3P10A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol694, 2-(thiophen-2-yl)phenyl methanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3p10A00
1U3PA 3T80A 4C82A 1IV2A 3KE1A 5B8FA 1JN1A 2PMPA 2GZLA 2UZHA 3P0ZA 4C8EA 1U40A 3P10A 1U43A 1VH8A 3F6MA 3FBAA 1IV4A 1YQNA 3IKEA 3JVHA 1IV3A 1KNJA 3ERNA 3QHDA 1H47A 1GX1A 1JY8A 4C8IA 3ESJA 3EORA 1W55A 3B6NA 1KNKA 3ELCA 3FPIA 3MBMA 3IEWA 3F0GA 1IV1A 2AMTA 4C81A 3K14A 3IKFA 3F0DA 3RE3A 3IEQA 3GHZA 3F0EA 3F0FA 1VHAA 3K2XA 1H48A 1U3LA 1T0AA 4C8GA 1W57A 3Q8HA
chains in the Genus database with same CATH superfamily
3R0PA 5LA6B 3JAKB 5FLXM 1Q81H 1QVGF 2V9YA 4KWEA 3HKEA 5A2QM 4R40B 2HX0A 4BT6A 5BMVB 3LFOA 3IR9A 4X1YB 3HJWC 5DCVA 2CVLA 1GZ0A 1KNJA 2ZODA 5JH7B 1Q82H 4I50A 2CHTA 5KMGB 1W5BA 2CZWA 4ERHA 2UYNB 3TD3A 3E22B 3K14A 3RE3A 4BVTA 3FFMA 3D00A 3CCEF 2K1SA 3KIZA 3JATA 1VQKF 3CCJF 4B5CA 2P6YA 3IMPA 4B45A 2BTOA 3N4ZA 3KE1A 3VCZA 3WGJA 5CB4A 5LP6C 4DXDA 2HS3A 1FFXA 1VQMF 1SA0A 3LWPC 3EORA 2KTUA 3JARA 5JCOC 3MQWA 3CCQF 3HWUA 4TZZA 1X52A 3VO8A 4O4IA 5EZYA 5EWRA 5EAZA 4BW0B 1R1MA 3M4SA 1H7MA 1U3LA 3V3TA 3JASA 5GIPC 2VAMA 3GYQA 3WGLA 3CPQA 1PXWA 2VGMA 1U40A 4IIJB 3F6MA 3NMUC 2H8CA 1K8AH 3JALA 5IYZA 3ON1A 1Z5WA 3LDTA 1IPAA 5GANK 3NK7A 4O4LB 2OTMA 2HVYD 1VHAA 1W5EA 2ALEA 2RB9A 5HXZA 2R6R1 5FNVB 2GVIA 2B33A 3J81M 4TV8B 5GAPK 3MDOA 4IHJB 2CW4A 1IV2A 2AIFA 2NMUA 1TVKA 3CCSF 5FJ4C 4ZI7B 3ERNA 4B62A 2Z1TA 3ZP7A 1VQNF 1OFUA 4C4WC 3WJRA 4YJ3A 3S0YA 3F0EA 3VMFB 3CCLF 5J2TB 1JFFA 2R751 1H48A 1W42A 5HXUA 3O85A 3Q8HA 3WPXA 5HP7A 5EYPA 3N4YA 4HNAA 2ZAUA 1VQ5F 3UT5A 1YJ9F 1RLUA 2VGNA 3AGKA 4BT7A 1SDSA 2IQQA 3HAXD 1DT9A 2QTPA 1IV3A 1TUBA 3J80M 2HP0B 3D54A 3RYFB 4X1IA 3MCQA 3K0TA 4M8IA 5HY1A 4F6RA 1GO1A 3HKEB 1CK2A 3OBYA 2HQSC 2I6RA 1T0AA 5LYJA 1W55A 5HY2A 4X3MA 5IJ9A 1GO0A 5LXTB 4E6EA 3HKDA 1JN1A 4BT4A 4I50B 2GZLA 4ZOLA 4YJ2B 3JCMM 1JJ2F 3FBAA 5J2UA 4C8IA 3KJJA 3B6NA 1PF5A 3CCUF 4O4JA 2ZVYA 4EI8A 3J7AR 1XV2A 3M84A 2AMTA 5C8YB 3U0OA 4B46A 3WGNA 3RA5A 3N2GB 4O2BB 5ITZA 5CB4B 3ZOPA 4I55A 1T0KB 3VTIC 3G6EF 1KQSF 4ZHWA 5G4VC 1FFXB 5B8FA 3JAWB 4U3JA 1SA0B 3SIVA 1S72F 2I6DA 3LYBA 4G4VA 4U39A 3D01A 3JARB 3QTYA 3P0ZA 4O4HA 1DBFA 3WJQA 5EZYB 1YJWF 4PWTA 4BT3A 5GIOC 1YHQF 5BMVA 3I56F 2F9ZC 3MBMA 3KHNA 3IEWA 4TUYB 4X1YA 3C9SA 1K9MH 1CN7A 2RHOA 5EB0A 5EO3A 1YITF 4ZHQA 4O2AA 5KMGA 5LP6B 1ONIA 3F0FA 1SZQA 2LBTA 5JVDA 1XBIA 4X20B 5HY0A 3HKCA 4NUTA 3K12A 3JALB 2KG4A 1Q8RA 3N2KB 3TD5A 4DRXB 4G4YA 4ZHVA 4C8EA 5IYZB 2IG8A 1VH8A 3WGKA 5KX5A 3WXMB 1ODEA 3WPWA 4TV9B 1GX1A 3V4DA 3C9UA 2WALA 3LMEA 3RYIA 3E1YA 5G4UC 3E20B 4I4TA 1TVKB 3CPWF 1UI9A 1FNKA 3C8LA 3CC4F 1VQVA 3NVKE 3SIUA 2G9IA 2DT4A 2PHNA 3P10A 2YYEA 2CWJA 2KTVA 5LOVB 3QHDA 4BT2A 3RYCA 2HS4A 3CC2F 4NQ3A 1W40A 4YJ3B 1KNKA 2Z1EA 5MN6A 1YIJF 2QI2A 2AIZP 3F0GA 3CYPB 2Q1YA 5EYPB 1VQ4F 2LCAA 2Q1XA 5IJ0A 3LWOC 1QAHA 3UT5B 2FGYA 2PMPA 2Z01A 3HTNA 3P4EA 4O4LA 1TUBB 4BY9D 4X1IB 2UZHA 3GTZA 4RHAA 3I55F 3RYHA 3JAMM 4IHJA 1M90H 4F6RB 5HWEA 3M1XA 4LNUB 4WBNA 3HKBB 3ESJA 5LYJB 5CA0A 5MN4A 2Z1FA 1XRGA 3OW2F 5IJ9B 3CYQA 1QVFF 3HKDB 2FC3A 3MCAB 3TD4A 5JQGA 1FNJA 4ZOLB 2QA4F 4C8GA 1VQ9F 5CA1A 1XHOA 4G4WA 4EI9A 3FD6A 5J2UB 2BO1A 3CB2A 1RQ2A 2HP3A 1NQ3A 5IT9M 3I7TA 1Q7YH 4LCKA 2IAFA 3LWQC 1RA4A 4O4JB 1W5FA 1Q86H 1NMUB 4X3LA 1JY8A 5ITZB 4I55B 4X1KA 4G4ZA 3JATB 4RQOA 1X7PA 4C81A 2HP0A 4U3JB 1X25A 3RYFA 3ZO8A 1W5AA 4FFBA 5EIBC 5MN5A 4O4HB 2YXZA 3VYTC 2W8BC 5GONA 2ZOVA 3VOAA 2KGWA 2VAPA 3PAFA 4EB6A 3CC7F 3CCMF 5LXTA 5LA6A 1J7HA 2CHSA 3JAKA 3JVHA 3KJKA 4O4IB 2LBXA 4O2AB 4ZHQB 4YJ2A 3CXCF 3PLAC 2H6LA 3VI6A 5JVDB 2LBWA 2OTLF 2QEXF 2Z1UA 1FSZA 2H8EA 3HKCB 3JASB 4G4XA 4XCQA 1OAPA 5JH7A 3IKFA 3IEQA 3GHZA 3WGMA 3OONA 5GINC 2MQEA 3LWVC 1W2BF 3S06A 1W581 2UYNA 5C8YA 5KX5B 1U3PA 3T80A 2RHHA 2OTJF 1JD1A 3E22A 3N2GA 4O2BA 3NVIB 2UYKA 3I3FA 4G88A 1N8RH 2HRUA 3RYIB 1IV4A 3JAWA 5EIBD 2JNBA 4NWOB 4I4TB 1M1KH 5AVMA 2RHJA 1UFYA 4BVRA 1KC8H 1ZWZA 2CSLA 4TUYA 1RLGA 3VIUA 1W57A 4BT5A 1Z5VA 5LP6A 3RYCB 2DYYA 2HRYA 4X20A 2HS0A 4ZK7A 3VOBA 2OHWA 3C9RA 3N2KA 3FD5A 4DRXA 2VXYA 5IJ0B 1VQ7F 5JCOA 1QD9A 2UYPA 3OBWA 3ELCA 1JFFB 4IIJA 3V7QA 4TV9A 4HNAB 2EWCA 3F0DA 3G4SF 3K2XA 1VK3A 3RYHB 4C82A 1COMA 1QU9A 4WBNB 3L7QA 1NJIH 1YGYA 3CCRF 5FNVA 5CA0B 1U43A 4TV8A 1YQNA 4ZHYB 4EI7A 3S0WA 3S0HA 3S02A 1KD1H 1K73H 5JQGB 1VQLF 3V7EA 2N48A 3CMAF 5CA1B 1CLIA 1W41A 1IV1A 1RQ7A 2VAWA 3CG6A 3QUWA 4ZI7A 5LOVA 3VYSC 1E7KA 1X7OA 3CCVF 3ZP4A 3C9TA 4BVSA 2BTUA 2GLZA 3RA6A 4BVQA 1YI2F 3BYQA 1YJNF 3CMEF 3NK6A 5J2TA 2L26A 1VQ6F 2ZF8A 3G71F 3DC2A 4X1KB 3VYUC 1W59A 1VQPF 2RHLA 3IKEA 3WJPA 2UYJA 1H47A 1W3EX 4FFBB 5EB1B 1VQ8F 5HP8A 3FPIA 3CD6F 2ZVZA 4LNUA 3HKBA 3S03A 1VQOF 5GONB 3DDNA 5HY4A 2BTQB 4EB6B 3LWRC 2OZBA
chains in the Genus database with same CATH topology
1U3PA 3T80A 4C82A 1IV2A 3KE1A 5B8FA 1JN1A 2PMPA 2GZLA 2UZHA 3P0ZA 4C8EA 1U40A 3P10A 1U43A 1VH8A 3F6MA 3FBAA 1IV4A 1YQNA 3IKEA 3JVHA 1IV3A 1KNJA 3ERNA 3QHDA 1H47A 1GX1A 1JY8A 4C8IA 3ESJA 3EORA 1W55A 3B6NA 1KNKA 3ELCA 3FPIA 3MBMA 3IEWA 3F0GA 1IV1A 2AMTA 4C81A 3K14A 3IKFA 3F0DA 3RE3A 3IEQA 3GHZA 3F0EA 3F0FA 1VHAA 3K2XA 1H48A 1U3LA 1T0AA 4C8GA 1W57A 3Q8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3P A;  3T80 A;  4C82 A;  1IV2 A;  3KE1 A;  5B8F A;  1JN1 A;  2PMP A;  2GZL A;  2UZH A;  3P0Z A;  4C8E A;  1U40 A;  3P10 A;  1U43 A;  1VH8 A;  3F6M A;  3FBA A;  1IV4 A;  1YQN A;  3IKE A;  3JVH A;  1IV3 A;  1KNJ A;  3ERN A;  3QHD A;  1H47 A;  1GX1 A;  1JY8 A;  4C8I A;  3ESJ A;  3EOR A;  1W55 A;  3B6N A;  1KNK A;  3ELC A;  3FPI A;  3MBM A;  3IEW A;  3F0G A;  1IV1 A;  2AMT A;  4C81 A;  3K14 A;  3IKF A;  3F0D A;  3RE3 A;  3IEQ A;  3GHZ A;  3F0E A;  3F0F A;  1VHA A;  3K2X A;  1H48 A;  1U3L A;  1T0A A;  4C8G A;  1W57 A;  3Q8H A; 
#chains in the Genus database with same CATH topology
 3R0P A;  5LA6 B;  3JAK B;  5FLX M;  1Q81 H;  1QVG F;  2V9Y A;  4KWE A;  3HKE A;  5A2Q M;  4R40 B;  2HX0 A;  4BT6 A;  5BMV B;  3LFO A;  3IR9 A;  4X1Y B;  3HJW C;  5DCV A;  2CVL A;  1GZ0 A;  1KNJ A;  2ZOD A;  5JH7 B;  1Q82 H;  4I50 A;  2CHT A;  5KMG B;  1W5B A;  2CZW A;  4ERH A;  2UYN B;  3TD3 A;  3E22 B;  3K14 A;  3RE3 A;  4BVT A;  3FFM A;  3D00 A;  3CCE F;  2K1S A;  3KIZ A;  3JAT A;  1VQK F;  3CCJ F;  4B5C A;  2P6Y A;  3IMP A;  4B45 A;  2BTO A;  3N4Z A;  3KE1 A;  3VCZ A;  3WGJ A;  5CB4 A;  5LP6 C;  4DXD A;  2HS3 A;  1FFX A;  1VQM F;  1SA0 A;  3LWP C;  3EOR A;  2KTU A;  3JAR A;  5JCO C;  3MQW A;  3CCQ F;  3HWU A;  4TZZ A;  1X52 A;  3VO8 A;  4O4I A;  5EZY A;  5EWR A;  5EAZ A;  4BW0 B;  1R1M A;  3M4S A;  1H7M A;  1U3L A;  3V3T A;  3JAS A;  5GIP C;  2VAM A;  3GYQ A;  3WGL A;  3CPQ A;  1PXW A;  2VGM A;  1U40 A;  4IIJ B;  3F6M A;  3NMU C;  2H8C A;  1K8A H;  3JAL A;  5IYZ A;  3ON1 A;  1Z5W A;  3LDT A;  1IPA A;  5GAN K;  3NK7 A;  4O4L B;  2OTM A;  2HVY D;  1VHA A;  1W5E A;  2ALE A;  2RB9 A;  5HXZ A;  2R6R 1;  5FNV B;  2GVI A;  2B33 A;  3J81 M;  4TV8 B;  5GAP K;  3MDO A;  4IHJ B;  2CW4 A;  1IV2 A;  2AIF A;  2NMU A;  1TVK A;  3CCS F;  5FJ4 C;  4ZI7 B;  3ERN A;  4B62 A;  2Z1T A;  3ZP7 A;  1VQN F;  1OFU A;  4C4W C;  3WJR A;  4YJ3 A;  3S0Y A;  3F0E A;  3VMF B;  3CCL F;  5J2T B;  1JFF A;  2R75 1;  1H48 A;  1W42 A;  5HXU A;  3O85 A;  3Q8H A;  3WPX A;  5HP7 A;  5EYP A;  3N4Y A;  4HNA A;  2ZAU A;  1VQ5 F;  3UT5 A;  1YJ9 F;  1RLU A;  2VGN A;  3AGK A;  4BT7 A;  1SDS A;  2IQQ A;  3HAX D;  1DT9 A;  2QTP A;  1IV3 A;  1TUB A;  3J80 M;  2HP0 B;  3D54 A;  3RYF B;  4X1I A;  3MCQ A;  3K0T A;  4M8I A;  5HY1 A;  4F6R A;  1GO1 A;  3HKE B;  1CK2 A;  3OBY A;  2HQS C;  2I6R A;  1T0A A;  5LYJ A;  1W55 A;  5HY2 A;  4X3M A;  5IJ9 A;  1GO0 A;  5LXT B;  4E6E A;  3HKD A;  1JN1 A;  4BT4 A;  4I50 B;  2GZL A;  4ZOL A;  4YJ2 B;  3JCM M;  1JJ2 F;  3FBA A;  5J2U A;  4C8I A;  3KJJ A;  3B6N A;  1PF5 A;  3CCU F;  4O4J A;  2ZVY A;  4EI8 A;  3J7A R;  1XV2 A;  3M84 A;  2AMT A;  5C8Y B;  3U0O A;  4B46 A;  3WGN A;  3RA5 A;  3N2G B;  4O2B B;  5ITZ A;  5CB4 B;  3ZOP A;  4I55 A;  1T0K B;  3VTI C;  3G6E F;  1KQS F;  4ZHW A;  5G4V C;  1FFX B;  5B8F A;  3JAW B;  4U3J A;  1SA0 B;  3SIV A;  1S72 F;  2I6D A;  3LYB A;  4G4V A;  4U39 A;  3D01 A;  3JAR B;  3QTY A;  3P0Z A;  4O4H A;  1DBF A;  3WJQ A;  5EZY B;  1YJW F;  4PWT A;  4BT3 A;  5GIO C;  1YHQ F;  5BMV A;  3I56 F;  2F9Z C;  3MBM A;  3KHN A;  3IEW A;  4TUY B;  4X1Y A;  3C9S A;  1K9M H;  1CN7 A;  2RHO A;  5EB0 A;  5EO3 A;  1YIT F;  4ZHQ A;  4O2A A;  5KMG A;  5LP6 B;  1ONI A;  3F0F A;  1SZQ A;  2LBT A;  5JVD A;  1XBI A;  4X20 B;  5HY0 A;  3HKC A;  4NUT A;  3K12 A;  3JAL B;  2KG4 A;  1Q8R A;  3N2K B;  3TD5 A;  4DRX B;  4G4Y A;  4ZHV A;  4C8E A;  5IYZ B;  2IG8 A;  1VH8 A;  3WGK A;  5KX5 A;  3WXM B;  1ODE A;  3WPW A;  4TV9 B;  1GX1 A;  3V4D A;  3C9U A;  2WAL A;  3LME A;  3RYI A;  3E1Y A;  5G4U C;  3E20 B;  4I4T A;  1TVK B;  3CPW F;  1UI9 A;  1FNK A;  3C8L A;  3CC4 F;  1VQV A;  3NVK E;  3SIU A;  2G9I A;  2DT4 A;  2PHN A;  3P10 A;  2YYE A;  2CWJ A;  2KTV A;  5LOV B;  3QHD A;  4BT2 A;  3RYC A;  2HS4 A;  3CC2 F;  4NQ3 A;  1W40 A;  4YJ3 B;  1KNK A;  2Z1E A;  5MN6 A;  1YIJ F;  2QI2 A;  2AIZ P;  3F0G A;  3CYP B;  2Q1Y A;  5EYP B;  1VQ4 F;  2LCA A;  2Q1X A;  5IJ0 A;  3LWO C;  1QAH A;  3UT5 B;  2FGY A;  2PMP A;  2Z01 A;  3HTN A;  3P4E A;  4O4L A;  1TUB B;  4BY9 D;  4X1I B;  2UZH A;  3GTZ A;  4RHA A;  3I55 F;  3RYH A;  3JAM M;  4IHJ A;  1M90 H;  4F6R B;  5HWE A;  3M1X A;  4LNU B;  4WBN A;  3HKB B;  3ESJ A;  5LYJ B;  5CA0 A;  5MN4 A;  2Z1F A;  1XRG A;  3OW2 F;  5IJ9 B;  3CYQ A;  1QVF F;  3HKD B;  2FC3 A;  3MCA B;  3TD4 A;  5JQG A;  1FNJ A;  4ZOL B;  2QA4 F;  4C8G A;  1VQ9 F;  5CA1 A;  1XHO A;  4G4W A;  4EI9 A;  3FD6 A;  5J2U B;  2BO1 A;  3CB2 A;  1RQ2 A;  2HP3 A;  1NQ3 A;  5IT9 M;  3I7T A;  1Q7Y H;  4LCK A;  2IAF A;  3LWQ C;  1RA4 A;  4O4J B;  1W5F A;  1Q86 H;  1NMU B;  4X3L A;  1JY8 A;  5ITZ B;  4I55 B;  4X1K A;  4G4Z A;  3JAT B;  4RQO A;  1X7P A;  4C81 A;  2HP0 A;  4U3J B;  1X25 A;  3RYF A;  3ZO8 A;  1W5A A;  4FFB A;  5EIB C;  5MN5 A;  4O4H B;  2YXZ A;  3VYT C;  2W8B C;  5GON A;  2ZOV A;  3VOA A;  2KGW A;  2VAP A;  3PAF A;  4EB6 A;  3CC7 F;  3CCM F;  5LXT A;  5LA6 A;  1J7H A;  2CHS A;  3JAK A;  3JVH A;  3KJK A;  4O4I B;  2LBX A;  4O2A B;  4ZHQ B;  4YJ2 A;  3CXC F;  3PLA C;  2H6L A;  3VI6 A;  5JVD B;  2LBW A;  2OTL F;  2QEX F;  2Z1U A;  1FSZ A;  2H8E A;  3HKC B;  3JAS B;  4G4X A;  4XCQ A;  1OAP A;  5JH7 A;  3IKF A;  3IEQ A;  3GHZ A;  3WGM A;  3OON A;  5GIN C;  2MQE A;  3LWV C;  1W2B F;  3S06 A;  1W58 1;  2UYN A;  5C8Y A;  5KX5 B;  1U3P A;  3T80 A;  2RHH A;  2OTJ F;  1JD1 A;  3E22 A;  3N2G A;  4O2B A;  3NVI B;  2UYK A;  3I3F A;  4G88 A;  1N8R H;  2HRU A;  3RYI B;  1IV4 A;  3JAW A;  5EIB D;  2JNB A;  4NWO B;  4I4T B;  1M1K H;  5AVM A;  2RHJ A;  1UFY A;  4BVR A;  1KC8 H;  1ZWZ A;  2CSL A;  4TUY A;  1RLG A;  3VIU A;  1W57 A;  4BT5 A;  1Z5V A;  5LP6 A;  3RYC B;  2DYY A;  2HRY A;  4X20 A;  2HS0 A;  4ZK7 A;  3VOB A;  2OHW A;  3C9R A;  3N2K A;  3FD5 A;  4DRX A;  2VXY A;  5IJ0 B;  1VQ7 F;  5JCO A;  1QD9 A;  2UYP A;  3OBW A;  3ELC A;  1JFF B;  4IIJ A;  3V7Q A;  4TV9 A;  4HNA B;  2EWC A;  3F0D A;  3G4S F;  3K2X A;  1VK3 A;  3RYH B;  4C82 A;  1COM A;  1QU9 A;  4WBN B;  3L7Q A;  1NJI H;  1YGY A;  3CCR F;  5FNV A;  5CA0 B;  1U43 A;  4TV8 A;  1YQN A;  4ZHY B;  4EI7 A;  3S0W A;  3S0H A;  3S02 A;  1KD1 H;  1K73 H;  5JQG B;  1VQL F;  3V7E A;  2N48 A;  3CMA F;  5CA1 B;  1CLI A;  1W41 A;  1IV1 A;  1RQ7 A;  2VAW A;  3CG6 A;  3QUW A;  4ZI7 A;  5LOV A;  3VYS C;  1E7K A;  1X7O A;  3CCV F;  3ZP4 A;  3C9T A;  4BVS A;  2BTU A;  2GLZ A;  3RA6 A;  4BVQ A;  1YI2 F;  3BYQ A;  1YJN F;  3CME F;  3NK6 A;  5J2T A;  2L26 A;  1VQ6 F;  2ZF8 A;  3G71 F;  3DC2 A;  4X1K B;  3VYU C;  1W59 A;  1VQP F;  2RHL A;  3IKE A;  3WJP A;  2UYJ A;  1H47 A;  1W3E X;  4FFB B;  5EB1 B;  1VQ8 F;  5HP8 A;  3FPI A;  3CD6 F;  2ZVZ A;  4LNU A;  3HKB A;  3S03 A;  1VQO F;  5GON B;  3DDN A;  5HY4 A;  2BTQ B;  4EB6 B;  3LWR C;  2OZB A; 
#chains in the Genus database with same CATH homology
 1U3P A;  3T80 A;  4C82 A;  1IV2 A;  3KE1 A;  5B8F A;  1JN1 A;  2PMP A;  2GZL A;  2UZH A;  3P0Z A;  4C8E A;  1U40 A;  3P10 A;  1U43 A;  1VH8 A;  3F6M A;  3FBA A;  1IV4 A;  1YQN A;  3IKE A;  3JVH A;  1IV3 A;  1KNJ A;  3ERN A;  3QHD A;  1H47 A;  1GX1 A;  1JY8 A;  4C8I A;  3ESJ A;  3EOR A;  1W55 A;  3B6N A;  1KNK A;  3ELC A;  3FPI A;  3MBM A;  3IEW A;  3F0G A;  1IV1 A;  2AMT A;  4C81 A;  3K14 A;  3IKF A;  3F0D A;  3RE3 A;  3IEQ A;  3GHZ A;  3F0E A;  3F0F A;  1VHA A;  3K2X A;  1H48 A;  1U3L A;  1T0A A;  4C8G A;  1W57 A;  3Q8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...