3JCMM

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3jcmM00
5IT9M 3LWRC 2LBWA 1KQSF 3CPWF 3LWVC 1VQOF 5G4UC 3CCUF 1Q81H 3VMFB 1JJ2F 2ALEA 2KTUA 1E7KA 1VQNF 3JAMM 1VQLF 2I6DA 3CCVF 1QVGF 3NVIB 3CCSF 1W2BF 3RA5A 2BO1A 1YITF 3CCRF 1N8RH 1VQMF 1NJIH 2CZWA 1Q82H 3CC4F 1VQKF 3CCQF 5GINC 3CC2F 4LCKA 4BY9D 3V7EA 1W42A 1CK2A 3CCEF 1CN7A 5A2QM 1IPAA 3E1YA 5G4VC 3E20B 3MCAB 1GO0A 3OBYA 2VGMA 5GIOC 3CCMF 1VQ8F 3OBWA 3PAFA 1YHQF 5GIPC 2QA4F 1YI2F 3CMEF 3HJWC 1X7PA 3CG6A 3CD6F 3LWPC 1K73H 2VGNA 3V7QA 1VQ4F 3LWQC 3PLAC 3VI6A 3I56F 3CMAF 1KD1H 5EWRA 3OW2F 3CPQA 3LWOC 1H7MA 1K9MH 1NMUB 1DT9A 4NUTA 3ON1A 1ZWZA 1YIJF 3NK6A 1GZ0A 2WALA 3WXMB 1S72F 5FLXM 1YJNF 3NMUC 4C4WC 1K8AH 1VQ9F 2QI2A 3N4YA 1YJ9F 1XBIA 4TZZA 3HAXD 3O85A 1RLGA 1W41A 5FJ4C 1GO1A 1PXWA 4X3LA 2OTJF 3J80M 3G4SF 2KG4A 3G71F 1KC8H 1T0KB 5GAPK 2LBXA 3SIUA 2OTLF 4X3MA 2OZBA 1Q86H 3JCMM 1YJWF 1M90H 1X7OA 1VQ5F 3SIVA 3G6EF 3J7AR 2FC3A 5DCVA 3NVKE 1VQPF 3I55F 4BW0B 1X52A 3NK7A 1W40A 3N4ZA 1VQ7F 3CXCF 1VQ6F 1W3EX 3CCJF 1Q7YH 2QEXF 1RA4A 2JNBA 1M1KH 3GYQA 1SDSA 5GANK 3AGKA 3IR9A 3LFOA 3CC7F 2HVYD 3FFMA 2OHWA 3J81M 2KTVA 1QVFF 2AIFA 3CCLF 5EO3A 3RA6A
chains in the Genus database with same CATH superfamily
4TUYB 4FFBB 1Z5VA 2HS0A 3CPWF 3LWVC 5G4UC 3CCUF 1Q81H 3HWUA 3JAKA 1VQNF 3VTIC 5ITZB 3JAMM 2H8CA 5EB0A 3LMEA 4XCQA 1QVGF 2UZHA 4G4WA 3I3FA 4X20A 3FD5A 1N8RH 1VQMF 4IIJB 3CC4F 4X1KB 4NQ3A 4ERHA 5GINC 3R0PA 4O4HA 3HKBA 1ODEA 3V7EA 1W42A 1OFUA 4X1IA 4DRXA 5A2QM 1IPAA 5G4VC 3E20B 3MCAB 1JY8A 3F0GA 3PAFA 5LYJB 3RYCB 1YHQF 5B8FA 1Q8RA 1U43A 1X7PA 2UYNB 2VGNA 4KWEA 1FNJA 4I55B 5EIBC 3CMAF 4BVRA 1IV3A 2HS3A 2P6YA 1KD1H 5C8YB 5EWRA 4B62A 5AVMA 3OW2F 2VAWA 1H7MA 2KGWA 3LWOC 1GX1A 1NMUB 3NK6A 5MN6A 3N2GA 2Z1FA 3S02A 1VQ9F 5LA6A 1JFFA 5IYZB 4O4LB 2CHSA 3TD4A 1GO1A 3WJRA 4WBNA 4RHAA 2I6RA 5LOVB 3P4EA 3G71F 2QTPA 4O4IB 4ZHVA 2OTMA 4O4JB 1W59A 3RYIA 3V3TA 3VCZA 1M90H 3F0FA 2HS4A 4YJ2A 1RQ2A 2MQEA 5CA0B 1X52A 2V9YA 1W5BA 2CHTA 2RHLA 1FFXB 3WPWA 4U3JB 1FSZA 2JNBA 1CLIA 4O2AB 2HVYD 4ZHWA 5GANK 3JATA 3CC7F 5IJ9B 3C9TA 3FFMA 4I50A 3J81M 3RYHB 5EO3A 3RA6A 1VQVA 2HP0B 2LBWA 3F0DA 1SA0B 1JJ2F 5GONA 2G9IA 3B6NA 3CCVF 1W5AA 1YGYA 3CCSF 1W2BF 3NVIB 4U39A 2BO1A 1YITF 3CCRF 1NJIH 1SZQA 2CZWA 3K14A 1Q82H 1W5EA 3QHDA 3BYQA 1VQKF 3JVHA 2RHHA 1RQ7A 2UYJA 1NQ3A 1TUBA 3LYBA 4X20B 3S0WA 2W8BC 3FD6A 4BVQA 1CK2A 3CCEF 2YXZA 2H6LA 3ZP4A 3HKBB 2VGMA 5BMVA 3OBWA 2AMTA 3HKDA 4X1IB 2BTUA 2ZOVA 5CA1A 1K73H 1VQ4F 3LWQC 2Q1YA 5EAZA 5MN4A 1RLUA 1XRGA 4BT6A 2Q1XA 5KMGB 2CW4A 3MBMA 3IMPA 2DT4A 3S06A 4X1YA 3C9UA 2ZVZA 4C8GA 1UFYA 3JALB 3ON1A 3UT5A 1ZWZA 4B46A 1H48A 3VOAA 3JAWA 2CVLA 5CB4A 1S72F 4LNUA 1KNJA 5FLXM 3C8LA 1VH8A 3TD3A 3IKEA 3N4YA 1XBIA 3MQWA 5J2TA 1YJ9F 4TZZA 5LXTA 1W41A 4O2BA 4EB6A 3ESJA 1JN1A 3WGNA 3WGLA 4B5CA 1Z5WA 2UYKA 3EORA 5FNVA 5LA6B 4DXDA 2IG8A 1JFFB 3IKFA 2KG4A 3J80M 1T0KB 1COMA 3WGMA 2LBXA 2Z1TA 3LDTA 5MN5A 2OZBA 1YJWF 4ZK7A 2AIZP 5HP8A 3SIVA 2EWCA 3RYIB 1VQPF 3N4ZA 3E22A 1VQ7F 4ZHQA 1QU9A 1W3EX 3CCJF 1Q7YH 3WPXA 2F9ZC 2QEXF 2UYPA 3C9RA 3HKEA 5KX5A 3IR9A 3LFOA 3M1XA 4IHJB 1QD9A 1IV2A 2KTVA 3K12A 3CCLF 5LYJA 3RYCA 3JATB 4BT4A 1XHOA 3P10A 5JH7A 2GZLA 3LWRC 2DYYA 1IV1A 2CSLA 3ZOPA 5JVDA 5HXZA 1KNKA 4ZOLB 3N2KB 1OAPA 3S0YA 1W57A 3VMFB 2B33A 4BVTA 2H8EA 3JARA 5C8YA 2GVIA 2I6DA 5JCOC 1U3PA 4HNAA 5GONB 5HY1A 1IV4A 3QUWA 2IAFA 5JQGA 4BY9D 4C82A 5EIBD 5LP6C 5HY2A 3D00A 5HY4A 4TV9A 4F6RA 3P0ZA 3F0EA 3E1YA 1TUBB 3C9SA 1GO0A 3K0TA 1U40A 3OBYA 4I4TA 5LOVA 3CCMF 1XV2A 5IJ0A 5GIPC 1YI2F 1H47A 3CG6A 3M4SA 3V7QA 2LBTA 5EZYA 3PLAC 1PF5A 4TV8A 4YJ3A 3JAKB 2LCAA 2BTOA 3KJKA 5J2UA 5EYPA 3CPQA 1DT9A 5HY0A 4G4ZA 3RYFA 4X1YB 2HP3A 4EI7A 4G4YA 3NMUC 3D01A 4O4HB 3VYSC 3ZO8A 4O2AA 3HAXD 3O85A 2ZODA 5CB4B 4ZI7A 4DRXB 5JCOA 2CWJA 1J7HA 1U3LA 1PXWA 2OTJF 1TVKA 3JASA 5LXTB 4O2BB 5GAPK 4EB6B 3M84A 3KHNA 3HTNA 5FNVB 2RB9A 4G4XA 3JCMM 5LP6A 4RQOA 2L26A 1X7OA 3OONA 1VQ5F 3KE1A 3G6EF 3VOBA 2FC3A 3J7AR 5DCVA 3FPIA 3IEWA 1DBFA 3NVKE 3GHZA 3CYQA 4EI8A 3NK7A 1W40A 4C8EA 3HKCA 2HRYA 3CXCF 3VYUC 1JD1A 3N2GB 4ZHYB 3S0HA 3VYTC 1RA4A 3E22B 1M1KH 4ZHQB 3GYQA 1W581 3IEQA 2OHWA 4FFBA 4TUYA 4WBNB 2AIFA 1QVFF 3MDOA 3HKEB 4BT2A 3ZP7A 4EI9A 5KX5B 5IT9M 3CB2A 5ITZA 1KQSF 4G88A 2HX0A 1VQOF 2Z1EA 5KMGA 2ALEA 5JH7B 4IIJA 2KTUA 1E7KA 4X1KA 4YJ2B 2Z1UA 4NWOB 1VQLF 5JVDB 3RA5A 2GLZA 3JALA 4C8IA 3JARB 4E6EA 2N48A 4BT7A 1W55A 3CCQF 3CC2F 2HRUA 3GTZA 3L7QA 4B45A 4LCKA 4HNAB 3U0OA 3WGKA 3ELCA 5HXUA 3DDNA 1CN7A 4BT3A 5JQGB 4I50B 4PWTA 2UYNA 2ZVYA 3F6MA 3KJJA 5GIOC 1VQ8F 4I55A 3VIUA 4R40B 4TV9B 2QA4F 2PMPA 3FBAA 3VO8A 4F6RB 3CMEF 3CD6F 3HJWC 3LWPC 1VK3A 1T0AA 1X25A 3VI6A 4I4TB 3I56F 5IJ0B 4BVSA 1QAHA 2R6R1 2VAMA 5EZYB 4G4VA 2BTQB 1K9MH 4TV8B 4M8IA 4NUTA 3D54A 4YJ3B 1YIJF 1UI9A 5J2UB 1GZ0A 2WALA 5EYPB 3WXMB 5IYZA 4O4LA 3T80A 1YJNF 5HP7A 3CYPB 4C4WC 1K8AH 2QI2A 2VAPA 3RYFB 1FNKA 4BT5A 3V4DA 1RLGA 4IHJA 5HWEA 4O4IA 1VHAA 3S03A 5FJ4C 4O4JA 2YYEA 3WJPA 2ZF8A 4X3LA 3QTYA 5BMVB 4C81A 3G4SF 1KC8H 3HKDB 4ZI7B 2IQQA 5CA1B 3RE3A 3SIUA 3WGJA 4ZOLA 3N2KA 2OTLF 5CA0A 4X3MA 1YQNA 2RHOA 3KIZA 1TVKB 3JASB 3MCQA 1Q86H 1W5FA 5EB1B 2ZAUA 3DC2A 2K1SA 1FFXA 3WJQA 4U3JA 3I55F 4BW0B 5LP6B 3UT5B 3K2XA 2FGYA 2RHJA 1VQ6F 2VXYA 3ERNA 3JAWB 1ONIA 4LNUB 5IJ9A 3I7TA 2Z01A 3RYHA 2HQSC 3HKCB 2NMUA 5J2TB 1SDSA 3AGKA 3TD5A 2HP0A 2PHNA 2R751 1SA0A 1R1MA 3Q8HA
chains in the Genus database with same CATH topology
5IT9M 3LWRC 2LBWA 1KQSF 3CPWF 3LWVC 5HXZA 1VQOF 5G4UC 3CCUF 1Q81H 3VMFB 1JJ2F 4BVTA 2ALEA 2KTUA 1E7KA 1VQNF 3JAMM 1VQLF 2I6DA 3CCVF 4XCQA 1QVGF 3CCSF 1W2BF 3NVIB 3RA5A 2BO1A 1YITF 2GLZA 3CCRF 1N8RH 1VQMF 1NJIH 2CZWA 5HY1A 1Q82H 3CC4F 4NQ3A 1VQKF 3CCQF 5GINC 3CC2F 4LCKA 4BY9D 5HXUA 3V7EA 1W42A 4BVQA 5HY2A 3D00A 1CK2A 5HY4A 3CCEF 1CN7A 5A2QM 1IPAA 3E1YA 5G4VC 3E20B 3MCAB 1GO0A 3OBYA 2VGMA 5GIOC 3CCMF 1VQ8F 3OBWA 3PAFA 1YHQF 5GIPC 2QA4F 1YI2F 3CMEF 3HJWC 1X7PA 3CG6A 3CD6F 3LWPC 1K73H 2VGNA 3V7QA 1VQ4F 3LWQC 3PLAC 3VI6A 3I56F 3CMAF 4BVRA 4BVSA 1KD1H 5EWRA 3OW2F 3CPQA 3LWOC 1H7MA 1K9MH 1NMUB 1DT9A 4NUTA 5HY0A 3ON1A 1ZWZA 1YIJF 3NK6A 1GZ0A 2WALA 3WXMB 4EI7A 1S72F 5FLXM 1YJNF 3NMUC 4C4WC 1K8AH 1VQ9F 2QI2A 3N4YA 1YJ9F 1XBIA 4TZZA 3HAXD 3O85A 1RLGA 1W41A 5HWEA 5FJ4C 1GO1A 1PXWA 4X3LA 2OTJF 3J80M 3G4SF 2KG4A 3G71F 1KC8H 1T0KB 5GAPK 2LBXA 3SIUA 2OTLF 4X3MA 3V3TA 2OZBA 1Q86H 3JCMM 1YJWF 1M90H 1X7OA 1VQ5F 3SIVA 3G6EF 3J7AR 2FC3A 5DCVA 3NVKE 1VQPF 3I55F 4EI8A 4BW0B 1X52A 3NK7A 1W40A 3N4ZA 1VQ7F 2FGYA 3CXCF 1VQ6F 1W3EX 3CCJF 1Q7YH 2F9ZC 2QEXF 1RA4A 2JNBA 1M1KH 3GYQA 1SDSA 5GANK 3AGKA 3IR9A 3LFOA 3CC7F 2HVYD 3FFMA 2OHWA 3J81M 2KTVA 1QVFF 2AIFA 3CCLF 4EI9A 5EO3A 3RA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 M;  3LWR C;  2LBW A;  1KQS F;  3CPW F;  3LWV C;  1VQO F;  5G4U C;  3CCU F;  1Q81 H;  3VMF B;  1JJ2 F;  2ALE A;  2KTU A;  1E7K A;  1VQN F;  3JAM M;  1VQL F;  2I6D A;  3CCV F;  1QVG F;  3NVI B;  3CCS F;  1W2B F;  3RA5 A;  2BO1 A;  1YIT F;  3CCR F;  1N8R H;  1VQM F;  1NJI H;  2CZW A;  1Q82 H;  3CC4 F;  1VQK F;  3CCQ F;  5GIN C;  3CC2 F;  4LCK A;  4BY9 D;  3V7E A;  1W42 A;  1CK2 A;  3CCE F;  1CN7 A;  5A2Q M;  1IPA A;  3E1Y A;  5G4V C;  3E20 B;  3MCA B;  1GO0 A;  3OBY A;  2VGM A;  5GIO C;  3CCM F;  1VQ8 F;  3OBW A;  3PAF A;  1YHQ F;  5GIP C;  2QA4 F;  1YI2 F;  3CME F;  3HJW C;  1X7P A;  3CG6 A;  3CD6 F;  3LWP C;  1K73 H;  2VGN A;  3V7Q A;  1VQ4 F;  3LWQ C;  3PLA C;  3VI6 A;  3I56 F;  3CMA F;  1KD1 H;  5EWR A;  3OW2 F;  3CPQ A;  3LWO C;  1H7M A;  1K9M H;  1NMU B;  1DT9 A;  4NUT A;  3ON1 A;  1ZWZ A;  1YIJ F;  3NK6 A;  1GZ0 A;  2WAL A;  3WXM B;  1S72 F;  5FLX M;  1YJN F;  3NMU C;  4C4W C;  1K8A H;  1VQ9 F;  2QI2 A;  3N4Y A;  1YJ9 F;  1XBI A;  4TZZ A;  3HAX D;  3O85 A;  1RLG A;  1W41 A;  5FJ4 C;  1GO1 A;  1PXW A;  4X3L A;  2OTJ F;  3J80 M;  3G4S F;  2KG4 A;  3G71 F;  1KC8 H;  1T0K B;  5GAP K;  2LBX A;  3SIU A;  2OTL F;  4X3M A;  2OZB A;  1Q86 H;  3JCM M;  1YJW F;  1M90 H;  1X7O A;  1VQ5 F;  3SIV A;  3G6E F;  3J7A R;  2FC3 A;  5DCV A;  3NVK E;  1VQP F;  3I55 F;  4BW0 B;  1X52 A;  3NK7 A;  1W40 A;  3N4Z A;  1VQ7 F;  3CXC F;  1VQ6 F;  1W3E X;  3CCJ F;  1Q7Y H;  2QEX F;  1RA4 A;  2JNB A;  1M1K H;  3GYQ A;  1SDS A;  5GAN K;  3AGK A;  3IR9 A;  3LFO A;  3CC7 F;  2HVY D;  3FFM A;  2OHW A;  3J81 M;  2KTV A;  1QVF F;  2AIF A;  3CCL F;  5EO3 A;  3RA6 A; 
#chains in the Genus database with same CATH topology
 4TUY B;  4FFB B;  1Z5V A;  2HS0 A;  3CPW F;  3LWV C;  5G4U C;  3CCU F;  1Q81 H;  3HWU A;  3JAK A;  1VQN F;  3VTI C;  5ITZ B;  3JAM M;  2H8C A;  5EB0 A;  3LME A;  4XCQ A;  1QVG F;  2UZH A;  4G4W A;  3I3F A;  4X20 A;  3FD5 A;  1N8R H;  1VQM F;  4IIJ B;  3CC4 F;  4X1K B;  4NQ3 A;  4ERH A;  5GIN C;  3R0P A;  4O4H A;  3HKB A;  1ODE A;  3V7E A;  1W42 A;  1OFU A;  4X1I A;  4DRX A;  5A2Q M;  1IPA A;  5G4V C;  3E20 B;  3MCA B;  1JY8 A;  3F0G A;  3PAF A;  5LYJ B;  3RYC B;  1YHQ F;  5B8F A;  1Q8R A;  1U43 A;  1X7P A;  2UYN B;  2VGN A;  4KWE A;  1FNJ A;  4I55 B;  5EIB C;  3CMA F;  4BVR A;  1IV3 A;  2HS3 A;  2P6Y A;  1KD1 H;  5C8Y B;  5EWR A;  4B62 A;  5AVM A;  3OW2 F;  2VAW A;  1H7M A;  2KGW A;  3LWO C;  1GX1 A;  1NMU B;  3NK6 A;  5MN6 A;  3N2G A;  2Z1F A;  3S02 A;  1VQ9 F;  5LA6 A;  1JFF A;  5IYZ B;  4O4L B;  2CHS A;  3TD4 A;  1GO1 A;  3WJR A;  4WBN A;  4RHA A;  2I6R A;  5LOV B;  3P4E A;  3G71 F;  2QTP A;  4O4I B;  4ZHV A;  2OTM A;  4O4J B;  1W59 A;  3RYI A;  3V3T A;  3VCZ A;  1M90 H;  3F0F A;  2HS4 A;  4YJ2 A;  1RQ2 A;  2MQE A;  5CA0 B;  1X52 A;  2V9Y A;  1W5B A;  2CHT A;  2RHL A;  1FFX B;  3WPW A;  4U3J B;  1FSZ A;  2JNB A;  1CLI A;  4O2A B;  2HVY D;  4ZHW A;  5GAN K;  3JAT A;  3CC7 F;  5IJ9 B;  3C9T A;  3FFM A;  4I50 A;  3J81 M;  3RYH B;  5EO3 A;  3RA6 A;  1VQV A;  2HP0 B;  2LBW A;  3F0D A;  1SA0 B;  1JJ2 F;  5GON A;  2G9I A;  3B6N A;  3CCV F;  1W5A A;  1YGY A;  3CCS F;  1W2B F;  3NVI B;  4U39 A;  2BO1 A;  1YIT F;  3CCR F;  1NJI H;  1SZQ A;  2CZW A;  3K14 A;  1Q82 H;  1W5E A;  3QHD A;  3BYQ A;  1VQK F;  3JVH A;  2RHH A;  1RQ7 A;  2UYJ A;  1NQ3 A;  1TUB A;  3LYB A;  4X20 B;  3S0W A;  2W8B C;  3FD6 A;  4BVQ A;  1CK2 A;  3CCE F;  2YXZ A;  2H6L A;  3ZP4 A;  3HKB B;  2VGM A;  5BMV A;  3OBW A;  2AMT A;  3HKD A;  4X1I B;  2BTU A;  2ZOV A;  5CA1 A;  1K73 H;  1VQ4 F;  3LWQ C;  2Q1Y A;  5EAZ A;  5MN4 A;  1RLU A;  1XRG A;  4BT6 A;  2Q1X A;  5KMG B;  2CW4 A;  3MBM A;  3IMP A;  2DT4 A;  3S06 A;  4X1Y A;  3C9U A;  2ZVZ A;  4C8G A;  1UFY A;  3JAL B;  3ON1 A;  3UT5 A;  1ZWZ A;  4B46 A;  1H48 A;  3VOA A;  3JAW A;  2CVL A;  5CB4 A;  1S72 F;  4LNU A;  1KNJ A;  5FLX M;  3C8L A;  1VH8 A;  3TD3 A;  3IKE A;  3N4Y A;  1XBI A;  3MQW A;  5J2T A;  1YJ9 F;  4TZZ A;  5LXT A;  1W41 A;  4O2B A;  4EB6 A;  3ESJ A;  1JN1 A;  3WGN A;  3WGL A;  4B5C A;  1Z5W A;  2UYK A;  3EOR A;  5FNV A;  5LA6 B;  4DXD A;  2IG8 A;  1JFF B;  3IKF A;  2KG4 A;  3J80 M;  1T0K B;  1COM A;  3WGM A;  2LBX A;  2Z1T A;  3LDT A;  5MN5 A;  2OZB A;  1YJW F;  4ZK7 A;  2AIZ P;  5HP8 A;  3SIV A;  2EWC A;  3RYI B;  1VQP F;  3N4Z A;  3E22 A;  1VQ7 F;  4ZHQ A;  1QU9 A;  1W3E X;  3CCJ F;  1Q7Y H;  3WPX A;  2F9Z C;  2QEX F;  2UYP A;  3C9R A;  3HKE A;  5KX5 A;  3IR9 A;  3LFO A;  3M1X A;  4IHJ B;  1QD9 A;  1IV2 A;  2KTV A;  3K12 A;  3CCL F;  5LYJ A;  3RYC A;  3JAT B;  4BT4 A;  1XHO A;  3P10 A;  5JH7 A;  2GZL A;  3LWR C;  2DYY A;  1IV1 A;  2CSL A;  3ZOP A;  5JVD A;  5HXZ A;  1KNK A;  4ZOL B;  3N2K B;  1OAP A;  3S0Y A;  1W57 A;  3VMF B;  2B33 A;  4BVT A;  2H8E A;  3JAR A;  5C8Y A;  2GVI A;  2I6D A;  5JCO C;  1U3P A;  4HNA A;  5GON B;  5HY1 A;  1IV4 A;  3QUW A;  2IAF A;  5JQG A;  4BY9 D;  4C82 A;  5EIB D;  5LP6 C;  5HY2 A;  3D00 A;  5HY4 A;  4TV9 A;  4F6R A;  3P0Z A;  3F0E A;  3E1Y A;  1TUB B;  3C9S A;  1GO0 A;  3K0T A;  1U40 A;  3OBY A;  4I4T A;  5LOV A;  3CCM F;  1XV2 A;  5IJ0 A;  5GIP C;  1YI2 F;  1H47 A;  3CG6 A;  3M4S A;  3V7Q A;  2LBT A;  5EZY A;  3PLA C;  1PF5 A;  4TV8 A;  4YJ3 A;  3JAK B;  2LCA A;  2BTO A;  3KJK A;  5J2U A;  5EYP A;  3CPQ A;  1DT9 A;  5HY0 A;  4G4Z A;  3RYF A;  4X1Y B;  2HP3 A;  4EI7 A;  4G4Y A;  3NMU C;  3D01 A;  4O4H B;  3VYS C;  3ZO8 A;  4O2A A;  3HAX D;  3O85 A;  2ZOD A;  5CB4 B;  4ZI7 A;  4DRX B;  5JCO A;  2CWJ A;  1J7H A;  1U3L A;  1PXW A;  2OTJ F;  1TVK A;  3JAS A;  5LXT B;  4O2B B;  5GAP K;  4EB6 B;  3M84 A;  3KHN A;  3HTN A;  5FNV B;  2RB9 A;  4G4X A;  3JCM M;  5LP6 A;  4RQO A;  2L26 A;  1X7O A;  3OON A;  1VQ5 F;  3KE1 A;  3G6E F;  3VOB A;  2FC3 A;  3J7A R;  5DCV A;  3FPI A;  3IEW A;  1DBF A;  3NVK E;  3GHZ A;  3CYQ A;  4EI8 A;  3NK7 A;  1W40 A;  4C8E A;  3HKC A;  2HRY A;  3CXC F;  3VYU C;  1JD1 A;  3N2G B;  4ZHY B;  3S0H A;  3VYT C;  1RA4 A;  3E22 B;  1M1K H;  4ZHQ B;  3GYQ A;  1W58 1;  3IEQ A;  2OHW A;  4FFB A;  4TUY A;  4WBN B;  2AIF A;  1QVF F;  3MDO A;  3HKE B;  4BT2 A;  3ZP7 A;  4EI9 A;  5KX5 B;  5IT9 M;  3CB2 A;  5ITZ A;  1KQS F;  4G88 A;  2HX0 A;  1VQO F;  2Z1E A;  5KMG A;  2ALE A;  5JH7 B;  4IIJ A;  2KTU A;  1E7K A;  4X1K A;  4YJ2 B;  2Z1U A;  4NWO B;  1VQL F;  5JVD B;  3RA5 A;  2GLZ A;  3JAL A;  4C8I A;  3JAR B;  4E6E A;  2N48 A;  4BT7 A;  1W55 A;  3CCQ F;  3CC2 F;  2HRU A;  3GTZ A;  3L7Q A;  4B45 A;  4LCK A;  4HNA B;  3U0O A;  3WGK A;  3ELC A;  5HXU A;  3DDN A;  1CN7 A;  4BT3 A;  5JQG B;  4I50 B;  4PWT A;  2UYN A;  2ZVY A;  3F6M A;  3KJJ A;  5GIO C;  1VQ8 F;  4I55 A;  3VIU A;  4R40 B;  4TV9 B;  2QA4 F;  2PMP A;  3FBA A;  3VO8 A;  4F6R B;  3CME F;  3CD6 F;  3HJW C;  3LWP C;  1VK3 A;  1T0A A;  1X25 A;  3VI6 A;  4I4T B;  3I56 F;  5IJ0 B;  4BVS A;  1QAH A;  2R6R 1;  2VAM A;  5EZY B;  4G4V A;  2BTQ B;  1K9M H;  4TV8 B;  4M8I A;  4NUT A;  3D54 A;  4YJ3 B;  1YIJ F;  1UI9 A;  5J2U B;  1GZ0 A;  2WAL A;  5EYP B;  3WXM B;  5IYZ A;  4O4L A;  3T80 A;  1YJN F;  5HP7 A;  3CYP B;  4C4W C;  1K8A H;  2QI2 A;  2VAP A;  3RYF B;  1FNK A;  4BT5 A;  3V4D A;  1RLG A;  4IHJ A;  5HWE A;  4O4I A;  1VHA A;  3S03 A;  5FJ4 C;  4O4J A;  2YYE A;  3WJP A;  2ZF8 A;  4X3L A;  3QTY A;  5BMV B;  4C81 A;  3G4S F;  1KC8 H;  3HKD B;  4ZI7 B;  2IQQ A;  5CA1 B;  3RE3 A;  3SIU A;  3WGJ A;  4ZOL A;  3N2K A;  2OTL F;  5CA0 A;  4X3M A;  1YQN A;  2RHO A;  3KIZ A;  1TVK B;  3JAS B;  3MCQ A;  1Q86 H;  1W5F A;  5EB1 B;  2ZAU A;  3DC2 A;  2K1S A;  1FFX A;  3WJQ A;  4U3J A;  3I55 F;  4BW0 B;  5LP6 B;  3UT5 B;  3K2X A;  2FGY A;  2RHJ A;  1VQ6 F;  2VXY A;  3ERN A;  3JAW B;  1ONI A;  4LNU B;  5IJ9 A;  3I7T A;  2Z01 A;  3RYH A;  2HQS C;  3HKC B;  2NMU A;  5J2T B;  1SDS A;  3AGK A;  3TD5 A;  2HP0 A;  2PHN A;  2R75 1;  1SA0 A;  1R1M A;  3Q8H A; 
#chains in the Genus database with same CATH homology
 5IT9 M;  3LWR C;  2LBW A;  1KQS F;  3CPW F;  3LWV C;  5HXZ A;  1VQO F;  5G4U C;  3CCU F;  1Q81 H;  3VMF B;  1JJ2 F;  4BVT A;  2ALE A;  2KTU A;  1E7K A;  1VQN F;  3JAM M;  1VQL F;  2I6D A;  3CCV F;  4XCQ A;  1QVG F;  3CCS F;  1W2B F;  3NVI B;  3RA5 A;  2BO1 A;  1YIT F;  2GLZ A;  3CCR F;  1N8R H;  1VQM F;  1NJI H;  2CZW A;  5HY1 A;  1Q82 H;  3CC4 F;  4NQ3 A;  1VQK F;  3CCQ F;  5GIN C;  3CC2 F;  4LCK A;  4BY9 D;  5HXU A;  3V7E A;  1W42 A;  4BVQ A;  5HY2 A;  3D00 A;  1CK2 A;  5HY4 A;  3CCE F;  1CN7 A;  5A2Q M;  1IPA A;  3E1Y A;  5G4V C;  3E20 B;  3MCA B;  1GO0 A;  3OBY A;  2VGM A;  5GIO C;  3CCM F;  1VQ8 F;  3OBW A;  3PAF A;  1YHQ F;  5GIP C;  2QA4 F;  1YI2 F;  3CME F;  3HJW C;  1X7P A;  3CG6 A;  3CD6 F;  3LWP C;  1K73 H;  2VGN A;  3V7Q A;  1VQ4 F;  3LWQ C;  3PLA C;  3VI6 A;  3I56 F;  3CMA F;  4BVR A;  4BVS A;  1KD1 H;  5EWR A;  3OW2 F;  3CPQ A;  3LWO C;  1H7M A;  1K9M H;  1NMU B;  1DT9 A;  4NUT A;  5HY0 A;  3ON1 A;  1ZWZ A;  1YIJ F;  3NK6 A;  1GZ0 A;  2WAL A;  3WXM B;  4EI7 A;  1S72 F;  5FLX M;  1YJN F;  3NMU C;  4C4W C;  1K8A H;  1VQ9 F;  2QI2 A;  3N4Y A;  1YJ9 F;  1XBI A;  4TZZ A;  3HAX D;  3O85 A;  1RLG A;  1W41 A;  5HWE A;  5FJ4 C;  1GO1 A;  1PXW A;  4X3L A;  2OTJ F;  3J80 M;  3G4S F;  2KG4 A;  3G71 F;  1KC8 H;  1T0K B;  5GAP K;  2LBX A;  3SIU A;  2OTL F;  4X3M A;  3V3T A;  2OZB A;  1Q86 H;  3JCM M;  1YJW F;  1M90 H;  1X7O A;  1VQ5 F;  3SIV A;  3G6E F;  3J7A R;  2FC3 A;  5DCV A;  3NVK E;  1VQP F;  3I55 F;  4EI8 A;  4BW0 B;  1X52 A;  3NK7 A;  1W40 A;  3N4Z A;  1VQ7 F;  2FGY A;  3CXC F;  1VQ6 F;  1W3E X;  3CCJ F;  1Q7Y H;  2F9Z C;  2QEX F;  1RA4 A;  2JNB A;  1M1K H;  3GYQ A;  1SDS A;  5GAN K;  3AGK A;  3IR9 A;  3LFO A;  3CC7 F;  2HVY D;  3FFM A;  2OHW A;  3J81 M;  2KTV A;  1QVF F;  2AIF A;  3CCL F;  4EI9 A;  5EO3 A;  3RA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...