3P10A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol694, 2-(thiophen-2-yl)phenyl methanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3p10A00
1JY8A 1T0AA 3IKEA 3ELCA 3B6NA 3IEQA 3ERNA 2UZHA 3F0FA 4C82A 1U40A 1U43A 3GHZA 1KNKA 3IEWA 1GX1A 4C8GA 3FBAA 1KNJA 1W55A 1YQNA 3FPIA 3ESJA 1JN1A 1W57A 3F0GA 4C8EA 3K2XA 3QHDA 1VH8A 3JVHA 3KE1A 3P10A 1IV3A 3MBMA 2PMPA 3P0ZA 3F0EA 1IV1A 5B8FA 2AMTA 3RE3A 3EORA 3IKFA 3Q8HA 1VHAA 4C8IA 1U3PA 3K14A 1H47A 1U3LA 1IV4A 3F0DA 1H48A 3F6MA 3T80A 4C81A 2GZLA 1IV2A
chains in the Genus database with same CATH superfamily
1J7HA 1RLGA 3JAKA 4O4HA 4EB6B 3HJWC 1W3EX 1W41A 3CCSF 3N2KB 3CCRF 1KNKA 5HY2A 1JN1A 5G4UC 1X7OA 2LBXA 1W5EA 5J2UB 3LWOC 3WGLA 4PWTA 2LBWA 3C9RA 4BT5A 5IJ0B 1VQ7F 1FFXA 4X1KA 1VHAA 5KX5B 1ODEA 2UYPA 3CPWF 3HKBB 3CYPB 5J2TA 4O4JB 3RYIB 3CMAF 1VQOF 2OTLF 5JVDB 3UT5A 2NMUA 1JFFB 4KWEA 5IJ9A 3HTNA 3S02A 1W5FA 2VAWA 4R40B 2UZHA 1KQSF 4LCKA 3SIVA 5ITZA 2R751 4ZHVA 2CHSA 4X1IA 3N2GA 3V4DA 5GONB 3JAWA 3LDTA 3CD6F 1IV3A 1X25A 2PMPA 3G6EF 1VQVA 5HWEA 3NVIB 4WBNA 1XBIA 5MN4A 3F0DA 3P4EA 4O2BB 2V9YA 2GZLA 4TV9B 2CWJA 3OBYA 1FNJA 4F6RB 5LA6A 3M4SA 3LFOA 3RYFB 3JASB 5CB4A 3E20B 3G4SF 2PHNA 3FPIA 3LYBA 2DT4A 5JH7A 5KX5A 2Z1TA 2ZVZA 4O4JA 3ON1A 5JVDA 4B45A 4FFBB 3N4ZA 2Z1UA 3RE3A 4RQOA 3KIZA 4ZI7B 1VQPF 2LBTA 3GYQA 1U3PA 1VQLF 3C9UA 2AIZP 3JALB 3WGNA 3CB2A 5LXTB 2G9IA 2I6DA 3ZO8A 2UYNB 3D01A 2QA4F 4BT3A 1VQ9F 1SA0B 1M1KH 1VQ5F 4G4WA 3QUWA 1W55A 4O4LA 1GO0A 1W57A 3CYQA 2Z01A 3JAKB 5GINC 3L7QA 2KG4A 3CC7F 5HP7A 5EO3A 2YXZA 5CA0B 4LNUA 3JASA 5LP6C 1TUBA 5EYPA 1RLUA 3ELCA 1XV2A 1FFXB 3B6NA 4X1KB 3S0HA 3VTIC 1T0KB 1FNKA 5LYJA 1KD1H 5J2TB 1YJNF 1U43A 4FFBA 1QD9A 3O85A 3UT5B 3CMEF 4ZHYB 3D54A 5EIBC 1VQKF 1Q81H 5LOVA 5IJ9B 3CC2F 5MN6A 5FNVA 4EI9A 5LXTA 3HKCA 2AMTA 5ITZB 2FC3A 5HY1A 3IKFA 4X1IB 3N2GB 2QEXF 3F6MA 3JAWB 3T80A 4C81A 5BMVA 3J7AR 4E6EA 1IPAA 1RQ2A 3OW2F 2ZOVA 4WBNB 5JQGB 3K12A 1XHOA 3M84A 2VAMA 2LCAA 2N48A 1YHQF 4C8GA 2RHJA 1KNJA 3VI6A 5LA6B 5CA0A 1UFYA 3LWVC 3JVHA 1VQNF 1YJ9F 4O2AA 3BYQA 3HAXD 3CPQA 5CB4B 2CZWA 3MQWA 4BVRA 1H47A 3CCJF 5JH7B 3E22A 1QAHA 3HWUA 1W581 5HXUA 2W8BC 5JCOC 3IR9A 3KHNA 1VQ4F 2H8CA 5DCVA 1N8RH 2H6LA 5EAZA 4YJ2A 1FSZA 3QTYA 2HX0A 3C8LA 1YIJF 3CCUF 3K2XA 3JARA 5LP6A 1RQ7A 3VCZA 2HP0A 1E7KA 3LWRC 5HP8A 2Z1EA 4ERHA 3Q8HA 4O4LB 2RHLA 1SZQA 5JQGA 4B62A 4TV8A 1IV2A 1CN7A 1JY8A 3KJJA 3IKEA 1TVKA 4DRXA 2K1SA 1KC8H 3RA6A 4LNUB 4U3JA 1U40A 3GHZA 1TUBB 5EYPB 2KTUA 1GX1A 3V3TA 3WPXA 4TZZA 1W5AA 4BT6A 2P6YA 3NMUC 1X52A 2HS0A 5LYJB 5AVMA 1K8AH 4ZHQB 1IV1A 2IG8A 2R6R1 3D00A 2ZF8A 4M8IA 5LOVB 5GIOC 1QVFF 1NQ3A 5FNVB 5EB0A 2CW4A 3HKCB 5GAPK 1ZWZA 5FLXM 3VOBA 3ERNA 3VOAA 1K9MH 2ZODA 5BMVB 3VIUA 5HXZA 2VGNA 1QVGF 3IMPA 1VK3A 3PAFA 3QHDA 2WALA 4NUTA 2JNBA 3F0EA 1Z5WA 2QI2A 1U3LA 2CVLA 1UI9A 2MQEA 4O2AB 2VGMA 1PF5A 4IHJB 3S0YA 2AIFA 5EIBD 5EZYA 3U0OA 3E1YA 5C8YA 3E22B 3WJRA 4ZHQA 3FD5A 1VQMF 4YJ3A 5EWRA 2BO1A 4B46A 3ESJA 3I7TA 1NMUB 1VQ6F 2OTJF 1JJ2F 5CA1A 3LMEA 4YJ2B 4RHAA 2Q1XA 3NK6A 4TUYB 4NWOB 2BTQB 3RA5A 5FJ4C 2B33A 3WGMA 3M1XA 3WGJA 3ZOPA 3JARB 5LP6B 3HKDA 2OHWA 2HP0B 4NQ3A 2IQQA 4G4YA 3PLAC 3IEQA 4IIJA 4B5CA 4HNAA 4ZK7A 2RHHA 4TV8B 4I4TA 3RYCA 1OFUA 3VYUC 3LWQC 1GO1A 1TVKB 1VQ8F 4DRXB 1VH8A 1W42A 4X3LA 4U3JB 1Q86H 3WGKA 5B8FA 2OZBA 3EORA 4IHJA 3CC4F 3C9TA 1COMA 4DXDA 1GZ0A 2HP3A 3VYTC 3MCQA 2ALEA 3RYHA 3V7QA 3JATA 1JD1A 1Q8RA 2F9ZC 1QU9A 2BTOA 3IEWA 3CCEF 1W59A 2ZVYA 4G88A 2GVIA 2L26A 4TUYA 4BVSA 1ONIA 3S0WA 1M90H 2VXYA 5EB1B 1Z5VA 3J80M 3C9SA 3DC2A 3MBMA 1SDSA 5MN5A 3OBWA 4BVTA 3AGKA 4G4VA 2HS4A 3OONA 1H48A 1S72F 1XRGA 3VMFB 1T0AA 2HRYA 2UYJA 2UYKA 5KMGA 2HQSC 4XCQA 3JAMM 4ZOLA 4I55A 4BVQA 2QTPA 3I3FA 4G4ZA 3WJPA 3WJQA 1YI2F 3FBAA 4I50A 1YQNA 3HKEA 1Q7YH 1X7PA 3R0PA 4X1YB 4X20A 5EZYB 4O4IA 3KE1A 5C8YB 3P10A 3P0ZA 3ZP4A 4EI7A 3CCQF 2RB9A 1CK2A 4U39A 4YJ3B 2BTUA 4EB6A 1DBFA 3VYSC 4C8IA 3G71F 1NJIH 1OAPA 3LWPC 5IYZB 3N2KA 3S03A 1R1MA 5CA1B 4EI8A 2IAFA 1W40A 4BT4A 2HVYD 3CCVF 1YGYA 2H8EA 5J2UA 4ZHWA 1W2BF 5IT9M 3F0FA 4BT2A 1PXWA 3HKDB 2HS3A 5IJ0A 3KJKA 4BW0B 2KGWA 3HKBA 3RYIA 3V7EA 4C4WC 3WPWA 5JCOA 4IIJB 1W5BA 2OTMA 4HNAB 3NK7A 1JFFA 4G4XA 3S06A 3J81M 2DYYA 4I4TB 3RYCB 5G4VC 3WXMB 1IV4A 3MDOA 2RHOA 3I55F 3I56F 2GLZA 3CCMF 3NVKE 3CG6A 5GONA 4X1YA 3FFMA 2KTVA 1H7MA 2ZAUA 3JCMM 4X3MA 3RYHB 2EWCA 3JATB 3F0GA 4O4HB 3TD5A 3VO8A 4C8EA 4O2BA 5IYZA 2Q1YA 4TV9A 2HRUA 4F6RA 3ZP7A 5HY0A 2VAPA 5GANK 3DDNA 3CCLF 2CHTA 3RYFA 3K14A 3K0TA 3MCAB 2I6RA 5A2QM 3FD6A 3CXCF 5GIPC 2CSLA 3GTZA 2YYEA 2Z1FA 4ZI7A 5KMGB 1RA4A 4ZOLB 1YITF 4I55B 3JALA 3N4YA 2FGYA 2UYNA 5HY4A 4BT7A 4I50B 3SIUA 3HKEB 1DT9A 1SA0A 4BY9D 1Q82H 1K73H 4X20B 4O4IB 3TD4A 4C82A 3TD3A 1YJWF 1CLIA
chains in the Genus database with same CATH topology
1JY8A 1T0AA 3IKEA 3ELCA 3B6NA 3IEQA 3ERNA 2UZHA 3F0FA 4C82A 1U40A 1U43A 3GHZA 1KNKA 3IEWA 1GX1A 4C8GA 3FBAA 1KNJA 1W55A 1YQNA 3FPIA 3ESJA 1JN1A 1W57A 3F0GA 4C8EA 3K2XA 3QHDA 1VH8A 3JVHA 3KE1A 3P10A 1IV3A 3MBMA 2PMPA 3P0ZA 3F0EA 1IV1A 5B8FA 2AMTA 3RE3A 3EORA 3IKFA 3Q8HA 1VHAA 4C8IA 1U3PA 3K14A 1H47A 1U3LA 1IV4A 3F0DA 1H48A 3F6MA 3T80A 4C81A 2GZLA 1IV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY8 A;  1T0A A;  3IKE A;  3ELC A;  3B6N A;  3IEQ A;  3ERN A;  2UZH A;  3F0F A;  4C82 A;  1U40 A;  1U43 A;  3GHZ A;  1KNK A;  3IEW A;  1GX1 A;  4C8G A;  3FBA A;  1KNJ A;  1W55 A;  1YQN A;  3FPI A;  3ESJ A;  1JN1 A;  1W57 A;  3F0G A;  4C8E A;  3K2X A;  3QHD A;  1VH8 A;  3JVH A;  3KE1 A;  3P10 A;  1IV3 A;  3MBM A;  2PMP A;  3P0Z A;  3F0E A;  1IV1 A;  5B8F A;  2AMT A;  3RE3 A;  3EOR A;  3IKF A;  3Q8H A;  1VHA A;  4C8I A;  1U3P A;  3K14 A;  1H47 A;  1U3L A;  1IV4 A;  3F0D A;  1H48 A;  3F6M A;  3T80 A;  4C81 A;  2GZL A;  1IV2 A; 
#chains in the Genus database with same CATH topology
 1J7H A;  1RLG A;  3JAK A;  4O4H A;  4EB6 B;  3HJW C;  1W3E X;  1W41 A;  3CCS F;  3N2K B;  3CCR F;  1KNK A;  5HY2 A;  1JN1 A;  5G4U C;  1X7O A;  2LBX A;  1W5E A;  5J2U B;  3LWO C;  3WGL A;  4PWT A;  2LBW A;  3C9R A;  4BT5 A;  5IJ0 B;  1VQ7 F;  1FFX A;  4X1K A;  1VHA A;  5KX5 B;  1ODE A;  2UYP A;  3CPW F;  3HKB B;  3CYP B;  5J2T A;  4O4J B;  3RYI B;  3CMA F;  1VQO F;  2OTL F;  5JVD B;  3UT5 A;  2NMU A;  1JFF B;  4KWE A;  5IJ9 A;  3HTN A;  3S02 A;  1W5F A;  2VAW A;  4R40 B;  2UZH A;  1KQS F;  4LCK A;  3SIV A;  5ITZ A;  2R75 1;  4ZHV A;  2CHS A;  4X1I A;  3N2G A;  3V4D A;  5GON B;  3JAW A;  3LDT A;  3CD6 F;  1IV3 A;  1X25 A;  2PMP A;  3G6E F;  1VQV A;  5HWE A;  3NVI B;  4WBN A;  1XBI A;  5MN4 A;  3F0D A;  3P4E A;  4O2B B;  2V9Y A;  2GZL A;  4TV9 B;  2CWJ A;  3OBY A;  1FNJ A;  4F6R B;  5LA6 A;  3M4S A;  3LFO A;  3RYF B;  3JAS B;  5CB4 A;  3E20 B;  3G4S F;  2PHN A;  3FPI A;  3LYB A;  2DT4 A;  5JH7 A;  5KX5 A;  2Z1T A;  2ZVZ A;  4O4J A;  3ON1 A;  5JVD A;  4B45 A;  4FFB B;  3N4Z A;  2Z1U A;  3RE3 A;  4RQO A;  3KIZ A;  4ZI7 B;  1VQP F;  2LBT A;  3GYQ A;  1U3P A;  1VQL F;  3C9U A;  2AIZ P;  3JAL B;  3WGN A;  3CB2 A;  5LXT B;  2G9I A;  2I6D A;  3ZO8 A;  2UYN B;  3D01 A;  2QA4 F;  4BT3 A;  1VQ9 F;  1SA0 B;  1M1K H;  1VQ5 F;  4G4W A;  3QUW A;  1W55 A;  4O4L A;  1GO0 A;  1W57 A;  3CYQ A;  2Z01 A;  3JAK B;  5GIN C;  3L7Q A;  2KG4 A;  3CC7 F;  5HP7 A;  5EO3 A;  2YXZ A;  5CA0 B;  4LNU A;  3JAS A;  5LP6 C;  1TUB A;  5EYP A;  1RLU A;  3ELC A;  1XV2 A;  1FFX B;  3B6N A;  4X1K B;  3S0H A;  3VTI C;  1T0K B;  1FNK A;  5LYJ A;  1KD1 H;  5J2T B;  1YJN F;  1U43 A;  4FFB A;  1QD9 A;  3O85 A;  3UT5 B;  3CME F;  4ZHY B;  3D54 A;  5EIB C;  1VQK F;  1Q81 H;  5LOV A;  5IJ9 B;  3CC2 F;  5MN6 A;  5FNV A;  4EI9 A;  5LXT A;  3HKC A;  2AMT A;  5ITZ B;  2FC3 A;  5HY1 A;  3IKF A;  4X1I B;  3N2G B;  2QEX F;  3F6M A;  3JAW B;  3T80 A;  4C81 A;  5BMV A;  3J7A R;  4E6E A;  1IPA A;  1RQ2 A;  3OW2 F;  2ZOV A;  4WBN B;  5JQG B;  3K12 A;  1XHO A;  3M84 A;  2VAM A;  2LCA A;  2N48 A;  1YHQ F;  4C8G A;  2RHJ A;  1KNJ A;  3VI6 A;  5LA6 B;  5CA0 A;  1UFY A;  3LWV C;  3JVH A;  1VQN F;  1YJ9 F;  4O2A A;  3BYQ A;  3HAX D;  3CPQ A;  5CB4 B;  2CZW A;  3MQW A;  4BVR A;  1H47 A;  3CCJ F;  5JH7 B;  3E22 A;  1QAH A;  3HWU A;  1W58 1;  5HXU A;  2W8B C;  5JCO C;  3IR9 A;  3KHN A;  1VQ4 F;  2H8C A;  5DCV A;  1N8R H;  2H6L A;  5EAZ A;  4YJ2 A;  1FSZ A;  3QTY A;  2HX0 A;  3C8L A;  1YIJ F;  3CCU F;  3K2X A;  3JAR A;  5LP6 A;  1RQ7 A;  3VCZ A;  2HP0 A;  1E7K A;  3LWR C;  5HP8 A;  2Z1E A;  4ERH A;  3Q8H A;  4O4L B;  2RHL A;  1SZQ A;  5JQG A;  4B62 A;  4TV8 A;  1IV2 A;  1CN7 A;  1JY8 A;  3KJJ A;  3IKE A;  1TVK A;  4DRX A;  2K1S A;  1KC8 H;  3RA6 A;  4LNU B;  4U3J A;  1U40 A;  3GHZ A;  1TUB B;  5EYP B;  2KTU A;  1GX1 A;  3V3T A;  3WPX A;  4TZZ A;  1W5A A;  4BT6 A;  2P6Y A;  3NMU C;  1X52 A;  2HS0 A;  5LYJ B;  5AVM A;  1K8A H;  4ZHQ B;  1IV1 A;  2IG8 A;  2R6R 1;  3D00 A;  2ZF8 A;  4M8I A;  5LOV B;  5GIO C;  1QVF F;  1NQ3 A;  5FNV B;  5EB0 A;  2CW4 A;  3HKC B;  5GAP K;  1ZWZ A;  5FLX M;  3VOB A;  3ERN A;  3VOA A;  1K9M H;  2ZOD A;  5BMV B;  3VIU A;  5HXZ A;  2VGN A;  1QVG F;  3IMP A;  1VK3 A;  3PAF A;  3QHD A;  2WAL A;  4NUT A;  2JNB A;  3F0E A;  1Z5W A;  2QI2 A;  1U3L A;  2CVL A;  1UI9 A;  2MQE A;  4O2A B;  2VGM A;  1PF5 A;  4IHJ B;  3S0Y A;  2AIF A;  5EIB D;  5EZY A;  3U0O A;  3E1Y A;  5C8Y A;  3E22 B;  3WJR A;  4ZHQ A;  3FD5 A;  1VQM F;  4YJ3 A;  5EWR A;  2BO1 A;  4B46 A;  3ESJ A;  3I7T A;  1NMU B;  1VQ6 F;  2OTJ F;  1JJ2 F;  5CA1 A;  3LME A;  4YJ2 B;  4RHA A;  2Q1X A;  3NK6 A;  4TUY B;  4NWO B;  2BTQ B;  3RA5 A;  5FJ4 C;  2B33 A;  3WGM A;  3M1X A;  3WGJ A;  3ZOP A;  3JAR B;  5LP6 B;  3HKD A;  2OHW A;  2HP0 B;  4NQ3 A;  2IQQ A;  4G4Y A;  3PLA C;  3IEQ A;  4IIJ A;  4B5C A;  4HNA A;  4ZK7 A;  2RHH A;  4TV8 B;  4I4T A;  3RYC A;  1OFU A;  3VYU C;  3LWQ C;  1GO1 A;  1TVK B;  1VQ8 F;  4DRX B;  1VH8 A;  1W42 A;  4X3L A;  4U3J B;  1Q86 H;  3WGK A;  5B8F A;  2OZB A;  3EOR A;  4IHJ A;  3CC4 F;  3C9T A;  1COM A;  4DXD A;  1GZ0 A;  2HP3 A;  3VYT C;  3MCQ A;  2ALE A;  3RYH A;  3V7Q A;  3JAT A;  1JD1 A;  1Q8R A;  2F9Z C;  1QU9 A;  2BTO A;  3IEW A;  3CCE F;  1W59 A;  2ZVY A;  4G88 A;  2GVI A;  2L26 A;  4TUY A;  4BVS A;  1ONI A;  3S0W A;  1M90 H;  2VXY A;  5EB1 B;  1Z5V A;  3J80 M;  3C9S A;  3DC2 A;  3MBM A;  1SDS A;  5MN5 A;  3OBW A;  4BVT A;  3AGK A;  4G4V A;  2HS4 A;  3OON A;  1H48 A;  1S72 F;  1XRG A;  3VMF B;  1T0A A;  2HRY A;  2UYJ A;  2UYK A;  5KMG A;  2HQS C;  4XCQ A;  3JAM M;  4ZOL A;  4I55 A;  4BVQ A;  2QTP A;  3I3F A;  4G4Z A;  3WJP A;  3WJQ A;  1YI2 F;  3FBA A;  4I50 A;  1YQN A;  3HKE A;  1Q7Y H;  1X7P A;  3R0P A;  4X1Y B;  4X20 A;  5EZY B;  4O4I A;  3KE1 A;  5C8Y B;  3P10 A;  3P0Z A;  3ZP4 A;  4EI7 A;  3CCQ F;  2RB9 A;  1CK2 A;  4U39 A;  4YJ3 B;  2BTU A;  4EB6 A;  1DBF A;  3VYS C;  4C8I A;  3G71 F;  1NJI H;  1OAP A;  3LWP C;  5IYZ B;  3N2K A;  3S03 A;  1R1M A;  5CA1 B;  4EI8 A;  2IAF A;  1W40 A;  4BT4 A;  2HVY D;  3CCV F;  1YGY A;  2H8E A;  5J2U A;  4ZHW A;  1W2B F;  5IT9 M;  3F0F A;  4BT2 A;  1PXW A;  3HKD B;  2HS3 A;  5IJ0 A;  3KJK A;  4BW0 B;  2KGW A;  3HKB A;  3RYI A;  3V7E A;  4C4W C;  3WPW A;  5JCO A;  4IIJ B;  1W5B A;  2OTM A;  4HNA B;  3NK7 A;  1JFF A;  4G4X A;  3S06 A;  3J81 M;  2DYY A;  4I4T B;  3RYC B;  5G4V C;  3WXM B;  1IV4 A;  3MDO A;  2RHO A;  3I55 F;  3I56 F;  2GLZ A;  3CCM F;  3NVK E;  3CG6 A;  5GON A;  4X1Y A;  3FFM A;  2KTV A;  1H7M A;  2ZAU A;  3JCM M;  4X3M A;  3RYH B;  2EWC A;  3JAT B;  3F0G A;  4O4H B;  3TD5 A;  3VO8 A;  4C8E A;  4O2B A;  5IYZ A;  2Q1Y A;  4TV9 A;  2HRU A;  4F6R A;  3ZP7 A;  5HY0 A;  2VAP A;  5GAN K;  3DDN A;  3CCL F;  2CHT A;  3RYF A;  3K14 A;  3K0T A;  3MCA B;  2I6R A;  5A2Q M;  3FD6 A;  3CXC F;  5GIP C;  2CSL A;  3GTZ A;  2YYE A;  2Z1F A;  4ZI7 A;  5KMG B;  1RA4 A;  4ZOL B;  1YIT F;  4I55 B;  3JAL A;  3N4Y A;  2FGY A;  2UYN A;  5HY4 A;  4BT7 A;  4I50 B;  3SIU A;  3HKE B;  1DT9 A;  1SA0 A;  4BY9 D;  1Q82 H;  1K73 H;  4X20 B;  4O4I B;  3TD4 A;  4C82 A;  3TD3 A;  1YJW F;  1CLI A; 
#chains in the Genus database with same CATH homology
 1JY8 A;  1T0A A;  3IKE A;  3ELC A;  3B6N A;  3IEQ A;  3ERN A;  2UZH A;  3F0F A;  4C82 A;  1U40 A;  1U43 A;  3GHZ A;  1KNK A;  3IEW A;  1GX1 A;  4C8G A;  3FBA A;  1KNJ A;  1W55 A;  1YQN A;  3FPI A;  3ESJ A;  1JN1 A;  1W57 A;  3F0G A;  4C8E A;  3K2X A;  3QHD A;  1VH8 A;  3JVH A;  3KE1 A;  3P10 A;  1IV3 A;  3MBM A;  2PMP A;  3P0Z A;  3F0E A;  1IV1 A;  5B8F A;  2AMT A;  3RE3 A;  3EOR A;  3IKF A;  3Q8H A;  1VHA A;  4C8I A;  1U3P A;  3K14 A;  1H47 A;  1U3L A;  1IV4 A;  3F0D A;  1H48 A;  3F6M A;  3T80 A;  4C81 A;  2GZL A;  1IV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...