1KD1H

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kd1H00
3CCQF 3JCMM 5A2QM 5GIPC 3CCSF 2OHWA 3G4SF 3E20B 3LWOC 3CPQA 5GINC 1JJ2F 1VQ5F 3CPWF 1Q81H 3IR9A 1N8RH 1ZWZA 3I55F 1GO0A 1K73H 5FJ4C 3CCEF 5EO3A 3OBYA 3N4YA 4X3MA 3SIUA 3ON1A 3CCRF 3AGKA 3CMAF 1M1KH 1S72F 1VQOF 5GIOC 1K8AH 3JAMM 1QVFF 1SDSA 3LWRC 2LBXA 3NK7A 4NUTA 1YHQF 3CMEF 2HVYD 1M90H 1VQ7F 1E7KA 3J81M 3LWQC 3CCMF 1GZ0A 3J80M 1KD1H 1K9MH 1KQSF 1YITF 1KC8H 2WALA 2KTUA 3OBWA 3WXMB 1W2BF 1QVGF 3CCLF 5GANK 2ALEA 1VQKF 2VGNA 2JNBA 2KTVA 3G71F 1W3EX 1VQLF 3CCJF 1W41A 2FC3A 3PAFA 1RA4A 2OTLF 2LBWA 2CZWA 3CCVF 1Q7YH 3MCAB 4C4WC 3N4ZA 3O85A 1W42A 1VQ4F 2I6DA 1W40A 2QI2A 1XBIA 1NMUB 3CCUF 3LWPC 5FLXM 4X3LA 1CN7A 3HAXD 2VGMA 1H7MA 3SIVA 1RLGA 5EWRA 2KG4A 1T0KB 5DCVA 5G4VC 1YJ9F 2OTJF 5GAPK 2BO1A 1VQNF 3J7AR 3NVKE 3CC7F 3NMUC 1YI2F 3FFMA 3CXCF 3OW2F 1VQ9F 3CG6A 3I56F 1YJWF 3RA5A 3E1YA 2AIFA 3CC2F 3VI6A 2QA4F 1YIJF 1VQPF 1IPAA 3V7QA 5G4UC 1VQ6F 4BY9D 1CK2A 1NJIH 1VQMF 1YJNF 1Q82H 1PXWA 3LFOA 1Q86H 3NVIB 3VMFB 1VQ8F 3GYQA 3LWVC 4BW0B 3PLAC 1X7PA 1X7OA 3V7EA 2OZBA 1GO1A 3RA6A 3CC4F 3NK6A 3G6EF 5IT9M 2QEXF 4LCKA 3CD6F 4TZZA 1DT9A 1X52A 3HJWC
chains in the Genus database with same CATH superfamily
3CCQF 4BT7A 4X20A 3LYBA 5GIPC 2OHWA 2Z1UA 3E20B 2H6LA 4O4LA 5HXUA 1JJ2F 3CPWF 2RHLA 1PF5A 4ZI7B 1IV4A 3OBYA 1VK3A 3N4YA 3CYPB 4ZHWA 2VXYA 4I4TB 2CHSA 4C8GA 3JAMM 1K8AH 4O4IB 4XCQA 4IIJA 2LBXA 3WPWA 3HKDB 4BVSA 3CMEF 2HVYD 1VQ7F 3WGJA 1E7KA 3LWQC 4B62A 4O4HB 4G4XA 4X1IA 5GONA 2HQSC 2HX0A 2ZODA 5J2TB 2KTUA 3C9SA 2YYEA 4TV8B 3WXMB 5GANK 4G4VA 3WJPA 2N48A 2KTVA 3E22A 2GVIA 2Z1EA 4F6RA 3PAFA 1NQ3A 3HKBA 3D01A 5MN5A 1RA4A 2OTLF 3D54A 1YQNA 5C8YB 1Q7YH 3HKEA 3RE3A 3S0YA 4C4WC 3N4ZA 5FNVA 2PHNA 1W5BA 5JQGA 2I6DA 1JN1A 1XBIA 3TD4A 3MQWA 1YGYA 5CA0B 2ZAUA 2GZLA 3U0OA 5FLXM 1W581 1W5FA 5LYJA 1RLGA 5LP6A 5LXTB 3OONA 4DXDA 1T0KB 2DT4A 3F0FA 5G4VC 3C9TA 1UI9A 2UYNA 5EB1B 2BTUA 2CSLA 1VQNF 5JVDA 3NMUC 4BVQA 3N2GA 4O2BA 4PWTA 1FNJA 1FNKA 2HP3A 3QHDA 3E1YA 5LOVB 2QA4F 3JALA 5G4UC 3FBAA 3WGLA 1X25A 3B6NA 3F0EA 4E6EA 1SA0A 5IYZB 2MQEA 1VQMF 3C8LA 3I3FA 5HWEA 3K14A 4I50A 4YJ2B 3LFOA 4BVTA 1JFFB 3BYQA 4X1YA 2VAPA 3GYQA 4R40B 1U43A 3V7EA 3HKDA 3GTZA 4KWEA 3RA6A 2I6RA 2HS0A 1COMA 3C9UA 3NK6A 3JAWB 4C8IA 4X1IB 5GONB 5LA6B 5CB4A 4X1KB 4TZZA 1DT9A 3RYHB 2ZF8A 4FFBA 3RYIA 2RHOA 4BVRA 4F6RB 3JCMM 3HKBB 1IV3A 3G4SF 3LWOC 3MCQA 2HP0A 3M1XA 5C8YA 4X20B 3IEWA 1JD1A 3UT5A 2LCAA 4WBNB 2CW4A 4ZHQB 1GO0A 5EO3A 1QD9A 4ZOLB 3VOAA 5J2UB 3CMAF 1M1KH 3ESJA 3FD6A 5GIOC 2L26A 3LWRC 3ZP7A 4NUTA 4O4IA 1YHQF 1DBFA 1KD1H 1K9MH 1KQSF 1W59A 4U3JB 3FD5A 1FFXB 1W55A 1QVGF 5JVDB 2HRYA 2JNBA 3M84A 3HKCA 3G71F 3JATA 3WGNA 1W41A 2FC3A 5JH7A 2UZHA 3HTNA 3IKFA 3IKEA 2LBWA 3CCVF 3ELCA 1SA0B 5IJ0B 2UYJA 3HKEB 1CLIA 1W40A 4RQOA 3JASB 3LWPC 4DRXA 1XHOA 5HP7A 3IEQA 5IJ9B 5ITZB 1TUBB 3MBMA 1FSZA 3SIVA 3V3TA 1VHAA 3KIZA 3S03A 4O4JB 5DCVA 1R1MA 5EAZA 3ERNA 3JARA 2P6YA 3P0ZA 4M8IA 2BO1A 3NVKE 4G4ZA 3VYSC 1VQVA 3OW2F 3RYFB 1IV2A 3N2GB 3RA5A 1UFYA 5KX5A 2G9IA 3F0GA 3VI6A 4C82A 1YIJF 3E22B 1ODEA 5JCOC 3RYCB 3K12A 3LDTA 3LMEA 2AIZP 4O4LB 3C9RA 1Q86H 3NVIB 1T0AA 3VMFB 2ZOVA 3PLAC 1X7OA 2QTPA 1GO1A 1RQ2A 4ERHA 3KE1A 4ZHYB 2IAFA 3JAKB 3EORA 5EIBC 4U3JA 1QU9A 3ZO8A 4TV9A 2ZVZA 5IT9M 1FFXA 2QEXF 4IHJA 2Z1FA 4B45A 5HP8A 1X52A 3WGMA 4X1KA 3VO8A 3MDOA 4HNAA 5BMVA 5A2QM 1Z5VA 3CCSF 2EWCA 1Q81H 1SZQA 1ZWZA 4TV8A 2RHJA 4O2BB 1K73H 5FJ4C 3CCEF 5CA1B 3SIUA 3CCRF 3AGKA 4NWOB 3K2XA 2RHHA 5EYPA 4BT5A 4LNUA 1QVFF 1KNKA 1M90H 1GX1A 4C81A 5JQGB 1GZ0A 3WJQA 5KMGB 1KC8H 4BT4A 2WALA 4ZI7A 5JCOA 3D00A 4I55B 2K1SA 3S0WA 4BT3A 1TVKB 2ALEA 2W8BC 2VGNA 1VQLF 4EI7A 2DYYA 3CYQA 3QTYA 2B33A 4B46A 5MN6A 2CZWA 1U3PA 4TUYA 2UYNB 1W42A 1H47A 1OAPA 3CCUF 3IMPA 4G4YA 3N2KA 4EB6A 2F9ZC 4ZOLA 3VCZA 5EWRA 5J2UA 2KG4A 2HS4A 2Z01A 3WJRA 4TV9B 2RB9A 2OTJF 5GAPK 4EI9A 3J7AR 3VOBA 3JARB 3CC7F 1YI2F 3FFMA 4O2AB 1XV2A 3CXCF 4HNAB 5BMVB 3ZP4A 5CA0A 3I56F 3TD5A 2ZVYA 1W5AA 2VAMA 3CB2A 1J7HA 5LA6A 2BTQB 5LYJB 1IPAA 5AVMA 3V7QA 3ZOPA 4IIJB 4NQ3A 5JH7B 3RYCA 5EYPB 4B5CA 2UYPA 1PXWA 4O4HA 4U39A 2Q1YA 5IJ0A 2VAWA 3GHZA 2FGYA 1X7PA 5EZYA 2OZBA 3KHNA 1ONIA 4DRXB 1Z5WA 3F6MA 3G6EF 3TD3A 5IJ9A 5ITZA 1TUBA 5LOVA 2R6R1 3WGKA 3KJKA 3JALB 5EB0A 2KGWA 2Q1XA 4LCKA 4I55A 3S02A 4O4JA 4G88A 3T80A 5B8FA 3HJWC 5IYZA 4IHJB 4I50B 4YJ2A 1VQ5F 3CPQA 5GINC 3S06A 3IR9A 1N8RH 5HY0A 4TUYB 3I55F 4ZHVA 4X3MA 4YJ3B 4I4TA 2HRUA 3ON1A 1IV1A 5LXTA 5CA1A 1U3LA 3DC2A 3HWUA 1S72F 1VQOF 2LBTA 1SDSA 3JVHA 4EB6B 3RYHA 4LNUB 3NK7A 2AMTA 3J81M 1OFUA 5HY4A 3CCMF 3J80M 2PMPA 3QUWA 2BTOA 2GLZA 1YITF 3VYUC 3OBWA 3UT5B 3Q8HA 4RHAA 4BT2A 4ZHQA 5KMGA 1W2BF 3F0DA 3CCLF 3P10A 1VQKF 3JAKA 1W3EX 3CCJF 1TVKA 1W5EA 4ZK7A 1RQ7A 3FPIA 3KJJA 4BT6A 2NMUA 3I7TA 3MCAB 3DDNA 3P4EA 2YXZA 3O85A 4X1YB 1VQ4F 2QI2A 3VYTC 1NMUB 1VH8A 2UYKA 4X3LA 3S0HA 1CN7A 5LP6B 1Q8RA 1U40A 5LP6C 3HAXD 5EIBD 2VGMA 1H7MA 3N2KB 3WPXA 3JATB 1QAHA 2Z1TA 3L7QA 4C8EA 3VTIC 4EI8A 2H8EA 5J2TA 1YJ9F 2HP0B 3K0TA 4WBNA 3JASA 2R751 5HY1A 1VQ9F 3CG6A 2H8CA 2IQQA 4O2AA 1YJWF 1H48A 2V9YA 4G4WA 1XRGA 1RLUA 2AIFA 2CHTA 3CC2F 5HY2A 1VQPF 1KNJA 5FNVB 1VQ6F 2OTMA 4YJ3A 4BY9D 1CK2A 1NJIH 1JFFA 2CWJA 1YJNF 1Q82H 1VQ8F 5MN4A 4BW0B 3LWVC 3V4DA 2IG8A 1JY8A 3JAWA 2HS3A 3RYFA 1W57A 3CC4F 5CB4B 5EZYB 3HKCB 5KX5B 2CVLA 3M4SA 3VIUA 3R0PA 5HXZA 4FFBB 3RYIB 3CD6F
chains in the Genus database with same CATH topology
4BVRA 3CCQF 3JCMM 5A2QM 5GIPC 3CCSF 2OHWA 3G4SF 3E20B 3LWOC 3CPQA 5HXUA 5GINC 1JJ2F 3CPWF 1VQ5F 1Q81H 3IR9A 1N8RH 1ZWZA 5HY0A 3I55F 1GO0A 1K73H 5FJ4C 3CCEF 5EO3A 3OBYA 3N4YA 4X3MA 3SIUA 3ON1A 3CCRF 3AGKA 3CMAF 1M1KH 1S72F 1VQOF 5GIOC 1K8AH 3JAMM 1QVFF 1SDSA 4XCQA 3LWRC 2LBXA 3NK7A 4NUTA 4BVSA 1YHQF 3CMEF 2HVYD 1M90H 1VQ7F 1E7KA 3J81M 3LWQC 3CCMF 5HY4A 1GZ0A 3J80M 1KD1H 1K9MH 1KQSF 2GLZA 1YITF 1KC8H 2WALA 2KTUA 3OBWA 3WXMB 3D00A 1W2BF 1QVGF 3CCLF 5GANK 2ALEA 1VQKF 2VGNA 2JNBA 2KTVA 3G71F 1W3EX 1VQLF 3CCJF 4EI7A 1W41A 2FC3A 3PAFA 1RA4A 2OTLF 2LBWA 2CZWA 3CCVF 1Q7YH 3MCAB 4C4WC 3N4ZA 3O85A 1W42A 1VQ4F 2I6DA 1W40A 2QI2A 1XBIA 1NMUB 3CCUF 3LWPC 5FLXM 4X3LA 1CN7A 3HAXD 2VGMA 2F9ZC 1H7MA 3SIVA 1RLGA 5EWRA 3V3TA 2KG4A 1T0KB 5DCVA 5G4VC 4EI8A 1YJ9F 2OTJF 5GAPK 2BO1A 1VQNF 4EI9A 3J7AR 3CC7F 3NMUC 3NVKE 1YI2F 3FFMA 4BVQA 3CXCF 3OW2F 5HY1A 1VQ9F 3CG6A 3I56F 1YJWF 3RA5A 3E1YA 2AIFA 3CC2F 3VI6A 2QA4F 5HY2A 1VQPF 1IPAA 3V7QA 1YIJF 5G4UC 1VQ6F 4NQ3A 4BY9D 1CK2A 1NJIH 1VQMF 1YJNF 5HWEA 1Q82H 1PXWA 3LFOA 4BVTA 1Q86H 3NVIB 3VMFB 1VQ8F 3GYQA 3LWVC 4BW0B 2FGYA 3PLAC 1X7PA 1X7OA 3V7EA 2OZBA 1GO1A 3RA6A 3CC4F 3NK6A 3G6EF 5HXZA 5IT9M 2QEXF 4LCKA 3CD6F 4TZZA 1DT9A 1X52A 3HJWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ F;  3JCM M;  5A2Q M;  5GIP C;  3CCS F;  2OHW A;  3G4S F;  3E20 B;  3LWO C;  3CPQ A;  5GIN C;  1JJ2 F;  1VQ5 F;  3CPW F;  1Q81 H;  3IR9 A;  1N8R H;  1ZWZ A;  3I55 F;  1GO0 A;  1K73 H;  5FJ4 C;  3CCE F;  5EO3 A;  3OBY A;  3N4Y A;  4X3M A;  3SIU A;  3ON1 A;  3CCR F;  3AGK A;  3CMA F;  1M1K H;  1S72 F;  1VQO F;  5GIO C;  1K8A H;  3JAM M;  1QVF F;  1SDS A;  3LWR C;  2LBX A;  3NK7 A;  4NUT A;  1YHQ F;  3CME F;  2HVY D;  1M90 H;  1VQ7 F;  1E7K A;  3J81 M;  3LWQ C;  3CCM F;  1GZ0 A;  3J80 M;  1KD1 H;  1K9M H;  1KQS F;  1YIT F;  1KC8 H;  2WAL A;  2KTU A;  3OBW A;  3WXM B;  1W2B F;  1QVG F;  3CCL F;  5GAN K;  2ALE A;  1VQK F;  2VGN A;  2JNB A;  2KTV A;  3G71 F;  1W3E X;  1VQL F;  3CCJ F;  1W41 A;  2FC3 A;  3PAF A;  1RA4 A;  2OTL F;  2LBW A;  2CZW A;  3CCV F;  1Q7Y H;  3MCA B;  4C4W C;  3N4Z A;  3O85 A;  1W42 A;  1VQ4 F;  2I6D A;  1W40 A;  2QI2 A;  1XBI A;  1NMU B;  3CCU F;  3LWP C;  5FLX M;  4X3L A;  1CN7 A;  3HAX D;  2VGM A;  1H7M A;  3SIV A;  1RLG A;  5EWR A;  2KG4 A;  1T0K B;  5DCV A;  5G4V C;  1YJ9 F;  2OTJ F;  5GAP K;  2BO1 A;  1VQN F;  3J7A R;  3NVK E;  3CC7 F;  3NMU C;  1YI2 F;  3FFM A;  3CXC F;  3OW2 F;  1VQ9 F;  3CG6 A;  3I56 F;  1YJW F;  3RA5 A;  3E1Y A;  2AIF A;  3CC2 F;  3VI6 A;  2QA4 F;  1YIJ F;  1VQP F;  1IPA A;  3V7Q A;  5G4U C;  1VQ6 F;  4BY9 D;  1CK2 A;  1NJI H;  1VQM F;  1YJN F;  1Q82 H;  1PXW A;  3LFO A;  1Q86 H;  3NVI B;  3VMF B;  1VQ8 F;  3GYQ A;  3LWV C;  4BW0 B;  3PLA C;  1X7P A;  1X7O A;  3V7E A;  2OZB A;  1GO1 A;  3RA6 A;  3CC4 F;  3NK6 A;  3G6E F;  5IT9 M;  2QEX F;  4LCK A;  3CD6 F;  4TZZ A;  1DT9 A;  1X52 A;  3HJW C; 
#chains in the Genus database with same CATH topology
 3CCQ F;  4BT7 A;  4X20 A;  3LYB A;  5GIP C;  2OHW A;  2Z1U A;  3E20 B;  2H6L A;  4O4L A;  5HXU A;  1JJ2 F;  3CPW F;  2RHL A;  1PF5 A;  4ZI7 B;  1IV4 A;  3OBY A;  1VK3 A;  3N4Y A;  3CYP B;  4ZHW A;  2VXY A;  4I4T B;  2CHS A;  4C8G A;  3JAM M;  1K8A H;  4O4I B;  4XCQ A;  4IIJ A;  2LBX A;  3WPW A;  3HKD B;  4BVS A;  3CME F;  2HVY D;  1VQ7 F;  3WGJ A;  1E7K A;  3LWQ C;  4B62 A;  4O4H B;  4G4X A;  4X1I A;  5GON A;  2HQS C;  2HX0 A;  2ZOD A;  5J2T B;  2KTU A;  3C9S A;  2YYE A;  4TV8 B;  3WXM B;  5GAN K;  4G4V A;  3WJP A;  2N48 A;  2KTV A;  3E22 A;  2GVI A;  2Z1E A;  4F6R A;  3PAF A;  1NQ3 A;  3HKB A;  3D01 A;  5MN5 A;  1RA4 A;  2OTL F;  3D54 A;  1YQN A;  5C8Y B;  1Q7Y H;  3HKE A;  3RE3 A;  3S0Y A;  4C4W C;  3N4Z A;  5FNV A;  2PHN A;  1W5B A;  5JQG A;  2I6D A;  1JN1 A;  1XBI A;  3TD4 A;  3MQW A;  1YGY A;  5CA0 B;  2ZAU A;  2GZL A;  3U0O A;  5FLX M;  1W58 1;  1W5F A;  5LYJ A;  1RLG A;  5LP6 A;  5LXT B;  3OON A;  4DXD A;  1T0K B;  2DT4 A;  3F0F A;  5G4V C;  3C9T A;  1UI9 A;  2UYN A;  5EB1 B;  2BTU A;  2CSL A;  1VQN F;  5JVD A;  3NMU C;  4BVQ A;  3N2G A;  4O2B A;  4PWT A;  1FNJ A;  1FNK A;  2HP3 A;  3QHD A;  3E1Y A;  5LOV B;  2QA4 F;  3JAL A;  5G4U C;  3FBA A;  3WGL A;  1X25 A;  3B6N A;  3F0E A;  4E6E A;  1SA0 A;  5IYZ B;  2MQE A;  1VQM F;  3C8L A;  3I3F A;  5HWE A;  3K14 A;  4I50 A;  4YJ2 B;  3LFO A;  4BVT A;  1JFF B;  3BYQ A;  4X1Y A;  2VAP A;  3GYQ A;  4R40 B;  1U43 A;  3V7E A;  3HKD A;  3GTZ A;  4KWE A;  3RA6 A;  2I6R A;  2HS0 A;  1COM A;  3C9U A;  3NK6 A;  3JAW B;  4C8I A;  4X1I B;  5GON B;  5LA6 B;  5CB4 A;  4X1K B;  4TZZ A;  1DT9 A;  3RYH B;  2ZF8 A;  4FFB A;  3RYI A;  2RHO A;  4BVR A;  4F6R B;  3JCM M;  3HKB B;  1IV3 A;  3G4S F;  3LWO C;  3MCQ A;  2HP0 A;  3M1X A;  5C8Y A;  4X20 B;  3IEW A;  1JD1 A;  3UT5 A;  2LCA A;  4WBN B;  2CW4 A;  4ZHQ B;  1GO0 A;  5EO3 A;  1QD9 A;  4ZOL B;  3VOA A;  5J2U B;  3CMA F;  1M1K H;  3ESJ A;  3FD6 A;  5GIO C;  2L26 A;  3LWR C;  3ZP7 A;  4NUT A;  4O4I A;  1YHQ F;  1DBF A;  1KD1 H;  1K9M H;  1KQS F;  1W59 A;  4U3J B;  3FD5 A;  1FFX B;  1W55 A;  1QVG F;  5JVD B;  2HRY A;  2JNB A;  3M84 A;  3HKC A;  3G71 F;  3JAT A;  3WGN A;  1W41 A;  2FC3 A;  5JH7 A;  2UZH A;  3HTN A;  3IKF A;  3IKE A;  2LBW A;  3CCV F;  3ELC A;  1SA0 B;  5IJ0 B;  2UYJ A;  3HKE B;  1CLI A;  1W40 A;  4RQO A;  3JAS B;  3LWP C;  4DRX A;  1XHO A;  5HP7 A;  3IEQ A;  5IJ9 B;  5ITZ B;  1TUB B;  3MBM A;  1FSZ A;  3SIV A;  3V3T A;  1VHA A;  3KIZ A;  3S03 A;  4O4J B;  5DCV A;  1R1M A;  5EAZ A;  3ERN A;  3JAR A;  2P6Y A;  3P0Z A;  4M8I A;  2BO1 A;  3NVK E;  4G4Z A;  3VYS C;  1VQV A;  3OW2 F;  3RYF B;  1IV2 A;  3N2G B;  3RA5 A;  1UFY A;  5KX5 A;  2G9I A;  3F0G A;  3VI6 A;  4C82 A;  1YIJ F;  3E22 B;  1ODE A;  5JCO C;  3RYC B;  3K12 A;  3LDT A;  3LME A;  2AIZ P;  4O4L B;  3C9R A;  1Q86 H;  3NVI B;  1T0A A;  3VMF B;  2ZOV A;  3PLA C;  1X7O A;  2QTP A;  1GO1 A;  1RQ2 A;  4ERH A;  3KE1 A;  4ZHY B;  2IAF A;  3JAK B;  3EOR A;  5EIB C;  4U3J A;  1QU9 A;  3ZO8 A;  4TV9 A;  2ZVZ A;  5IT9 M;  1FFX A;  2QEX F;  4IHJ A;  2Z1F A;  4B45 A;  5HP8 A;  1X52 A;  3WGM A;  4X1K A;  3VO8 A;  3MDO A;  4HNA A;  5BMV A;  5A2Q M;  1Z5V A;  3CCS F;  2EWC A;  1Q81 H;  1SZQ A;  1ZWZ A;  4TV8 A;  2RHJ A;  4O2B B;  1K73 H;  5FJ4 C;  3CCE F;  5CA1 B;  3SIU A;  3CCR F;  3AGK A;  4NWO B;  3K2X A;  2RHH A;  5EYP A;  4BT5 A;  4LNU A;  1QVF F;  1KNK A;  1M90 H;  1GX1 A;  4C81 A;  5JQG B;  1GZ0 A;  3WJQ A;  5KMG B;  1KC8 H;  4BT4 A;  2WAL A;  4ZI7 A;  5JCO A;  3D00 A;  4I55 B;  2K1S A;  3S0W A;  4BT3 A;  1TVK B;  2ALE A;  2W8B C;  2VGN A;  1VQL F;  4EI7 A;  2DYY A;  3CYQ A;  3QTY A;  2B33 A;  4B46 A;  5MN6 A;  2CZW A;  1U3P A;  4TUY A;  2UYN B;  1W42 A;  1H47 A;  1OAP A;  3CCU F;  3IMP A;  4G4Y A;  3N2K A;  4EB6 A;  2F9Z C;  4ZOL A;  3VCZ A;  5EWR A;  5J2U A;  2KG4 A;  2HS4 A;  2Z01 A;  3WJR A;  4TV9 B;  2RB9 A;  2OTJ F;  5GAP K;  4EI9 A;  3J7A R;  3VOB A;  3JAR B;  3CC7 F;  1YI2 F;  3FFM A;  4O2A B;  1XV2 A;  3CXC F;  4HNA B;  5BMV B;  3ZP4 A;  5CA0 A;  3I56 F;  3TD5 A;  2ZVY A;  1W5A A;  2VAM A;  3CB2 A;  1J7H A;  5LA6 A;  2BTQ B;  5LYJ B;  1IPA A;  5AVM A;  3V7Q A;  3ZOP A;  4IIJ B;  4NQ3 A;  5JH7 B;  3RYC A;  5EYP B;  4B5C A;  2UYP A;  1PXW A;  4O4H A;  4U39 A;  2Q1Y A;  5IJ0 A;  2VAW A;  3GHZ A;  2FGY A;  1X7P A;  5EZY A;  2OZB A;  3KHN A;  1ONI A;  4DRX B;  1Z5W A;  3F6M A;  3G6E F;  3TD3 A;  5IJ9 A;  5ITZ A;  1TUB A;  5LOV A;  2R6R 1;  3WGK A;  3KJK A;  3JAL B;  5EB0 A;  2KGW A;  2Q1X A;  4LCK A;  4I55 A;  3S02 A;  4O4J A;  4G88 A;  3T80 A;  5B8F A;  3HJW C;  5IYZ A;  4IHJ B;  4I50 B;  4YJ2 A;  1VQ5 F;  3CPQ A;  5GIN C;  3S06 A;  3IR9 A;  1N8R H;  5HY0 A;  4TUY B;  3I55 F;  4ZHV A;  4X3M A;  4YJ3 B;  4I4T A;  2HRU A;  3ON1 A;  1IV1 A;  5LXT A;  5CA1 A;  1U3L A;  3DC2 A;  3HWU A;  1S72 F;  1VQO F;  2LBT A;  1SDS A;  3JVH A;  4EB6 B;  3RYH A;  4LNU B;  3NK7 A;  2AMT A;  3J81 M;  1OFU A;  5HY4 A;  3CCM F;  3J80 M;  2PMP A;  3QUW A;  2BTO A;  2GLZ A;  1YIT F;  3VYU C;  3OBW A;  3UT5 B;  3Q8H A;  4RHA A;  4BT2 A;  4ZHQ A;  5KMG A;  1W2B F;  3F0D A;  3CCL F;  3P10 A;  1VQK F;  3JAK A;  1W3E X;  3CCJ F;  1TVK A;  1W5E A;  4ZK7 A;  1RQ7 A;  3FPI A;  3KJJ A;  4BT6 A;  2NMU A;  3I7T A;  3MCA B;  3DDN A;  3P4E A;  2YXZ A;  3O85 A;  4X1Y B;  1VQ4 F;  2QI2 A;  3VYT C;  1NMU B;  1VH8 A;  2UYK A;  4X3L A;  3S0H A;  1CN7 A;  5LP6 B;  1Q8R A;  1U40 A;  5LP6 C;  3HAX D;  5EIB D;  2VGM A;  1H7M A;  3N2K B;  3WPX A;  3JAT B;  1QAH A;  2Z1T A;  3L7Q A;  4C8E A;  3VTI C;  4EI8 A;  2H8E A;  5J2T A;  1YJ9 F;  2HP0 B;  3K0T A;  4WBN A;  3JAS A;  2R75 1;  5HY1 A;  1VQ9 F;  3CG6 A;  2H8C A;  2IQQ A;  4O2A A;  1YJW F;  1H48 A;  2V9Y A;  4G4W A;  1XRG A;  1RLU A;  2AIF A;  2CHT A;  3CC2 F;  5HY2 A;  1VQP F;  1KNJ A;  5FNV B;  1VQ6 F;  2OTM A;  4YJ3 A;  4BY9 D;  1CK2 A;  1NJI H;  1JFF A;  2CWJ A;  1YJN F;  1Q82 H;  1VQ8 F;  5MN4 A;  4BW0 B;  3LWV C;  3V4D A;  2IG8 A;  1JY8 A;  3JAW A;  2HS3 A;  3RYF A;  1W57 A;  3CC4 F;  5CB4 B;  5EZY B;  3HKC B;  5KX5 B;  2CVL A;  3M4S A;  3VIU A;  3R0P A;  5HXZ A;  4FFB B;  3RYI B;  3CD6 F; 
#chains in the Genus database with same CATH homology
 4BVR A;  3CCQ F;  3JCM M;  5A2Q M;  5GIP C;  3CCS F;  2OHW A;  3G4S F;  3E20 B;  3LWO C;  3CPQ A;  5HXU A;  5GIN C;  1JJ2 F;  3CPW F;  1VQ5 F;  1Q81 H;  3IR9 A;  1N8R H;  1ZWZ A;  5HY0 A;  3I55 F;  1GO0 A;  1K73 H;  5FJ4 C;  3CCE F;  5EO3 A;  3OBY A;  3N4Y A;  4X3M A;  3SIU A;  3ON1 A;  3CCR F;  3AGK A;  3CMA F;  1M1K H;  1S72 F;  1VQO F;  5GIO C;  1K8A H;  3JAM M;  1QVF F;  1SDS A;  4XCQ A;  3LWR C;  2LBX A;  3NK7 A;  4NUT A;  4BVS A;  1YHQ F;  3CME F;  2HVY D;  1M90 H;  1VQ7 F;  1E7K A;  3J81 M;  3LWQ C;  3CCM F;  5HY4 A;  1GZ0 A;  3J80 M;  1KD1 H;  1K9M H;  1KQS F;  2GLZ A;  1YIT F;  1KC8 H;  2WAL A;  2KTU A;  3OBW A;  3WXM B;  3D00 A;  1W2B F;  1QVG F;  3CCL F;  5GAN K;  2ALE A;  1VQK F;  2VGN A;  2JNB A;  2KTV A;  3G71 F;  1W3E X;  1VQL F;  3CCJ F;  4EI7 A;  1W41 A;  2FC3 A;  3PAF A;  1RA4 A;  2OTL F;  2LBW A;  2CZW A;  3CCV F;  1Q7Y H;  3MCA B;  4C4W C;  3N4Z A;  3O85 A;  1W42 A;  1VQ4 F;  2I6D A;  1W40 A;  2QI2 A;  1XBI A;  1NMU B;  3CCU F;  3LWP C;  5FLX M;  4X3L A;  1CN7 A;  3HAX D;  2VGM A;  2F9Z C;  1H7M A;  3SIV A;  1RLG A;  5EWR A;  3V3T A;  2KG4 A;  1T0K B;  5DCV A;  5G4V C;  4EI8 A;  1YJ9 F;  2OTJ F;  5GAP K;  2BO1 A;  1VQN F;  4EI9 A;  3J7A R;  3CC7 F;  3NMU C;  3NVK E;  1YI2 F;  3FFM A;  4BVQ A;  3CXC F;  3OW2 F;  5HY1 A;  1VQ9 F;  3CG6 A;  3I56 F;  1YJW F;  3RA5 A;  3E1Y A;  2AIF A;  3CC2 F;  3VI6 A;  2QA4 F;  5HY2 A;  1VQP F;  1IPA A;  3V7Q A;  1YIJ F;  5G4U C;  1VQ6 F;  4NQ3 A;  4BY9 D;  1CK2 A;  1NJI H;  1VQM F;  1YJN F;  5HWE A;  1Q82 H;  1PXW A;  3LFO A;  4BVT A;  1Q86 H;  3NVI B;  3VMF B;  1VQ8 F;  3GYQ A;  3LWV C;  4BW0 B;  2FGY A;  3PLA C;  1X7P A;  1X7O A;  3V7E A;  2OZB A;  1GO1 A;  3RA6 A;  3CC4 F;  3NK6 A;  3G6E F;  5HXZ A;  5IT9 M;  2QEX F;  4LCK A;  3CD6 F;  4TZZ A;  1DT9 A;  1X52 A;  3HJW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...