3P10A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol694, 2-(thiophen-2-yl)phenyl methanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Burkholderia pseudomallei
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
total genus 52
structure length 159
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3p10A00
1T0AA 3F0DA 4C8GA 5B8FA 1JY8A 2UZHA 4C8EA 4C82A 4C8IA 1GX1A 3F0EA 1YQNA 3EORA 3P0ZA 3F0FA 3P10A 3GHZA 3T80A 3FPIA 2PMPA 3F0GA 1IV2A 1H47A 1U43A 1H48A 3ELCA 3ERNA 3MBMA 3K14A 3JVHA 1U3LA 3Q8HA 3K2XA 1JN1A 1W57A 1IV1A 3ESJA 3IEWA 1IV4A 2AMTA 3IKFA 1KNJA 3FBAA 3KE1A 1U40A 1VHAA 1KNKA 3IKEA 3QHDA 3IEQA 3B6NA 3F6MA 3RE3A 4C81A 1U3PA 1IV3A 2GZLA 1W55A 1VH8A
chains in the Genus database with same CATH superfamily
1T0AA 1SA0A 2KTVA 3N2KA 1GZ0A 2HS4A 1VQOF 1VQ9F 5ITZA 3VOBA 2LBWA 4ZOLB 4G4ZA 5FNVB 2WALA 3ELCA 1YHQF 3G71F 3VIUA 4I4TB 4BT5A 3HKEB 3IKFA 3N4ZA 5KX5B 5EIBC 1FFXA 2BTOA 4IIJA 3CB2A 5A2QM 4R40B 4DXDA 5LOVA 3CCLF 3JASA 1PF5A 2KTUA 4ZHWA 1OFUA 3J7AR 2OTJF 2UZHA 2Z1FA 4EB6B 2UYKA 3JALA 4B46A 4LNUA 4YJ2A 2ALEA 4I55A 2QA4F 4NWOB 1QVGF 1W5EA 2HRUA 3WGKA 4I55B 1VQMF 3M84A 1VQVA 3MQWA 1IV1A 3J80M 3CC4F 5IT9M 4EB6A 3LDTA 1DBFA 2LBTA 4BVRA 3HAXD 3FD6A 4TZZA 2IAFA 4B62A 3RA6A 3HTNA 1X52A 5LP6A 4O2BA 3LWVC 4FFBB 3KJJA 3JAKA 3PAFA 3FD5A 2KG4A 2HVYD 4O4LB 3CCMF 3WJRA 5JH7B 3CCJF 3CPWF 2Z01A 4BT7A 1U3LA 3E20B 4G4VA 2VGMA 3LWRC 5BMVB 3K2XA 4O4JA 5EO3A 1VQPF 3IEWA 2QEXF 3WGLA 5CA1B 2HS3A 2YYEA 1S72F 2CZWA 4KWEA 2R751 3VYTC 1YIJF 1RLUA 3V7EA 1CN7A 1W55A 4ZI7B 5J2TB 3E22A 5IJ9A 2CW4A 1K73H 5HY2A 2P6YA 2QTPA 4YJ3B 4ZK7A 3FFMA 3WPXA 3CCUF 2I6RA 2CHTA 1Z5WA 3CMEF 3HKBA 4LCKA 1VHAA 1UI9A 5CA0A 4O2AB 4O4HB 3D54A 4O4IA 2ZF8A 1TUBA 5EWRA 4O2AA 1NQ3A 5DCVA 3IR9A 4O4HA 1IV2A 2FGYA 1Q86H 2VAMA 2B33A 4X20B 5JCOC 3WGNA 3ZO8A 4TV9A 3LMEA 2CHSA 3ESJA 5IYZB 2I6DA 3JALB 1W5AA 4WBNB 5JQGA 4F6RB 3S0HA 4C4WC 3RE3A 5KMGB 1VQLF 1YJWF 3CYPB 2VAPA 2RHLA 1GX1A 1NJIH 3HKDA 4X1YA 3RYCB 3F0FA 1TVKB 3N2GB 4NQ3A 4O2BB 1H47A 5EYPB 2Z1UA 3RYCA 3PLAC 2CVLA 3WXMB 3NVKE 2K1SA 2CWJA 1W57A 5LA6A 3KE1A 1IV4A 5EZYB 3FBAA 3VYUC 3LFOA 1YJ9F 3JAWA 3OW2F 2AIFA 3BYQA 4I50B 4TV8B 1W5BA 4E6EA 1SDSA 3M4SA 5HY4A 3D00A 4X1IB 3NK6A 5LP6B 2Q1YA 3F0EA 4B45A 2W8BC 3QUWA 3JAMM 3SIVA 4FFBA 4EI7A 4TV8A 3F0GA 5JVDA 1RA4A 3MCAB 3HWUA 3S03A 3N2KB 3RYIB 5ITZB 1SA0B 1JN1A 4X3LA 3QTYA 1RLGA 5J2TA 1VQ5F 2DYYA 1U40A 3GTZA 4I4TA 2MQEA 3B6NA 3HKEA 5HP8A 5FLXM 1VK3A 3CCSF 2OZBA 3CC7F 5LYJA 4HNAA 1VQ7F 3I56F 3TD5A 3LYBA 3I7TA 2VXYA 4G88A 5FNVA 3DC2A 1YQNA 3P10A 3VTIC 3T80A 2OHWA 1QD9A 2UYNB 4ZHYB 2VGNA 1TUBB 2Q1XA 5LXTB 3MBMA 2CSLA 3CPQA 5HWEA 3G4SF 4IIJB 3LWPC 1CLIA 3L7QA 4HNAB 1VQ6F 3V3TA 4RHAA 3DDNA 4DRXA 3QHDA 1FNKA 4C81A 1ONIA 1U3PA 1TVKA 2GZLA 1X25A 1VQ4F 2UYNA 5LP6C 4G4YA 3ON1A 5JCOA 1RQ7A 5JH7A 4WBNA 5JQGB 5LA6B 4O4IB 3V7QA 2DT4A 1JFFB 1OAPA 1W42A 3RYFB 1H48A 4G4WA 3S0WA 3N2GA 2UYJA 1JD1A 5J2UB 2HRYA 4BW0B 3VO8A 2G9IA 4BY9D 1JFFA 1QAHA 2FC3A 3IKEA 3VI6A 3IEQA 1FSZA 3OONA 1GO0A 3HKCA 4BT2A 2HQSC 3TD3A 4F6RA 4X1KA 3CMAF 2HS0A 4C8EA 5KMGA 4ZHVA 3OBYA 1W2BF 2HX0A 1R1MA 4X1IA 5G4VC 1ZWZA 2N48A 1KD1H 5FJ4C 2OTMA 4M8IA 3TD4A 3ZP4A 3S0YA 5CB4B 2AMTA 2UYPA 3I3FA 3CCVF 4X3MA 1KNKA 3K12A 5EB0A 5CB4A 3CG6A 1GO1A 3U0OA 3KHNA 1E7KA 4TUYB 2IG8A 5GONA 2RHHA 5KX5A 1W40A 3ZP7A 3E1YA 3NMUC 1Q82H 1K9MH 2ZOVA 2RHJA 3HKBB 3IMPA 4EI8A 1Q81H 1W5FA 2H8EA 5HY1A 1K8AH 1QU9A 2NMUA 3CC2F 5LOVB 3CD6F 2BTUA 5GANK 3G6EF 1RQ2A 1W41A 2QI2A 4ZHQB 4B5CA 1JY8A 4X1YB 1J7HA 5LXTA 3C9RA 5G4UC 4BVTA 3VOAA 1QVFF 1IPAA 3RA5A 3UT5A 1PXWA 2GVIA 3C9UA 2VAWA 3JASB 1M90H 3CCRF 5BMVA 5EZYA 3WJPA 2HP0A 3ERNA 3UT5B 3VCZA 1M1KH 1XRGA 5GIPC 1N8RH 3Q8HA 3VYSC 4IHJA 4U3JA 4O4LA 2F9ZC 3JAKB 5HP7A 4TV9B 3AGKA 1SZQA 2GLZA 3C9SA 3HKDB 3RYFA 2H8CA 1X7OA 5EB1B 5CA1A 4EI9A 5IJ0A 1UFYA 3F0DA 2HP0B 4BT3A 5GIOC 2YXZA 1JJ2F 3HJWC 5IJ0B 3VMFB 1W59A 4PWTA 4XCQA 1T0KB 3P0ZA 3HKCB 4ERHA 1DT9A 3RYHA 1U43A 1YITF 1X7PA 3V4DA 3MDOA 3JCMM 3ZOPA 4TUYA 5GONB 1COMA 1W3EX 2EWCA 3KIZA 3JATA 2IQQA 5GINC 2HP3A 3F6MA 5HXUA 1CK2A 3R0PA 3LWOC 3E22B 4YJ3A 5IJ9B 5MN4A 1VQNF 4NUTA 4C82A 3CXCF 3GYQA 2ZVZA 3JATB 3NVIB 3C9TA 3JARA 3O85A 3EORA 2ZAUA 3FPIA 5HXZA 3CYQA 1H7MA 2Z1TA 3JVHA 4ZOLA 4LNUB 2R6R1 4YJ2B 4BT4A 1Q8RA 1Z5VA 4G4XA 3I55F 1KC8H 1XBIA 2ZODA 2L26A 2OTLF 5HY0A 1Q7YH 2LBXA 1FFXB 3M1XA 3WJQA 3P4EA 5C8YA 3MCQA 3CCQF 5IYZA 2Z1EA 2LCAA 4C8IA 3LWQC 4DRXB 4ZHQA 1ODEA 5MN5A 1YJNF 1YGYA 5AVMA 4IHJB 2AIZP 3S06A 4U39A 5C8YB 4X20A 1NMUB 3GHZA 5EIBD 3KJKA 3C8LA 1W581 1VQKF 2V9YA 3S02A 3JAWB 3J81M 1XV2A 3WPWA 2BTQB 3N4YA 1KQSF 4BT6A 1XHOA 2KGWA 1VQ8F 1VH8A 2RHOA 2JNBA 4C8GA 3K0TA 5B8FA 3WGMA 2BO1A 5GAPK 1YI2F 4O4JB 2PHNA 2ZVYA 4X1KB 5MN6A 3SIUA 4RQOA 4I50A 3RYIA 2PMPA 3CCEF 3D01A 4BVSA 3K14A 2RB9A 4ZI7A 5JVDB 3WGJA 1FNJA 5CA0B 1KNJA 5EAZA 3NK7A 5LYJB 5J2UA 3JARB 5EYPA 3RYHB 2H6LA 3OBWA 4U3JB 4BVQA 1IV3A
chains in the Genus database with same CATH topology
1T0AA 3F0DA 4C8GA 5B8FA 1JY8A 2UZHA 4C8EA 4C82A 4C8IA 1GX1A 3F0EA 1YQNA 3EORA 3P0ZA 3F0FA 3P10A 3GHZA 3T80A 3FPIA 2PMPA 3F0GA 1IV2A 1H47A 1U43A 1H48A 3ELCA 3ERNA 3MBMA 3K14A 3JVHA 1U3LA 3Q8HA 3K2XA 1JN1A 1W57A 1IV1A 3ESJA 3IEWA 1IV4A 2AMTA 3IKFA 1KNJA 3FBAA 3KE1A 1U40A 1VHAA 1KNKA 3IKEA 3QHDA 3IEQA 3B6NA 3F6MA 3RE3A 4C81A 1U3PA 1IV3A 2GZLA 1W55A 1VH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0A A;  3F0D A;  4C8G A;  5B8F A;  1JY8 A;  2UZH A;  4C8E A;  4C82 A;  4C8I A;  1GX1 A;  3F0E A;  1YQN A;  3EOR A;  3P0Z A;  3F0F A;  3P10 A;  3GHZ A;  3T80 A;  3FPI A;  2PMP A;  3F0G A;  1IV2 A;  1H47 A;  1U43 A;  1H48 A;  3ELC A;  3ERN A;  3MBM A;  3K14 A;  3JVH A;  1U3L A;  3Q8H A;  3K2X A;  1JN1 A;  1W57 A;  1IV1 A;  3ESJ A;  3IEW A;  1IV4 A;  2AMT A;  3IKF A;  1KNJ A;  3FBA A;  3KE1 A;  1U40 A;  1VHA A;  1KNK A;  3IKE A;  3QHD A;  3IEQ A;  3B6N A;  3F6M A;  3RE3 A;  4C81 A;  1U3P A;  1IV3 A;  2GZL A;  1W55 A;  1VH8 A; 
#chains in the Genus database with same CATH topology
 1T0A A;  1SA0 A;  2KTV A;  3N2K A;  1GZ0 A;  2HS4 A;  1VQO F;  1VQ9 F;  5ITZ A;  3VOB A;  2LBW A;  4ZOL B;  4G4Z A;  5FNV B;  2WAL A;  3ELC A;  1YHQ F;  3G71 F;  3VIU A;  4I4T B;  4BT5 A;  3HKE B;  3IKF A;  3N4Z A;  5KX5 B;  5EIB C;  1FFX A;  2BTO A;  4IIJ A;  3CB2 A;  5A2Q M;  4R40 B;  4DXD A;  5LOV A;  3CCL F;  3JAS A;  1PF5 A;  2KTU A;  4ZHW A;  1OFU A;  3J7A R;  2OTJ F;  2UZH A;  2Z1F A;  4EB6 B;  2UYK A;  3JAL A;  4B46 A;  4LNU A;  4YJ2 A;  2ALE A;  4I55 A;  2QA4 F;  4NWO B;  1QVG F;  1W5E A;  2HRU A;  3WGK A;  4I55 B;  1VQM F;  3M84 A;  1VQV A;  3MQW A;  1IV1 A;  3J80 M;  3CC4 F;  5IT9 M;  4EB6 A;  3LDT A;  1DBF A;  2LBT A;  4BVR A;  3HAX D;  3FD6 A;  4TZZ A;  2IAF A;  4B62 A;  3RA6 A;  3HTN A;  1X52 A;  5LP6 A;  4O2B A;  3LWV C;  4FFB B;  3KJJ A;  3JAK A;  3PAF A;  3FD5 A;  2KG4 A;  2HVY D;  4O4L B;  3CCM F;  3WJR A;  5JH7 B;  3CCJ F;  3CPW F;  2Z01 A;  4BT7 A;  1U3L A;  3E20 B;  4G4V A;  2VGM A;  3LWR C;  5BMV B;  3K2X A;  4O4J A;  5EO3 A;  1VQP F;  3IEW A;  2QEX F;  3WGL A;  5CA1 B;  2HS3 A;  2YYE A;  1S72 F;  2CZW A;  4KWE A;  2R75 1;  3VYT C;  1YIJ F;  1RLU A;  3V7E A;  1CN7 A;  1W55 A;  4ZI7 B;  5J2T B;  3E22 A;  5IJ9 A;  2CW4 A;  1K73 H;  5HY2 A;  2P6Y A;  2QTP A;  4YJ3 B;  4ZK7 A;  3FFM A;  3WPX A;  3CCU F;  2I6R A;  2CHT A;  1Z5W A;  3CME F;  3HKB A;  4LCK A;  1VHA A;  1UI9 A;  5CA0 A;  4O2A B;  4O4H B;  3D54 A;  4O4I A;  2ZF8 A;  1TUB A;  5EWR A;  4O2A A;  1NQ3 A;  5DCV A;  3IR9 A;  4O4H A;  1IV2 A;  2FGY A;  1Q86 H;  2VAM A;  2B33 A;  4X20 B;  5JCO C;  3WGN A;  3ZO8 A;  4TV9 A;  3LME A;  2CHS A;  3ESJ A;  5IYZ B;  2I6D A;  3JAL B;  1W5A A;  4WBN B;  5JQG A;  4F6R B;  3S0H A;  4C4W C;  3RE3 A;  5KMG B;  1VQL F;  1YJW F;  3CYP B;  2VAP A;  2RHL A;  1GX1 A;  1NJI H;  3HKD A;  4X1Y A;  3RYC B;  3F0F A;  1TVK B;  3N2G B;  4NQ3 A;  4O2B B;  1H47 A;  5EYP B;  2Z1U A;  3RYC A;  3PLA C;  2CVL A;  3WXM B;  3NVK E;  2K1S A;  2CWJ A;  1W57 A;  5LA6 A;  3KE1 A;  1IV4 A;  5EZY B;  3FBA A;  3VYU C;  3LFO A;  1YJ9 F;  3JAW A;  3OW2 F;  2AIF A;  3BYQ A;  4I50 B;  4TV8 B;  1W5B A;  4E6E A;  1SDS A;  3M4S A;  5HY4 A;  3D00 A;  4X1I B;  3NK6 A;  5LP6 B;  2Q1Y A;  3F0E A;  4B45 A;  2W8B C;  3QUW A;  3JAM M;  3SIV A;  4FFB A;  4EI7 A;  4TV8 A;  3F0G A;  5JVD A;  1RA4 A;  3MCA B;  3HWU A;  3S03 A;  3N2K B;  3RYI B;  5ITZ B;  1SA0 B;  1JN1 A;  4X3L A;  3QTY A;  1RLG A;  5J2T A;  1VQ5 F;  2DYY A;  1U40 A;  3GTZ A;  4I4T A;  2MQE A;  3B6N A;  3HKE A;  5HP8 A;  5FLX M;  1VK3 A;  3CCS F;  2OZB A;  3CC7 F;  5LYJ A;  4HNA A;  1VQ7 F;  3I56 F;  3TD5 A;  3LYB A;  3I7T A;  2VXY A;  4G88 A;  5FNV A;  3DC2 A;  1YQN A;  3P10 A;  3VTI C;  3T80 A;  2OHW A;  1QD9 A;  2UYN B;  4ZHY B;  2VGN A;  1TUB B;  2Q1X A;  5LXT B;  3MBM A;  2CSL A;  3CPQ A;  5HWE A;  3G4S F;  4IIJ B;  3LWP C;  1CLI A;  3L7Q A;  4HNA B;  1VQ6 F;  3V3T A;  4RHA A;  3DDN A;  4DRX A;  3QHD A;  1FNK A;  4C81 A;  1ONI A;  1U3P A;  1TVK A;  2GZL A;  1X25 A;  1VQ4 F;  2UYN A;  5LP6 C;  4G4Y A;  3ON1 A;  5JCO A;  1RQ7 A;  5JH7 A;  4WBN A;  5JQG B;  5LA6 B;  4O4I B;  3V7Q A;  2DT4 A;  1JFF B;  1OAP A;  1W42 A;  3RYF B;  1H48 A;  4G4W A;  3S0W A;  3N2G A;  2UYJ A;  1JD1 A;  5J2U B;  2HRY A;  4BW0 B;  3VO8 A;  2G9I A;  4BY9 D;  1JFF A;  1QAH A;  2FC3 A;  3IKE A;  3VI6 A;  3IEQ A;  1FSZ A;  3OON A;  1GO0 A;  3HKC A;  4BT2 A;  2HQS C;  3TD3 A;  4F6R A;  4X1K A;  3CMA F;  2HS0 A;  4C8E A;  5KMG A;  4ZHV A;  3OBY A;  1W2B F;  2HX0 A;  1R1M A;  4X1I A;  5G4V C;  1ZWZ A;  2N48 A;  1KD1 H;  5FJ4 C;  2OTM A;  4M8I A;  3TD4 A;  3ZP4 A;  3S0Y A;  5CB4 B;  2AMT A;  2UYP A;  3I3F A;  3CCV F;  4X3M A;  1KNK A;  3K12 A;  5EB0 A;  5CB4 A;  3CG6 A;  1GO1 A;  3U0O A;  3KHN A;  1E7K A;  4TUY B;  2IG8 A;  5GON A;  2RHH A;  5KX5 A;  1W40 A;  3ZP7 A;  3E1Y A;  3NMU C;  1Q82 H;  1K9M H;  2ZOV A;  2RHJ A;  3HKB B;  3IMP A;  4EI8 A;  1Q81 H;  1W5F A;  2H8E A;  5HY1 A;  1K8A H;  1QU9 A;  2NMU A;  3CC2 F;  5LOV B;  3CD6 F;  2BTU A;  5GAN K;  3G6E F;  1RQ2 A;  1W41 A;  2QI2 A;  4ZHQ B;  4B5C A;  1JY8 A;  4X1Y B;  1J7H A;  5LXT A;  3C9R A;  5G4U C;  4BVT A;  3VOA A;  1QVF F;  1IPA A;  3RA5 A;  3UT5 A;  1PXW A;  2GVI A;  3C9U A;  2VAW A;  3JAS B;  1M90 H;  3CCR F;  5BMV A;  5EZY A;  3WJP A;  2HP0 A;  3ERN A;  3UT5 B;  3VCZ A;  1M1K H;  1XRG A;  5GIP C;  1N8R H;  3Q8H A;  3VYS C;  4IHJ A;  4U3J A;  4O4L A;  2F9Z C;  3JAK B;  5HP7 A;  4TV9 B;  3AGK A;  1SZQ A;  2GLZ A;  3C9S A;  3HKD B;  3RYF A;  2H8C A;  1X7O A;  5EB1 B;  5CA1 A;  4EI9 A;  5IJ0 A;  1UFY A;  3F0D A;  2HP0 B;  4BT3 A;  5GIO C;  2YXZ A;  1JJ2 F;  3HJW C;  5IJ0 B;  3VMF B;  1W59 A;  4PWT A;  4XCQ A;  1T0K B;  3P0Z A;  3HKC B;  4ERH A;  1DT9 A;  3RYH A;  1U43 A;  1YIT F;  1X7P A;  3V4D A;  3MDO A;  3JCM M;  3ZOP A;  4TUY A;  5GON B;  1COM A;  1W3E X;  2EWC A;  3KIZ A;  3JAT A;  2IQQ A;  5GIN C;  2HP3 A;  3F6M A;  5HXU A;  1CK2 A;  3R0P A;  3LWO C;  3E22 B;  4YJ3 A;  5IJ9 B;  5MN4 A;  1VQN F;  4NUT A;  4C82 A;  3CXC F;  3GYQ A;  2ZVZ A;  3JAT B;  3NVI B;  3C9T A;  3JAR A;  3O85 A;  3EOR A;  2ZAU A;  3FPI A;  5HXZ A;  3CYQ A;  1H7M A;  2Z1T A;  3JVH A;  4ZOL A;  4LNU B;  2R6R 1;  4YJ2 B;  4BT4 A;  1Q8R A;  1Z5V A;  4G4X A;  3I55 F;  1KC8 H;  1XBI A;  2ZOD A;  2L26 A;  2OTL F;  5HY0 A;  1Q7Y H;  2LBX A;  1FFX B;  3M1X A;  3WJQ A;  3P4E A;  5C8Y A;  3MCQ A;  3CCQ F;  5IYZ A;  2Z1E A;  2LCA A;  4C8I A;  3LWQ C;  4DRX B;  4ZHQ A;  1ODE A;  5MN5 A;  1YJN F;  1YGY A;  5AVM A;  4IHJ B;  2AIZ P;  3S06 A;  4U39 A;  5C8Y B;  4X20 A;  1NMU B;  3GHZ A;  5EIB D;  3KJK A;  3C8L A;  1W58 1;  1VQK F;  2V9Y A;  3S02 A;  3JAW B;  3J81 M;  1XV2 A;  3WPW A;  2BTQ B;  3N4Y A;  1KQS F;  4BT6 A;  1XHO A;  2KGW A;  1VQ8 F;  1VH8 A;  2RHO A;  2JNB A;  4C8G A;  3K0T A;  5B8F A;  3WGM A;  2BO1 A;  5GAP K;  1YI2 F;  4O4J B;  2PHN A;  2ZVY A;  4X1K B;  5MN6 A;  3SIU A;  4RQO A;  4I50 A;  3RYI A;  2PMP A;  3CCE F;  3D01 A;  4BVS A;  3K14 A;  2RB9 A;  4ZI7 A;  5JVD B;  3WGJ A;  1FNJ A;  5CA0 B;  1KNJ A;  5EAZ A;  3NK7 A;  5LYJ B;  5J2U A;  3JAR B;  5EYP A;  3RYH B;  2H6L A;  3OBW A;  4U3J B;  4BVQ A;  1IV3 A; 
#chains in the Genus database with same CATH homology
 1T0A A;  3F0D A;  4C8G A;  5B8F A;  1JY8 A;  2UZH A;  4C8E A;  4C82 A;  4C8I A;  1GX1 A;  3F0E A;  1YQN A;  3EOR A;  3P0Z A;  3F0F A;  3P10 A;  3GHZ A;  3T80 A;  3FPI A;  2PMP A;  3F0G A;  1IV2 A;  1H47 A;  1U43 A;  1H48 A;  3ELC A;  3ERN A;  3MBM A;  3K14 A;  3JVH A;  1U3L A;  3Q8H A;  3K2X A;  1JN1 A;  1W57 A;  1IV1 A;  3ESJ A;  3IEW A;  1IV4 A;  2AMT A;  3IKF A;  1KNJ A;  3FBA A;  3KE1 A;  1U40 A;  1VHA A;  1KNK A;  3IKE A;  3QHD A;  3IEQ A;  3B6N A;  3F6M A;  3RE3 A;  4C81 A;  1U3P A;  1IV3 A;  2GZL A;  1W55 A;  1VH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...