3P10A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol694, 2-(thiophen-2-yl)phenyl methanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3p10A00
4C8EA 3K2XA 3GHZA 3RE3A 4C81A 3IEWA 1VH8A 3F6MA 1H47A 3FBAA 3F0GA 1H48A 3P10A 3B6NA 1U43A 1U3LA 1W57A 1W55A 1YQNA 3F0EA 4C82A 1VHAA 3QHDA 3IKFA 3P0ZA 3JVHA 3IKEA 5B8FA 3T80A 3K14A 1T0AA 3EORA 3ERNA 3F0DA 3KE1A 1GX1A 1U40A 1JN1A 1KNKA 2PMPA 4C8GA 1IV3A 3F0FA 2AMTA 3Q8HA 2UZHA 3MBMA 1U3PA 4C8IA 2GZLA 3FPIA 1IV2A 1JY8A 1IV1A 1IV4A 3ESJA 1KNJA 3ELCA 3IEQA
chains in the Genus database with same CATH superfamily
4TUYA 1FFXA 5IJ0B 3RA6A 3E22A 1W40A 3IEWA 2Z1EA 1ODEA 5A2QM 2NMUA 3P10A 3JALA 4DXDA 1W57A 3GTZA 4X1IA 5EIBD 3O85A 5HP7A 2LBXA 3WGNA 3RYIA 3CCJF 3EORA 2B33A 2VXYA 5LXTA 1W5FA 2HS4A 2BTQB 3FD6A 3OONA 2OTMA 3DDNA 5DCVA 3V4DA 3WGJA 4WBNB 1W5EA 3CCUF 3J81M 2L26A 3VOAA 1IV4A 5HP8A 4C8EA 3C8LA 3TD3A 3VMFB 1RQ2A 5IJ9B 4G4VA 1VHAA 5HXUA 2VGNA 3C9UA 4YJ3A 3RYCA 5KMGA 3KJKA 1VQ4F 5AVMA 4B46A 5CA0A 2ZODA 3Q8HA 4BY9D 2ZAUA 2UZHA 1S72F 1QVFF 1JFFB 4C8IA 1FNJA 3FPIA 3MCAB 3S02A 3LFOA 2RHHA 5EWRA 5IYZA 3F6MA 3JASA 4G4ZA 3VOBA 2Q1YA 4O4LA 1W3EX 1DT9A 1M1KH 3P0ZA 3IKEA 1T0AA 2H6LA 5C8YA 3RYHA 1Q82H 2HRYA 5IT9M 1W5AA 3OBWA 3RYFB 4BVRA 3VYUC 4G4XA 3N2KB 1COMA 2R751 1VQNF 4YJ2B 5CB4A 4XCQA 2I6DA 1ZWZA 3IEQA 4O4HB 5LA6A 2I6RA 3R0PA 1OAPA 3F0GA 3VIUA 2AIFA 3WPWA 3E22B 5FJ4C 1VQPF 1GX1A 1DBFA 1U40A 2Z1TA 1SDSA 4O4IA 3DC2A 3CCMF 2V9YA 4LCKA 1H7MA 3RYIB 3NK7A 4R40B 5EZYB 3WXMB 1VQKF 5LXTB 1IV2A 4X1KA 1KC8H 1JD1A 2JNBA 3NK6A 5J2UA 3C9SA 2OTLF 2CW4A 4X3LA 5EAZA 3CCLF 5ITZA 2P6YA 2QTPA 5HY2A 1YQNA 1NMUB 3N2GA 5J2TB 3NMUC 2GLZA 4I55B 2VAPA 3F0FA 2ALEA 1QVGF 3MBMA 5GAPK 3RYCB 5LP6B 1JY8A 4ZK7A 3I56F 3WJPA 5CA0B 3WGMA 3CC7F 3CC2F 5FNVA 3FBAA 1W41A 4I50A 1KQSF 3FD5A 3G6EF 5EB1B 3JVHA 3F0DA 3CYPB 5IYZB 5MN5A 4IIJA 4DRXA 3CCEF 2IG8A 4O4LB 5GIOC 4TV8A 2LBWA 3VI6A 4ZI7A 2IQQA 1VQ5F 5C8YB 3KJJA 1YITF 2VAMA 4EI8A 3JAMM 3CCQF 1VQ6F 5LP6C 2HP3A 5LOVB 3UT5A 3K2XA 4BT7A 1UFYA 3U0OA 3PAFA 2OZBA 5CB4B 5EYPB 3TD5A 3CMAF 4BVSA 1H48A 1TUBB 4C82A 4G4YA 1Q8RA 3WJQA 1RLUA 3SIVA 1CK2A 1X25A 5LA6B 4X1YA 4ERHA 3CCSF 2ZVZA 4BT4A 3RA5A 3VYTC 2CHSA 5MN4A 4I4TA 1JJ2F 4C8GA 4BW0B 4ZHYB 1XRGA 3CPWF 4EB6A 1U3PA 4RHAA 4O4IB 3T80A 2QEXF 5JCOC 1VQ9F 2HP0A 2Z01A 2LBTA 3RE3A 4C81A 2AIZP 5LYJA 3FFMA 1VQMF 1W42A 2HX0A 3M84A 3MDOA 4BT2A 5BMVA 3I7TA 5J2UB 2KTVA 2DYYA 3D01A 3HKBA 4HNAB 3HKEB 4X20A 3JAWA 5ITZB 5JH7A 3CCVF 3D00A 5IJ0A 3S0YA 3JCMM 1K8AH 2ZVYA 1W59A 2HQSC 3N2GB 2KGWA 3OBYA 1VQOF 3L7QA 5KX5A 1Q81H 4B5CA 1VQLF 1SA0A 2Z1FA 4KWEA 3VYSC 1X7PA 4EI9A 3J80M 5JVDA 3LWRC 4ZOLB 3KIZA 1R1MA 3IKFA 5JVDB 3C9TA 5B8FA 4TUYB 1FFXB 2BTUA 3K14A 1N8RH 1XBIA 5JCOA 5FNVB 3CMEF 3N4ZA 4I50B 1M90H 3JALB 2WALA 3PLAC 2BTOA 4X1IB 2MQEA 4IIJB 4DRXB 4IHJA 2QI2A 1FSZA 3ESJA 4ZHQA 3K0TA 3LWPC 4TV8B 5GIPC 3HKCA 3CYQA 1GO1A 2VGMA 4TV9A 1VK3A 1X52A 1YHQF 4BVTA 1SZQA 1U3LA 3CB2A 3LDTA 3F0EA 3MCQA 1E7KA 3UT5B 1YJNF 3K12A 4E6EA 2ZOVA 1W2BF 1JN1A 2GVIA 4B45A 1QU9A 3J7AR 4NUTA 1Z5WA 3TD4A 5JQGA 5GANK 3HWUA 4G88A 4X1YB 4YJ3B 2RHLA 3GYQA 5GONA 5KMGB 2H8CA 4I4TB 5HY1A 4RQOA 3CPQA 4BT6A 4FFBA 4B62A 2ZF8A 3HKDA 1H47A 3JARA 4EB6B 3N2KA 5CA1A 2UYKA 3WGLA 4YJ2A 2RHJA 2HP0B 4BT3A 5LYJB 4O2AA 4BVQA 1RQ7A 3JASB 1KNKA 3SIUA 5BMVB 1CN7A 1IV3A 2Z1UA 3V7EA 3JAKA 5EIBC 2IAFA 1TVKA 2RB9A 1Z5VA 4X20B 3RYHB 5HWEA 5JH7B 2GZLA 1KD1H 1K9MH 3LYBA 3V3TA 2DT4A 3WGKA 2OTJF 3GHZA 4O4JA 4ZHVA 5G4VC 2UYJA 4EI7A 3E20B 3CCRF 1W55A 5KX5B 3CXCF 1GO0A 1SA0B 5EZYA 1VQVA 2HVYD 2N48A 3AGKA 5HXZA 2W8BC 2G9IA 2HRUA 2PHNA 2UYNA 5FLXM 3JATA 1IV1A 3V7QA 1KNJA 3ELCA 4U3JA 2VAWA 5J2TA 3VO8A 4LNUA 3S0HA 3OW2F 1VH8A 4I55A 4O2BA 1ONIA 4IHJB 4U39A 3IMPA 3ZP7A 4ZHQB 4X1KB 3ZP4A 1VQ7F 5G4UC 1Q86H 3HKCB 2YXZA 1J7HA 4TV9B 4F6RA 5LP6A 2F9ZC 1UI9A 3M1XA 2PMPA 3IR9A 3C9RA 1GZ0A 2YYEA 1YJWF 3G4SF 2KTUA 1VQ8F 1YIJF 2LCAA 4BT5A 1OFUA 3WJRA 1RA4A 3G71F 1W581 2OHWA 5JQGB 4TZZA 3P4EA 1YGYA 3LWOC 5GONB 3VCZA 4FFBB 3S0WA 1NQ3A 3HKDB 3JARB 4WBNA 3ZOPA 5LOVA 3I3FA 5CA1B 3LMEA 4G4WA 5EYPA 3BYQA 2H8EA 2BO1A 1TUBA 5IJ9A 4O2AB 5EB0A 1YI2F 2Q1XA 2FGYA 3QUWA 3S06A 3HAXD 2K1SA 3LWQC 1XHOA 2CSLA 3JAKB 4ZI7B 3HTNA 1TVKB 1T0KB 3B6NA 2RHOA 4M8IA 3LWVC 4NWOB 3QHDA 1Q7YH 1RLGA 2EWCA 4O4JB 2HS3A 3ERNA 3KE1A 3CG6A 1JFFA 3M4SA 4ZHWA 1YJ9F 3WPXA 3N4YA 3ZO8A 5MN6A 2KG4A 3D54A 4NQ3A 3MQWA 5HY0A 4HNAA 3HKEA 3QTYA 1K73H 2CWJA 3S03A 1CLIA 1IPAA 1FNKA 3RYFA 2UYNB 1U43A 3JATB 2CVLA 1NJIH 3ON1A 4X3MA 4U3JB 4PWTA 5GINC 1QD9A 3CC4F 4LNUB 1X7OA 2FC3A 3KHNA 4O2BB 2CZWA 3E1YA 3HJWC 2CHTA 2QA4F 5EO3A 3I55F 4O4HA 2AMTA 3NVIB 2R6R1 3CD6F 1PF5A 1XV2A 3NVKE 3HKBB 3VTIC 1PXWA 4F6RB 4C4WC 4ZOLA 3JAWB 5HY4A 1W5BA 1QAHA 2HS0A 2UYPA
chains in the Genus database with same CATH topology
4C8EA 3K2XA 3GHZA 3RE3A 4C81A 3IEWA 1VH8A 3F6MA 1H47A 3FBAA 3F0GA 1H48A 3P10A 3B6NA 1U43A 1U3LA 1W57A 1W55A 1YQNA 3F0EA 4C82A 1VHAA 3QHDA 3IKFA 3P0ZA 3JVHA 3IKEA 5B8FA 3T80A 3K14A 1T0AA 3EORA 3ERNA 3F0DA 3KE1A 1GX1A 1U40A 1JN1A 1KNKA 2PMPA 4C8GA 1IV3A 3F0FA 2AMTA 3Q8HA 2UZHA 3MBMA 1U3PA 4C8IA 2GZLA 3FPIA 1IV2A 1JY8A 1IV1A 1IV4A 3ESJA 1KNJA 3ELCA 3IEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8E A;  3K2X A;  3GHZ A;  3RE3 A;  4C81 A;  3IEW A;  1VH8 A;  3F6M A;  1H47 A;  3FBA A;  3F0G A;  1H48 A;  3P10 A;  3B6N A;  1U43 A;  1U3L A;  1W57 A;  1W55 A;  1YQN A;  3F0E A;  4C82 A;  1VHA A;  3QHD A;  3IKF A;  3P0Z A;  3JVH A;  3IKE A;  5B8F A;  3T80 A;  3K14 A;  1T0A A;  3EOR A;  3ERN A;  3F0D A;  3KE1 A;  1GX1 A;  1U40 A;  1JN1 A;  1KNK A;  2PMP A;  4C8G A;  1IV3 A;  3F0F A;  2AMT A;  3Q8H A;  2UZH A;  3MBM A;  1U3P A;  4C8I A;  2GZL A;  3FPI A;  1IV2 A;  1JY8 A;  1IV1 A;  1IV4 A;  3ESJ A;  1KNJ A;  3ELC A;  3IEQ A; 
#chains in the Genus database with same CATH topology
 4TUY A;  1FFX A;  5IJ0 B;  3RA6 A;  3E22 A;  1W40 A;  3IEW A;  2Z1E A;  1ODE A;  5A2Q M;  2NMU A;  3P10 A;  3JAL A;  4DXD A;  1W57 A;  3GTZ A;  4X1I A;  5EIB D;  3O85 A;  5HP7 A;  2LBX A;  3WGN A;  3RYI A;  3CCJ F;  3EOR A;  2B33 A;  2VXY A;  5LXT A;  1W5F A;  2HS4 A;  2BTQ B;  3FD6 A;  3OON A;  2OTM A;  3DDN A;  5DCV A;  3V4D A;  3WGJ A;  4WBN B;  1W5E A;  3CCU F;  3J81 M;  2L26 A;  3VOA A;  1IV4 A;  5HP8 A;  4C8E A;  3C8L A;  3TD3 A;  3VMF B;  1RQ2 A;  5IJ9 B;  4G4V A;  1VHA A;  5HXU A;  2VGN A;  3C9U A;  4YJ3 A;  3RYC A;  5KMG A;  3KJK A;  1VQ4 F;  5AVM A;  4B46 A;  5CA0 A;  2ZOD A;  3Q8H A;  4BY9 D;  2ZAU A;  2UZH A;  1S72 F;  1QVF F;  1JFF B;  4C8I A;  1FNJ A;  3FPI A;  3MCA B;  3S02 A;  3LFO A;  2RHH A;  5EWR A;  5IYZ A;  3F6M A;  3JAS A;  4G4Z A;  3VOB A;  2Q1Y A;  4O4L A;  1W3E X;  1DT9 A;  1M1K H;  3P0Z A;  3IKE A;  1T0A A;  2H6L A;  5C8Y A;  3RYH A;  1Q82 H;  2HRY A;  5IT9 M;  1W5A A;  3OBW A;  3RYF B;  4BVR A;  3VYU C;  4G4X A;  3N2K B;  1COM A;  2R75 1;  1VQN F;  4YJ2 B;  5CB4 A;  4XCQ A;  2I6D A;  1ZWZ A;  3IEQ A;  4O4H B;  5LA6 A;  2I6R A;  3R0P A;  1OAP A;  3F0G A;  3VIU A;  2AIF A;  3WPW A;  3E22 B;  5FJ4 C;  1VQP F;  1GX1 A;  1DBF A;  1U40 A;  2Z1T A;  1SDS A;  4O4I A;  3DC2 A;  3CCM F;  2V9Y A;  4LCK A;  1H7M A;  3RYI B;  3NK7 A;  4R40 B;  5EZY B;  3WXM B;  1VQK F;  5LXT B;  1IV2 A;  4X1K A;  1KC8 H;  1JD1 A;  2JNB A;  3NK6 A;  5J2U A;  3C9S A;  2OTL F;  2CW4 A;  4X3L A;  5EAZ A;  3CCL F;  5ITZ A;  2P6Y A;  2QTP A;  5HY2 A;  1YQN A;  1NMU B;  3N2G A;  5J2T B;  3NMU C;  2GLZ A;  4I55 B;  2VAP A;  3F0F A;  2ALE A;  1QVG F;  3MBM A;  5GAP K;  3RYC B;  5LP6 B;  1JY8 A;  4ZK7 A;  3I56 F;  3WJP A;  5CA0 B;  3WGM A;  3CC7 F;  3CC2 F;  5FNV A;  3FBA A;  1W41 A;  4I50 A;  1KQS F;  3FD5 A;  3G6E F;  5EB1 B;  3JVH A;  3F0D A;  3CYP B;  5IYZ B;  5MN5 A;  4IIJ A;  4DRX A;  3CCE F;  2IG8 A;  4O4L B;  5GIO C;  4TV8 A;  2LBW A;  3VI6 A;  4ZI7 A;  2IQQ A;  1VQ5 F;  5C8Y B;  3KJJ A;  1YIT F;  2VAM A;  4EI8 A;  3JAM M;  3CCQ F;  1VQ6 F;  5LP6 C;  2HP3 A;  5LOV B;  3UT5 A;  3K2X A;  4BT7 A;  1UFY A;  3U0O A;  3PAF A;  2OZB A;  5CB4 B;  5EYP B;  3TD5 A;  3CMA F;  4BVS A;  1H48 A;  1TUB B;  4C82 A;  4G4Y A;  1Q8R A;  3WJQ A;  1RLU A;  3SIV A;  1CK2 A;  1X25 A;  5LA6 B;  4X1Y A;  4ERH A;  3CCS F;  2ZVZ A;  4BT4 A;  3RA5 A;  3VYT C;  2CHS A;  5MN4 A;  4I4T A;  1JJ2 F;  4C8G A;  4BW0 B;  4ZHY B;  1XRG A;  3CPW F;  4EB6 A;  1U3P A;  4RHA A;  4O4I B;  3T80 A;  2QEX F;  5JCO C;  1VQ9 F;  2HP0 A;  2Z01 A;  2LBT A;  3RE3 A;  4C81 A;  2AIZ P;  5LYJ A;  3FFM A;  1VQM F;  1W42 A;  2HX0 A;  3M84 A;  3MDO A;  4BT2 A;  5BMV A;  3I7T A;  5J2U B;  2KTV A;  2DYY A;  3D01 A;  3HKB A;  4HNA B;  3HKE B;  4X20 A;  3JAW A;  5ITZ B;  5JH7 A;  3CCV F;  3D00 A;  5IJ0 A;  3S0Y A;  3JCM M;  1K8A H;  2ZVY A;  1W59 A;  2HQS C;  3N2G B;  2KGW A;  3OBY A;  1VQO F;  3L7Q A;  5KX5 A;  1Q81 H;  4B5C A;  1VQL F;  1SA0 A;  2Z1F A;  4KWE A;  3VYS C;  1X7P A;  4EI9 A;  3J80 M;  5JVD A;  3LWR C;  4ZOL B;  3KIZ A;  1R1M A;  3IKF A;  5JVD B;  3C9T A;  5B8F A;  4TUY B;  1FFX B;  2BTU A;  3K14 A;  1N8R H;  1XBI A;  5JCO A;  5FNV B;  3CME F;  3N4Z A;  4I50 B;  1M90 H;  3JAL B;  2WAL A;  3PLA C;  2BTO A;  4X1I B;  2MQE A;  4IIJ B;  4DRX B;  4IHJ A;  2QI2 A;  1FSZ A;  3ESJ A;  4ZHQ A;  3K0T A;  3LWP C;  4TV8 B;  5GIP C;  3HKC A;  3CYQ A;  1GO1 A;  2VGM A;  4TV9 A;  1VK3 A;  1X52 A;  1YHQ F;  4BVT A;  1SZQ A;  1U3L A;  3CB2 A;  3LDT A;  3F0E A;  3MCQ A;  1E7K A;  3UT5 B;  1YJN F;  3K12 A;  4E6E A;  2ZOV A;  1W2B F;  1JN1 A;  2GVI A;  4B45 A;  1QU9 A;  3J7A R;  4NUT A;  1Z5W A;  3TD4 A;  5JQG A;  5GAN K;  3HWU A;  4G88 A;  4X1Y B;  4YJ3 B;  2RHL A;  3GYQ A;  5GON A;  5KMG B;  2H8C A;  4I4T B;  5HY1 A;  4RQO A;  3CPQ A;  4BT6 A;  4FFB A;  4B62 A;  2ZF8 A;  3HKD A;  1H47 A;  3JAR A;  4EB6 B;  3N2K A;  5CA1 A;  2UYK A;  3WGL A;  4YJ2 A;  2RHJ A;  2HP0 B;  4BT3 A;  5LYJ B;  4O2A A;  4BVQ A;  1RQ7 A;  3JAS B;  1KNK A;  3SIU A;  5BMV B;  1CN7 A;  1IV3 A;  2Z1U A;  3V7E A;  3JAK A;  5EIB C;  2IAF A;  1TVK A;  2RB9 A;  1Z5V A;  4X20 B;  3RYH B;  5HWE A;  5JH7 B;  2GZL A;  1KD1 H;  1K9M H;  3LYB A;  3V3T A;  2DT4 A;  3WGK A;  2OTJ F;  3GHZ A;  4O4J A;  4ZHV A;  5G4V C;  2UYJ A;  4EI7 A;  3E20 B;  3CCR F;  1W55 A;  5KX5 B;  3CXC F;  1GO0 A;  1SA0 B;  5EZY A;  1VQV A;  2HVY D;  2N48 A;  3AGK A;  5HXZ A;  2W8B C;  2G9I A;  2HRU A;  2PHN A;  2UYN A;  5FLX M;  3JAT A;  1IV1 A;  3V7Q A;  1KNJ A;  3ELC A;  4U3J A;  2VAW A;  5J2T A;  3VO8 A;  4LNU A;  3S0H A;  3OW2 F;  1VH8 A;  4I55 A;  4O2B A;  1ONI A;  4IHJ B;  4U39 A;  3IMP A;  3ZP7 A;  4ZHQ B;  4X1K B;  3ZP4 A;  1VQ7 F;  5G4U C;  1Q86 H;  3HKC B;  2YXZ A;  1J7H A;  4TV9 B;  4F6R A;  5LP6 A;  2F9Z C;  1UI9 A;  3M1X A;  2PMP A;  3IR9 A;  3C9R A;  1GZ0 A;  2YYE A;  1YJW F;  3G4S F;  2KTU A;  1VQ8 F;  1YIJ F;  2LCA A;  4BT5 A;  1OFU A;  3WJR A;  1RA4 A;  3G71 F;  1W58 1;  2OHW A;  5JQG B;  4TZZ A;  3P4E A;  1YGY A;  3LWO C;  5GON B;  3VCZ A;  4FFB B;  3S0W A;  1NQ3 A;  3HKD B;  3JAR B;  4WBN A;  3ZOP A;  5LOV A;  3I3F A;  5CA1 B;  3LME A;  4G4W A;  5EYP A;  3BYQ A;  2H8E A;  2BO1 A;  1TUB A;  5IJ9 A;  4O2A B;  5EB0 A;  1YI2 F;  2Q1X A;  2FGY A;  3QUW A;  3S06 A;  3HAX D;  2K1S A;  3LWQ C;  1XHO A;  2CSL A;  3JAK B;  4ZI7 B;  3HTN A;  1TVK B;  1T0K B;  3B6N A;  2RHO A;  4M8I A;  3LWV C;  4NWO B;  3QHD A;  1Q7Y H;  1RLG A;  2EWC A;  4O4J B;  2HS3 A;  3ERN A;  3KE1 A;  3CG6 A;  1JFF A;  3M4S A;  4ZHW A;  1YJ9 F;  3WPX A;  3N4Y A;  3ZO8 A;  5MN6 A;  2KG4 A;  3D54 A;  4NQ3 A;  3MQW A;  5HY0 A;  4HNA A;  3HKE A;  3QTY A;  1K73 H;  2CWJ A;  3S03 A;  1CLI A;  1IPA A;  1FNK A;  3RYF A;  2UYN B;  1U43 A;  3JAT B;  2CVL A;  1NJI H;  3ON1 A;  4X3M A;  4U3J B;  4PWT A;  5GIN C;  1QD9 A;  3CC4 F;  4LNU B;  1X7O A;  2FC3 A;  3KHN A;  4O2B B;  2CZW A;  3E1Y A;  3HJW C;  2CHT A;  2QA4 F;  5EO3 A;  3I55 F;  4O4H A;  2AMT A;  3NVI B;  2R6R 1;  3CD6 F;  1PF5 A;  1XV2 A;  3NVK E;  3HKB B;  3VTI C;  1PXW A;  4F6R B;  4C4W C;  4ZOL A;  3JAW B;  5HY4 A;  1W5B A;  1QAH A;  2HS0 A;  2UYP A; 
#chains in the Genus database with same CATH homology
 4C8E A;  3K2X A;  3GHZ A;  3RE3 A;  4C81 A;  3IEW A;  1VH8 A;  3F6M A;  1H47 A;  3FBA A;  3F0G A;  1H48 A;  3P10 A;  3B6N A;  1U43 A;  1U3L A;  1W57 A;  1W55 A;  1YQN A;  3F0E A;  4C82 A;  1VHA A;  3QHD A;  3IKF A;  3P0Z A;  3JVH A;  3IKE A;  5B8F A;  3T80 A;  3K14 A;  1T0A A;  3EOR A;  3ERN A;  3F0D A;  3KE1 A;  1GX1 A;  1U40 A;  1JN1 A;  1KNK A;  2PMP A;  4C8G A;  1IV3 A;  3F0F A;  2AMT A;  3Q8H A;  2UZH A;  3MBM A;  1U3P A;  4C8I A;  2GZL A;  3FPI A;  1IV2 A;  1JY8 A;  1IV1 A;  1IV4 A;  3ESJ A;  1KNJ A;  3ELC A;  3IEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...