1VQMF

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqmF00
3CMAF 1Q82H 1VQ8F 3V7EA 1GO0A 1DT9A 3I55F 3J81M 3PLAC 1K9MH 1QVFF 3NVKE 3CMEF 3G71F 1W40A 1XBIA 3LWPC 3CCRF 5EWRA 5GINC 3HJWC 3VI6A 1QVGF 1VQ4F 1YI2F 3G6EF 2BO1A 3LWRC 3CC2F 3CC7F 3SIVA 3J80M 2OHWA 3O85A 3CCMF 1SDSA 1GO1A 3ON1A 1S72F 1VQ7F 3E1YA 2AIFA 1VQNF 3LWOC 1IPAA 1VQLF 4X3LA 2I6DA 3CPQA 5FLXM 5G4VC 3FFMA 2OTLF 3CCVF 1NJIH 1E7KA 1Q7YH 3SIUA 4LCKA 1VQOF 4TZZA 2OTJF 1M1KH 2QEXF 4X3MA 3RA5A 1JJ2F 1VQKF 1T0KB 1Q86H 3VMFB 2ALEA 3CD6F 4C4WC 1RA4A 3HAXD 3JCMM 3NMUC 3V7QA 3MCAB 4BW0B 2KTVA 5EO3A 3CCSF 5GAPK 1M90H 1PXWA 2FC3A 3IR9A 3NVIB 2CZWA 1VQ6F 1H7MA 3LWVC 1VQ5F 3AGKA 1NMUB 2KTUA 1YHQF 3CCEF 5GIOC 3GYQA 4NUTA 1X52A 4BY9D 5DCVA 1GZ0A 3G4SF 1YITF 3CPWF 3CCJF 1KQSF 3JAMM 1YJNF 2VGMA 2WALA 1YJ9F 1KD1H 3CC4F 1K73H 2HVYD 3OBYA 1W2BF 3N4YA 3WXMB 3OW2F 3CG6A 2LBXA 3OBWA 3RA6A 3CXCF 1YJWF 1W3EX 1W41A 1K8AH 5GANK 3PAFA 1N8RH 1YIJF 5G4UC 1CK2A 1X7OA 3LFOA 2QA4F 1Q81H 2LBWA 1VQPF 1ZWZA 1X7PA 3N4ZA 2QI2A 3NK7A 2KG4A 1VQMF 2OZBA 3CCUF 3CCLF 1W42A 3CCQF 1KC8H 5GIPC 1RLGA 1CN7A 3J7AR 2JNBA 1VQ9F 3LWQC 5FJ4C 2VGNA 3NK6A 3E20B 5A2QM 5IT9M 3I56F
chains in the Genus database with same CATH superfamily
5JH7B 5BMVB 4NQ3A 4BT6A 1Q82H 3V7EA 5HY0A 1DT9A 4ZHWA 1GO0A 3J81M 1Z5VA 1XRGA 2VAPA 4WBNB 3CMEF 2N48A 1XBIA 2CW4A 3CB2A 3CCRF 5EYPB 3HJWC 1QVGF 4DXDA 3G6EF 3CC7F 3ZO8A 5JH7A 5BMVA 2OHWA 1UI9A 1SDSA 3E1YA 2AIFA 3F0FA 5LA6B 3KE1A 3C9UA 5CB4B 3RYFB 5LYJB 2ZVYA 2I6DA 3CPQA 5MN4A 5G4VC 1OFUA 5EYPA 3K14A 3P10A 3U0OA 5ITZA 1SA0B 3VCZA 1Q7YH 4TZZA 2QEXF 4YJ3B 1T0KB 5AVMA 4FFBA 3JAWB 4O2AB 3JALB 5LA6A 3CD6F 3NMUC 3WGKA 4G4YA 3RYFA 4C82A 3C9RA 5IJ9B 3D54A 1JFFB 4EB6A 2HRYA 1NQ3A 1PXWA 1W5FA 3NVIB 2CZWA 1SA0A 1VQ6F 2GZLA 1QU9A 3VO8A 1VQ5F 2IG8A 3ZP4A 4YJ3A 3M84A 2ZF8A 3HKDA 3TD4A 3CCEF 3JAWA 4O2AA 2CHSA 3LMEA 2PMPA 3G4SF 5IJ9A 3WPXA 1RLUA 2F9ZC 4X1IB 1YJNF 3QTYA 1YJ9F 2Z1EA 4X20B 3HKBB 5IJ0A 5IYZB 4M8IA 3CXCF 4BT2A 3WJPA 4ZHQB 2CVLA 4TV9B 1IV3A 4IIJB 1X7OA 3GHZA 5GONA 2LBWA 3P0ZA 4X1IA 1X7PA 2CSLA 4F6RB 2KG4A 3HKBA 5HY1A 1J7HA 4O4HB 4G88A 5IYZA 1FFXA 3ZP7A 1KC8H 4IHJA 2UYNB 4RQOA 3M1XA 2JNBA 3D00A 5GIPC 3J7AR 5CA1B 3OONA 1SZQA 4TV8B 1W5AA 4LNUA 5A2QM 5IT9M 3I56F 2RHHA 4IIJA 2ZVZA 1KNJA 4E6EA 3NVKE 1VK3A 3G71F 4KWEA 4O4HA 3E22B 4C8IA 2BTUA 1W59A 2UYNA 2Q1YA 4U3JA 4ERHA 2VXYA 5CA0B 5CA1A 2HP3A 4TV8A 4G4WA 3LWRC 5B8FA 2RHJA 3SIVA 1PF5A 5KX5B 1S72F 3LYBA 4B62A 2GLZA 3DC2A 2HX0A 1QD9A 4B46A 1IPAA 3RYHB 5JVDB 3JATB 3E22A 3FFMA 1NJIH 1VH8A 3GTZA 3V4DA 5CA0A 3BYQA 5HY2A 1E7KA 4LCKA 3SIUA 1M1KH 3HKCB 3RA5A 5LOVA 5KX5A 1Q86H 3V3TA 2KGWA 3MDOA 3L7QA 3RYCB 3HAXD 5ITZB 1IV2A 3RYHA 3QUWA 5JVDA 3JATA 2KTVA 3WJQA 4O4LB 4FFBB 3K0TA 3IR9A 5HXZA 1H7MA 3LWVC 4U39A 3MBMA 1FNKA 3HKCA 4BVRA 3IEQA 4EI7A 3FD6A 4G4XA 4EB6B 5JQGB 1YHQF 3GYQA 3CYPB 3RYCA 5HWEA 2IQQA 4RHAA 5EB0A 4G4VA 2H6LA 1Z5WA 3HKDB 3CPWF 4O4LA 3WGLA 2UYKA 2YYEA 1KQSF 3JAMM 1DBFA 1W5BA 1W57A 5EAZA 3K2XA 3WPWA 3DDNA 2B33A 3OBYA 4I55B 1VQVA 1W2BF 3N4YA 3OW2F 3RA6A 5JQGA 3R0PA 5JCOA 1K8AH 1W41A 3IMPA 2HS3A 1X25A 2NMUA 3S0HA 1YIJF 5IJ0B 1CK2A 1H47A 2Q1XA 3VOBA 3ZOPA 2QA4F 2QI2A 3ERNA 4BT7A 3CCUF 4I55A 4B5CA 3CCQF 5GONB 1CN7A 3IKFA 4BVQA 3LWQC 1RQ7A 5HP8A 4XCQA 4O4IB 4EI9A 3CMAF 3MQWA 1FFXB 4NWOB 3MCQA 4IHJB 3TD3A 3I55F 1OAPA 2EWCA 3HWUA 4ZOLB 1YGYA 4LNUB 1FNJA 2ZODA 3IKEA 4G4ZA 3ESJA 2DT4A 3I3FA 1UFYA 5GINC 2UYJA 1YI2F 1IV4A 2BO1A 4O4IA 4C8EA 3S0WA 3F0EA 3C9TA 1H48A 1GO1A 3ON1A 4U3JB 1VQ7F 3WGMA 1VQNF 4ZOLA 3LWOC 4BVTA 1VQLF 1YQNA 5FLXM 2LCAA 3N2KB 3RYIA 1IV1A 4ZI7A 2OTLF 3QHDA 3T80A 3VYTC 4I50A 2HS0A 1JD1A 3LDTA 5C8YB 5EZYB 1W581 5EIBC 1JJ2F 3KJKA 2VAWA 2RHLA 4TUYA 3S03A 1T0AA 2UYPA 2HQSC 3V7QA 3MCAB 4BW0B 5LOVB 3N2KA 1RQ2A 4ZK7A 3B6NA 5GAPK 4PWTA 1M90H 2P6YA 2FC3A 5C8YA 5EZYA 2ZAUA 2KTUA 2L26A 4YJ2A 4EI8A 5GIOC 2Z01A 5J2TB 3HKEB 4NUTA 1X52A 3C9SA 3RE3A 3KIZA 5DCVA 3D01A 1GZ0A 1YITF 1GX1A 1FSZA 3N2GB 5J2UA 5EB1B 1R1MA 1JY8A 1KD1H 2HVYD 3UT5B 3WJRA 1JN1A 3WXMB 3CYQA 3VIUA 2AMTA 5J2TA 3VYUC 1W3EX 3HKEA 3M4SA 5LP6B 5GANK 3PAFA 5MN5A 4DRXB 5MN6A 5G4UC 3F0DA 3LFOA 5HXUA 3N2GA 2H8CA 1Q81H 3VOAA 3JARB 1VQPF 3FPIA 3N4ZA 3NK7A 2RHOA 3VYSC 2K1SA 1U43A 5LP6C 3UT5A 5FNVB 3CCLF 3TD5A 1RLGA 1VQ9F 5LP6A 5JCOC 4WBNA 2Z1UA 3E20B 3FD5A 2H8EA 2CWJA 5HY4A 4DRXA 2BTOA 1VQ8F 2G9IA 2MQEA 4BT5A 3PLAC 3JARA 1K9MH 1QVFF 3K12A 4BT4A 1W40A 3WGNA 5FNVA 2VAMA 3LWPC 2GVIA 3F0GA 2AIZP 5EWRA 3VI6A 5LXTB 1VQ4F 4O4JB 2W8BC 3CC2F 4C81A 5CB4A 2BTQB 5LYJA 2RB9A 3J80M 3EORA 3O85A 3CCMF 3HTNA 3ELCA 1XV2A 4X3LA 3CCVF 2HP0B 3P4EA 4B45A 1TUBB 4ZHYB 5LXTA 3JALA 1ODEA 4O4JA 2PHNA 1COMA 1VQOF 3FBAA 2OTJF 3Q8HA 4X3MA 3RYIB 2CHTA 1VQKF 4ZI7B 4I50B 1XHOA 3F6MA 1JFFA 3VMFB 3KJJA 2ALEA 4C4WC 1Q8RA 1RA4A 2R751 4HNAB 3JCMM 2OTMA 5EO3A 1ONIA 3CCSF 4TUYB 1U3LA 1KNKA 2HP0A 1TUBA 4BT3A 2FGYA 3C8LA 2HRUA 3I7TA 4X1YB 3JVHA 2Z1TA 1QAHA 3AGKA 1NMUB 1W55A 1U40A 5KMGB 5HP7A 2HS4A 4HNAA 2IAFA 4BY9D 3S02A 1U3PA 4X20A 1VHAA 2Z1FA 3JAKB 1TVKB 4YJ2B 3CCJF 4I4TB 2V9YA 4ZHVA 4BVSA 2VGMA 2WALA 4X1KB 4ZHQA 4X1YA 3CC4F 1K73H 4TV9A 2QTPA 5EIBD 2I6RA 3S0YA 3CG6A 5J2UB 2LBXA 3OBWA 3VTIC 4O2BB 5KMGA 1YJWF 2YXZA 2R6R1 3IEWA 1N8RH 3WGJA 4F6RA 1CLIA 3JASB 2LBTA 3JAKA 1TVKA 4I4TA 3S06A 4R40B 1ZWZA 4X1KA 4C8GA 3KHNA 1VQMF 2OZBA 1W42A 2UZHA 4O2BA 2ZOVA 2DYYA 1W5EA 5FJ4C 2VGNA 3NK6A 3JASA
chains in the Genus database with same CATH topology
3CMAF 4NQ3A 1Q82H 1VQ8F 3V7EA 5HY0A 1DT9A 1GO0A 3I55F 3J81M 3PLAC 1K9MH 1QVFF 3NVKE 3CMEF 3G71F 1W40A 1XBIA 3LWPC 3CCRF 5EWRA 5GINC 3HJWC 3VI6A 1QVGF 1VQ4F 1YI2F 3G6EF 2BO1A 3LWRC 3CC2F 3CC7F 3SIVA 3J80M 2OHWA 3O85A 3CCMF 1SDSA 1GO1A 3ON1A 1S72F 1VQ7F 3E1YA 2AIFA 1VQNF 2GLZA 3LWOC 4BVTA 1IPAA 1VQLF 4X3LA 2I6DA 3CPQA 5FLXM 5G4VC 3FFMA 2OTLF 3CCVF 1NJIH 5HY2A 1E7KA 1Q7YH 3SIUA 4LCKA 1VQOF 4TZZA 2OTJF 1M1KH 2QEXF 4X3MA 3RA5A 1JJ2F 1VQKF 1T0KB 1Q86H 3V3TA 3VMFB 2ALEA 3CD6F 4C4WC 1RA4A 3HAXD 3JCMM 3NMUC 3V7QA 3MCAB 4BW0B 2KTVA 5EO3A 3CCSF 5GAPK 2FGYA 1M90H 1PXWA 2FC3A 3IR9A 5HXZA 3NVIB 2CZWA 1VQ6F 1H7MA 3LWVC 1VQ5F 4BVRA 3AGKA 1NMUB 2KTUA 4EI7A 1YHQF 3CCEF 4EI8A 5GIOC 3GYQA 5HWEA 4NUTA 1X52A 4BY9D 5DCVA 1GZ0A 3G4SF 1YITF 3CPWF 3CCJF 1KQSF 3JAMM 1YJNF 2F9ZC 4BVSA 2VGMA 2WALA 1YJ9F 1KD1H 3CC4F 1K73H 2HVYD 3OBYA 1W2BF 3N4YA 3WXMB 3OW2F 3CG6A 2LBXA 3OBWA 3RA6A 3CXCF 1YJWF 1W3EX 1W41A 1K8AH 5GANK 3PAFA 1N8RH 1YIJF 5G4UC 1CK2A 1X7OA 3LFOA 5HXUA 2QA4F 1Q81H 2LBWA 1VQPF 1ZWZA 1X7PA 3N4ZA 2QI2A 3NK7A 2KG4A 5HY1A 1VQMF 2OZBA 3CCUF 3CCLF 1W42A 3CCQF 1KC8H 5GIPC 1RLGA 1CN7A 3J7AR 2JNBA 3D00A 1VQ9F 4BVQA 3LWQC 5FJ4C 2VGNA 3NK6A 5HY4A 3E20B 4XCQA 5A2QM 5IT9M 3I56F 4EI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA F;  1Q82 H;  1VQ8 F;  3V7E A;  1GO0 A;  1DT9 A;  3I55 F;  3J81 M;  3PLA C;  1K9M H;  1QVF F;  3NVK E;  3CME F;  3G71 F;  1W40 A;  1XBI A;  3LWP C;  3CCR F;  5EWR A;  5GIN C;  3HJW C;  3VI6 A;  1QVG F;  1VQ4 F;  1YI2 F;  3G6E F;  2BO1 A;  3LWR C;  3CC2 F;  3CC7 F;  3SIV A;  3J80 M;  2OHW A;  3O85 A;  3CCM F;  1SDS A;  1GO1 A;  3ON1 A;  1S72 F;  1VQ7 F;  3E1Y A;  2AIF A;  1VQN F;  3LWO C;  1IPA A;  1VQL F;  4X3L A;  2I6D A;  3CPQ A;  5FLX M;  5G4V C;  3FFM A;  2OTL F;  3CCV F;  1NJI H;  1E7K A;  1Q7Y H;  3SIU A;  4LCK A;  1VQO F;  4TZZ A;  2OTJ F;  1M1K H;  2QEX F;  4X3M A;  3RA5 A;  1JJ2 F;  1VQK F;  1T0K B;  1Q86 H;  3VMF B;  2ALE A;  3CD6 F;  4C4W C;  1RA4 A;  3HAX D;  3JCM M;  3NMU C;  3V7Q A;  3MCA B;  4BW0 B;  2KTV A;  5EO3 A;  3CCS F;  5GAP K;  1M90 H;  1PXW A;  2FC3 A;  3IR9 A;  3NVI B;  2CZW A;  1VQ6 F;  1H7M A;  3LWV C;  1VQ5 F;  3AGK A;  1NMU B;  2KTU A;  1YHQ F;  3CCE F;  5GIO C;  3GYQ A;  4NUT A;  1X52 A;  4BY9 D;  5DCV A;  1GZ0 A;  3G4S F;  1YIT F;  3CPW F;  3CCJ F;  1KQS F;  3JAM M;  1YJN F;  2VGM A;  2WAL A;  1YJ9 F;  1KD1 H;  3CC4 F;  1K73 H;  2HVY D;  3OBY A;  1W2B F;  3N4Y A;  3WXM B;  3OW2 F;  3CG6 A;  2LBX A;  3OBW A;  3RA6 A;  3CXC F;  1YJW F;  1W3E X;  1W41 A;  1K8A H;  5GAN K;  3PAF A;  1N8R H;  1YIJ F;  5G4U C;  1CK2 A;  1X7O A;  3LFO A;  2QA4 F;  1Q81 H;  2LBW A;  1VQP F;  1ZWZ A;  1X7P A;  3N4Z A;  2QI2 A;  3NK7 A;  2KG4 A;  1VQM F;  2OZB A;  3CCU F;  3CCL F;  1W42 A;  3CCQ F;  1KC8 H;  5GIP C;  1RLG A;  1CN7 A;  3J7A R;  2JNB A;  1VQ9 F;  3LWQ C;  5FJ4 C;  2VGN A;  3NK6 A;  3E20 B;  5A2Q M;  5IT9 M;  3I56 F; 
#chains in the Genus database with same CATH topology
 5JH7 B;  5BMV B;  4NQ3 A;  4BT6 A;  1Q82 H;  3V7E A;  5HY0 A;  1DT9 A;  4ZHW A;  1GO0 A;  3J81 M;  1Z5V A;  1XRG A;  2VAP A;  4WBN B;  3CME F;  2N48 A;  1XBI A;  2CW4 A;  3CB2 A;  3CCR F;  5EYP B;  3HJW C;  1QVG F;  4DXD A;  3G6E F;  3CC7 F;  3ZO8 A;  5JH7 A;  5BMV A;  2OHW A;  1UI9 A;  1SDS A;  3E1Y A;  2AIF A;  3F0F A;  5LA6 B;  3KE1 A;  3C9U A;  5CB4 B;  3RYF B;  5LYJ B;  2ZVY A;  2I6D A;  3CPQ A;  5MN4 A;  5G4V C;  1OFU A;  5EYP A;  3K14 A;  3P10 A;  3U0O A;  5ITZ A;  1SA0 B;  3VCZ A;  1Q7Y H;  4TZZ A;  2QEX F;  4YJ3 B;  1T0K B;  5AVM A;  4FFB A;  3JAW B;  4O2A B;  3JAL B;  5LA6 A;  3CD6 F;  3NMU C;  3WGK A;  4G4Y A;  3RYF A;  4C82 A;  3C9R A;  5IJ9 B;  3D54 A;  1JFF B;  4EB6 A;  2HRY A;  1NQ3 A;  1PXW A;  1W5F A;  3NVI B;  2CZW A;  1SA0 A;  1VQ6 F;  2GZL A;  1QU9 A;  3VO8 A;  1VQ5 F;  2IG8 A;  3ZP4 A;  4YJ3 A;  3M84 A;  2ZF8 A;  3HKD A;  3TD4 A;  3CCE F;  3JAW A;  4O2A A;  2CHS A;  3LME A;  2PMP A;  3G4S F;  5IJ9 A;  3WPX A;  1RLU A;  2F9Z C;  4X1I B;  1YJN F;  3QTY A;  1YJ9 F;  2Z1E A;  4X20 B;  3HKB B;  5IJ0 A;  5IYZ B;  4M8I A;  3CXC F;  4BT2 A;  3WJP A;  4ZHQ B;  2CVL A;  4TV9 B;  1IV3 A;  4IIJ B;  1X7O A;  3GHZ A;  5GON A;  2LBW A;  3P0Z A;  4X1I A;  1X7P A;  2CSL A;  4F6R B;  2KG4 A;  3HKB A;  5HY1 A;  1J7H A;  4O4H B;  4G88 A;  5IYZ A;  1FFX A;  3ZP7 A;  1KC8 H;  4IHJ A;  2UYN B;  4RQO A;  3M1X A;  2JNB A;  3D00 A;  5GIP C;  3J7A R;  5CA1 B;  3OON A;  1SZQ A;  4TV8 B;  1W5A A;  4LNU A;  5A2Q M;  5IT9 M;  3I56 F;  2RHH A;  4IIJ A;  2ZVZ A;  1KNJ A;  4E6E A;  3NVK E;  1VK3 A;  3G71 F;  4KWE A;  4O4H A;  3E22 B;  4C8I A;  2BTU A;  1W59 A;  2UYN A;  2Q1Y A;  4U3J A;  4ERH A;  2VXY A;  5CA0 B;  5CA1 A;  2HP3 A;  4TV8 A;  4G4W A;  3LWR C;  5B8F A;  2RHJ A;  3SIV A;  1PF5 A;  5KX5 B;  1S72 F;  3LYB A;  4B62 A;  2GLZ A;  3DC2 A;  2HX0 A;  1QD9 A;  4B46 A;  1IPA A;  3RYH B;  5JVD B;  3JAT B;  3E22 A;  3FFM A;  1NJI H;  1VH8 A;  3GTZ A;  3V4D A;  5CA0 A;  3BYQ A;  5HY2 A;  1E7K A;  4LCK A;  3SIU A;  1M1K H;  3HKC B;  3RA5 A;  5LOV A;  5KX5 A;  1Q86 H;  3V3T A;  2KGW A;  3MDO A;  3L7Q A;  3RYC B;  3HAX D;  5ITZ B;  1IV2 A;  3RYH A;  3QUW A;  5JVD A;  3JAT A;  2KTV A;  3WJQ A;  4O4L B;  4FFB B;  3K0T A;  3IR9 A;  5HXZ A;  1H7M A;  3LWV C;  4U39 A;  3MBM A;  1FNK A;  3HKC A;  4BVR A;  3IEQ A;  4EI7 A;  3FD6 A;  4G4X A;  4EB6 B;  5JQG B;  1YHQ F;  3GYQ A;  3CYP B;  3RYC A;  5HWE A;  2IQQ A;  4RHA A;  5EB0 A;  4G4V A;  2H6L A;  1Z5W A;  3HKD B;  3CPW F;  4O4L A;  3WGL A;  2UYK A;  2YYE A;  1KQS F;  3JAM M;  1DBF A;  1W5B A;  1W57 A;  5EAZ A;  3K2X A;  3WPW A;  3DDN A;  2B33 A;  3OBY A;  4I55 B;  1VQV A;  1W2B F;  3N4Y A;  3OW2 F;  3RA6 A;  5JQG A;  3R0P A;  5JCO A;  1K8A H;  1W41 A;  3IMP A;  2HS3 A;  1X25 A;  2NMU A;  3S0H A;  1YIJ F;  5IJ0 B;  1CK2 A;  1H47 A;  2Q1X A;  3VOB A;  3ZOP A;  2QA4 F;  2QI2 A;  3ERN A;  4BT7 A;  3CCU F;  4I55 A;  4B5C A;  3CCQ F;  5GON B;  1CN7 A;  3IKF A;  4BVQ A;  3LWQ C;  1RQ7 A;  5HP8 A;  4XCQ A;  4O4I B;  4EI9 A;  3CMA F;  3MQW A;  1FFX B;  4NWO B;  3MCQ A;  4IHJ B;  3TD3 A;  3I55 F;  1OAP A;  2EWC A;  3HWU A;  4ZOL B;  1YGY A;  4LNU B;  1FNJ A;  2ZOD A;  3IKE A;  4G4Z A;  3ESJ A;  2DT4 A;  3I3F A;  1UFY A;  5GIN C;  2UYJ A;  1YI2 F;  1IV4 A;  2BO1 A;  4O4I A;  4C8E A;  3S0W A;  3F0E A;  3C9T A;  1H48 A;  1GO1 A;  3ON1 A;  4U3J B;  1VQ7 F;  3WGM A;  1VQN F;  4ZOL A;  3LWO C;  4BVT A;  1VQL F;  1YQN A;  5FLX M;  2LCA A;  3N2K B;  3RYI A;  1IV1 A;  4ZI7 A;  2OTL F;  3QHD A;  3T80 A;  3VYT C;  4I50 A;  2HS0 A;  1JD1 A;  3LDT A;  5C8Y B;  5EZY B;  1W58 1;  5EIB C;  1JJ2 F;  3KJK A;  2VAW A;  2RHL A;  4TUY A;  3S03 A;  1T0A A;  2UYP A;  2HQS C;  3V7Q A;  3MCA B;  4BW0 B;  5LOV B;  3N2K A;  1RQ2 A;  4ZK7 A;  3B6N A;  5GAP K;  4PWT A;  1M90 H;  2P6Y A;  2FC3 A;  5C8Y A;  5EZY A;  2ZAU A;  2KTU A;  2L26 A;  4YJ2 A;  4EI8 A;  5GIO C;  2Z01 A;  5J2T B;  3HKE B;  4NUT A;  1X52 A;  3C9S A;  3RE3 A;  3KIZ A;  5DCV A;  3D01 A;  1GZ0 A;  1YIT F;  1GX1 A;  1FSZ A;  3N2G B;  5J2U A;  5EB1 B;  1R1M A;  1JY8 A;  1KD1 H;  2HVY D;  3UT5 B;  3WJR A;  1JN1 A;  3WXM B;  3CYQ A;  3VIU A;  2AMT A;  5J2T A;  3VYU C;  1W3E X;  3HKE A;  3M4S A;  5LP6 B;  5GAN K;  3PAF A;  5MN5 A;  4DRX B;  5MN6 A;  5G4U C;  3F0D A;  3LFO A;  5HXU A;  3N2G A;  2H8C A;  1Q81 H;  3VOA A;  3JAR B;  1VQP F;  3FPI A;  3N4Z A;  3NK7 A;  2RHO A;  3VYS C;  2K1S A;  1U43 A;  5LP6 C;  3UT5 A;  5FNV B;  3CCL F;  3TD5 A;  1RLG A;  1VQ9 F;  5LP6 A;  5JCO C;  4WBN A;  2Z1U A;  3E20 B;  3FD5 A;  2H8E A;  2CWJ A;  5HY4 A;  4DRX A;  2BTO A;  1VQ8 F;  2G9I A;  2MQE A;  4BT5 A;  3PLA C;  3JAR A;  1K9M H;  1QVF F;  3K12 A;  4BT4 A;  1W40 A;  3WGN A;  5FNV A;  2VAM A;  3LWP C;  2GVI A;  3F0G A;  2AIZ P;  5EWR A;  3VI6 A;  5LXT B;  1VQ4 F;  4O4J B;  2W8B C;  3CC2 F;  4C81 A;  5CB4 A;  2BTQ B;  5LYJ A;  2RB9 A;  3J80 M;  3EOR A;  3O85 A;  3CCM F;  3HTN A;  3ELC A;  1XV2 A;  4X3L A;  3CCV F;  2HP0 B;  3P4E A;  4B45 A;  1TUB B;  4ZHY B;  5LXT A;  3JAL A;  1ODE A;  4O4J A;  2PHN A;  1COM A;  1VQO F;  3FBA A;  2OTJ F;  3Q8H A;  4X3M A;  3RYI B;  2CHT A;  1VQK F;  4ZI7 B;  4I50 B;  1XHO A;  3F6M A;  1JFF A;  3VMF B;  3KJJ A;  2ALE A;  4C4W C;  1Q8R A;  1RA4 A;  2R75 1;  4HNA B;  3JCM M;  2OTM A;  5EO3 A;  1ONI A;  3CCS F;  4TUY B;  1U3L A;  1KNK A;  2HP0 A;  1TUB A;  4BT3 A;  2FGY A;  3C8L A;  2HRU A;  3I7T A;  4X1Y B;  3JVH A;  2Z1T A;  1QAH A;  3AGK A;  1NMU B;  1W55 A;  1U40 A;  5KMG B;  5HP7 A;  2HS4 A;  4HNA A;  2IAF A;  4BY9 D;  3S02 A;  1U3P A;  4X20 A;  1VHA A;  2Z1F A;  3JAK B;  1TVK B;  4YJ2 B;  3CCJ F;  4I4T B;  2V9Y A;  4ZHV A;  4BVS A;  2VGM A;  2WAL A;  4X1K B;  4ZHQ A;  4X1Y A;  3CC4 F;  1K73 H;  4TV9 A;  2QTP A;  5EIB D;  2I6R A;  3S0Y A;  3CG6 A;  5J2U B;  2LBX A;  3OBW A;  3VTI C;  4O2B B;  5KMG A;  1YJW F;  2YXZ A;  2R6R 1;  3IEW A;  1N8R H;  3WGJ A;  4F6R A;  1CLI A;  3JAS B;  2LBT A;  3JAK A;  1TVK A;  4I4T A;  3S06 A;  4R40 B;  1ZWZ A;  4X1K A;  4C8G A;  3KHN A;  1VQM F;  2OZB A;  1W42 A;  2UZH A;  4O2B A;  2ZOV A;  2DYY A;  1W5E A;  5FJ4 C;  2VGN A;  3NK6 A;  3JAS A; 
#chains in the Genus database with same CATH homology
 3CMA F;  4NQ3 A;  1Q82 H;  1VQ8 F;  3V7E A;  5HY0 A;  1DT9 A;  1GO0 A;  3I55 F;  3J81 M;  3PLA C;  1K9M H;  1QVF F;  3NVK E;  3CME F;  3G71 F;  1W40 A;  1XBI A;  3LWP C;  3CCR F;  5EWR A;  5GIN C;  3HJW C;  3VI6 A;  1QVG F;  1VQ4 F;  1YI2 F;  3G6E F;  2BO1 A;  3LWR C;  3CC2 F;  3CC7 F;  3SIV A;  3J80 M;  2OHW A;  3O85 A;  3CCM F;  1SDS A;  1GO1 A;  3ON1 A;  1S72 F;  1VQ7 F;  3E1Y A;  2AIF A;  1VQN F;  2GLZ A;  3LWO C;  4BVT A;  1IPA A;  1VQL F;  4X3L A;  2I6D A;  3CPQ A;  5FLX M;  5G4V C;  3FFM A;  2OTL F;  3CCV F;  1NJI H;  5HY2 A;  1E7K A;  1Q7Y H;  3SIU A;  4LCK A;  1VQO F;  4TZZ A;  2OTJ F;  1M1K H;  2QEX F;  4X3M A;  3RA5 A;  1JJ2 F;  1VQK F;  1T0K B;  1Q86 H;  3V3T A;  3VMF B;  2ALE A;  3CD6 F;  4C4W C;  1RA4 A;  3HAX D;  3JCM M;  3NMU C;  3V7Q A;  3MCA B;  4BW0 B;  2KTV A;  5EO3 A;  3CCS F;  5GAP K;  2FGY A;  1M90 H;  1PXW A;  2FC3 A;  3IR9 A;  5HXZ A;  3NVI B;  2CZW A;  1VQ6 F;  1H7M A;  3LWV C;  1VQ5 F;  4BVR A;  3AGK A;  1NMU B;  2KTU A;  4EI7 A;  1YHQ F;  3CCE F;  4EI8 A;  5GIO C;  3GYQ A;  5HWE A;  4NUT A;  1X52 A;  4BY9 D;  5DCV A;  1GZ0 A;  3G4S F;  1YIT F;  3CPW F;  3CCJ F;  1KQS F;  3JAM M;  1YJN F;  2F9Z C;  4BVS A;  2VGM A;  2WAL A;  1YJ9 F;  1KD1 H;  3CC4 F;  1K73 H;  2HVY D;  3OBY A;  1W2B F;  3N4Y A;  3WXM B;  3OW2 F;  3CG6 A;  2LBX A;  3OBW A;  3RA6 A;  3CXC F;  1YJW F;  1W3E X;  1W41 A;  1K8A H;  5GAN K;  3PAF A;  1N8R H;  1YIJ F;  5G4U C;  1CK2 A;  1X7O A;  3LFO A;  5HXU A;  2QA4 F;  1Q81 H;  2LBW A;  1VQP F;  1ZWZ A;  1X7P A;  3N4Z A;  2QI2 A;  3NK7 A;  2KG4 A;  5HY1 A;  1VQM F;  2OZB A;  3CCU F;  3CCL F;  1W42 A;  3CCQ F;  1KC8 H;  5GIP C;  1RLG A;  1CN7 A;  3J7A R;  2JNB A;  3D00 A;  1VQ9 F;  4BVQ A;  3LWQ C;  5FJ4 C;  2VGN A;  3NK6 A;  5HY4 A;  3E20 B;  4XCQ A;  5A2Q M;  5IT9 M;  3I56 F;  4EI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...