 3OBYA 4ZHQA 5MN5A 3JASA 4G88A 4I55B 1Q86H 2VGNA 4BT3A 5FJ4C 3N4ZA 1IV1A 4ZHQB 3AGKA 3JASB 4ZHVA 1YHQF 4YJ3A 2ZODA 3VMFB 2LBTA 1GO1A 3I7TA 2CWJA 3HKCA 1VQKF 5LXTA 1X25A 1M90H 4YJ3B 3V4DA 1Q8RA 3RA6A 3SIUA 4C82A 1W41A 5AVMA 3CPWF 3HKCB 3C9TA 5LXTB 3VOAA 1VQ9F 3F0EA 4EB6A 5HWEA 3FD5A 1YJNF 3CCJF 1SDSA 1JN1A 4EB6B 1CLIA 3BYQA 5HY0A 3CCVF 2Z1EA 4M8IA 5GINC 4E6EA 3K12A 2OZBA 5HXZA 5J2UA 2ZOVA 1W5BA 3WXMB 1W40A 4EI9A 3J81M 1XRGA 2KG4A 2NMUA 1XHOA 5JVDA 5EB0A 3LWVC 1U3PA 3WGMA 4TZZA 1JD1A 5J2UB 3MCQA 5LOVA 3NK6A 3JATA 1IV3A 2UYJA 3FBAA 4BY9D 5JVDB 2BTQB 3E20B 1TUBA 1YGYA 5LOVB 2DT4A 3JATB 1Z5VA 2YXZA 4NUTA 1FSZA 2LBXA 2RHHA 4YJ2A 1RA4A 3RYIA 1TUBB 3CMAF 2YYEA 3CC7F 1XV2A 5JCOA
chains in the Genus database with same CATH topology
1CK2A 2I6DA 5FLXM 4XCQA 3OW2F 1Q81H 1X7OA 1GO0A 1YIJF 3IR9A 3PLAC 1S72F 3NK7A 1XBIA 3CMEF 2HVYD 3JAMM 5GIOC 2LBWA 1VQ5F 2WALA 3CCEF 3J7AR 2JNBA 2FC3A 1H7MA 3E1YA 2BO1A 3V3TA 5EWRA 1Q82H 1CN7A 2GLZA 3HAXD 5HY4A 3G4SF 1W3EX 2CZWA 2QEXF 2QI2A 1JJ2F 1VQMF 1RLGA 4BVRA 4C4WC 5DCVA 1VQPF 1KD1H 1K9MH 1NMUB 3OBYA 5G4VC 1Q86H 3O85A 2VGNA 4BVQA 5FJ4C 2QA4F 3NVKE 3N4ZA 3OBWA 4LCKA 5GIPC 2OTLF 3CD6F 5HY2A 1W2BF 1VQ6F 4X3LA 3RA5A 5HXUA 2OTJF 3AGKA 1YHQF 2VGMA 3D00A 1N8RH 4BVSA 3VMFB 1T0KB 1GO1A 3SIVA 1Q7YH 1VQNF 1DT9A 3CXCF 4NQ3A 1VQKF 3LWOC 1VQ8F 1M90H 4EI8A 3RA6A 1KC8H 1ZWZA 3SIUA 1YITF 4BVTA 3CC4F 1W41A 3CPWF 3PAFA 1VQ9F 4X3MA 5HWEA 2AIFA 5EO3A 1YJNF 3CPQA 3CCJF 1K73H 1PXWA 1SDSA 1W42A 1VQ4F 1VQ7F 1YI2F 2F9ZC 1QVFF 5GAPK 3LWPC 3CC2F 3CCMF 5HY0A 5GANK 1X52A 3LWQC 5HY1A 3CCVF 5IT9M 5GINC 1VQLF 5HXZA 3G71F 2OZBA 3I55F 3WXMB 4EI9A 2OHWA 1W40A 3J81M 2KTVA 4EI7A 5A2QM 2KG4A 3GYQA 3V7QA 3CCSF 1QVGF 3LFOA 3CG6A 1VQOF 3LWVC 3V7EA 1IPAA 1KQSF 4TZZA 1E7KA 4BW0B 3NK6A 3VI6A 4BY9D 1YJ9F 2ALEA 1K8AH 1YJWF 3I56F 3G6EF 3E20B 3MCAB 3N4YA 3ON1A 3FFMA 5G4UC 3CCUF 3NVIB 3CCLF 3CCQF 3J80M 1X7PA 2FGYA 2KTUA 3LWRC 1M1KH 1GZ0A 4NUTA 1NJIH 2LBXA 3HJWC 1RA4A 3CCRF 3NMUC 3JCMM 3CC7F 3CMAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK2 A;  2I6D A;  5FLX M;  3OW2 F;  1Q81 H;  1X7O A;  1GO0 A;  1YIJ F;  3IR9 A;  1S72 F;  3NK7 A;  1XBI A;  3CME F;  2HVY D;  3JAM M;  5GIO C;  2LBW A;  1VQ5 F;  2WAL A;  3CCE F;  3J7A R;  2JNB A;  2FC3 A;  1H7M A;  3E1Y A;  2BO1 A;  5EWR A;  1Q82 H;  1CN7 A;  3HAX D;  3G4S F;  1W3E X;  2CZW A;  2QEX F;  2QI2 A;  1JJ2 F;  1VQM F;  1RLG A;  4C4W C;  5DCV A;  1VQP F;  1KD1 H;  1K9M H;  1NMU B;  3OBY A;  5G4V C;  1Q86 H;  3O85 A;  2VGN A;  5FJ4 C;  2QA4 F;  3NVK E;  3N4Z A;  3OBW A;  4LCK A;  5GIP C;  2OTL F;  3CD6 F;  1W2B F;  1VQ6 F;  4X3L A;  3RA5 A;  2OTJ F;  3AGK A;  1YHQ F;  2VGM A;  1N8R H;  3VMF B;  1T0K B;  1GO1 A;  3SIV A;  1Q7Y H;  1VQN F;  1DT9 A;  3CXC F;  1VQK F;  3LWO C;  1VQ8 F;  1M90 H;  3RA6 A;  1KC8 H;  1ZWZ A;  3SIU A;  1YIT F;  3CC4 F;  1W41 A;  3CPW F;  3PAF A;  1VQ9 F;  4X3M A;  2AIF A;  5EO3 A;  1YJN F;  3CPQ A;  3CCJ F;  1K73 H;  1PXW A;  1SDS A;  1W42 A;  1VQ4 F;  1VQ7 F;  1YI2 F;  1QVF F;  5GAP K;  3LWP C;  3CC2 F;  3CCM F;  5GAN K;  1X52 A;  3LWQ C;  3CCV F;  5IT9 M;  5GIN C;  1VQL F;  2OZB A;  3G71 F;  3I55 F;  3WXM B;  2OHW A;  1W40 A;  3J81 M;  2KTV A;  5A2Q M;  1QVG F;  2KG4 A;  3GYQ A;  3V7Q A;  3CCS F;  3PLA C;  3LFO A;  3CG6 A;  1VQO F;  3LWV C;  3V7E A;  1IPA A;  1KQS F;  4TZZ A;  1E7K A;  4BW0 B;  3NK6 A;  3VI6 A;  4BY9 D;  1YJ9 F;  2ALE A;  1K8A H;  1YJW F;  3I56 F;  3G6E F;  3E20 B;  3MCA B;  3N4Y A;  3ON1 A;  3FFM A;  5G4U C;  3CCU F;  3NVI B;  3CCL F;  3CCQ F;  3J80 M;  1X7P A;  2KTU A;  3LWR C;  1M1K H;  1GZ0 A;  4NUT A;  1NJI H;  2LBX A;  3HJW C;  1RA4 A;  3CCR F;  3NMU C;  3JCM M;  3CC7 F;  3CMA F; 
#chains in the Genus database with same CATH topology
 2I6D A;  4XCQ A;  3WPW A;  3MQW A;  3DDN A;  4YJ2 B;  3NK7 A;  1XBI A;  3K2X A;  3RYI B;  3CME F;  2HVY D;  1U43 A;  2LBW A;  2JNB A;  3VCZ A;  2L26 A;  1FFX A;  2BO1 A;  3V3T A;  1Q82 H;  3P4E A;  1VHA A;  3VTI C;  1W3E X;  2CZW A;  4BT6 A;  1FFX B;  3LDT A;  4O4L A;  3F6M A;  5DCV A;  1KD1 H;  5J2T A;  3O85 A;  4BVQ A;  2Z1U A;  2QA4 F;  2Q1X A;  3OBW A;  3U0O A;  5HP7 A;  4O4L B;  3UT5 A;  3VYU C;  5GIP C;  3I3F A;  5EAZ A;  1VQ6 F;  5HXU A;  5J2T B;  5MN4 A;  2H6L A;  1UI9 A;  2GZL A;  2QTP A;  3HTN A;  3KE1 A;  1N8R H;  3UT5 B;  2I6R A;  1Q7Y H;  3C9U A;  2VAM A;  4NQ3 A;  3F0F A;  1VQ8 F;  2LCA A;  1IV4 A;  1KC8 H;  3ZOP A;  2HP0 A;  2BTO A;  4BVT A;  3CC4 F;  2P6Y A;  3MBM A;  3PAF A;  4LNU A;  1J7H A;  2AIF A;  4B5C A;  3MDO A;  1QD9 A;  5EO3 A;  3M84 A;  2HP0 B;  5EZY A;  3JAK A;  3JAR A;  1VQ4 F;  4LNU B;  3WPX A;  1VQ7 F;  2F9Z C;  3LWP C;  3M4S A;  1Z5W A;  1R1M A;  5EZY B;  5GAN K;  3JAK B;  4G4X A;  3JAR B;  1U3L A;  2OHW A;  4ZK7 A;  4EI7 A;  2KTV A;  2Z1F A;  3V7E A;  2B33 A;  3JAL A;  1IPA A;  3S02 A;  3VYT C;  3B6N A;  2ALE A;  3IEW A;  3JAL B;  3I56 F;  2ZAU A;  3MCA B;  3S0H A;  4G4Z A;  3WJQ A;  3GTZ A;  2FGY A;  1W5E A;  2H8C A;  1M1K H;  3HKB A;  1GZ0 A;  1NJI H;  3HJW C;  3CCR F;  1PF5 A;  3RYC A;  2H8E A;  1CK2 A;  2UYP A;  2HX0 A;  1Q81 H;  4U39 A;  3HKB B;  3IR9 A;  3TD3 A;  3WGN A;  3E22 A;  4DXD A;  3RYC B;  4RHA A;  5GIO C;  2RHO A;  2WAL A;  4X1I A;  2IQQ A;  4TUY A;  4ZHW A;  5IYZ A;  5FNV A;  5EWR A;  3E22 B;  3IKF A;  3M1X A;  2GLZ A;  1CN7 A;  3EOR A;  3DC2 A;  4G4V A;  3G4S F;  4O4H A;  2QEX F;  4X1I B;  4TUY B;  3F0D A;  5IYZ B;  5FNV B;  4C4W C;  2HRU A;  5LYJ A;  2UYN A;  3JAW A;  4O4H B;  3S06 A;  1VK3 A;  3WGJ A;  3FPI A;  4X1Y A;  4B46 A;  3CD6 F;  5HY2 A;  4RQO A;  5LYJ B;  1W2B F;  4X3L A;  5CA1 A;  2R75 1;  2UYN B;  3JAW B;  2VGM A;  3D00 A;  3P0Z A;  2UYK A;  4TV9 A;  2MQE A;  1RQ7 A;  4X1Y B;  2HP3 A;  4X20 A;  3SIV A;  2GVI A;  1DT9 A;  2EWC A;  3C9S A;  1VQN F;  5CA1 B;  5LA6 A;  5LP6 C;  4TV9 B;  3IKE A;  3OON A;  3TD4 A;  1ZWZ A;  4X20 B;  4R40 B;  1YIT F;  3QUW A;  2CHS A;  5LA6 B;  5EIB D;  4BT7 A;  5EB1 B;  2AIZ P;  5KMG A;  3KIZ A;  1SA0 A;  2VAP A;  1K73 H;  1PXW A;  1IV2 A;  3K0T A;  1H48 A;  2Q1Y A;  2CHT A;  1FNJ A;  5CA0 A;  4BT5 A;  4ERH A;  5KMG B;  2RHL A;  3ELC A;  5CB4 A;  1SA0 B;  1NQ3 A;  3LWQ C;  5C8Y A;  1W59 A;  3IMP A;  5IT9 M;  2HRY A;  3FD6 A;  5CA0 B;  3G71 F;  3K14 A;  4G4W A;  1QVG F;  3PLA C;  5CB4 B;  2RB9 A;  3GYQ A;  3CCS F;  3KJK A;  3CG6 A;  3LFO A;  5C8Y B;  1VQO F;  2K1S A;  3LME A;  2ZVY A;  4U3J A;  2OTM A;  1E7K A;  4BW0 B;  1YJ9 F;  5IJ0 A;  5LP6 A;  3G6E F;  2PMP A;  1U40 A;  3FFM A;  4U3J B;  5ITZ A;  3CCL F;  4IIJ A;  1GX1 A;  1W55 A;  1X7P A;  3J80 M;  4G4Y A;  5IJ0 B;  1T0A A;  3LWR C;  5LP6 B;  4PWT A;  4C8I A;  2UZH A;  3HKE A;  3IEQ A;  5G4U C;  4O2A A;  4B45 A;  5ITZ B;  4IIJ B;  4WBN A;  3OW2 F;  2N48 A;  2W8B C;  3S0W A;  1W58 1;  3D54 A;  3QTY A;  2CVL A;  3VOB A;  1RQ2 A;  1JFF A;  5JH7 A;  3C9R A;  3HKE B;  1VQ5 F;  4O2A B;  3CCE F;  4KWE A;  4WBN B;  1H7M A;  2DYY A;  2Z01 A;  1RLU A;  3HAX D;  1JFF B;  4C81 A;  5JH7 B;  5HY4 A;  1KNJ A;  3L7Q A;  5KX5 A;  1JJ2 F;  3WGK A;  4BVR A;  4ZHY B;  3S0Y A;  1ONI A;  1DBF A;  2V9Y A;  1NMU B;  3F0G A;  2RHJ A;  5G4V C;  1TVK A;  1W5A A;  5KX5 B;  4TV8 A;  3NVK E;  1QU9 A;  1UFY A;  4LCK A;  4C8G A;  5JCO C;  2OTL F;  3RA5 A;  3HWU A;  2OTJ F;  1TVK B;  3RYF A;  1VQV A;  3WJP A;  5MN6 A;  4TV8 B;  2BTU A;  4BVS A;  1YQN A;  1T0K B;  5B8F A;  2HS0 A;  3ERN A;  3CXC F;  3HKD A;  3WJR A;  3LWO C;  4I50 A;  3QHD A;  4O4J A;  3R0P A;  3RYF B;  1QAH A;  4EI8 A;  4BT2 A;  2ZVZ A;  2HS3 A;  5JQG A;  5BMV A;  3HKD B;  2G9I A;  2CSL A;  4I50 B;  4X3M A;  4O4J B;  3ZP4 A;  2CW4 A;  4HNA A;  3CB2 A;  3CPQ A;  4DRX A;  1W57 A;  1W42 A;  4O4I A;  5BMV B;  5JQG B;  2AMT A;  1YI2 F;  4C8E A;  4IHJ A;  2ZF8 A;  3C8L A;  1FNK A;  1SZQ A;  5GAP K;  1QVF F;  4HNA B;  2PHN A;  3CC2 F;  3CCM F;  5IJ9 A;  1X52 A;  4DRX B;  5HY1 A;  4O4I B;  3N2K A;  3P10 A;  1OAP A;  3N2G A;  3S03 A;  4IHJ B;  1VQL F;  3I55 F;  5A2Q M;  2R6R 1;  3V7Q A;  2HQS C;  4X1K A;  5IJ9 B;  1JY8 A;  3N2K B;  3N2G B;  1KQS F;  3RE3 A;  4ZOL A;  2VXY A;  3VYS C;  3GHZ A;  3VI6 A;  4B62 A;  4F6R A;  4X1K B;  3T80 A;  4I4T A;  4ZI7 A;  1YJW F;  1K8A H;  3ZO8 A;  3N4Y A;  4ZOL B;  3ON1 A;  3CCU F;  3WGL A;  3NVI B;  3CCQ F;  2KTU A;  5HP8 A;  5GON A;  3ZP7 A;  4F6R B;  4I4T B;  4ZI7 B;  1OFU A;  3LYB A;  3NMU C;  2VAW A;  3ESJ A;  5EIB C;  3JCM M;  3RYH A;  5FLX M;  4NWO B;  3CYQ A;  2IG8 A;  4FFB A;  1X7O A;  4O2B A;  5GON B;  1YIJ F;  1GO0 A;  1W5F A;  5EYP A;  2KGW A;  1S72 F;  3VIU A;  2HS4 A;  3JAM M;  3RYH B;  1ODE A;  3TD5 A;  3J7A R;  2Z1T A;  3CYP B;  2FC3 A;  4FFB B;  3JVH A;  3E1Y A;  4O2B B;  4BT4 A;  2IAF A;  5EYP B;  1H47 A;  1VH8 A;  3KHN A;  1COM A;  4I55 A;  1KNK A;  3KJJ A;  2QI2 A;  3VO8 A;  1VQM F;  1RLG A;  3D01 A;  3Q8H A;  1VQP F;  1K9M H;  3OBY A;  4ZHQ A;  5MN5 A;  3JAS A;  4G88 A;  4I55 B;  1Q86 H;  2VGN A;  4BT3 A;  5FJ4 C;  3N4Z A;  1IV1 A;  4ZHQ B;  3AGK A;  3JAS B;  4ZHV A;  1YHQ F;  4YJ3 A;  2ZOD A;  3VMF B;  2LBT A;  1GO1 A;  3I7T A;  2CWJ A;  3HKC A;  1VQK F;  5LXT A;  1X25 A;  1M90 H;  4YJ3 B;  3V4D A;  1Q8R A;  3RA6 A;  3SIU A;  4C82 A;  1W41 A;  5AVM A;  3CPW F;  3HKC B;  3C9T A;  5LXT B;  3VOA A;  1VQ9 F;  3F0E A;  4EB6 A;  5HWE A;  3FD5 A;  1YJN F;  3CCJ F;  1SDS A;  1JN1 A;  4EB6 B;  1CLI A;  3BYQ A;  5HY0 A;  3CCV F;  2Z1E A;  4M8I A;  5GIN C;  4E6E A;  3K12 A;  2OZB A;  5HXZ A;  5J2U A;  2ZOV A;  1W5B A;  3WXM B;  1W40 A;  4EI9 A;  3J81 M;  1XRG A;  2KG4 A;  2NMU A;  1XHO A;  5JVD A;  5EB0 A;  3LWV C;  1U3P A;  3WGM A;  4TZZ A;  1JD1 A;  5J2U B;  3MCQ A;  5LOV A;  3NK6 A;  3JAT A;  1IV3 A;  2UYJ A;  3FBA A;  4BY9 D;  5JVD B;  2BTQ B;  3E20 B;  1TUB A;  1YGY A;  5LOV B;  2DT4 A;  3JAT B;  1Z5V A;  2YXZ A;  4NUT A;  1FSZ A;  2LBX A;  2RHH A;  4YJ2 A;  1RA4 A;  3RYI A;  1TUB B;  3CMA F;  2YYE A;  3CC7 F;  1XV2 A;  5JCO A; 
#chains in the Genus database with same CATH homology
 1CK2 A;  2I6D A;  5FLX M;  4XCQ A;  3OW2 F;  1Q81 H;  1X7O A;  1GO0 A;  1YIJ F;  3IR9 A;  3PLA C;  1S72 F;  3NK7 A;  1XBI A;  3CME F;  2HVY D;  3JAM M;  5GIO C;  2LBW A;  1VQ5 F;  2WAL A;  3CCE F;  3J7A R;  2JNB A;  2FC3 A;  1H7M A;  3E1Y A;  2BO1 A;  3V3T A;  5EWR A;  1Q82 H;  1CN7 A;  2GLZ A;  3HAX D;  5HY4 A;  3G4S F;  1W3E X;  2CZW A;  2QEX F;  2QI2 A;  1JJ2 F;  1VQM F;  1RLG A;  4BVR A;  4C4W C;  5DCV A;  1VQP F;  1KD1 H;  1K9M H;  1NMU B;  3OBY A;  5G4V C;  1Q86 H;  3O85 A;  2VGN A;  4BVQ A;  5FJ4 C;  2QA4 F;  3NVK E;  3N4Z A;  3OBW A;  4LCK A;  5GIP C;  2OTL F;  3CD6 F;  5HY2 A;  1W2B F;  1VQ6 F;  4X3L A;  3RA5 A;  5HXU A;  2OTJ F;  3AGK A;  1YHQ F;  2VGM A;  3D00 A;  1N8R H;  4BVS A;  3VMF B;  1T0K B;  1GO1 A;  3SIV A;  1Q7Y H;  1VQN F;  1DT9 A;  3CXC F;  4NQ3 A;  1VQK F;  3LWO C;  1VQ8 F;  1M90 H;  4EI8 A;  3RA6 A;  1KC8 H;  1ZWZ A;  3SIU A;  1YIT F;  4BVT A;  3CC4 F;  1W41 A;  3CPW F;  3PAF A;  1VQ9 F;  4X3M A;  5HWE A;  2AIF A;  5EO3 A;  1YJN F;  3CPQ A;  3CCJ F;  1K73 H;  1PXW A;  1SDS A;  1W42 A;  1VQ4 F;  1VQ7 F;  1YI2 F;  2F9Z C;  1QVF F;  5GAP K;  3LWP C;  3CC2 F;  3CCM F;  5HY0 A;  5GAN K;  1X52 A;  3LWQ C;  5HY1 A;  3CCV F;  5IT9 M;  5GIN C;  1VQL F;  5HXZ A;  3G71 F;  2OZB A;  3I55 F;  3WXM B;  4EI9 A;  2OHW A;  1W40 A;  3J81 M;  2KTV A;  4EI7 A;  5A2Q M;  2KG4 A;  3GYQ A;  3V7Q A;  3CCS F;  1QVG F;  3LFO A;  3CG6 A;  1VQO F;  3LWV C;  3V7E A;  1IPA A;  1KQS F;  4TZZ A;  1E7K A;  4BW0 B;  3NK6 A;  3VI6 A;  4BY9 D;  1YJ9 F;  2ALE A;  1K8A H;  1YJW F;  3I56 F;  3G6E F;  3E20 B;  3MCA B;  3N4Y A;  3ON1 A;  3FFM A;  5G4U C;  3CCU F;  3NVI B;  3CCL F;  3CCQ F;  3J80 M;  1X7P A;  2FGY A;  2KTU A;  3LWR C;  1M1K H;  1GZ0 A;  4NUT A;  1NJI H;  2LBX A;  3HJW C;  1RA4 A;  3CCR F;  3NMU C;  3JCM M;  3CC7 F;  3CMA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...