3JCMM

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3jcmM00
3NK6A 3V7QA 1M1KH 1K73H 3FFMA 3CPWF 1E7KA 2OHWA 4TZZA 1YI2F 1Q81H 3CMEF 5FLXM 3O85A 3CPQA 2LBXA 1VQ6F 3CCRF 4X3LA 1CN7A 1Q86H 1NMUB 3G6EF 1X7OA 3I56F 2ALEA 3E1YA 1JJ2F 3J7AR 1VQ4F 1X52A 1Q7YH 3NVIB 1VQOF 2VGNA 3CCJF 3NVKE 1GO1A 3VMFB 1CK2A 1XBIA 3JCMM 3PLAC 3HAXD 2LBWA 1VQLF 3LWQC 5A2QM 3AGKA 2WALA 3CXCF 2QEXF 4C4WC 2AIFA 1PXWA 3CCEF 3G71F 3CCQF 4BY9D 3SIUA 1H7MA 3OBWA 3NK7A 1YJWF 1VQKF 1DT9A 1T0KB 1ZWZA 3RA5A 3LWPC 2HVYD 1YHQF 1W41A 1W3EX 5DCVA 2FC3A 1W2BF 1K8AH 1VQ5F 3CCMF 5GANK 5GIPC 1YJNF 4LCKA 3OBYA 3G4SF 3CG6A 3CMAF 1S72F 1GO0A 1M90H 5G4UC 2VGMA 3CCVF 1X7PA 3LWRC 3RA6A 1KD1H 2OTJF 5GINC 1GZ0A 3GYQA 1KC8H 1VQ9F 3CC7F 1W42A 2KTUA 3V7EA 3CCSF 3HJWC 3N4ZA 1VQNF 3LWVC 1QVFF 3CCUF 5EWRA 1VQPF 5EO3A 3ON1A 1Q82H 3WXMB 4BW0B 1QVGF 1VQ8F 1SDSA 1IPAA 3LWOC 1VQMF 2OTLF 3CD6F 1W40A 2QA4F 3I55F 3OW2F 3CC4F 3LFOA 1NJIH 5G4VC 2BO1A 5GAPK 1YJ9F 5GIOC 3CCLF 2QI2A 3J81M 1K9MH 2CZWA 3NMUC 3VI6A 3CC2F 1RLGA 5IT9M 2I6DA 1YIJF 1N8RH 1YITF 3JAMM 5FJ4C 3PAFA 3E20B 2OZBA 2KG4A 1RA4A 4NUTA 3J80M 3SIVA 1KQSF 3N4YA 4X3MA 2JNBA 3MCAB 2KTVA 3IR9A 1VQ7F
chains in the Genus database with same CATH superfamily
3NK6A 3V7QA 3QUWA 4ZK7A 2W8BC 3HKBA 1JFFA 2OHWA 4TZZA 1YI2F 3ZOPA 3CPQA 4O4LA 1CN7A 3D01A 1FSZA 2RHJA 2YYEA 3RYIB 1VQ4F 5IYZB 3MBMA 2AIZP 3QHDA 2HS4A 2F9ZC 2ZODA 4O4IA 4I50B 1QAHA 3JCMM 4X20B 4G4YA 3I3FA 1J7HA 2VAMA 4ZI7A 3AGKA 2Q1YA 1PXWA 3UT5B 3SIUA 4BVTA 3OBWA 2UYJA 3FD5A 3ZP4A 3ELCA 1T0KB 1TVKA 2VAPA 1W3EX 5LOVA 1VQ5F 2VAWA 3CCMF 3F0FA 5GIPC 3OBYA 1S72F 3VYSC 3MCQA 1VH8A 5G4UC 2UYNB 4X1YB 3M4SA 3JASA 2R751 2YXZA 2Z1FA 3IEWA 1W581 2OTJF 2VXYA 3HTNA 3GYQA 4HNAA 1KC8H 1VQ9F 3CC7F 1UFYA 2CHTA 4WBNB 2H8CA 3D54A 1IV1A 2CWJA 1VQPF 5LXTB 3ON1A 1QD9A 3F0GA 5FNVB 4C8GA 1VQ8F 1TUBB 1VQMF 3WGNA 2OTLF 2UYKA 5EYPB 1W5BA 5LA6B 2KGWA 4ZHQB 2QA4F 4TUYA 2GZLA 5G4VC 5KX5A 4G4VA 5EIBD 3KE1A 4RQOA 5GIOC 1FFXA 1T0AA 2ZF8A 3ZO8A 5J2TB 5CA0B 5JH7B 1YIJF 4G88A 4TV8A 5FJ4C 3JARA 5C8YA 4ZOLA 4BT4A 3J80M 3MDOA 3HKCB 5ITZA 4B46A 1KQSF 2JNBA 3MCAB 4EB6A 4O2BA 4U3JA 4TV9A 3WJRA 1M1KH 3FFMA 1DBFA 1E7KA 1KNJA 4O4IB 2HP0A 5LP6A 1W59A 3F0EA 2UZHA 3JAKA 3G6EF 1X7OA 3I56F 2ALEA 2RB9A 2Z1TA 3E1YA 5JVDA 4I55A 3WGMA 3MQWA 1JJ2F 4RHAA 4ZI7B 3P4EA 3NVKE 4YJ2B 1U40A 2ZAUA 1CK2A 1XBIA 2EWCA 5HY1A 3PLAC 3ESJA 3TD4A 2LBWA 4YJ3B 5A2QM 3D00A 2WALA 3CXCF 2QEXF 3WPWA 1PF5A 3JALA 5CA1A 3CCQF 1YQNA 3WJQA 4BY9D 3RYCA 3JATA 3R0PA 5LYJB 4EI7A 3IEQA 2CVLA 3JAWB 1ZWZA 3RA5A 1W41A 1W57A 3S03A 5IJ9A 3S0HA 3S06A 3KHNA 2HRUA 4ZHYB 5KMGA 3CMAF 5EZYA 5MN6A 4HNAB 3U0OA 1M90H 1ONIA 2HX0A 4G4ZA 2MQEA 5CB4A 4LNUA 3N2GA 3C9TA 3LWRC 4BT5A 1GZ0A 4ERHA 2KTUA 3CCSF 2I6RA 3N4ZA 3LWVC 4IIJA 2CHSA 5JQGA 1QVFF 3P10A 3GTZA 5KX5B 4BVSA 4X1IB 4BW0B 1QVGF 1Q8RA 3E22B 2HS0A 3VYTC 2DYYA 3IKEA 4BT7A 1W40A 1W5FA 2BO1A 1U3LA 5C8YB 4ZOLB 4F6RA 1K9MH 2CZWA 3NMUC 3CC2F 1OFUA 2PMPA 1RLGA 3P0ZA 4EB6B 4O4HA 2R6R1 4NQ3A 4B62A 3JAMM 4O2BB 3FD6A 4FFBA 4NWOB 4TV9B 5IJ0A 2KG4A 1RA4A 4NUTA 3F6MA 3I7TA 5LP6C 3ERNA 5LP6B 3RYIA 3IR9A 5IYZA 1Z5VA 1VHAA 1K73H 4I55B 3CPWF 1Z5WA 4C82A 4I50A 3N2KB 3S0YA 1JD1A 3CMEF 5FLXM 2V9YA 3K0TA 1JY8A 2CSLA 2ZOVA 4G4WA 2LBXA 1VQ6F 3CCRF 4X3LA 1Q86H 1NMUB 2DT4A 2BTQB 1IV4A 1OAPA 5J2UB 3ZP7A 1Q7YH 2LBTA 1VQOF 5HY0A 5JCOA 1GX1A 4DRXA 4BT3A 4E6EA 3HKBB 1JFFB 3JALB 1XHOA 3RYFA 4O4LB 3VOBA 3M84A 3FPIA 3BYQA 4I4TA 3IKFA 4C4WC 3LMEA 5EB1B 3CCEF 3G71F 1U43A 2H6LA 3NK7A 5HWEA 5HXUA 1VQKF 1DT9A 3V4DA 3V3TA 2UYNA 4X1YA 2HVYD 4DXDA 1YHQF 3K2XA 1W2BF 3CB2A 1YJNF 3WGLA 1NQ3A 3RYHA 2NMUA 2HRYA 4WBNA 2ZVYA 2GVIA 5LXTA 2G9IA 2IG8A 2VGMA 4IIJB 4O4JA 1TVKB 1X7PA 1VK3A 3CCVF 2RHLA 3VIUA 5HP7A 5GINC 1FNJA 5LOVB 4ZHVA 2HS3A 1XRGA 3QTYA 4ZHQA 2FGYA 1W5EA 3HJWC 4R40B 4C8IA 3IMPA 3S02A 5EWRA 2BTUA 1Q82H 1QU9A 3DC2A 3WXMB 2HP3A 4XCQA 1IV3A 4O2AA 2LCAA 4EI9A 3JASB 4EI8A 5HY2A 5JH7A 3F0DA 1KNKA 3C9RA 5EAZA 3VO8A 5EB0A 3I55F 3CC4F 4O4HB 1COMA 3TD5A 1NJIH 2RHOA 3HKCA 5GAPK 4FFBB 5IJ0B 1YJ9F 3CCLF 1W5AA 3J81M 1W55A 4PWTA 3VI6A 5IT9M 4X1KA 4IHJA 3E20B 5BMVA 4TUYB 2OZBA 4C81A 3LYBA 2QTPA 3KJKA 2Z1EA 5AVMA 3SIVA 1FFXB 3C9UA 3N4YA 4X3MA 1X25A 3HKDA 1VQ7F 4B45A 3HKEA 2GLZA 2BTOA 5GONA 4YJ2A 5JCOC 4TV8B 3JARB 3K12A 1Q81H 4DRXB 1JN1A 3O85A 3FBAA 3KIZA 4YJ3A 1SA0A 4BVQA 5ITZB 1FNKA 1YGYA 3RYFB 4BT6A 2CW4A 1X52A 3GHZA 3S0WA 5HY4A 4U3JB 3NVIB 1U3PA 4I4TB 2VGNA 3CCJF 1GO1A 3VMFB 5LYJA 3HAXD 3TD3A 3JAWA 2HP0B 1VQLF 1RQ2A 5EIBC 2HQSC 3LWQC 2Z01A 3JAKB 1ODEA 1UI9A 2H8EA 5JVDB 2AIFA 3OONA 3K14A 3WJPA 4X20A 2Q1XA 3RYHB 1H7MA 2AMTA 1VQVA 1YJWF 1H47A 3VYUC 3DDNA 5B8FA 3LWPC 2PHNA 4C8EA 5DCVA 2FC3A 4ZHWA 1K8AH 4O4JB 5GANK 3UT5A 3C9SA 3J7AR 2IQQA 4B5CA 4LCKA 3G4SF 2L26A 3CG6A 5CA1B 1GO0A 3EORA 3RYCB 2IAFA 3CYPB 2OTMA 3JATB 4X1IA 3VOAA 2UYPA 3E22A 3WPXA 3RA6A 5MN5A 1KD1H 3L7QA 3WGKA 5IJ9B 4O2AB 1W42A 3V7EA 5KMGB 5EZYB 1VQNF 3CCUF 5EO3A 3VTIC 5CB4B 1CLIA 4LNUB 3N2GB 1SDSA 1IPAA 3HWUA 1IV2A 1R1MA 3KJJA 4KWEA 3LWOC 1RLUA 2K1SA 3Q8HA 3RE3A 2ZVZA 5HXZA 3CD6F 4BVRA 3OW2F 3LFOA 4X1KB 4IHJB 2RHHA 1RQ7A 5FNVA 2Z1UA 3M1XA 2P6YA 3T80A 5BMVB 5JQGB 1TUBA 5MN4A 2QI2A 3CYQA 3LDTA 3C8LA 5EYPA 5LA6A 2B33A 3HKDB 2I6DA 4M8IA 3HKEB 2N48A 1N8RH 1YITF 3N2KA 4G4XA 3PAFA 1H48A 3JVHA 5GONB 5HP8A 3VCZA 1SZQA 5J2TA 1XV2A 3B6NA 4BT2A 3WGJA 4U39A 5CA0A 4F6RB 2KTVA 1SA0B 5J2UA
chains in the Genus database with same CATH topology
3NK6A 3V7QA 1M1KH 1K73H 3FFMA 3CPWF 1E7KA 2OHWA 4TZZA 1YI2F 1Q81H 3CMEF 5FLXM 3O85A 3CPQA 2LBXA 1VQ6F 3CCRF 4X3LA 1CN7A 1Q86H 1NMUB 4BVQA 3G6EF 1X7OA 3I56F 2ALEA 3E1YA 1JJ2F 3J7AR 1VQ4F 1X52A 1Q7YH 5HY4A 1VQOF 2F9ZC 3NVIB 2VGNA 5HY0A 3CCJF 3NVKE 1GO1A 3VMFB 1CK2A 1XBIA 3JCMM 5HY1A 3PLAC 3HAXD 2LBWA 1VQLF 3LWQC 5A2QM 3D00A 3AGKA 2WALA 3CXCF 2QEXF 4C4WC 2AIFA 2GLZA 1PXWA 3CCEF 3G71F 3CCQF 4BY9D 3SIUA 4BVTA 1H7MA 3OBWA 3NK7A 5HWEA 1YJWF 5HXUA 1VQKF 1DT9A 3V3TA 4EI7A 1T0KB 1ZWZA 3RA5A 3LWPC 2HVYD 1YHQF 1W41A 1W3EX 5DCVA 2FC3A 1W2BF 1K8AH 1VQ5F 3CCMF 5GANK 5GIPC 1YJNF 4LCKA 3OBYA 3G4SF 3CG6A 3CMAF 1S72F 1GO0A 1M90H 5G4UC 2VGMA 3CCVF 1X7PA 3LWRC 3RA6A 1KD1H 2OTJF 5GINC 1GZ0A 3GYQA 1KC8H 1VQ9F 3CC7F 1W42A 2KTUA 3V7EA 2FGYA 3CCSF 3HJWC 3N4ZA 1VQNF 3LWVC 1QVFF 3CCUF 5EWRA 1VQPF 5EO3A 3ON1A 4BVSA 1Q82H 3WXMB 4XCQA 4BW0B 1QVGF 1VQ8F 4EI9A 1IPAA 3LWOC 1SDSA 4EI8A 5HY2A 1VQMF 2OTLF 5HXZA 3CD6F 1W40A 4BVRA 2QA4F 3I55F 3OW2F 3CC4F 3LFOA 1NJIH 5G4VC 2BO1A 5GAPK 1YJ9F 5GIOC 3CCLF 2QI2A 3J81M 1K9MH 2CZWA 3NMUC 3VI6A 3CC2F 1RLGA 5IT9M 2I6DA 1YIJF 4NQ3A 1N8RH 1YITF 3JAMM 5FJ4C 3PAFA 3E20B 2OZBA 2KG4A 1RA4A 4NUTA 3J80M 3SIVA 1KQSF 3N4YA 4X3MA 2JNBA 3MCAB 2KTVA 3IR9A 1VQ7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK6 A;  3V7Q A;  1M1K H;  1K73 H;  3FFM A;  3CPW F;  1E7K A;  2OHW A;  4TZZ A;  1YI2 F;  1Q81 H;  3CME F;  5FLX M;  3O85 A;  3CPQ A;  2LBX A;  1VQ6 F;  3CCR F;  4X3L A;  1CN7 A;  1Q86 H;  1NMU B;  3G6E F;  1X7O A;  3I56 F;  2ALE A;  3E1Y A;  1JJ2 F;  3J7A R;  1VQ4 F;  1X52 A;  1Q7Y H;  3NVI B;  1VQO F;  2VGN A;  3CCJ F;  3NVK E;  1GO1 A;  3VMF B;  1CK2 A;  1XBI A;  3JCM M;  3PLA C;  3HAX D;  2LBW A;  1VQL F;  3LWQ C;  5A2Q M;  3AGK A;  2WAL A;  3CXC F;  2QEX F;  4C4W C;  2AIF A;  1PXW A;  3CCE F;  3G71 F;  3CCQ F;  4BY9 D;  3SIU A;  1H7M A;  3OBW A;  3NK7 A;  1YJW F;  1VQK F;  1DT9 A;  1T0K B;  1ZWZ A;  3RA5 A;  3LWP C;  2HVY D;  1YHQ F;  1W41 A;  1W3E X;  5DCV A;  2FC3 A;  1W2B F;  1K8A H;  1VQ5 F;  3CCM F;  5GAN K;  5GIP C;  1YJN F;  4LCK A;  3OBY A;  3G4S F;  3CG6 A;  3CMA F;  1S72 F;  1GO0 A;  1M90 H;  5G4U C;  2VGM A;  3CCV F;  1X7P A;  3LWR C;  3RA6 A;  1KD1 H;  2OTJ F;  5GIN C;  1GZ0 A;  3GYQ A;  1KC8 H;  1VQ9 F;  3CC7 F;  1W42 A;  2KTU A;  3V7E A;  3CCS F;  3HJW C;  3N4Z A;  1VQN F;  3LWV C;  1QVF F;  3CCU F;  5EWR A;  1VQP F;  5EO3 A;  3ON1 A;  1Q82 H;  3WXM B;  4BW0 B;  1QVG F;  1VQ8 F;  1SDS A;  1IPA A;  3LWO C;  1VQM F;  2OTL F;  3CD6 F;  1W40 A;  2QA4 F;  3I55 F;  3OW2 F;  3CC4 F;  3LFO A;  1NJI H;  5G4V C;  2BO1 A;  5GAP K;  1YJ9 F;  5GIO C;  3CCL F;  2QI2 A;  3J81 M;  1K9M H;  2CZW A;  3NMU C;  3VI6 A;  3CC2 F;  1RLG A;  5IT9 M;  2I6D A;  1YIJ F;  1N8R H;  1YIT F;  3JAM M;  5FJ4 C;  3PAF A;  3E20 B;  2OZB A;  2KG4 A;  1RA4 A;  4NUT A;  3J80 M;  3SIV A;  1KQS F;  3N4Y A;  4X3M A;  2JNB A;  3MCA B;  2KTV A;  3IR9 A;  1VQ7 F; 
#chains in the Genus database with same CATH topology
 3NK6 A;  3V7Q A;  3QUW A;  4ZK7 A;  2W8B C;  3HKB A;  1JFF A;  2OHW A;  4TZZ A;  1YI2 F;  3ZOP A;  3CPQ A;  4O4L A;  1CN7 A;  3D01 A;  1FSZ A;  2RHJ A;  2YYE A;  3RYI B;  1VQ4 F;  5IYZ B;  3MBM A;  2AIZ P;  3QHD A;  2HS4 A;  2F9Z C;  2ZOD A;  4O4I A;  4I50 B;  1QAH A;  3JCM M;  4X20 B;  4G4Y A;  3I3F A;  1J7H A;  2VAM A;  4ZI7 A;  3AGK A;  2Q1Y A;  1PXW A;  3UT5 B;  3SIU A;  4BVT A;  3OBW A;  2UYJ A;  3FD5 A;  3ZP4 A;  3ELC A;  1T0K B;  1TVK A;  2VAP A;  1W3E X;  5LOV A;  1VQ5 F;  2VAW A;  3CCM F;  3F0F A;  5GIP C;  3OBY A;  1S72 F;  3VYS C;  3MCQ A;  1VH8 A;  5G4U C;  2UYN B;  4X1Y B;  3M4S A;  3JAS A;  2R75 1;  2YXZ A;  2Z1F A;  3IEW A;  1W58 1;  2OTJ F;  2VXY A;  3HTN A;  3GYQ A;  4HNA A;  1KC8 H;  1VQ9 F;  3CC7 F;  1UFY A;  2CHT A;  4WBN B;  2H8C A;  3D54 A;  1IV1 A;  2CWJ A;  1VQP F;  5LXT B;  3ON1 A;  1QD9 A;  3F0G A;  5FNV B;  4C8G A;  1VQ8 F;  1TUB B;  1VQM F;  3WGN A;  2OTL F;  2UYK A;  5EYP B;  1W5B A;  5LA6 B;  2KGW A;  4ZHQ B;  2QA4 F;  4TUY A;  2GZL A;  5G4V C;  5KX5 A;  4G4V A;  5EIB D;  3KE1 A;  4RQO A;  5GIO C;  1FFX A;  1T0A A;  2ZF8 A;  3ZO8 A;  5J2T B;  5CA0 B;  5JH7 B;  1YIJ F;  4G88 A;  4TV8 A;  5FJ4 C;  3JAR A;  5C8Y A;  4ZOL A;  4BT4 A;  3J80 M;  3MDO A;  3HKC B;  5ITZ A;  4B46 A;  1KQS F;  2JNB A;  3MCA B;  4EB6 A;  4O2B A;  4U3J A;  4TV9 A;  3WJR A;  1M1K H;  3FFM A;  1DBF A;  1E7K A;  1KNJ A;  4O4I B;  2HP0 A;  5LP6 A;  1W59 A;  3F0E A;  2UZH A;  3JAK A;  3G6E F;  1X7O A;  3I56 F;  2ALE A;  2RB9 A;  2Z1T A;  3E1Y A;  5JVD A;  4I55 A;  3WGM A;  3MQW A;  1JJ2 F;  4RHA A;  4ZI7 B;  3P4E A;  3NVK E;  4YJ2 B;  1U40 A;  2ZAU A;  1CK2 A;  1XBI A;  2EWC A;  5HY1 A;  3PLA C;  3ESJ A;  3TD4 A;  2LBW A;  4YJ3 B;  5A2Q M;  3D00 A;  2WAL A;  3CXC F;  2QEX F;  3WPW A;  1PF5 A;  3JAL A;  5CA1 A;  3CCQ F;  1YQN A;  3WJQ A;  4BY9 D;  3RYC A;  3JAT A;  3R0P A;  5LYJ B;  4EI7 A;  3IEQ A;  2CVL A;  3JAW B;  1ZWZ A;  3RA5 A;  1W41 A;  1W57 A;  3S03 A;  5IJ9 A;  3S0H A;  3S06 A;  3KHN A;  2HRU A;  4ZHY B;  5KMG A;  3CMA F;  5EZY A;  5MN6 A;  4HNA B;  3U0O A;  1M90 H;  1ONI A;  2HX0 A;  4G4Z A;  2MQE A;  5CB4 A;  4LNU A;  3N2G A;  3C9T A;  3LWR C;  4BT5 A;  1GZ0 A;  4ERH A;  2KTU A;  3CCS F;  2I6R A;  3N4Z A;  3LWV C;  4IIJ A;  2CHS A;  5JQG A;  1QVF F;  3P10 A;  3GTZ A;  5KX5 B;  4BVS A;  4X1I B;  4BW0 B;  1QVG F;  1Q8R A;  3E22 B;  2HS0 A;  3VYT C;  2DYY A;  3IKE A;  4BT7 A;  1W40 A;  1W5F A;  2BO1 A;  1U3L A;  5C8Y B;  4ZOL B;  4F6R A;  1K9M H;  2CZW A;  3NMU C;  3CC2 F;  1OFU A;  2PMP A;  1RLG A;  3P0Z A;  4EB6 B;  4O4H A;  2R6R 1;  4NQ3 A;  4B62 A;  3JAM M;  4O2B B;  3FD6 A;  4FFB A;  4NWO B;  4TV9 B;  5IJ0 A;  2KG4 A;  1RA4 A;  4NUT A;  3F6M A;  3I7T A;  5LP6 C;  3ERN A;  5LP6 B;  3RYI A;  3IR9 A;  5IYZ A;  1Z5V A;  1VHA A;  1K73 H;  4I55 B;  3CPW F;  1Z5W A;  4C82 A;  4I50 A;  3N2K B;  3S0Y A;  1JD1 A;  3CME F;  5FLX M;  2V9Y A;  3K0T A;  1JY8 A;  2CSL A;  2ZOV A;  4G4W A;  2LBX A;  1VQ6 F;  3CCR F;  4X3L A;  1Q86 H;  1NMU B;  2DT4 A;  2BTQ B;  1IV4 A;  1OAP A;  5J2U B;  3ZP7 A;  1Q7Y H;  2LBT A;  1VQO F;  5HY0 A;  5JCO A;  1GX1 A;  4DRX A;  4BT3 A;  4E6E A;  3HKB B;  1JFF B;  3JAL B;  1XHO A;  3RYF A;  4O4L B;  3VOB A;  3M84 A;  3FPI A;  3BYQ A;  4I4T A;  3IKF A;  4C4W C;  3LME A;  5EB1 B;  3CCE F;  3G71 F;  1U43 A;  2H6L A;  3NK7 A;  5HWE A;  5HXU A;  1VQK F;  1DT9 A;  3V4D A;  3V3T A;  2UYN A;  4X1Y A;  2HVY D;  4DXD A;  1YHQ F;  3K2X A;  1W2B F;  3CB2 A;  1YJN F;  3WGL A;  1NQ3 A;  3RYH A;  2NMU A;  2HRY A;  4WBN A;  2ZVY A;  2GVI A;  5LXT A;  2G9I A;  2IG8 A;  2VGM A;  4IIJ B;  4O4J A;  1TVK B;  1X7P A;  1VK3 A;  3CCV F;  2RHL A;  3VIU A;  5HP7 A;  5GIN C;  1FNJ A;  5LOV B;  4ZHV A;  2HS3 A;  1XRG A;  3QTY A;  4ZHQ A;  2FGY A;  1W5E A;  3HJW C;  4R40 B;  4C8I A;  3IMP A;  3S02 A;  5EWR A;  2BTU A;  1Q82 H;  1QU9 A;  3DC2 A;  3WXM B;  2HP3 A;  4XCQ A;  1IV3 A;  4O2A A;  2LCA A;  4EI9 A;  3JAS B;  4EI8 A;  5HY2 A;  5JH7 A;  3F0D A;  1KNK A;  3C9R A;  5EAZ A;  3VO8 A;  5EB0 A;  3I55 F;  3CC4 F;  4O4H B;  1COM A;  3TD5 A;  1NJI H;  2RHO A;  3HKC A;  5GAP K;  4FFB B;  5IJ0 B;  1YJ9 F;  3CCL F;  1W5A A;  3J81 M;  1W55 A;  4PWT A;  3VI6 A;  5IT9 M;  4X1K A;  4IHJ A;  3E20 B;  5BMV A;  4TUY B;  2OZB A;  4C81 A;  3LYB A;  2QTP A;  3KJK A;  2Z1E A;  5AVM A;  3SIV A;  1FFX B;  3C9U A;  3N4Y A;  4X3M A;  1X25 A;  3HKD A;  1VQ7 F;  4B45 A;  3HKE A;  2GLZ A;  2BTO A;  5GON A;  4YJ2 A;  5JCO C;  4TV8 B;  3JAR B;  3K12 A;  1Q81 H;  4DRX B;  1JN1 A;  3O85 A;  3FBA A;  3KIZ A;  4YJ3 A;  1SA0 A;  4BVQ A;  5ITZ B;  1FNK A;  1YGY A;  3RYF B;  4BT6 A;  2CW4 A;  1X52 A;  3GHZ A;  3S0W A;  5HY4 A;  4U3J B;  3NVI B;  1U3P A;  4I4T B;  2VGN A;  3CCJ F;  1GO1 A;  3VMF B;  5LYJ A;  3HAX D;  3TD3 A;  3JAW A;  2HP0 B;  1VQL F;  1RQ2 A;  5EIB C;  2HQS C;  3LWQ C;  2Z01 A;  3JAK B;  1ODE A;  1UI9 A;  2H8E A;  5JVD B;  2AIF A;  3OON A;  3K14 A;  3WJP A;  4X20 A;  2Q1X A;  3RYH B;  1H7M A;  2AMT A;  1VQV A;  1YJW F;  1H47 A;  3VYU C;  3DDN A;  5B8F A;  3LWP C;  2PHN A;  4C8E A;  5DCV A;  2FC3 A;  4ZHW A;  1K8A H;  4O4J B;  5GAN K;  3UT5 A;  3C9S A;  3J7A R;  2IQQ A;  4B5C A;  4LCK A;  3G4S F;  2L26 A;  3CG6 A;  5CA1 B;  1GO0 A;  3EOR A;  3RYC B;  2IAF A;  3CYP B;  2OTM A;  3JAT B;  4X1I A;  3VOA A;  2UYP A;  3E22 A;  3WPX A;  3RA6 A;  5MN5 A;  1KD1 H;  3L7Q A;  3WGK A;  5IJ9 B;  4O2A B;  1W42 A;  3V7E A;  5KMG B;  5EZY B;  1VQN F;  3CCU F;  5EO3 A;  3VTI C;  5CB4 B;  1CLI A;  4LNU B;  3N2G B;  1SDS A;  1IPA A;  3HWU A;  1IV2 A;  1R1M A;  3KJJ A;  4KWE A;  3LWO C;  1RLU A;  2K1S A;  3Q8H A;  3RE3 A;  2ZVZ A;  5HXZ A;  3CD6 F;  4BVR A;  3OW2 F;  3LFO A;  4X1K B;  4IHJ B;  2RHH A;  1RQ7 A;  5FNV A;  2Z1U A;  3M1X A;  2P6Y A;  3T80 A;  5BMV B;  5JQG B;  1TUB A;  5MN4 A;  2QI2 A;  3CYQ A;  3LDT A;  3C8L A;  5EYP A;  5LA6 A;  2B33 A;  3HKD B;  2I6D A;  4M8I A;  3HKE B;  2N48 A;  1N8R H;  1YIT F;  3N2K A;  4G4X A;  3PAF A;  1H48 A;  3JVH A;  5GON B;  5HP8 A;  3VCZ A;  1SZQ A;  5J2T A;  1XV2 A;  3B6N A;  4BT2 A;  3WGJ A;  4U39 A;  5CA0 A;  4F6R B;  2KTV A;  1SA0 B;  5J2U A; 
#chains in the Genus database with same CATH homology
 3NK6 A;  3V7Q A;  1M1K H;  1K73 H;  3FFM A;  3CPW F;  1E7K A;  2OHW A;  4TZZ A;  1YI2 F;  1Q81 H;  3CME F;  5FLX M;  3O85 A;  3CPQ A;  2LBX A;  1VQ6 F;  3CCR F;  4X3L A;  1CN7 A;  1Q86 H;  1NMU B;  4BVQ A;  3G6E F;  1X7O A;  3I56 F;  2ALE A;  3E1Y A;  1JJ2 F;  3J7A R;  1VQ4 F;  1X52 A;  1Q7Y H;  5HY4 A;  1VQO F;  2F9Z C;  3NVI B;  2VGN A;  5HY0 A;  3CCJ F;  3NVK E;  1GO1 A;  3VMF B;  1CK2 A;  1XBI A;  3JCM M;  5HY1 A;  3PLA C;  3HAX D;  2LBW A;  1VQL F;  3LWQ C;  5A2Q M;  3D00 A;  3AGK A;  2WAL A;  3CXC F;  2QEX F;  4C4W C;  2AIF A;  2GLZ A;  1PXW A;  3CCE F;  3G71 F;  3CCQ F;  4BY9 D;  3SIU A;  4BVT A;  1H7M A;  3OBW A;  3NK7 A;  5HWE A;  1YJW F;  5HXU A;  1VQK F;  1DT9 A;  3V3T A;  4EI7 A;  1T0K B;  1ZWZ A;  3RA5 A;  3LWP C;  2HVY D;  1YHQ F;  1W41 A;  1W3E X;  5DCV A;  2FC3 A;  1W2B F;  1K8A H;  1VQ5 F;  3CCM F;  5GAN K;  5GIP C;  1YJN F;  4LCK A;  3OBY A;  3G4S F;  3CG6 A;  3CMA F;  1S72 F;  1GO0 A;  1M90 H;  5G4U C;  2VGM A;  3CCV F;  1X7P A;  3LWR C;  3RA6 A;  1KD1 H;  2OTJ F;  5GIN C;  1GZ0 A;  3GYQ A;  1KC8 H;  1VQ9 F;  3CC7 F;  1W42 A;  2KTU A;  3V7E A;  2FGY A;  3CCS F;  3HJW C;  3N4Z A;  1VQN F;  3LWV C;  1QVF F;  3CCU F;  5EWR A;  1VQP F;  5EO3 A;  3ON1 A;  4BVS A;  1Q82 H;  3WXM B;  4XCQ A;  4BW0 B;  1QVG F;  1VQ8 F;  4EI9 A;  1IPA A;  3LWO C;  1SDS A;  4EI8 A;  5HY2 A;  1VQM F;  2OTL F;  5HXZ A;  3CD6 F;  1W40 A;  4BVR A;  2QA4 F;  3I55 F;  3OW2 F;  3CC4 F;  3LFO A;  1NJI H;  5G4V C;  2BO1 A;  5GAP K;  1YJ9 F;  5GIO C;  3CCL F;  2QI2 A;  3J81 M;  1K9M H;  2CZW A;  3NMU C;  3VI6 A;  3CC2 F;  1RLG A;  5IT9 M;  2I6D A;  1YIJ F;  4NQ3 A;  1N8R H;  1YIT F;  3JAM M;  5FJ4 C;  3PAF A;  3E20 B;  2OZB A;  2KG4 A;  1RA4 A;  4NUT A;  3J80 M;  3SIV A;  1KQS F;  3N4Y A;  4X3M A;  2JNB A;  3MCA B;  2KTV A;  3IR9 A;  1VQ7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...