3JCMM

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3jcmM00
4X3MA 1IPAA 2LBWA 3JAMM 3RA6A 1Q81H 3CCUF 3I56F 1KD1H 3V7QA 3VI6A 1KQSF 3J80M 3LFOA 5GIOC 1YI2F 3N4YA 1VQ9F 1VQ6F 1VQ8F 3HAXD 2AIFA 1NMUB 1K8AH 2QA4F 1GO0A 1S72F 1PXWA 5EO3A 2CZWA 1VQ7F 3NK7A 3RA5A 1H7MA 4TZZA 3NVIB 5GAPK 3CG6A 3ON1A 3CD6F 3LWOC 2ALEA 3CCRF 3CPQA 2LBXA 5G4VC 3G71F 3LWRC 3VMFB 5GINC 1M90H 3LWQC 2OHWA 2VGMA 3J81M 1VQ5F 3OW2F 3CPWF 3G4SF 1JJ2F 3IR9A 1Q86H 1K73H 1GZ0A 3CCEF 3O85A 1VQ4F 3HJWC 1Q7YH 1KC8H 3LWPC 3G6EF 4X3LA 5IT9M 2QI2A 3CC2F 3NMUC 1W41A 1NJIH 3J7AR 4BY9D 3CCLF 5EWRA 1W40A 1DT9A 4C4WC 1XBIA 3SIVA 1T0KB 3CCQF 1W3EX 3CMEF 4BW0B 3CCJF 5A2QM 2HVYD 3I55F 3CCSF 3NK6A 2VGNA 3LWVC 5G4UC 1VQMF 1X52A 1YIJF 3OBWA 1E7KA 3N4ZA 3OBYA 3CCVF 1YJNF 3JCMM 1YITF 2OTLF 1VQOF 2I6DA 1M1KH 5GANK 5FJ4C 1N8RH 3PAFA 1YHQF 2BO1A 1CK2A 1VQKF 5GIPC 1ZWZA 1K9MH 2OZBA 3NVKE 2FC3A 1SDSA 1CN7A 4LCKA 3E20B 1YJ9F 3CC7F 1VQNF 4NUTA 1W42A 3CMAF 3AGKA 3GYQA 1X7OA 3FFMA 2KTUA 1YJWF 2QEXF 5FLXM 3MCAB 2KTVA 3SIUA 1QVFF 1GO1A 2JNBA 3WXMB 1W2BF 3CCMF 1Q82H 1QVGF 1RA4A 3PLAC 5DCVA 2OTJF 3CXCF 1VQPF 2WALA 2KG4A 3CC4F 3V7EA 3E1YA 1X7PA 1RLGA 1VQLF
chains in the Genus database with same CATH superfamily
1QAHA 2LBWA 1PF5A 1W581 2Z1UA 3JAKA 1KD1H 5FNVA 3VI6A 2UYJA 3TD3A 3J80M 5GIOC 2QTPA 4ZOLA 3VYTC 1TUBB 3OONA 1XV2A 5GONA 2AIFA 2DYYA 4M8IA 1FFXA 3P4EA 1NMUB 3FBAA 4C8IA 3HKEA 5LP6C 4EI8A 2CZWA 3RA5A 5EYPB 3NVIB 3RYFB 4G4WA 2BTOA 2W8BC 3ON1A 5LXTB 5J2TB 4F6RB 3FPIA 2UYNB 4IIJB 5BMVB 2KGWA 3LDTA 5LP6B 3F0FA 4ZI7A 3IR9A 5LYJA 2Z1FA 3CCEF 3HKBA 1Z5VA 4B5CA 4X3LA 3RYFA 2QI2A 3FD5A 5IT9M 1W41A 3VIUA 3C9RA 4BY9D 1DT9A 1XBIA 2CSLA 3K12A 3CMEF 2RHLA 3CCJF 3IKEA 5A2QM 3CCSF 3NK6A 4FFBA 3M1XA 4X1KB 1XRGA 3WGNA 3LWVC 1UFYA 3JVHA 4E6EA 2VAPA 4X1YB 3OBWA 1E7KA 3VO8A 1IV2A 2YXZA 3JCMM 4ZK7A 2CW4A 5HY4A 1YITF 1U3LA 2R751 4TV9B 5GANK 1NQ3A 3M84A 3EORA 1N8RH 5EB0A 1VQKF 1JFFA 5LOVA 1Z5WA 1RQ2A 3JAWA 4NUTA 4DRXB 4YJ2A 5C8YA 1X7OA 4I55B 4TUYA 1ODEA 3VYUC 1YJWF 3F0EA 3RYHB 2HP0A 4U39A 5JVDB 3SIUA 2IQQA 4YJ3A 3TD4A 2MQEA 3IKFA 2JNBA 4LNUB 3JASB 1W55A 5EAZA 4ZHQB 2ZODA 2KG4A 1FNJA 4I55A 4TUYB 3V7EA 1X7PA 1RLGA 4YJ2B 3RA6A 3VYSC 1Q81H 1KNKA 4EI9A 2UYPA 4I50B 3VOAA 1U43A 5KMGA 4O4HB 1VQ8F 3WGMA 5J2UB 3S06A 2QA4F 4X1IA 3NK7A 2ZVYA 1H7MA 4BT6A 1SA0B 1J7HA 1RLUA 1IV4A 3CG6A 1JD1A 2GLZA 3S0HA 4O4LA 1W59A 3CD6F 4X1IB 5HY1A 2LBXA 4IHJB 3G71F 3JATA 3LWRC 5HWEA 3VMFB 3N2GB 5IYZA 5J2UA 4B46A 5JCOC 5JCOA 2VGMA 3J81M 1VQ5F 3WPXA 2K1SA 2RHHA 3OW2F 2HS4A 2CHSA 1Q86H 2I6RA 1U3PA 4NWOB 1TVKB 1K73H 2F9ZC 3E22A 2LCAA 5HP8A 3CC2F 1NJIH 3CCLF 3HKBB 2RHJA 3SIVA 3F0GA 3CCQF 2IAFA 2VAMA 1KNJA 5MN5A 4C82A 3I55F 4LNUA 2Q1XA 2HS0A 3V3TA 5G4UC 1W5AA 3RYCA 1VQMF 4R40B 4G4ZA 3C9SA 3WGLA 4O2BA 5HP7A 3JARA 3ZP7A 1M1KH 3HKEB 4PWTA 1IV3A 3S0YA 3M4SA 5FJ4C 2HRYA 1YHQF 1JY8A 3F6MA 1JFFB 3DDNA 5GIPC 3CB2A 1FNKA 3LYBA 1K9MH 3N2KA 3I3FA 2OZBA 5CB4A 3WGKA 3E20B 3CC7F 3CYQA 4TV8A 1SA0A 3RE3A 3BYQA 3IEWA 4X1YA 2QEXF 1QD9A 1YQNA 3MCAB 4B45A 3D01A 5CB4B 3WJPA 2KTVA 3GHZA 3N2KB 1QVFF 1GO1A 5DCVA 4C8EA 2WALA 3CC4F 1DBFA 4I4TB 2HQSC 2RB9A 4WBNA 4ZHYB 1VQLF 3WJQA 4HNAA 5CA1B 1IPAA 3JAMM 2ZOVA 3I56F 3CCUF 3V7QA 3D00A 5LYJB 2R6R1 3LFOA 1VQ9F 3N4YA 3GTZA 3QUWA 3HAXD 3Q8HA 5JVDA 3WGJA 2Z1EA 4IIJA 5BMVA 2H8EA 1K8AH 1PXWA 1H47A 2GZLA 5IJ9A 5CA0A 5JQGB 3TD5A 5C8YB 2AMTA 4TZZA 3MCQA 5EB1B 5GAPK 3HWUA 2HX0A 4DRXA 3HKDA 5EZYB 4KWEA 2ALEA 5ITZB 3LWOC 5G4VC 3HTNA 5GINC 4O4IB 3MDOA 3N2GA 2OHWA 4ZOLB 3ZOPA 4C8GA 3G4SF 3VTIC 4O4LB 2B33A 1W57A 1VQ4F 3HJWC 4O2BB 1Q7YH 1KC8H 5EZYA 3LWPC 3S02A 3DC2A 3NMUC 3CYPB 5KX5B 2UZHA 3RYCB 5EWRA 1W40A 4C4WC 2L26A 3I7TA 4BW0B 3S03A 2HVYD 4O4IA 4O4HA 3T80A 2GVIA 3KE1A 2VXYA 5EIBD 3JALB 3LMEA 3HKDB 3ELCA 2ZAUA 3N4ZA 4WBNB 3E22B 2V9YA 3RYIA 1TVKA 3IMPA 3CCVF 1YJNF 5CA0B 5MN4A 2P6YA 2OTLF 1VQOF 4ZHQA 3UT5A 1CLIA 1OFUA 1VQVA 2OTMA 5IYZB 2FGYA 2ZVZA 1ZWZA 4IHJA 3ERNA 2YYEA 5LXTA 5J2TA 3F0DA 1SDSA 3UT5B 1RQ7A 4RHAA 5IJ0A 1VQNF 1Q8RA 1W42A 3KHNA 5EYPA 2LBTA 2N48A 3FFMA 2PHNA 2CWJA 3KJJA 3U0OA 5EIBC 5GONB 4EB6A 4G4YA 1IV1A 1R1MA 3VOBA 3WXMB 4BT4A 1W2BF 3V4DA 1UI9A 1RA4A 2EWCA 3MQWA 4I50A 3PLAC 3R0PA 4C81A 3FD6A 3CXCF 1VQPF 1OAPA 3WPWA 1GX1A 4BVSA 4X20B 5HY2A 4X3MA 2UYKA 2VAWA 2ZF8A 2Q1YA 4BT3A 5AVMA 4XCQA 1JN1A 4BVTA 1U40A 5IJ0B 1COMA 5JH7B 3JASA 3P10A 5LA6B 1KQSF 5HXUA 2H6LA 2PMPA 3K2XA 4FFBB 1SZQA 1X25A 4X1KA 1YI2F 1VQ6F 3C9UA 3D54A 2HP0B 4ERHA 1VHAA 1GO0A 1S72F 5EO3A 5ITZA 3WJRA 1VQ7F 3RYIB 3HKCB 4O2AA 4BVRA 3MBMA 1VK3A 4G88A 4NQ3A 1YGYA 3JAWB 1W5EA 3C8LA 5B8FA 5LOVB 2CVLA 4U3JB 4ZHWA 3CPQA 3CCRF 5HXZA 1M90H 3LWQC 3ZP4A 2UYNA 3CPWF 4TV9A 1JJ2F 4BVQA 4BT2A 5LA6A 3ZO8A 1GZ0A 3O85A 5KX5A 3G6EF 1FSZA 3C9TA 5HY0A 5CA1A 4HNAB 3S0WA 3J7AR 2HP3A 2BTUA 3L7QA 2BTQB 2G9IA 1T0KB 1W5FA 1W3EX 2NMUA 1TUBA 2H8CA 1QU9A 3JATB 2VGNA 4EB6B 3KIZA 3VCZA 4BT7A 2RHOA 3JAKB 4DXDA 1X52A 2Z1TA 3K14A 1YIJF 3OBYA 3QHDA 4G4VA 4ZHVA 5JQGA 5IJ9B 1ONIA 2I6DA 2HS3A 1T0AA 3PAFA 4ZI7B 2BO1A 1CK2A 5LP6A 4O4JA 5KMGB 3IEQA 2HRUA 4U3JA 3NVKE 2DT4A 2FC3A 1H48A 4EI7A 4F6RA 1CN7A 2AIZP 3RYHA 5MN6A 4LCKA 1YJ9F 1XHOA 3P0ZA 3JARB 1VH8A 3CMAF 4G4XA 3HKCA 4O2AB 3AGKA 3GYQA 2KTUA 4I4TA 2IG8A 5FLXM 3ESJA 3KJKA 1FFXB 2CHTA 4B62A 4RQOA 1W5BA 3K0TA 3QTYA 3JALA 4O4JB 3CCMF 1Q82H 4YJ3B 1QVGF 5FNVB 5JH7A 4BT5A 2OTJF 2Z01A 3B6NA 4X20A 3E1YA 4TV8B
chains in the Genus database with same CATH topology
4X3MA 1IPAA 2LBWA 3JAMM 3RA6A 1Q81H 4XCQA 4BVTA 4EI9A 3I56F 3CCUF 1KD1H 3V7QA 3D00A 3VI6A 1KQSF 5HXUA 3J80M 3LFOA 5GIOC 1YI2F 3N4YA 1VQ9F 1VQ6F 1VQ8F 3HAXD 2AIFA 1NMUB 1K8AH 2QA4F 1GO0A 1S72F 1PXWA 5EO3A 4EI8A 2CZWA 1VQ7F 3NK7A 3RA5A 1H7MA 4BVRA 4TZZA 3NVIB 5GAPK 3CG6A 3ON1A 4NQ3A 2GLZA 3CD6F 2ALEA 3LWOC 3CCRF 3CPQA 2LBXA 5HY1A 5HXZA 5G4VC 3LWRC 3G71F 5HWEA 3VMFB 5GINC 1M90H 3LWQC 2OHWA 2VGMA 3J81M 1VQ5F 3OW2F 3CPWF 3G4SF 1JJ2F 4BVQA 3IR9A 1Q86H 1K73H 1GZ0A 3CCEF 2F9ZC 3O85A 1VQ4F 3HJWC 1Q7YH 1KC8H 3LWPC 3G6EF 4X3LA 5HY0A 2QI2A 5IT9M 3CC2F 3NMUC 1W41A 1NJIH 3J7AR 4BY9D 3CCLF 5EWRA 1W40A 1DT9A 4C4WC 1XBIA 3SIVA 1T0KB 3CCQF 1W3EX 3CMEF 4BW0B 3CCJF 5A2QM 2HVYD 3I55F 3CCSF 3NK6A 2VGNA 3V3TA 3LWVC 5G4UC 1VQMF 1X52A 1YIJF 3OBWA 1E7KA 3N4ZA 3OBYA 3CCVF 1YJNF 3JCMM 1YITF 5HY4A 2OTLF 1VQOF 2I6DA 1M1KH 5GANK 5FJ4C 1N8RH 3PAFA 1YHQF 2BO1A 1CK2A 1VQKF 2FGYA 5GIPC 1ZWZA 1K9MH 2OZBA 3NVKE 2FC3A 4EI7A 1SDSA 1CN7A 4LCKA 3E20B 1YJ9F 3CC7F 1VQNF 4NUTA 1W42A 3CMAF 3AGKA 3GYQA 1X7OA 3FFMA 2KTUA 1YJWF 2QEXF 5FLXM 3MCAB 2KTVA 3SIUA 1QVFF 1GO1A 2JNBA 3WXMB 1W2BF 3CCMF 1Q82H 1QVGF 1RA4A 3PLAC 5DCVA 2OTJF 3CXCF 1VQPF 2WALA 2KG4A 3CC4F 3V7EA 3E1YA 4BVSA 1X7PA 1RLGA 1VQLF 5HY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3M A;  1IPA A;  2LBW A;  3JAM M;  3RA6 A;  1Q81 H;  3CCU F;  3I56 F;  1KD1 H;  3V7Q A;  3VI6 A;  1KQS F;  3J80 M;  3LFO A;  5GIO C;  1YI2 F;  3N4Y A;  1VQ9 F;  1VQ6 F;  1VQ8 F;  3HAX D;  2AIF A;  1NMU B;  1K8A H;  2QA4 F;  1GO0 A;  1S72 F;  1PXW A;  5EO3 A;  2CZW A;  1VQ7 F;  3NK7 A;  3RA5 A;  1H7M A;  4TZZ A;  3NVI B;  5GAP K;  3CG6 A;  3ON1 A;  3CD6 F;  3LWO C;  2ALE A;  3CCR F;  3CPQ A;  2LBX A;  5G4V C;  3G71 F;  3LWR C;  3VMF B;  5GIN C;  1M90 H;  3LWQ C;  2OHW A;  2VGM A;  3J81 M;  1VQ5 F;  3OW2 F;  3CPW F;  3G4S F;  1JJ2 F;  3IR9 A;  1Q86 H;  1K73 H;  1GZ0 A;  3CCE F;  3O85 A;  1VQ4 F;  3HJW C;  1Q7Y H;  1KC8 H;  3LWP C;  3G6E F;  4X3L A;  5IT9 M;  2QI2 A;  3CC2 F;  3NMU C;  1W41 A;  1NJI H;  3J7A R;  4BY9 D;  3CCL F;  5EWR A;  1W40 A;  1DT9 A;  4C4W C;  1XBI A;  3SIV A;  1T0K B;  3CCQ F;  1W3E X;  3CME F;  4BW0 B;  3CCJ F;  5A2Q M;  2HVY D;  3I55 F;  3CCS F;  3NK6 A;  2VGN A;  3LWV C;  5G4U C;  1VQM F;  1X52 A;  1YIJ F;  3OBW A;  1E7K A;  3N4Z A;  3OBY A;  3CCV F;  1YJN F;  3JCM M;  1YIT F;  2OTL F;  1VQO F;  2I6D A;  1M1K H;  5GAN K;  5FJ4 C;  1N8R H;  3PAF A;  1YHQ F;  2BO1 A;  1CK2 A;  1VQK F;  5GIP C;  1ZWZ A;  1K9M H;  2OZB A;  3NVK E;  2FC3 A;  1SDS A;  1CN7 A;  4LCK A;  3E20 B;  1YJ9 F;  3CC7 F;  1VQN F;  4NUT A;  1W42 A;  3CMA F;  3AGK A;  3GYQ A;  1X7O A;  3FFM A;  2KTU A;  1YJW F;  2QEX F;  5FLX M;  3MCA B;  2KTV A;  3SIU A;  1QVF F;  1GO1 A;  2JNB A;  3WXM B;  1W2B F;  3CCM F;  1Q82 H;  1QVG F;  1RA4 A;  3PLA C;  5DCV A;  2OTJ F;  3CXC F;  1VQP F;  2WAL A;  2KG4 A;  3CC4 F;  3V7E A;  3E1Y A;  1X7P A;  1RLG A;  1VQL F; 
#chains in the Genus database with same CATH topology
 1QAH A;  2LBW A;  1PF5 A;  1W58 1;  2Z1U A;  3JAK A;  1KD1 H;  5FNV A;  3VI6 A;  2UYJ A;  3TD3 A;  3J80 M;  5GIO C;  2QTP A;  4ZOL A;  3VYT C;  1TUB B;  3OON A;  1XV2 A;  5GON A;  2AIF A;  2DYY A;  4M8I A;  1FFX A;  3P4E A;  1NMU B;  3FBA A;  4C8I A;  3HKE A;  5LP6 C;  4EI8 A;  2CZW A;  3RA5 A;  5EYP B;  3NVI B;  3RYF B;  4G4W A;  2BTO A;  2W8B C;  3ON1 A;  5LXT B;  5J2T B;  4F6R B;  3FPI A;  2UYN B;  4IIJ B;  5BMV B;  2KGW A;  3LDT A;  5LP6 B;  3F0F A;  4ZI7 A;  3IR9 A;  5LYJ A;  2Z1F A;  3CCE F;  3HKB A;  1Z5V A;  4B5C A;  4X3L A;  3RYF A;  2QI2 A;  3FD5 A;  5IT9 M;  1W41 A;  3VIU A;  3C9R A;  4BY9 D;  1DT9 A;  1XBI A;  2CSL A;  3K12 A;  3CME F;  2RHL A;  3CCJ F;  3IKE A;  5A2Q M;  3CCS F;  3NK6 A;  4FFB A;  3M1X A;  4X1K B;  1XRG A;  3WGN A;  3LWV C;  1UFY A;  3JVH A;  4E6E A;  2VAP A;  4X1Y B;  3OBW A;  1E7K A;  3VO8 A;  1IV2 A;  2YXZ A;  3JCM M;  4ZK7 A;  2CW4 A;  5HY4 A;  1YIT F;  1U3L A;  2R75 1;  4TV9 B;  5GAN K;  1NQ3 A;  3M84 A;  3EOR A;  1N8R H;  5EB0 A;  1VQK F;  1JFF A;  5LOV A;  1Z5W A;  1RQ2 A;  3JAW A;  4NUT A;  4DRX B;  4YJ2 A;  5C8Y A;  1X7O A;  4I55 B;  4TUY A;  1ODE A;  3VYU C;  1YJW F;  3F0E A;  3RYH B;  2HP0 A;  4U39 A;  5JVD B;  3SIU A;  2IQQ A;  4YJ3 A;  3TD4 A;  2MQE A;  3IKF A;  2JNB A;  4LNU B;  3JAS B;  1W55 A;  5EAZ A;  4ZHQ B;  2ZOD A;  2KG4 A;  1FNJ A;  4I55 A;  4TUY B;  3V7E A;  1X7P A;  1RLG A;  4YJ2 B;  3RA6 A;  3VYS C;  1Q81 H;  1KNK A;  4EI9 A;  2UYP A;  4I50 B;  3VOA A;  1U43 A;  5KMG A;  4O4H B;  1VQ8 F;  3WGM A;  5J2U B;  3S06 A;  2QA4 F;  4X1I A;  3NK7 A;  2ZVY A;  1H7M A;  4BT6 A;  1SA0 B;  1J7H A;  1RLU A;  1IV4 A;  3CG6 A;  1JD1 A;  2GLZ A;  3S0H A;  4O4L A;  1W59 A;  3CD6 F;  4X1I B;  5HY1 A;  2LBX A;  4IHJ B;  3G71 F;  3JAT A;  3LWR C;  5HWE A;  3VMF B;  3N2G B;  5IYZ A;  5J2U A;  4B46 A;  5JCO C;  5JCO A;  2VGM A;  3J81 M;  1VQ5 F;  3WPX A;  2K1S A;  2RHH A;  3OW2 F;  2HS4 A;  2CHS A;  1Q86 H;  2I6R A;  1U3P A;  4NWO B;  1TVK B;  1K73 H;  2F9Z C;  3E22 A;  2LCA A;  5HP8 A;  3CC2 F;  1NJI H;  3CCL F;  3HKB B;  2RHJ A;  3SIV A;  3F0G A;  3CCQ F;  2IAF A;  2VAM A;  1KNJ A;  5MN5 A;  4C82 A;  3I55 F;  4LNU A;  2Q1X A;  2HS0 A;  3V3T A;  5G4U C;  1W5A A;  3RYC A;  1VQM F;  4R40 B;  4G4Z A;  3C9S A;  3WGL A;  4O2B A;  5HP7 A;  3JAR A;  3ZP7 A;  1M1K H;  3HKE B;  4PWT A;  1IV3 A;  3S0Y A;  3M4S A;  5FJ4 C;  2HRY A;  1YHQ F;  1JY8 A;  3F6M A;  1JFF B;  3DDN A;  5GIP C;  3CB2 A;  1FNK A;  3LYB A;  1K9M H;  3N2K A;  3I3F A;  2OZB A;  5CB4 A;  3WGK A;  3E20 B;  3CC7 F;  3CYQ A;  4TV8 A;  1SA0 A;  3RE3 A;  3BYQ A;  3IEW A;  4X1Y A;  2QEX F;  1QD9 A;  1YQN A;  3MCA B;  4B45 A;  3D01 A;  5CB4 B;  3WJP A;  2KTV A;  3GHZ A;  3N2K B;  1QVF F;  1GO1 A;  5DCV A;  4C8E A;  2WAL A;  3CC4 F;  1DBF A;  4I4T B;  2HQS C;  2RB9 A;  4WBN A;  4ZHY B;  1VQL F;  3WJQ A;  4HNA A;  5CA1 B;  1IPA A;  3JAM M;  2ZOV A;  3I56 F;  3CCU F;  3V7Q A;  3D00 A;  5LYJ B;  2R6R 1;  3LFO A;  1VQ9 F;  3N4Y A;  3GTZ A;  3QUW A;  3HAX D;  3Q8H A;  5JVD A;  3WGJ A;  2Z1E A;  4IIJ A;  5BMV A;  2H8E A;  1K8A H;  1PXW A;  1H47 A;  2GZL A;  5IJ9 A;  5CA0 A;  5JQG B;  3TD5 A;  5C8Y B;  2AMT A;  4TZZ A;  3MCQ A;  5EB1 B;  5GAP K;  3HWU A;  2HX0 A;  4DRX A;  3HKD A;  5EZY B;  4KWE A;  2ALE A;  5ITZ B;  3LWO C;  5G4V C;  3HTN A;  5GIN C;  4O4I B;  3MDO A;  3N2G A;  2OHW A;  4ZOL B;  3ZOP A;  4C8G A;  3G4S F;  3VTI C;  4O4L B;  2B33 A;  1W57 A;  1VQ4 F;  3HJW C;  4O2B B;  1Q7Y H;  1KC8 H;  5EZY A;  3LWP C;  3S02 A;  3DC2 A;  3NMU C;  3CYP B;  5KX5 B;  2UZH A;  3RYC B;  5EWR A;  1W40 A;  4C4W C;  2L26 A;  3I7T A;  4BW0 B;  3S03 A;  2HVY D;  4O4I A;  4O4H A;  3T80 A;  2GVI A;  3KE1 A;  2VXY A;  5EIB D;  3JAL B;  3LME A;  3HKD B;  3ELC A;  2ZAU A;  3N4Z A;  4WBN B;  3E22 B;  2V9Y A;  3RYI A;  1TVK A;  3IMP A;  3CCV F;  1YJN F;  5CA0 B;  5MN4 A;  2P6Y A;  2OTL F;  1VQO F;  4ZHQ A;  3UT5 A;  1CLI A;  1OFU A;  1VQV A;  2OTM A;  5IYZ B;  2FGY A;  2ZVZ A;  1ZWZ A;  4IHJ A;  3ERN A;  2YYE A;  5LXT A;  5J2T A;  3F0D A;  1SDS A;  3UT5 B;  1RQ7 A;  4RHA A;  5IJ0 A;  1VQN F;  1Q8R A;  1W42 A;  3KHN A;  5EYP A;  2LBT A;  2N48 A;  3FFM A;  2PHN A;  2CWJ A;  3KJJ A;  3U0O A;  5EIB C;  5GON B;  4EB6 A;  4G4Y A;  1IV1 A;  1R1M A;  3VOB A;  3WXM B;  4BT4 A;  1W2B F;  3V4D A;  1UI9 A;  1RA4 A;  2EWC A;  3MQW A;  4I50 A;  3PLA C;  3R0P A;  4C81 A;  3FD6 A;  3CXC F;  1VQP F;  1OAP A;  3WPW A;  1GX1 A;  4BVS A;  4X20 B;  5HY2 A;  4X3M A;  2UYK A;  2VAW A;  2ZF8 A;  2Q1Y A;  4BT3 A;  5AVM A;  4XCQ A;  1JN1 A;  4BVT A;  1U40 A;  5IJ0 B;  1COM A;  5JH7 B;  3JAS A;  3P10 A;  5LA6 B;  1KQS F;  5HXU A;  2H6L A;  2PMP A;  3K2X A;  4FFB B;  1SZQ A;  1X25 A;  4X1K A;  1YI2 F;  1VQ6 F;  3C9U A;  3D54 A;  2HP0 B;  4ERH A;  1VHA A;  1GO0 A;  1S72 F;  5EO3 A;  5ITZ A;  3WJR A;  1VQ7 F;  3RYI B;  3HKC B;  4O2A A;  4BVR A;  3MBM A;  1VK3 A;  4G88 A;  4NQ3 A;  1YGY A;  3JAW B;  1W5E A;  3C8L A;  5B8F A;  5LOV B;  2CVL A;  4U3J B;  4ZHW A;  3CPQ A;  3CCR F;  5HXZ A;  1M90 H;  3LWQ C;  3ZP4 A;  2UYN A;  3CPW F;  4TV9 A;  1JJ2 F;  4BVQ A;  4BT2 A;  5LA6 A;  3ZO8 A;  1GZ0 A;  3O85 A;  5KX5 A;  3G6E F;  1FSZ A;  3C9T A;  5HY0 A;  5CA1 A;  4HNA B;  3S0W A;  3J7A R;  2HP3 A;  2BTU A;  3L7Q A;  2BTQ B;  2G9I A;  1T0K B;  1W5F A;  1W3E X;  2NMU A;  1TUB A;  2H8C A;  1QU9 A;  3JAT B;  2VGN A;  4EB6 B;  3KIZ A;  3VCZ A;  4BT7 A;  2RHO A;  3JAK B;  4DXD A;  1X52 A;  2Z1T A;  3K14 A;  1YIJ F;  3OBY A;  3QHD A;  4G4V A;  4ZHV A;  5JQG A;  5IJ9 B;  1ONI A;  2I6D A;  2HS3 A;  1T0A A;  3PAF A;  4ZI7 B;  2BO1 A;  1CK2 A;  5LP6 A;  4O4J A;  5KMG B;  3IEQ A;  2HRU A;  4U3J A;  3NVK E;  2DT4 A;  2FC3 A;  1H48 A;  4EI7 A;  4F6R A;  1CN7 A;  2AIZ P;  3RYH A;  5MN6 A;  4LCK A;  1YJ9 F;  1XHO A;  3P0Z A;  3JAR B;  1VH8 A;  3CMA F;  4G4X A;  3HKC A;  4O2A B;  3AGK A;  3GYQ A;  2KTU A;  4I4T A;  2IG8 A;  5FLX M;  3ESJ A;  3KJK A;  1FFX B;  2CHT A;  4B62 A;  4RQO A;  1W5B A;  3K0T A;  3QTY A;  3JAL A;  4O4J B;  3CCM F;  1Q82 H;  4YJ3 B;  1QVG F;  5FNV B;  5JH7 A;  4BT5 A;  2OTJ F;  2Z01 A;  3B6N A;  4X20 A;  3E1Y A;  4TV8 B; 
#chains in the Genus database with same CATH homology
 4X3M A;  1IPA A;  2LBW A;  3JAM M;  3RA6 A;  1Q81 H;  4XCQ A;  4BVT A;  4EI9 A;  3I56 F;  3CCU F;  1KD1 H;  3V7Q A;  3D00 A;  3VI6 A;  1KQS F;  5HXU A;  3J80 M;  3LFO A;  5GIO C;  1YI2 F;  3N4Y A;  1VQ9 F;  1VQ6 F;  1VQ8 F;  3HAX D;  2AIF A;  1NMU B;  1K8A H;  2QA4 F;  1GO0 A;  1S72 F;  1PXW A;  5EO3 A;  4EI8 A;  2CZW A;  1VQ7 F;  3NK7 A;  3RA5 A;  1H7M A;  4BVR A;  4TZZ A;  3NVI B;  5GAP K;  3CG6 A;  3ON1 A;  4NQ3 A;  2GLZ A;  3CD6 F;  2ALE A;  3LWO C;  3CCR F;  3CPQ A;  2LBX A;  5HY1 A;  5HXZ A;  5G4V C;  3LWR C;  3G71 F;  5HWE A;  3VMF B;  5GIN C;  1M90 H;  3LWQ C;  2OHW A;  2VGM A;  3J81 M;  1VQ5 F;  3OW2 F;  3CPW F;  3G4S F;  1JJ2 F;  4BVQ A;  3IR9 A;  1Q86 H;  1K73 H;  1GZ0 A;  3CCE F;  2F9Z C;  3O85 A;  1VQ4 F;  3HJW C;  1Q7Y H;  1KC8 H;  3LWP C;  3G6E F;  4X3L A;  5HY0 A;  2QI2 A;  5IT9 M;  3CC2 F;  3NMU C;  1W41 A;  1NJI H;  3J7A R;  4BY9 D;  3CCL F;  5EWR A;  1W40 A;  1DT9 A;  4C4W C;  1XBI A;  3SIV A;  1T0K B;  3CCQ F;  1W3E X;  3CME F;  4BW0 B;  3CCJ F;  5A2Q M;  2HVY D;  3I55 F;  3CCS F;  3NK6 A;  2VGN A;  3V3T A;  3LWV C;  5G4U C;  1VQM F;  1X52 A;  1YIJ F;  3OBW A;  1E7K A;  3N4Z A;  3OBY A;  3CCV F;  1YJN F;  3JCM M;  1YIT F;  5HY4 A;  2OTL F;  1VQO F;  2I6D A;  1M1K H;  5GAN K;  5FJ4 C;  1N8R H;  3PAF A;  1YHQ F;  2BO1 A;  1CK2 A;  1VQK F;  2FGY A;  5GIP C;  1ZWZ A;  1K9M H;  2OZB A;  3NVK E;  2FC3 A;  4EI7 A;  1SDS A;  1CN7 A;  4LCK A;  3E20 B;  1YJ9 F;  3CC7 F;  1VQN F;  4NUT A;  1W42 A;  3CMA F;  3AGK A;  3GYQ A;  1X7O A;  3FFM A;  2KTU A;  1YJW F;  2QEX F;  5FLX M;  3MCA B;  2KTV A;  3SIU A;  1QVF F;  1GO1 A;  2JNB A;  3WXM B;  1W2B F;  3CCM F;  1Q82 H;  1QVG F;  1RA4 A;  3PLA C;  5DCV A;  2OTJ F;  3CXC F;  1VQP F;  2WAL A;  2KG4 A;  3CC4 F;  3V7E A;  3E1Y A;  4BVS A;  1X7P A;  1RLG A;  1VQL F;  5HY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...