3JCMM

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
b'MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
molecule tags Transcription
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 34
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3jcmM00
2QI2A 3HAXD 3JCMM 3CMAF 1K8AH 3V7EA 1IPAA 1VQPF 5G4UC 3VI6A 1Q82H 5G4VC 4C4WC 1VQ8F 3CCJF 2OTLF 1H7MA 3FFMA 3OBYA 2AIFA 3J81M 3CCQF 5A2QM 1KC8H 1QVFF 2LBWA 3SIVA 2KG4A 4BY9D 3E20B 3CC4F 5FJ4C 1YJNF 1GO0A 2CZWA 3J80M 1VQOF 1Q7YH 3J7AR 3LWOC 1W42A 1W41A 1YJWF 3G4SF 3CXCF 3CCRF 3NK7A 1YI2F 3GYQA 1W40A 3V7QA 5DCVA 3CPWF 2OZBA 1GZ0A 3RA6A 1VQ5F 1T0KB 1KD1H 1ZWZA 1DT9A 1X7OA 2HVYD 1CN7A 3NVKE 3E1YA 2OTJF 2KTVA 3ON1A 1W2BF 3PAFA 3O85A 1K9MH 3CPQA 2JNBA 3I56F 1PXWA 3JAMM 3WXMB 3OW2F 1E7KA 3HJWC 1VQ4F 1NMUB 5GANK 1VQLF 5IT9M 3MCAB 1VQNF 2LBXA 1VQ7F 4BW0B 1VQKF 1RA4A 3AGKA 3N4ZA 3LFOA 3CC7F 1M1KH 1VQ9F 1JJ2F 3SIUA 3NVIB 3CG6A 2I6DA 1X7PA 1CK2A 3LWRC 3CCMF 1RLGA 3NMUC 1YHQF 3OBWA 1X52A 2WALA 3N4YA 3CCVF 3CMEF 3CD6F 3G71F 4LCKA 1GO1A 5GAPK 5EO3A 1NJIH 2QEXF 5GINC 1YITF 1K73H 4X3LA 1VQ6F 5FLXM 3CCSF 3LWPC 1YJ9F 5GIOC 3CC2F 1QVGF 3LWVC 2VGMA 3G6EF 2OHWA 2ALEA 1VQMF 1SDSA 2KTUA 3RA5A 2QA4F 4TZZA 1W3EX 1Q81H 1M90H 4NUTA 3CCUF 1S72F 5EWRA 3PLAC 1Q86H 2BO1A 1XBIA 3CCLF 4X3MA 3I55F 3IR9A 3LWQC 5GIPC 3VMFB 3CCEF 1N8RH 1KQSF 2VGNA 2FC3A 1YIJF 3NK6A
chains in the Genus database with same CATH superfamily
3TD5A 3JCMM 2ZVYA 1ONIA 4DRXB 2IQQA 2RHHA 2UZHA 4X20A 3CYPB 5HY4A 4C4WC 5KMGA 4C82A 1H7MA 3FFMA 4ERHA 3J81M 3CCQF 1J7HA 1TUBB 3F0GA 3CB2A 5CB4A 4U3JB 4IHJA 3WPWA 3DDNA 5JCOA 2CZWA 4HNAA 1Q7YH 1YI2F 3JAWB 3CXCF 3JALB 2ZAUA 3GTZA 5JQGB 3D00A 3GYQA 3JASA 5CA1B 3V7QA 4O4LB 3KIZA 5MN5A 2HS0A 3MCQA 1W55A 3P4EA 1VQ5F 1W57A 5EYPA 5J2UB 2OTMA 1X7OA 1CN7A 1X25A 3HKBB 3NVKE 4FFBB 4KWEA 4C8GA 3IEWA 3JAKB 3JATA 2ZODA 3RYHA 4G4ZA 5LA6B 5IJ0A 5KX5A 5AVMA 2AIZP 2JNBA 3I56F 3VTIC 1RQ7A 3JAMM 3OW2F 1XHOA 1NMUB 5J2TA 2B33A 1QU9A 4IIJA 3B6NA 3VOAA 4ZOLA 2CHSA 3E22A 2YXZA 3HKDB 2Z1FA 2HP3A 3R0PA 4LNUB 3CCVF 3K14A 3CMEF 5HP7A 3UT5B 4LCKA 1GO1A 5EO3A 2QEXF 1YITF 3M1XA 2G9IA 4BT3A 4EI9A 5LXTA 1VQ6F 5ITZA 4EI7A 3WGJA 4I55A 1JFFA 3S0WA 2HQSC 2UYNA 3VYTC 3K0TA 4I50B 4WBNA 3RA5A 4O2AA 5EB1B 4YJ2A 1IV1A 1M90H 3MQWA 3CCLF 1FSZA 4EI8A 5JVDB 3JARA 4X3MA 5JH7A 3IR9A 4ZHWA 3N2KA 1N8RH 5KMGB 5HXUA 2I6RA 3F6MA 3CMAF 2GVIA 1TVKA 5CB4B 1GX1A 4U3JA 2L26A 3RYIA 1SA0A 3VI6A 3S0HA 3F0DA 1Q82H 4BVSA 4HNAB 3CCJF 1W5EA 2OTLF 3VO8A 5HP8A 4X1IA 3JAWA 3BYQA 3RYCB 3JALA 5JQGA 4ZHQB 2LBWA 2KG4A 4ZI7B 4O4LA 1W5FA 3QUWA 1YJNF 1UFYA 4O4HA 4TV8A 4TV9A 3J80M 1YGYA 2PMPA 1U3PA 1W42A 1W41A 4RHAA 3HKBA 2LBTA 3TD4A 1YJWF 2CVLA 3CCRF 4C8EA 2AMTA 1XV2A 5C8YB 4YJ3A 1OAPA 3ZP4A 2RB9A 4O4IA 2CSLA 4E6EA 3RA6A 2Q1YA 1T0KB 1KD1H 1ZWZA 2Z1TA 4B46A 3C9UA 5LYJA 1VH8A 3ON1A 3PAFA 3O85A 1Z5VA 5GONA 4I4TA 5EIBC 3D01A 3ELCA 2EWCA 2Z01A 3WXMB 1UI9A 2DT4A 3HJWC 4BVRA 2ZF8A 4U39A 4LNUA 1VK3A 4B62A 3MBMA 5EZYA 1RA4A 2RHOA 5BMVB 1M1KH 1U43A 3KE1A 3S0YA 3QHDA 3WGMA 5HWEA 4EB6B 5ITZB 3NMUC 4F6RA 3KJKA 1X52A 2UYKA 3ESJA 3M4SA 1JN1A 5LP6C 3WJRA 2HP0A 3CD6F 4X20B 3VOBA 1IV3A 5GAPK 1NJIH 4ZK7A 1R1MA 2BTQB 4BVTA 1TUBA 3N2GB 5FNVB 3L7QA 2V9YA 5GIOC 3CC2F 5LOVA 4TUYB 3JARB 3V4DA 3LWVC 2VGMA 1T0AA 5CA0B 2ALEA 1VQMF 4G4VA 4NUTA 3CCUF 3JASB 5CA1A 3FPIA 3RYFA 5EWRA 4BVQA 3PLAC 2BO1A 1CLIA 2HX0A 3Q8HA 3WGKA 1SA0B 4X1KA 5GIPC 5EYPB 3S03A 2YYEA 2VAMA 4G4WA 4X1IB 3RYCA 4ZHQA 2QI2A 1FFXB 2Z1EA 3JATB 3RYHB 4O4HB 4TV8B 5G4VC 1VQ8F 1IV2A 3OONA 3ZP7A 4C81A 3OBYA 2AIFA 5A2QM 2HS4A 5J2TB 4X1YB 1VQVA 4O4IB 3WJPA 3CC4F 1GO0A 3C8LA 1VQOF 3J7AR 4O2BA 3LWOC 5HXZA 2UYPA 3E22B 3G4SF 3NK7A 1DBFA 3DC2A 3HKDA 3ZOPA 3CPWF 3V3TA 2OZBA 4ZHYB 4I4TB 1GZ0A 3VCZA 3KHNA 1JY8A 1DT9A 3E1YA 1KNKA 3HKCB 2H8CA 2KTVA 2R751 5LXTB 2OTJF 2HRUA 1K9MH 1COMA 3CPQA 4DRXA 5EIBD 4XCQA 1PXWA 3FD5A 5JCOC 4ZHVA 4WBNB 1VQ4F 3WGLA 3I3FA 2GZLA 3C9RA 4NQ3A 4NWOB 1VQLF 4YJ2B 4G4XA 3KJJA 3MCAB 4EB6A 2P6YA 4F6RB 2K1SA 3F0EA 4BW0B 2VAPA 5JH7B 5JVDA 3N4ZA 3AGKA 3S02A 2IG8A 3WPXA 1JJ2F 2BTUA 3MDOA 1QD9A 3CG6A 2I6DA 1X7PA 4G88A 1CK2A 3LWRC 5IYZA 3RE3A 1YHQF 3LMEA 2DYYA 3M84A 2WALA 3N2GA 3N4YA 5FNVA 1Q8RA 1TVKB 1W5BA 5IJ9A 1FNJA 3RYIB 3FBAA 3I7TA 3G71F 5CA0A 3K2XA 5J2UA 1Z5WA 5GINC 2MQEA 2HS3A 5FLXM 4BT5A 3CCSF 3RYFB 5IJ0B 5KX5B 1YJ9F 4O4JB 2KGWA 1QVGF 1W5AA 4X1KB 4TV9B 1IV4A 2H6LA 2OHWA 2PHNA 4BT4A 4BT6A 3ZO8A 4TZZA 3HKEA 1FFXA 3IMPA 3HTNA 4YJ3B 1S72F 3K12A 1Q86H 1XBIA 4IIJB 3IKFA 2CW4A 4ZOLB 3I55F 3LWQC 3CCEF 2VAWA 5B8FA 4PWTA 1YQNA 5LYJB 3NK6A 1KNJA 1SZQA 3P0ZA 1RQ2A 3HAXD 3LDTA 1K8AH 3V7EA 1IPAA 1VQPF 5G4UC 3C9TA 5LP6A 5GONB 2Q1XA 2F9ZC 2CHTA 4BT7A 2ZOVA 3P10A 1H48A 2H8EA 1QAHA 2UYJA 1KC8H 1QVFF 4B45A 3SIVA 1VHAA 4BY9D 1FNKA 1JFFB 3E20B 3VYSC 5FJ4C 1H47A 3ERNA 2HRYA 2NMUA 4RQOA 5EZYB 2UYNB 5MN4A 3TD3A 4I50A 1XRGA 2R6R1 5EAZA 1W40A 1OFUA 5DCVA 3CYQA 3WJQA 3VYUC 3EORA 4IHJB 2IAFA 2HP0B 1ODEA 3N2KB 2QTPA 2HVYD 3VIUA 1W59A 3IEQA 1W2BF 4M8IA 1RLUA 2FC3A 5LOVB 4TUYA 2LCAA 1E7KA 4FFBA 3T80A 5GANK 5IT9M 3JAKA 5IYZB 2Z1UA 2VXYA 1VQNF 4ZI7A 5LA6A 2LBXA 3U0OA 5IJ9B 1VQ7F 1VQKF 4BT2A 3LFOA 3GHZA 3CC7F 1NQ3A 2RHLA 1VQ9F 3SIUA 3NVIB 3CCMF 5C8YA 1RLGA 3OBWA 3JVHA 2ZVZA 4O4JA 3C9SA 3HWUA 5HY2A 4R40B 2RHJA 1K73H 1U3LA 5HY0A 4X3LA 3HKEB 3FD6A 4X1YA 1U40A 3LWPC 5EB0A 4G4YA 2N48A 3F0FA 3UT5A 3D54A 3G6EF 1SDSA 4O2BB 2KTUA 2QA4F 4C8IA 5MN6A 1Q81H 1W3EX 4B5CA 1PF5A 2W8BC 2BTOA 3LYBA 2FGYA 4I55B 3S06A 4DXDA 5LP6B 3WGNA 3QTYA 3VMFB 5BMVA 1W581 1KQSF 2CWJA 2VGNA 1JD1A 3IKEA 4O2AB 2GLZA 1YIJF 3HKCA 5HY1A
chains in the Genus database with same CATH topology
2QI2A 3HAXD 3JCMM 3CMAF 1K8AH 3V7EA 1IPAA 1VQPF 5G4UC 3VI6A 1Q82H 2F9ZC 5G4VC 5HY4A 4BVSA 1VQ8F 3CCJF 4C4WC 2OTLF 1H7MA 3FFMA 3OBYA 2AIFA 3J81M 3CCQF 5A2QM 1KC8H 1QVFF 2LBWA 3SIVA 2KG4A 4BY9D 3E20B 3CC4F 2GLZA 5FJ4C 1YJNF 1GO0A 2CZWA 3J80M 1VQOF 1Q7YH 3J7AR 3LWOC 1W42A 1W41A 5HXZA 1YJWF 3G4SF 3CXCF 3CCRF 3NK7A 1YI2F 3D00A 3GYQA 1W40A 3V7QA 5DCVA 3CPWF 2OZBA 1GZ0A 3RA6A 1VQ5F 1T0KB 1KD1H 1ZWZA 1DT9A 1X7OA 2HVYD 1CN7A 3NVKE 3E1YA 2OTJF 2KTVA 3ON1A 1W2BF 3PAFA 3O85A 1K9MH 3CPQA 2JNBA 4XCQA 3I56F 1PXWA 3JAMM 3WXMB 3OW2F 1E7KA 3HJWC 1VQ4F 1NMUB 4NQ3A 5GANK 1VQLF 5IT9M 3MCAB 4BVRA 1VQNF 2LBXA 1VQ7F 4BW0B 1VQKF 1RA4A 3AGKA 3N4ZA 3LFOA 3CC7F 1M1KH 1VQ9F 1JJ2F 3SIUA 3NVIB 3CG6A 2I6DA 1X7PA 1CK2A 5HWEA 3LWRC 3CCMF 1RLGA 3NMUC 1YHQF 3OBWA 1X52A 2WALA 3N4YA 3CCVF 3CMEF 3CD6F 5HY2A 3G71F 4LCKA 1GO1A 5GAPK 5EO3A 1NJIH 2QEXF 5GINC 5HY0A 1YITF 1K73H 4X3LA 4EI9A 1VQ6F 5FLXM 4BVTA 4EI7A 3CCSF 3LWPC 1YJ9F 5GIOC 3CC2F 1QVGF 3LWVC 2VGMA 3G6EF 2OHWA 2ALEA 1VQMF 1SDSA 2KTUA 3RA5A 2QA4F 4TZZA 1W3EX 1Q81H 1M90H 4NUTA 3CCUF 1S72F 2FGYA 5EWRA 4BVQA 1Q86H 3PLAC 2BO1A 1XBIA 3CCLF 4EI8A 4X3MA 3I55F 3IR9A 3LWQC 5GIPC 3VMFB 3CCEF 1N8RH 1KQSF 5HXUA 2VGNA 2FC3A 3V3TA 1YIJF 5HY1A 3NK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QI2 A;  3HAX D;  3JCM M;  3CMA F;  1K8A H;  3V7E A;  1IPA A;  1VQP F;  5G4U C;  3VI6 A;  1Q82 H;  5G4V C;  4C4W C;  1VQ8 F;  3CCJ F;  2OTL F;  1H7M A;  3FFM A;  3OBY A;  2AIF A;  3J81 M;  3CCQ F;  5A2Q M;  1KC8 H;  1QVF F;  2LBW A;  3SIV A;  2KG4 A;  4BY9 D;  3E20 B;  3CC4 F;  5FJ4 C;  1YJN F;  1GO0 A;  2CZW A;  3J80 M;  1VQO F;  1Q7Y H;  3J7A R;  3LWO C;  1W42 A;  1W41 A;  1YJW F;  3G4S F;  3CXC F;  3CCR F;  3NK7 A;  1YI2 F;  3GYQ A;  1W40 A;  3V7Q A;  5DCV A;  3CPW F;  2OZB A;  1GZ0 A;  3RA6 A;  1VQ5 F;  1T0K B;  1KD1 H;  1ZWZ A;  1DT9 A;  1X7O A;  2HVY D;  1CN7 A;  3NVK E;  3E1Y A;  2OTJ F;  2KTV A;  3ON1 A;  1W2B F;  3PAF A;  3O85 A;  1K9M H;  3CPQ A;  2JNB A;  3I56 F;  1PXW A;  3JAM M;  3WXM B;  3OW2 F;  1E7K A;  3HJW C;  1VQ4 F;  1NMU B;  5GAN K;  1VQL F;  5IT9 M;  3MCA B;  1VQN F;  2LBX A;  1VQ7 F;  4BW0 B;  1VQK F;  1RA4 A;  3AGK A;  3N4Z A;  3LFO A;  3CC7 F;  1M1K H;  1VQ9 F;  1JJ2 F;  3SIU A;  3NVI B;  3CG6 A;  2I6D A;  1X7P A;  1CK2 A;  3LWR C;  3CCM F;  1RLG A;  3NMU C;  1YHQ F;  3OBW A;  1X52 A;  2WAL A;  3N4Y A;  3CCV F;  3CME F;  3CD6 F;  3G71 F;  4LCK A;  1GO1 A;  5GAP K;  5EO3 A;  1NJI H;  2QEX F;  5GIN C;  1YIT F;  1K73 H;  4X3L A;  1VQ6 F;  5FLX M;  3CCS F;  3LWP C;  1YJ9 F;  5GIO C;  3CC2 F;  1QVG F;  3LWV C;  2VGM A;  3G6E F;  2OHW A;  2ALE A;  1VQM F;  1SDS A;  2KTU A;  3RA5 A;  2QA4 F;  4TZZ A;  1W3E X;  1Q81 H;  1M90 H;  4NUT A;  3CCU F;  1S72 F;  5EWR A;  3PLA C;  1Q86 H;  2BO1 A;  1XBI A;  3CCL F;  4X3M A;  3I55 F;  3IR9 A;  3LWQ C;  5GIP C;  3VMF B;  3CCE F;  1N8R H;  1KQS F;  2VGN A;  2FC3 A;  1YIJ F;  3NK6 A; 
#chains in the Genus database with same CATH topology
 3TD5 A;  3JCM M;  2ZVY A;  1ONI A;  4DRX B;  2IQQ A;  2RHH A;  2UZH A;  4X20 A;  3CYP B;  5HY4 A;  4C4W C;  5KMG A;  4C82 A;  1H7M A;  3FFM A;  4ERH A;  3J81 M;  3CCQ F;  1J7H A;  1TUB B;  3F0G A;  3CB2 A;  5CB4 A;  4U3J B;  4IHJ A;  3WPW A;  3DDN A;  5JCO A;  2CZW A;  4HNA A;  1Q7Y H;  1YI2 F;  3JAW B;  3CXC F;  3JAL B;  2ZAU A;  3GTZ A;  5JQG B;  3D00 A;  3GYQ A;  3JAS A;  5CA1 B;  3V7Q A;  4O4L B;  3KIZ A;  5MN5 A;  2HS0 A;  3MCQ A;  1W55 A;  3P4E A;  1VQ5 F;  1W57 A;  5EYP A;  5J2U B;  2OTM A;  1X7O A;  1CN7 A;  1X25 A;  3HKB B;  3NVK E;  4FFB B;  4KWE A;  4C8G A;  3IEW A;  3JAK B;  3JAT A;  2ZOD A;  3RYH A;  4G4Z A;  5LA6 B;  5IJ0 A;  5KX5 A;  5AVM A;  2AIZ P;  2JNB A;  3I56 F;  3VTI C;  1RQ7 A;  3JAM M;  3OW2 F;  1XHO A;  1NMU B;  5J2T A;  2B33 A;  1QU9 A;  4IIJ A;  3B6N A;  3VOA A;  4ZOL A;  2CHS A;  3E22 A;  2YXZ A;  3HKD B;  2Z1F A;  2HP3 A;  3R0P A;  4LNU B;  3CCV F;  3K14 A;  3CME F;  5HP7 A;  3UT5 B;  4LCK A;  1GO1 A;  5EO3 A;  2QEX F;  1YIT F;  3M1X A;  2G9I A;  4BT3 A;  4EI9 A;  5LXT A;  1VQ6 F;  5ITZ A;  4EI7 A;  3WGJ A;  4I55 A;  1JFF A;  3S0W A;  2HQS C;  2UYN A;  3VYT C;  3K0T A;  4I50 B;  4WBN A;  3RA5 A;  4O2A A;  5EB1 B;  4YJ2 A;  1IV1 A;  1M90 H;  3MQW A;  3CCL F;  1FSZ A;  4EI8 A;  5JVD B;  3JAR A;  4X3M A;  5JH7 A;  3IR9 A;  4ZHW A;  3N2K A;  1N8R H;  5KMG B;  5HXU A;  2I6R A;  3F6M A;  3CMA F;  2GVI A;  1TVK A;  5CB4 B;  1GX1 A;  4U3J A;  2L26 A;  3RYI A;  1SA0 A;  3VI6 A;  3S0H A;  3F0D A;  1Q82 H;  4BVS A;  4HNA B;  3CCJ F;  1W5E A;  2OTL F;  3VO8 A;  5HP8 A;  4X1I A;  3JAW A;  3BYQ A;  3RYC B;  3JAL A;  5JQG A;  4ZHQ B;  2LBW A;  2KG4 A;  4ZI7 B;  4O4L A;  1W5F A;  3QUW A;  1YJN F;  1UFY A;  4O4H A;  4TV8 A;  4TV9 A;  3J80 M;  1YGY A;  2PMP A;  1U3P A;  1W42 A;  1W41 A;  4RHA A;  3HKB A;  2LBT A;  3TD4 A;  1YJW F;  2CVL A;  3CCR F;  4C8E A;  2AMT A;  1XV2 A;  5C8Y B;  4YJ3 A;  1OAP A;  3ZP4 A;  2RB9 A;  4O4I A;  2CSL A;  4E6E A;  3RA6 A;  2Q1Y A;  1T0K B;  1KD1 H;  1ZWZ A;  2Z1T A;  4B46 A;  3C9U A;  5LYJ A;  1VH8 A;  3ON1 A;  3PAF A;  3O85 A;  1Z5V A;  5GON A;  4I4T A;  5EIB C;  3D01 A;  3ELC A;  2EWC A;  2Z01 A;  3WXM B;  1UI9 A;  2DT4 A;  3HJW C;  4BVR A;  2ZF8 A;  4U39 A;  4LNU A;  1VK3 A;  4B62 A;  3MBM A;  5EZY A;  1RA4 A;  2RHO A;  5BMV B;  1M1K H;  1U43 A;  3KE1 A;  3S0Y A;  3QHD A;  3WGM A;  5HWE A;  4EB6 B;  5ITZ B;  3NMU C;  4F6R A;  3KJK A;  1X52 A;  2UYK A;  3ESJ A;  3M4S A;  1JN1 A;  5LP6 C;  3WJR A;  2HP0 A;  3CD6 F;  4X20 B;  3VOB A;  1IV3 A;  5GAP K;  1NJI H;  4ZK7 A;  1R1M A;  2BTQ B;  4BVT A;  1TUB A;  3N2G B;  5FNV B;  3L7Q A;  2V9Y A;  5GIO C;  3CC2 F;  5LOV A;  4TUY B;  3JAR B;  3V4D A;  3LWV C;  2VGM A;  1T0A A;  5CA0 B;  2ALE A;  1VQM F;  4G4V A;  4NUT A;  3CCU F;  3JAS B;  5CA1 A;  3FPI A;  3RYF A;  5EWR A;  4BVQ A;  3PLA C;  2BO1 A;  1CLI A;  2HX0 A;  3Q8H A;  3WGK A;  1SA0 B;  4X1K A;  5GIP C;  5EYP B;  3S03 A;  2YYE A;  2VAM A;  4G4W A;  4X1I B;  3RYC A;  4ZHQ A;  2QI2 A;  1FFX B;  2Z1E A;  3JAT B;  3RYH B;  4O4H B;  4TV8 B;  5G4V C;  1VQ8 F;  1IV2 A;  3OON A;  3ZP7 A;  4C81 A;  3OBY A;  2AIF A;  5A2Q M;  2HS4 A;  5J2T B;  4X1Y B;  1VQV A;  4O4I B;  3WJP A;  3CC4 F;  1GO0 A;  3C8L A;  1VQO F;  3J7A R;  4O2B A;  3LWO C;  5HXZ A;  2UYP A;  3E22 B;  3G4S F;  3NK7 A;  1DBF A;  3DC2 A;  3HKD A;  3ZOP A;  3CPW F;  3V3T A;  2OZB A;  4ZHY B;  4I4T B;  1GZ0 A;  3VCZ A;  3KHN A;  1JY8 A;  1DT9 A;  3E1Y A;  1KNK A;  3HKC B;  2H8C A;  2KTV A;  2R75 1;  5LXT B;  2OTJ F;  2HRU A;  1K9M H;  1COM A;  3CPQ A;  4DRX A;  5EIB D;  4XCQ A;  1PXW A;  3FD5 A;  5JCO C;  4ZHV A;  4WBN B;  1VQ4 F;  3WGL A;  3I3F A;  2GZL A;  3C9R A;  4NQ3 A;  4NWO B;  1VQL F;  4YJ2 B;  4G4X A;  3KJJ A;  3MCA B;  4EB6 A;  2P6Y A;  4F6R B;  2K1S A;  3F0E A;  4BW0 B;  2VAP A;  5JH7 B;  5JVD A;  3N4Z A;  3AGK A;  3S02 A;  2IG8 A;  3WPX A;  1JJ2 F;  2BTU A;  3MDO A;  1QD9 A;  3CG6 A;  2I6D A;  1X7P A;  4G88 A;  1CK2 A;  3LWR C;  5IYZ A;  3RE3 A;  1YHQ F;  3LME A;  2DYY A;  3M84 A;  2WAL A;  3N2G A;  3N4Y A;  5FNV A;  1Q8R A;  1TVK B;  1W5B A;  5IJ9 A;  1FNJ A;  3RYI B;  3FBA A;  3I7T A;  3G71 F;  5CA0 A;  3K2X A;  5J2U A;  1Z5W A;  5GIN C;  2MQE A;  2HS3 A;  5FLX M;  4BT5 A;  3CCS F;  3RYF B;  5IJ0 B;  5KX5 B;  1YJ9 F;  4O4J B;  2KGW A;  1QVG F;  1W5A A;  4X1K B;  4TV9 B;  1IV4 A;  2H6L A;  2OHW A;  2PHN A;  4BT4 A;  4BT6 A;  3ZO8 A;  4TZZ A;  3HKE A;  1FFX A;  3IMP A;  3HTN A;  4YJ3 B;  1S72 F;  3K12 A;  1Q86 H;  1XBI A;  4IIJ B;  3IKF A;  2CW4 A;  4ZOL B;  3I55 F;  3LWQ C;  3CCE F;  2VAW A;  5B8F A;  4PWT A;  1YQN A;  5LYJ B;  3NK6 A;  1KNJ A;  1SZQ A;  3P0Z A;  1RQ2 A;  3HAX D;  3LDT A;  1K8A H;  3V7E A;  1IPA A;  1VQP F;  5G4U C;  3C9T A;  5LP6 A;  5GON B;  2Q1X A;  2F9Z C;  2CHT A;  4BT7 A;  2ZOV A;  3P10 A;  1H48 A;  2H8E A;  1QAH A;  2UYJ A;  1KC8 H;  1QVF F;  4B45 A;  3SIV A;  1VHA A;  4BY9 D;  1FNK A;  1JFF B;  3E20 B;  3VYS C;  5FJ4 C;  1H47 A;  3ERN A;  2HRY A;  2NMU A;  4RQO A;  5EZY B;  2UYN B;  5MN4 A;  3TD3 A;  4I50 A;  1XRG A;  2R6R 1;  5EAZ A;  1W40 A;  1OFU A;  5DCV A;  3CYQ A;  3WJQ A;  3VYU C;  3EOR A;  4IHJ B;  2IAF A;  2HP0 B;  1ODE A;  3N2K B;  2QTP A;  2HVY D;  3VIU A;  1W59 A;  3IEQ A;  1W2B F;  4M8I A;  1RLU A;  2FC3 A;  5LOV B;  4TUY A;  2LCA A;  1E7K A;  4FFB A;  3T80 A;  5GAN K;  5IT9 M;  3JAK A;  5IYZ B;  2Z1U A;  2VXY A;  1VQN F;  4ZI7 A;  5LA6 A;  2LBX A;  3U0O A;  5IJ9 B;  1VQ7 F;  1VQK F;  4BT2 A;  3LFO A;  3GHZ A;  3CC7 F;  1NQ3 A;  2RHL A;  1VQ9 F;  3SIU A;  3NVI B;  3CCM F;  5C8Y A;  1RLG A;  3OBW A;  3JVH A;  2ZVZ A;  4O4J A;  3C9S A;  3HWU A;  5HY2 A;  4R40 B;  2RHJ A;  1K73 H;  1U3L A;  5HY0 A;  4X3L A;  3HKE B;  3FD6 A;  4X1Y A;  1U40 A;  3LWP C;  5EB0 A;  4G4Y A;  2N48 A;  3F0F A;  3UT5 A;  3D54 A;  3G6E F;  1SDS A;  4O2B B;  2KTU A;  2QA4 F;  4C8I A;  5MN6 A;  1Q81 H;  1W3E X;  4B5C A;  1PF5 A;  2W8B C;  2BTO A;  3LYB A;  2FGY A;  4I55 B;  3S06 A;  4DXD A;  5LP6 B;  3WGN A;  3QTY A;  3VMF B;  5BMV A;  1W58 1;  1KQS F;  2CWJ A;  2VGN A;  1JD1 A;  3IKE A;  4O2A B;  2GLZ A;  1YIJ F;  3HKC A;  5HY1 A; 
#chains in the Genus database with same CATH homology
 2QI2 A;  3HAX D;  3JCM M;  3CMA F;  1K8A H;  3V7E A;  1IPA A;  1VQP F;  5G4U C;  3VI6 A;  1Q82 H;  2F9Z C;  5G4V C;  5HY4 A;  4BVS A;  1VQ8 F;  3CCJ F;  4C4W C;  2OTL F;  1H7M A;  3FFM A;  3OBY A;  2AIF A;  3J81 M;  3CCQ F;  5A2Q M;  1KC8 H;  1QVF F;  2LBW A;  3SIV A;  2KG4 A;  4BY9 D;  3E20 B;  3CC4 F;  2GLZ A;  5FJ4 C;  1YJN F;  1GO0 A;  2CZW A;  3J80 M;  1VQO F;  1Q7Y H;  3J7A R;  3LWO C;  1W42 A;  1W41 A;  5HXZ A;  1YJW F;  3G4S F;  3CXC F;  3CCR F;  3NK7 A;  1YI2 F;  3D00 A;  3GYQ A;  1W40 A;  3V7Q A;  5DCV A;  3CPW F;  2OZB A;  1GZ0 A;  3RA6 A;  1VQ5 F;  1T0K B;  1KD1 H;  1ZWZ A;  1DT9 A;  1X7O A;  2HVY D;  1CN7 A;  3NVK E;  3E1Y A;  2OTJ F;  2KTV A;  3ON1 A;  1W2B F;  3PAF A;  3O85 A;  1K9M H;  3CPQ A;  2JNB A;  4XCQ A;  3I56 F;  1PXW A;  3JAM M;  3WXM B;  3OW2 F;  1E7K A;  3HJW C;  1VQ4 F;  1NMU B;  4NQ3 A;  5GAN K;  1VQL F;  5IT9 M;  3MCA B;  4BVR A;  1VQN F;  2LBX A;  1VQ7 F;  4BW0 B;  1VQK F;  1RA4 A;  3AGK A;  3N4Z A;  3LFO A;  3CC7 F;  1M1K H;  1VQ9 F;  1JJ2 F;  3SIU A;  3NVI B;  3CG6 A;  2I6D A;  1X7P A;  1CK2 A;  5HWE A;  3LWR C;  3CCM F;  1RLG A;  3NMU C;  1YHQ F;  3OBW A;  1X52 A;  2WAL A;  3N4Y A;  3CCV F;  3CME F;  3CD6 F;  5HY2 A;  3G71 F;  4LCK A;  1GO1 A;  5GAP K;  5EO3 A;  1NJI H;  2QEX F;  5GIN C;  5HY0 A;  1YIT F;  1K73 H;  4X3L A;  4EI9 A;  1VQ6 F;  5FLX M;  4BVT A;  4EI7 A;  3CCS F;  3LWP C;  1YJ9 F;  5GIO C;  3CC2 F;  1QVG F;  3LWV C;  2VGM A;  3G6E F;  2OHW A;  2ALE A;  1VQM F;  1SDS A;  2KTU A;  3RA5 A;  2QA4 F;  4TZZ A;  1W3E X;  1Q81 H;  1M90 H;  4NUT A;  3CCU F;  1S72 F;  2FGY A;  5EWR A;  4BVQ A;  1Q86 H;  3PLA C;  2BO1 A;  1XBI A;  3CCL F;  4EI8 A;  4X3M A;  3I55 F;  3IR9 A;  3LWQ C;  5GIP C;  3VMF B;  3CCE F;  1N8R H;  1KQS F;  5HXU A;  2VGN A;  2FC3 A;  3V3T A;  1YIJ F;  5HY1 A;  3NK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...