3P10A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol694, 2-(thiophen-2-yl)phenyl methanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3p10A00
1IV2A 3IEWA 3JVHA 1W57A 1GX1A 1T0AA 1U3PA 1YQNA 1U40A 4C8EA 2UZHA 2AMTA 3P0ZA 4C8IA 3EORA 1IV3A 3ERNA 2GZLA 3F0FA 1U43A 3GHZA 5B8FA 3MBMA 1U3LA 3K14A 3F6MA 1IV4A 2PMPA 1H47A 3KE1A 1VH8A 3QHDA 1KNJA 3B6NA 1VHAA 3F0DA 4C8GA 3IKFA 1JN1A 1H48A 3IEQA 1W55A 3ELCA 3Q8HA 4C81A 1JY8A 3ESJA 3FPIA 3P10A 3RE3A 3IKEA 1IV1A 3F0GA 3T80A 3FBAA 4C82A 3F0EA 1KNKA 3K2XA
chains in the Genus database with same CATH superfamily
3WJPA 5AVMA 4B45A 4EB6B 4ZHQB 1OAPA 3HKCB 3HJWC 4TV8A 1H7MA 4X20B 4YJ3B 2AIFA 4I4TB 3RYFB 1XV2A 2Z1TA 2QEXF 5J2TA 2NMUA 4I4TA 4I55B 4G4WA 3VYTC 3CC4F 5HP8A 4ZHQA 3FPIA 1RQ7A 5KX5B 5IYZA 2UYKA 4M8IA 5EZYB 1RA4A 3F0EA 2CWJA 3WGLA 4BT7A 1UFYA 4HNAB 1R1MA 3GTZA 4O2BA 5CA0A 4U39A 3CYQA 2QA4F 2ZODA 3LWOC 1QAHA 1JFFA 3F0FA 2HS3A 4BT6A 5LOVA 5EWRA 3CYPB 1QVFF 1Q8RA 5LYJB 1YHQF 5A2QM 1ODEA 1FFXB 5HY4A 5GAPK 4DXDA 4ZI7A 2R6R1 3CPQA 2CZWA 3JATA 3RE3A 3C9SA 3JARA 5CB4A 1CK2A 1W5EA 2JNBA 5IJ0B 2MQEA 5G4VC 5JQGA 4X1IB 2Z01A 5LOVB 3RYHB 4I50B 1YGYA 2YYEA 1VQ7F 3JAWA 1T0AA 1U40A 3I55F 3CCQF 2KGWA 5LA6B 3HAXD 3SIVA 3CB2A 3QHDA 3F0DA 3LWPC 2KTVA 3J7AR 1TVKB 3JASA 4X1IA 2HP0B 4IIJB 4I55A 4YJ2A 4LNUB 4DRXA 1GO1A 3JCMM 3E22A 5LP6A 3QTYA 4B5CA 3UT5A 1RLUA 1Q7YH 4O4JB 4BVSA 3FFMA 3N4YA 1JFFB 1CN7A 4B62A 2AMTA 3JALB 1DT9A 4BT5A 5CA0B 3MBMA 5J2UB 1TUBB 4R40B 2RHOA 4G4YA 3ZO8A 4ZHYB 3HTNA 3WGNA 1KQSF 2WALA 5JQGB 3OBYA 1GO0A 2ZAUA 1X7OA 3KJJA 3K2XA 2VXYA 5CB4B 5IJ9A 2HRYA 4F6RB 3IR9A 1QD9A 3VOAA 3M4SA 3WGJA 1KC8H 2QI2A 2HS0A 2UYJA 1S72F 4FFBB 3S02A 1W2BF 1FSZA 5EYPB 5HXUA 3HKEA 1W55A 3G6EF 1K73H 3MDOA 3O85A 3ESJA 2G9IA 4WBNB 1W40A 1IV1A 2H6LA 5EYPA 1VQ8F 1T0KB 5EB0A 4C81A 3E20B 3CC7F 3IEWA 3MQWA 3G71F 2H8CA 3JARB 2B33A 3MCQA 5CA1B 3CCRF 1XRGA 3SIUA 4NQ3A 2BTOA 2GZLA 4PWTA 1VQ4F 2Z1EA 2ZVZA 2IAFA 5CA1A 3TD5A 2ZOVA 1X25A 3CCSF 5JH7A 1JN1A 2GLZA 4O4LA 1SZQA 4RQOA 1QU9A 1VQOF 3T80A 2OZBA 3AGKA 1KNKA 4EI8A 2FGYA 3GYQA 3JAKA 5DCVA 4X1KA 5FNVA 3CXCF 3CCVF 5LXTA 3C9UA 1U3PA 2RB9A 4TV9A 3WXMB 5HY1A 4FFBA 3CCEF 3HKDB 3EORA 5JH7B 5HXZA 2OTLF 1W5FA 5HP7A 2Q1YA 5FJ4C 3V7QA 1VQLF 1KNJA 5HWEA 3L7QA 5EO3A 4B46A 3TD3A 2KG4A 1N8RH 1ZWZA 1VQKF 1SA0B 3PAFA 1W5AA 4TUYA 3LDTA 2W8BC 4C82A 3JASB 3CC2F 3CCJF 1NQ3A 1VQPF 4G4ZA 1JD1A 3RA6A 3VIUA 3N2GA 1M90H 1U3LA 3CCLF 4IHJB 5GIOC 4TZZA 3QUWA 3KE1A 2VGMA 3C8LA 3CPWF 1VQ5F 1NMUB 3ZP7A 1YJWF 5HY2A 2RHHA 3UT5B 2EWCA 3S0WA 4F6RA 3F0GA 5BMVB 2UYNA 3C9TA 4RHAA 2QTPA 5GONA 4G88A 1W57A 2IG8A 2CVLA 2ALEA 4ERHA 2R751 4O2BB 5LP6C 1U43A 1KD1H 3CD6F 3N2KB 5KX5A 3OBWA 3IEQA 3WPWA 1Q82H 3IMPA 4NUTA 3J80M 2H8EA 5MN4A 2VGNA 1YITF 1VQNF 4O4LB 3S0YA 3I56F 1PXWA 3NK7A 4O4JA 3JATB 4ZI7B 5JCOC 3VYUC 2ZF8A 3RYIB 1FNJA 2BTQB 3JVHA 2UYPA 1GZ0A 4BVRA 3HWUA 3BYQA 5LYJA 4C8IA 5MN5A 2HP3A 4EB6A 4BVQA 3D00A 4KWEA 2YXZA 2VAMA 1XHOA 2LBTA 5LXTB 3NK6A 2HX0A 5JCOA 3CG6A 1FNKA 4ZK7A 5LA6A 2OTJF 3WJQA 4EI9A 3CMAF 2VAPA 4ZOLB 5EZYA 4O4HB 4EI7A 3I7TA 4BVTA 1Q81H 2HQSC 2LCAA 1CLIA 5BMVA 1K9MH 1YIJF 3KHNA 1W3EX 1Z5VA 5EIBC 1VQVA 1NJIH 2UZHA 3S03A 3P0ZA 1VQ6F 2OTMA 3M1XA 1FFXA 3GHZA 1IPAA 2CHTA 3CCMF 1E7KA 2PHNA 3HKDA 1YI2F 5JVDA 2AIZP 2I6DA 4U3JA 1W59A 5FNVB 3VI6A 5G4UC 3IKEA 4HNAA 3ZOPA 3JAMM 4ZOLA 1IV2A 5KMGB 1RQ2A 4TUYB 1W42A 1OFUA 1Q86H 1JJ2F 1K8AH 3FD6A 2IQQA 3KIZA 3RYFA 1W5BA 1VH8A 3B6NA 1VHAA 4TV8B 2Q1XA 1COMA 4X20A 3E22B 5LP6B 3IKFA 3VYSC 3V7EA 3DDNA 3N4ZA 2K1SA 3I3FA 4O4IB 3K0TA 3DC2A 3Q8HA 5IT9M 3OONA 3G4SF 3R0PA 1Z5WA 1ONIA 5KMGA 4O4HA 4G4XA 3HKEB 2KTUA 3VO8A 4X3MA 1TUBA 1X7PA 3N2KA 3HKBB 5EAZA 4C8EA 5J2UA 1SDSA 3U0OA 4BT4A 4O2AB 3NMUC 2CSLA 4XCQA 3LMEA 3RYCA 3JAWB 4C4WC 5B8FA 3E1YA 3F6MA 1IV4A 4X1YA 5C8YA 2HVYD 2PMPA 3LWQC 4NWOB 4BY9D 3NVKE 2UYNB 3VMFB 3RA5A 3K12A 3KJKA 3RYIA 2RHJA 3P10A 3WGMA 2LBXA 2DYYA 5ITZB 1DBFA 3C9RA 5HY0A 1XBIA 1J7HA 3D01A 2BTUA 2L26A 4BT3A 3LFOA 3N2GB 1YQNA 4ZHWA 4LCKA 1W41A 4IHJA 4X1KB 3HKBA 3JALA 1PF5A 1H47A 5GINC 2LBWA 2RHLA 3M84A 4X3LA 5EIBD 3VTIC 5IJ0A 3P4EA 3WGKA 4ZHVA 1JY8A 5ITZA 3WJRA 4G4VA 5IJ9B 4O4IA 3FBAA 2DT4A 1YJNF 2HP0A 3D54A 2FC3A 5FLXM 2Z1UA 3ZP4A 3PLAC 5J2TB 5GIPC 3J81M 1VK3A 2ZVYA 5C8YB 3MCAB 3WPXA 1YJ9F 1W581 4X1YB 3S06A 3V4DA 1VQ9F 3V3TA 4BW0B 4O2AA 1QVGF 3LYBA 2V9YA 1UI9A 4TV9B 5EB1B 3VCZA 4WBNA 2VAWA 3JAKB 5IYZB 3LWRC 4BT2A 3RYHA 5GONB 4E6EA 2HRUA 2P6YA 5MN6A 5JVDB 3ERNA 3CMEF 1SA0A 2CHSA 3CCUF 2CW4A 1GX1A 4LNUA 4DRXB 4IIJA 4YJ2B 1X52A 1M1KH 2OHWA 2Z1FA 2GVIA 1IV3A 1TVKA 3LWVC 3VOBA 3OW2F 1VQMF 4YJ3A 3K14A 3HKCA 3ON1A 5GANK 2BO1A 4C8GA 1RLGA 2F9ZC 3RYCB 1H48A 2I6RA 3ELCA 2HS4A 3FD5A 3S0HA 3TD4A 3NVIB 4I50A 4U3JB 2N48A
chains in the Genus database with same CATH topology
1IV2A 3IEWA 3JVHA 1W57A 1GX1A 1T0AA 1U3PA 1YQNA 1U40A 4C8EA 2UZHA 2AMTA 3P0ZA 4C8IA 3EORA 1IV3A 3ERNA 2GZLA 3F0FA 1U43A 3GHZA 5B8FA 3MBMA 1U3LA 3K14A 3F6MA 1IV4A 2PMPA 1H47A 3KE1A 1VH8A 3QHDA 1KNJA 3B6NA 1VHAA 3F0DA 4C8GA 3IKFA 1JN1A 1H48A 3IEQA 1W55A 3ELCA 3Q8HA 4C81A 1JY8A 3ESJA 3FPIA 3P10A 3RE3A 3IKEA 1IV1A 3F0GA 3T80A 3FBAA 4C82A 3F0EA 1KNKA 3K2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV2 A;  3IEW A;  3JVH A;  1W57 A;  1GX1 A;  1T0A A;  1U3P A;  1YQN A;  1U40 A;  4C8E A;  2UZH A;  2AMT A;  3P0Z A;  4C8I A;  3EOR A;  1IV3 A;  3ERN A;  2GZL A;  3F0F A;  1U43 A;  3GHZ A;  5B8F A;  3MBM A;  1U3L A;  3K14 A;  3F6M A;  1IV4 A;  2PMP A;  1H47 A;  3KE1 A;  1VH8 A;  3QHD A;  1KNJ A;  3B6N A;  1VHA A;  3F0D A;  4C8G A;  3IKF A;  1JN1 A;  1H48 A;  3IEQ A;  1W55 A;  3ELC A;  3Q8H A;  4C81 A;  1JY8 A;  3ESJ A;  3FPI A;  3P10 A;  3RE3 A;  3IKE A;  1IV1 A;  3F0G A;  3T80 A;  3FBA A;  4C82 A;  3F0E A;  1KNK A;  3K2X A; 
#chains in the Genus database with same CATH topology
 3WJP A;  5AVM A;  4B45 A;  4EB6 B;  4ZHQ B;  1OAP A;  3HKC B;  3HJW C;  4TV8 A;  1H7M A;  4X20 B;  4YJ3 B;  2AIF A;  4I4T B;  3RYF B;  1XV2 A;  2Z1T A;  2QEX F;  5J2T A;  2NMU A;  4I4T A;  4I55 B;  4G4W A;  3VYT C;  3CC4 F;  5HP8 A;  4ZHQ A;  3FPI A;  1RQ7 A;  5KX5 B;  5IYZ A;  2UYK A;  4M8I A;  5EZY B;  1RA4 A;  3F0E A;  2CWJ A;  3WGL A;  4BT7 A;  1UFY A;  4HNA B;  1R1M A;  3GTZ A;  4O2B A;  5CA0 A;  4U39 A;  3CYQ A;  2QA4 F;  2ZOD A;  3LWO C;  1QAH A;  1JFF A;  3F0F A;  2HS3 A;  4BT6 A;  5LOV A;  5EWR A;  3CYP B;  1QVF F;  1Q8R A;  5LYJ B;  1YHQ F;  5A2Q M;  1ODE A;  1FFX B;  5HY4 A;  5GAP K;  4DXD A;  4ZI7 A;  2R6R 1;  3CPQ A;  2CZW A;  3JAT A;  3RE3 A;  3C9S A;  3JAR A;  5CB4 A;  1CK2 A;  1W5E A;  2JNB A;  5IJ0 B;  2MQE A;  5G4V C;  5JQG A;  4X1I B;  2Z01 A;  5LOV B;  3RYH B;  4I50 B;  1YGY A;  2YYE A;  1VQ7 F;  3JAW A;  1T0A A;  1U40 A;  3I55 F;  3CCQ F;  2KGW A;  5LA6 B;  3HAX D;  3SIV A;  3CB2 A;  3QHD A;  3F0D A;  3LWP C;  2KTV A;  3J7A R;  1TVK B;  3JAS A;  4X1I A;  2HP0 B;  4IIJ B;  4I55 A;  4YJ2 A;  4LNU B;  4DRX A;  1GO1 A;  3JCM M;  3E22 A;  5LP6 A;  3QTY A;  4B5C A;  3UT5 A;  1RLU A;  1Q7Y H;  4O4J B;  4BVS A;  3FFM A;  3N4Y A;  1JFF B;  1CN7 A;  4B62 A;  2AMT A;  3JAL B;  1DT9 A;  4BT5 A;  5CA0 B;  3MBM A;  5J2U B;  1TUB B;  4R40 B;  2RHO A;  4G4Y A;  3ZO8 A;  4ZHY B;  3HTN A;  3WGN A;  1KQS F;  2WAL A;  5JQG B;  3OBY A;  1GO0 A;  2ZAU A;  1X7O A;  3KJJ A;  3K2X A;  2VXY A;  5CB4 B;  5IJ9 A;  2HRY A;  4F6R B;  3IR9 A;  1QD9 A;  3VOA A;  3M4S A;  3WGJ A;  1KC8 H;  2QI2 A;  2HS0 A;  2UYJ A;  1S72 F;  4FFB B;  3S02 A;  1W2B F;  1FSZ A;  5EYP B;  5HXU A;  3HKE A;  1W55 A;  3G6E F;  1K73 H;  3MDO A;  3O85 A;  3ESJ A;  2G9I A;  4WBN B;  1W40 A;  1IV1 A;  2H6L A;  5EYP A;  1VQ8 F;  1T0K B;  5EB0 A;  4C81 A;  3E20 B;  3CC7 F;  3IEW A;  3MQW A;  3G71 F;  2H8C A;  3JAR B;  2B33 A;  3MCQ A;  5CA1 B;  3CCR F;  1XRG A;  3SIU A;  4NQ3 A;  2BTO A;  2GZL A;  4PWT A;  1VQ4 F;  2Z1E A;  2ZVZ A;  2IAF A;  5CA1 A;  3TD5 A;  2ZOV A;  1X25 A;  3CCS F;  5JH7 A;  1JN1 A;  2GLZ A;  4O4L A;  1SZQ A;  4RQO A;  1QU9 A;  1VQO F;  3T80 A;  2OZB A;  3AGK A;  1KNK A;  4EI8 A;  2FGY A;  3GYQ A;  3JAK A;  5DCV A;  4X1K A;  5FNV A;  3CXC F;  3CCV F;  5LXT A;  3C9U A;  1U3P A;  2RB9 A;  4TV9 A;  3WXM B;  5HY1 A;  4FFB A;  3CCE F;  3HKD B;  3EOR A;  5JH7 B;  5HXZ A;  2OTL F;  1W5F A;  5HP7 A;  2Q1Y A;  5FJ4 C;  3V7Q A;  1VQL F;  1KNJ A;  5HWE A;  3L7Q A;  5EO3 A;  4B46 A;  3TD3 A;  2KG4 A;  1N8R H;  1ZWZ A;  1VQK F;  1SA0 B;  3PAF A;  1W5A A;  4TUY A;  3LDT A;  2W8B C;  4C82 A;  3JAS B;  3CC2 F;  3CCJ F;  1NQ3 A;  1VQP F;  4G4Z A;  1JD1 A;  3RA6 A;  3VIU A;  3N2G A;  1M90 H;  1U3L A;  3CCL F;  4IHJ B;  5GIO C;  4TZZ A;  3QUW A;  3KE1 A;  2VGM A;  3C8L A;  3CPW F;  1VQ5 F;  1NMU B;  3ZP7 A;  1YJW F;  5HY2 A;  2RHH A;  3UT5 B;  2EWC A;  3S0W A;  4F6R A;  3F0G A;  5BMV B;  2UYN A;  3C9T A;  4RHA A;  2QTP A;  5GON A;  4G88 A;  1W57 A;  2IG8 A;  2CVL A;  2ALE A;  4ERH A;  2R75 1;  4O2B B;  5LP6 C;  1U43 A;  1KD1 H;  3CD6 F;  3N2K B;  5KX5 A;  3OBW A;  3IEQ A;  3WPW A;  1Q82 H;  3IMP A;  4NUT A;  3J80 M;  2H8E A;  5MN4 A;  2VGN A;  1YIT F;  1VQN F;  4O4L B;  3S0Y A;  3I56 F;  1PXW A;  3NK7 A;  4O4J A;  3JAT B;  4ZI7 B;  5JCO C;  3VYU C;  2ZF8 A;  3RYI B;  1FNJ A;  2BTQ B;  3JVH A;  2UYP A;  1GZ0 A;  4BVR A;  3HWU A;  3BYQ A;  5LYJ A;  4C8I A;  5MN5 A;  2HP3 A;  4EB6 A;  4BVQ A;  3D00 A;  4KWE A;  2YXZ A;  2VAM A;  1XHO A;  2LBT A;  5LXT B;  3NK6 A;  2HX0 A;  5JCO A;  3CG6 A;  1FNK A;  4ZK7 A;  5LA6 A;  2OTJ F;  3WJQ A;  4EI9 A;  3CMA F;  2VAP A;  4ZOL B;  5EZY A;  4O4H B;  4EI7 A;  3I7T A;  4BVT A;  1Q81 H;  2HQS C;  2LCA A;  1CLI A;  5BMV A;  1K9M H;  1YIJ F;  3KHN A;  1W3E X;  1Z5V A;  5EIB C;  1VQV A;  1NJI H;  2UZH A;  3S03 A;  3P0Z A;  1VQ6 F;  2OTM A;  3M1X A;  1FFX A;  3GHZ A;  1IPA A;  2CHT A;  3CCM F;  1E7K A;  2PHN A;  3HKD A;  1YI2 F;  5JVD A;  2AIZ P;  2I6D A;  4U3J A;  1W59 A;  5FNV B;  3VI6 A;  5G4U C;  3IKE A;  4HNA A;  3ZOP A;  3JAM M;  4ZOL A;  1IV2 A;  5KMG B;  1RQ2 A;  4TUY B;  1W42 A;  1OFU A;  1Q86 H;  1JJ2 F;  1K8A H;  3FD6 A;  2IQQ A;  3KIZ A;  3RYF A;  1W5B A;  1VH8 A;  3B6N A;  1VHA A;  4TV8 B;  2Q1X A;  1COM A;  4X20 A;  3E22 B;  5LP6 B;  3IKF A;  3VYS C;  3V7E A;  3DDN A;  3N4Z A;  2K1S A;  3I3F A;  4O4I B;  3K0T A;  3DC2 A;  3Q8H A;  5IT9 M;  3OON A;  3G4S F;  3R0P A;  1Z5W A;  1ONI A;  5KMG A;  4O4H A;  4G4X A;  3HKE B;  2KTU A;  3VO8 A;  4X3M A;  1TUB A;  1X7P A;  3N2K A;  3HKB B;  5EAZ A;  4C8E A;  5J2U A;  1SDS A;  3U0O A;  4BT4 A;  4O2A B;  3NMU C;  2CSL A;  4XCQ A;  3LME A;  3RYC A;  3JAW B;  4C4W C;  5B8F A;  3E1Y A;  3F6M A;  1IV4 A;  4X1Y A;  5C8Y A;  2HVY D;  2PMP A;  3LWQ C;  4NWO B;  4BY9 D;  3NVK E;  2UYN B;  3VMF B;  3RA5 A;  3K12 A;  3KJK A;  3RYI A;  2RHJ A;  3P10 A;  3WGM A;  2LBX A;  2DYY A;  5ITZ B;  1DBF A;  3C9R A;  5HY0 A;  1XBI A;  1J7H A;  3D01 A;  2BTU A;  2L26 A;  4BT3 A;  3LFO A;  3N2G B;  1YQN A;  4ZHW A;  4LCK A;  1W41 A;  4IHJ A;  4X1K B;  3HKB A;  3JAL A;  1PF5 A;  1H47 A;  5GIN C;  2LBW A;  2RHL A;  3M84 A;  4X3L A;  5EIB D;  3VTI C;  5IJ0 A;  3P4E A;  3WGK A;  4ZHV A;  1JY8 A;  5ITZ A;  3WJR A;  4G4V A;  5IJ9 B;  4O4I A;  3FBA A;  2DT4 A;  1YJN F;  2HP0 A;  3D54 A;  2FC3 A;  5FLX M;  2Z1U A;  3ZP4 A;  3PLA C;  5J2T B;  5GIP C;  3J81 M;  1VK3 A;  2ZVY A;  5C8Y B;  3MCA B;  3WPX A;  1YJ9 F;  1W58 1;  4X1Y B;  3S06 A;  3V4D A;  1VQ9 F;  3V3T A;  4BW0 B;  4O2A A;  1QVG F;  3LYB A;  2V9Y A;  1UI9 A;  4TV9 B;  5EB1 B;  3VCZ A;  4WBN A;  2VAW A;  3JAK B;  5IYZ B;  3LWR C;  4BT2 A;  3RYH A;  5GON B;  4E6E A;  2HRU A;  2P6Y A;  5MN6 A;  5JVD B;  3ERN A;  3CME F;  1SA0 A;  2CHS A;  3CCU F;  2CW4 A;  1GX1 A;  4LNU A;  4DRX B;  4IIJ A;  4YJ2 B;  1X52 A;  1M1K H;  2OHW A;  2Z1F A;  2GVI A;  1IV3 A;  1TVK A;  3LWV C;  3VOB A;  3OW2 F;  1VQM F;  4YJ3 A;  3K14 A;  3HKC A;  3ON1 A;  5GAN K;  2BO1 A;  4C8G A;  1RLG A;  2F9Z C;  3RYC B;  1H48 A;  2I6R A;  3ELC A;  2HS4 A;  3FD5 A;  3S0H A;  3TD4 A;  3NVI B;  4I50 A;  4U3J B;  2N48 A; 
#chains in the Genus database with same CATH homology
 1IV2 A;  3IEW A;  3JVH A;  1W57 A;  1GX1 A;  1T0A A;  1U3P A;  1YQN A;  1U40 A;  4C8E A;  2UZH A;  2AMT A;  3P0Z A;  4C8I A;  3EOR A;  1IV3 A;  3ERN A;  2GZL A;  3F0F A;  1U43 A;  3GHZ A;  5B8F A;  3MBM A;  1U3L A;  3K14 A;  3F6M A;  1IV4 A;  2PMP A;  1H47 A;  3KE1 A;  1VH8 A;  3QHD A;  1KNJ A;  3B6N A;  1VHA A;  3F0D A;  4C8G A;  3IKF A;  1JN1 A;  1H48 A;  3IEQ A;  1W55 A;  3ELC A;  3Q8H A;  4C81 A;  1JY8 A;  3ESJ A;  3FPI A;  3P10 A;  3RE3 A;  3IKE A;  1IV1 A;  3F0G A;  3T80 A;  3FBA A;  4C82 A;  3F0E A;  1KNK A;  3K2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...