1KD1H

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kd1H00
1K8AH 5IT9M 2KG4A 3PLAC 1ZWZA 1Q82H 1VQ6F 3E20B 1X7OA 2VGMA 4BW0B 4BY9D 3NK7A 3AGKA 1RA4A 5A2QM 1VQPF 5GAPK 1DT9A 3OBYA 1W2BF 3PAFA 1K9MH 3CCLF 2BO1A 2HVYD 3N4ZA 2ALEA 3JAMM 1YJ9F 3SIVA 2LBWA 1W42A 3SIUA 1W41A 5G4UC 3JCMM 2KTVA 1Q86H 1RLGA 3CCVF 2KTUA 1QVFF 3CPQA 1KQSF 1PXWA 3I56F 1Q81H 5EWRA 3J81M 1VQ4F 3MCAB 3NVKE 2OZBA 5GIPC 1YIJF 1VQKF 3HAXD 1GO0A 3CPWF 3CCSF 1X52A 3NK6A 1M1KH 3CCUF 2OTJF 3J80M 3IR9A 1YI2F 1K73H 3ON1A 3CCJF 3NVIB 1YHQF 5G4VC 2QI2A 2FC3A 1KD1H 1VQ5F 3LFOA 1X7PA 1VQ9F 4X3LA 5GINC 3CMEF 5FJ4C 3LWQC 1VQLF 3LWOC 2VGNA 3CCMF 3CC7F 4NUTA 3CCRF 1IPAA 5FLXM 1S72F 1VQMF 3G6EF 2LBXA 2AIFA 1YITF 3O85A 1YJNF 3VI6A 3V7EA 1VQ8F 3RA5A 3LWPC 1VQOF 3E1YA 1NMUB 2OHWA 3RA6A 1CK2A 3LWVC 3I55F 1GZ0A 2QEXF 1W40A 1H7MA 1SDSA 3FFMA 3VMFB 2OTLF 1KC8H 2I6DA 3G4SF 3CD6F 3LWRC 4TZZA 3CXCF 1NJIH 1XBIA 1VQ7F 3HJWC 3GYQA 1JJ2F 4C4WC 3OBWA 1M90H 3CMAF 2QA4F 3WXMB 5GIOC 3CC4F 3CCEF 5GANK 3CG6A 1GO1A 2WALA 5EO3A 3J7AR 3N4YA 4LCKA 2CZWA 4X3MA 2JNBA 3CC2F 3V7QA 3CCQF 1Q7YH 1N8RH 5DCVA 1VQNF 1W3EX 1CN7A 3OW2F 1QVGF 1T0KB 3G71F 1YJWF 1E7KA 3NMUC
chains in the Genus database with same CATH superfamily
1K8AH 2H8CA 2KG4A 2IG8A 3R0PA 3RYIA 3F0GA 2VGMA 4BY9D 3HKEA 2F9ZC 3AGKA 3K14A 5LYJA 5GAPK 4DRXA 3N2KB 3CCLF 3ZOPA 4F6RA 2HVYD 4DRXB 2ALEA 3QUWA 1GX1A 3SIUA 1COMA 1H48A 3LMEA 2R751 4ZI7B 4X20A 1IV3A 2Z1TA 1DBFA 4X20B 3I56F 3WJQA 3J81M 1VQ4F 3MCAB 1FFXB 4G88A 3V4DA 1YIJF 1SZQA 3CCSF 3NK6A 2HS0A 2OTJF 4ZK7A 1VK3A 4O4HA 1IV1A 1K73H 3ON1A 4O4HB 2CHTA 2HS4A 3C9UA 3GTZA 2QI2A 3P4EA 3LFOA 5FNVA 4M8IA 2L26A 3B6NA 1KNJA 4C82A 5EZYA 3KJJA 3S06A 2IQQA 4WBNA 5J2TA 3LWQC 5EZYB 4WBNB 3MDOA 4KWEA 1IPAA 5FLXM 3KE1A 2R6R1 3WGNA 3G6EF 2QTPA 2LBXA 1T0AA 1YITF 4X1KB 5HY2A 2AIZP 3JAWA 4EI8A 4YJ3B 5EAZA 3E1YA 5C8YA 3IMPA 5LOVA 1SA0A 2OHWA 3RA6A 1CK2A 1FNJA 3LWVC 3JASA 4BVRA 3JASB 1W40A 2GLZA 1KNKA 1H7MA 1SDSA 2Z01A 2I6DA 3TD4A 4TV8A 4HNAB 2OTMA 2RHOA 3TD3A 2PMPA 3CXCF 4TV8B 1NJIH 3I7TA 1VQ7F 3D01A 4C4WC 3N2GA 4O4LA 1M90H 2V9YA 3C9TA 5JVDA 2QA4F 4ZHYB 3ZO8A 3CCEF 4IHJB 3CG6A 1GO1A 3IKEA 4ZHQA 4BVTA 5JCOA 1H47A 2CZWA 4ZHQB 1TVKB 3VYTC 3CCQF 4YJ2A 3JAKA 2KGWA 4EI7A 3JAKB 3VO8A 3S0WA 3ZP7A 3P0ZA 3FBAA 4B46A 4U3JA 2ZOVA 2NMUA 3WPXA 1E7KA 4U3JB 4I4TA 4X1IA 2I6RA 3ZP4A 5HP7A 3PLAC 1ZWZA 4NQ3A 3E20B 4X1IB 1VQ6F 3JATA 5JQGA 3JATB 5A2QM 3BYQA 5JQGB 3OBYA 3F0DA 1W55A 1IV2A 2BO1A 1OAPA 3N4ZA 1QAHA 4ZHVA 3JAMM 2HQSC 3ERNA 2GVIA 3S0YA 5IJ9A 5HY0A 3VCZA 4O4JA 3CCVF 5IJ9B 1JN1A 4O4JB 1QVFF 3I3FA 1PXWA 1Q81H 1RQ2A 2UYPA 3CYPB 2CHSA 2HP0B 3ESJA 2OZBA 1QU9A 3L7QA 3DC2A 1X52A 2W8BC 3WGMA 1QD9A 2CW4A 4G4VA 3N2KA 1W581 1XRGA 3JVHA 2VAWA 3CCJF 1YHQF 5IYZA 4ZI7A 5LXTA 4X3LA 2RB9A 5IYZB 4C8GA 3KHNA 5LXTB 5FJ4C 3F6MA 4NUTA 1FSZA 4G4YA 4PWTA 1FFXA 1VHAA 2ZAUA 1S72F 3HKCB 2YXZA 4DXDA 3MCQA 2VAPA 2AIFA 1UFYA 5LP6A 1Q8RA 1YJNF 5LP6B 1UI9A 3RA5A 1TUBB 5KX5A 3P10A 1YGYA 2BTUA 5HXZA 5KX5B 3FD6A 1X25A 1W5AA 1GZ0A 2QEXF 3WPWA 3V3TA 4FFBA 3HKDB 2LCAA 3TD5A 4FFBB 4TZZA 1W5FA 3K0TA 3RYHA 4X1KA 1JJ2F 3RYHB 3FD5A 3LDTA 4YJ3A 2Q1XA 5GANK 1W5EA 5EO3A 5EIBD 2H6LA 4X3MA 3WJRA 5AVMA 3VTIC 2VXYA 3CC2F 5HY4A 3V7QA 3DDNA 1ODEA 1N8RH 5DCVA 1CN7A 4C81A 3OW2F 4C8IA 1R1MA 4HNAA 2UYKA 3G71F 2LBTA 2RHLA 5ITZB 1XV2A 1Q82H 1X7OA 4BW0B 3RYFA 3NK7A 3GHZA 4IHJA 1RA4A 3RYFB 2PHNA 2DT4A 1VQPF 3PAFA 3RE3A 3WGKA 3HTNA 1TVKA 3SIVA 2LBWA 3F0FA 5G4UC 1Q86H 1RLGA 4B5CA 4B45A 1KQSF 1W57A 5EWRA 1J7HA 2ZODA 3VIUA 3NVKE 3LYBA 4TUYA 2IAFA 1VQKF 1GO0A 4ZHWA 4TUYB 3CPWF 2RHJA 4O2AA 4I55B 5HP8A 2Q1YA 2UZHA 4O2AB 3IEWA 5J2UA 1JY8A 5EIBC 2Z1UA 5J2UB 5JH7B 5G4VC 3FPIA 2CVLA 4LNUA 2FC3A 3U0OA 2Z1EA 1KD1H 1X7PA 4ZOLA 1VQ9F 4LNUB 2RHHA 4G4XA 4ZOLB 4G4ZA 2ZVZA 3LWOC 3CCMF 1Z5VA 1OFUA 2B33A 5HWEA 2HP0A 4XCQA 5KMGB 1JFFB 1W59A 4EB6A 3VI6A 1YQNA 2HX0A 2P6YA 3IEQA 2ZVYA 4EB6B 5CB4B 3JALB 4ERHA 3LWPC 4I50A 1RLUA 1Z5WA 1W5BA 4I50B 5CA1A 2AMTA 2UYJA 5CA1B 2K1SA 4BT5A 2HRUA 5EB0A 1VH8A 1CLIA 4B62A 3FFMA 3VMFB 2OTLF 3VOAA 3G4SF 3CD6F 4O4IA 2ZF8A 3HKCA 4O4IB 1XBIA 3M4SA 3UT5A 3GYQA 3UT5B 2CSLA 5MN4A 3RYIB 5EYPA 1TUBA 4BT2A 3WXMB 5GIOC 3HKEB 5EYPB 4BVQA 2WALA 5LYJB 4LCKA 3N4YA 2G9IA 4F6RB 4U39A 3JARA 3QTYA 4TV9A 4IIJA 3S0HA 3JARB 4X1YA 1NQ3A 3HKDA 2VAMA 5GONA 4TV9B 4IIJB 4RQOA 4X1YB 5GONB 1FNKA 3CYQA 3C9RA 4O2BA 3Q8HA 1T0KB 2UYNA 3MQWA 1YJWF 4O2BB 2YYEA 3KJKA 2UYNB 4BT3A 3NMUC 5IT9M 1XHOA 1U40A 2HRYA 3ELCA 5HY1A 3OONA 1W2BF 1DT9A 3D00A 1K9MH 3RYCA 1YJ9F 3C8LA 1W42A 3RYCB 1W41A 3JCMM 2KTVA 5FNVB 2KTUA 5JCOC 1U43A 3CPQA 1JD1A 3F0EA 5J2TB 3S02A 3WGLA 5LA6A 3K2XA 4E6EA 5ITZA 1IV4A 5LA6B 5GIPC 3CB2A 3E22A 3HAXD 3WGJA 5IJ0A 2CWJA 3E22B 1M1KH 5IJ0B 3CCUF 3JAWB 3J80M 3IR9A 3K12A 5C8YB 5LOVB 1YI2F 1SA0B 3NVIB 3T80A 3M1XA 1VQ5F 1U3PA 3HKBA 5GINC 3CMEF 2GZLA 5MN5A 3HKBB 1VQLF 3CC7F 2VGNA 3CCRF 2H8EA 5B8FA 2BTOA 1VQMF 3VYSC 1RQ7A 3O85A 3V7EA 3N2GB 4O4LB 4NWOB 4R40B 4I55A 4RHAA 1VQ8F 5JVDB 5BMVA 1VQOF 3QHDA 5BMVB 3M84A 1ONIA 5JH7A 1NMUB 4BVSA 3I55F 2HP3A 3KIZA 4C8EA 2HS3A 4YJ2B 3WJPA 3S03A 3VYUC 3EORA 5HXUA 3D54A 1KC8H 1PF5A 3LWRC 3C9SA 2N48A 5KMGA 1JFFA 3HJWC 4I4TB 3OBWA 2FGYA 5MN6A 5CA0A 5CB4A 3CMAF 3JALA 2EWCA 4G4WA 5CA0B 3CC4F 1U3LA 5LP6C 3HWUA 3J7AR 5EB1B 2JNBA 3VOBA 3MBMA 1VQVA 4BT7A 1Q7YH 2BTQB 1VQNF 2DYYA 1W3EX 4BT6A 3IKFA 4BT4A 4EI9A 1QVGF 2MQEA 2Z1FA
chains in the Genus database with same CATH topology
1K8AH 5IT9M 2KG4A 3PLAC 1ZWZA 1Q82H 4NQ3A 3E20B 1VQ6F 1X7OA 2VGMA 4BW0B 4BY9D 3NK7A 2F9ZC 3AGKA 1RA4A 5A2QM 5HY1A 1VQPF 5GAPK 1DT9A 3D00A 3OBYA 3PAFA 1W2BF 1K9MH 3CCLF 2BO1A 2HVYD 3N4ZA 2ALEA 3JAMM 1YJ9F 3SIVA 2LBWA 1W42A 3SIUA 1W41A 5HY0A 3JCMM 2KTVA 5G4UC 1Q86H 1RLGA 3CCVF 2KTUA 1QVFF 3CPQA 1KQSF 1PXWA 3I56F 1Q81H 5EWRA 3J81M 1VQ4F 3MCAB 3NVKE 2OZBA 5GIPC 1YIJF 1VQKF 3HAXD 1GO0A 3CPWF 3CCSF 1X52A 3NK6A 1M1KH 3CCUF 2OTJF 3J80M 3IR9A 1YI2F 1K73H 3ON1A 3CCJF 3NVIB 1YHQF 5G4VC 2QI2A 2FC3A 1KD1H 1VQ5F 3LFOA 1X7PA 1VQ9F 4X3LA 5GINC 3CMEF 5FJ4C 3LWQC 1VQLF 3LWOC 2VGNA 3CCMF 3CC7F 4NUTA 3CCRF 1IPAA 5FLXM 5HWEA 1S72F 1VQMF 3G6EF 2LBXA 4XCQA 2AIFA 1YITF 3O85A 1YJNF 3VI6A 3V7EA 5HY2A 1VQ8F 3RA5A 4EI8A 3LWPC 1VQOF 3E1YA 5HXZA 1NMUB 4BVSA 2OHWA 3RA6A 1CK2A 3LWVC 3I55F 1GZ0A 4BVRA 2QEXF 1W40A 2GLZA 1H7MA 1SDSA 3V3TA 3FFMA 3VMFB 2OTLF 5HXUA 1KC8H 2I6DA 3G4SF 3CD6F 3LWRC 4TZZA 3CXCF 1NJIH 1XBIA 1VQ7F 3HJWC 3GYQA 1JJ2F 4C4WC 3OBWA 2FGYA 1M90H 3CMAF 2QA4F 3WXMB 5GIOC 3CC4F 3CCEF 5GANK 4BVQA 3CG6A 1GO1A 2WALA 5EO3A 4BVTA 3J7AR 3N4YA 4LCKA 2CZWA 4X3MA 2JNBA 3CC2F 5HY4A 3V7QA 3CCQF 1Q7YH 1N8RH 5DCVA 1VQNF 1W3EX 4EI7A 1CN7A 3OW2F 4EI9A 1QVGF 1T0KB 3G71F 1YJWF 1E7KA 3NMUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A H;  5IT9 M;  2KG4 A;  3PLA C;  1ZWZ A;  1Q82 H;  1VQ6 F;  3E20 B;  1X7O A;  2VGM A;  4BW0 B;  4BY9 D;  3NK7 A;  3AGK A;  1RA4 A;  5A2Q M;  1VQP F;  5GAP K;  1DT9 A;  3OBY A;  1W2B F;  3PAF A;  1K9M H;  3CCL F;  2BO1 A;  2HVY D;  3N4Z A;  2ALE A;  3JAM M;  1YJ9 F;  3SIV A;  2LBW A;  1W42 A;  3SIU A;  1W41 A;  5G4U C;  3JCM M;  2KTV A;  1Q86 H;  1RLG A;  3CCV F;  2KTU A;  1QVF F;  3CPQ A;  1KQS F;  1PXW A;  3I56 F;  1Q81 H;  5EWR A;  3J81 M;  1VQ4 F;  3MCA B;  3NVK E;  2OZB A;  5GIP C;  1YIJ F;  1VQK F;  3HAX D;  1GO0 A;  3CPW F;  3CCS F;  1X52 A;  3NK6 A;  1M1K H;  3CCU F;  2OTJ F;  3J80 M;  3IR9 A;  1YI2 F;  1K73 H;  3ON1 A;  3CCJ F;  3NVI B;  1YHQ F;  5G4V C;  2QI2 A;  2FC3 A;  1KD1 H;  1VQ5 F;  3LFO A;  1X7P A;  1VQ9 F;  4X3L A;  5GIN C;  3CME F;  5FJ4 C;  3LWQ C;  1VQL F;  3LWO C;  2VGN A;  3CCM F;  3CC7 F;  4NUT A;  3CCR F;  1IPA A;  5FLX M;  1S72 F;  1VQM F;  3G6E F;  2LBX A;  2AIF A;  1YIT F;  3O85 A;  1YJN F;  3VI6 A;  3V7E A;  1VQ8 F;  3RA5 A;  3LWP C;  1VQO F;  3E1Y A;  1NMU B;  2OHW A;  3RA6 A;  1CK2 A;  3LWV C;  3I55 F;  1GZ0 A;  2QEX F;  1W40 A;  1H7M A;  1SDS A;  3FFM A;  3VMF B;  2OTL F;  1KC8 H;  2I6D A;  3G4S F;  3CD6 F;  3LWR C;  4TZZ A;  3CXC F;  1NJI H;  1XBI A;  1VQ7 F;  3HJW C;  3GYQ A;  1JJ2 F;  4C4W C;  3OBW A;  1M90 H;  3CMA F;  2QA4 F;  3WXM B;  5GIO C;  3CC4 F;  3CCE F;  5GAN K;  3CG6 A;  1GO1 A;  2WAL A;  5EO3 A;  3J7A R;  3N4Y A;  4LCK A;  2CZW A;  4X3M A;  2JNB A;  3CC2 F;  3V7Q A;  3CCQ F;  1Q7Y H;  1N8R H;  5DCV A;  1VQN F;  1W3E X;  1CN7 A;  3OW2 F;  1QVG F;  1T0K B;  3G71 F;  1YJW F;  1E7K A;  3NMU C; 
#chains in the Genus database with same CATH topology
 1K8A H;  2H8C A;  2KG4 A;  2IG8 A;  3R0P A;  3RYI A;  3F0G A;  2VGM A;  4BY9 D;  3HKE A;  2F9Z C;  3AGK A;  3K14 A;  5LYJ A;  5GAP K;  4DRX A;  3N2K B;  3CCL F;  3ZOP A;  4F6R A;  2HVY D;  4DRX B;  2ALE A;  3QUW A;  1GX1 A;  3SIU A;  1COM A;  1H48 A;  3LME A;  2R75 1;  4ZI7 B;  4X20 A;  1IV3 A;  2Z1T A;  1DBF A;  4X20 B;  3I56 F;  3WJQ A;  3J81 M;  1VQ4 F;  3MCA B;  1FFX B;  4G88 A;  3V4D A;  1YIJ F;  1SZQ A;  3CCS F;  3NK6 A;  2HS0 A;  2OTJ F;  4ZK7 A;  1VK3 A;  4O4H A;  1IV1 A;  1K73 H;  3ON1 A;  4O4H B;  2CHT A;  2HS4 A;  3C9U A;  3GTZ A;  2QI2 A;  3P4E A;  3LFO A;  5FNV A;  4M8I A;  2L26 A;  3B6N A;  1KNJ A;  4C82 A;  5EZY A;  3KJJ A;  3S06 A;  2IQQ A;  4WBN A;  5J2T A;  3LWQ C;  5EZY B;  4WBN B;  3MDO A;  4KWE A;  1IPA A;  5FLX M;  3KE1 A;  2R6R 1;  3WGN A;  3G6E F;  2QTP A;  2LBX A;  1T0A A;  1YIT F;  4X1K B;  5HY2 A;  2AIZ P;  3JAW A;  4EI8 A;  4YJ3 B;  5EAZ A;  3E1Y A;  5C8Y A;  3IMP A;  5LOV A;  1SA0 A;  2OHW A;  3RA6 A;  1CK2 A;  1FNJ A;  3LWV C;  3JAS A;  4BVR A;  3JAS B;  1W40 A;  2GLZ A;  1KNK A;  1H7M A;  1SDS A;  2Z01 A;  2I6D A;  3TD4 A;  4TV8 A;  4HNA B;  2OTM A;  2RHO A;  3TD3 A;  2PMP A;  3CXC F;  4TV8 B;  1NJI H;  3I7T A;  1VQ7 F;  3D01 A;  4C4W C;  3N2G A;  4O4L A;  1M90 H;  2V9Y A;  3C9T A;  5JVD A;  2QA4 F;  4ZHY B;  3ZO8 A;  3CCE F;  4IHJ B;  3CG6 A;  1GO1 A;  3IKE A;  4ZHQ A;  4BVT A;  5JCO A;  1H47 A;  2CZW A;  4ZHQ B;  1TVK B;  3VYT C;  3CCQ F;  4YJ2 A;  3JAK A;  2KGW A;  4EI7 A;  3JAK B;  3VO8 A;  3S0W A;  3ZP7 A;  3P0Z A;  3FBA A;  4B46 A;  4U3J A;  2ZOV A;  2NMU A;  3WPX A;  1E7K A;  4U3J B;  4I4T A;  4X1I A;  2I6R A;  3ZP4 A;  5HP7 A;  3PLA C;  1ZWZ A;  4NQ3 A;  3E20 B;  4X1I B;  1VQ6 F;  3JAT A;  5JQG A;  3JAT B;  5A2Q M;  3BYQ A;  5JQG B;  3OBY A;  3F0D A;  1W55 A;  1IV2 A;  2BO1 A;  1OAP A;  3N4Z A;  1QAH A;  4ZHV A;  3JAM M;  2HQS C;  3ERN A;  2GVI A;  3S0Y A;  5IJ9 A;  5HY0 A;  3VCZ A;  4O4J A;  3CCV F;  5IJ9 B;  1JN1 A;  4O4J B;  1QVF F;  3I3F A;  1PXW A;  1Q81 H;  1RQ2 A;  2UYP A;  3CYP B;  2CHS A;  2HP0 B;  3ESJ A;  2OZB A;  1QU9 A;  3L7Q A;  3DC2 A;  1X52 A;  2W8B C;  3WGM A;  1QD9 A;  2CW4 A;  4G4V A;  3N2K A;  1W58 1;  1XRG A;  3JVH A;  2VAW A;  3CCJ F;  1YHQ F;  5IYZ A;  4ZI7 A;  5LXT A;  4X3L A;  2RB9 A;  5IYZ B;  4C8G A;  3KHN A;  5LXT B;  5FJ4 C;  3F6M A;  4NUT A;  1FSZ A;  4G4Y A;  4PWT A;  1FFX A;  1VHA A;  2ZAU A;  1S72 F;  3HKC B;  2YXZ A;  4DXD A;  3MCQ A;  2VAP A;  2AIF A;  1UFY A;  5LP6 A;  1Q8R A;  1YJN F;  5LP6 B;  1UI9 A;  3RA5 A;  1TUB B;  5KX5 A;  3P10 A;  1YGY A;  2BTU A;  5HXZ A;  5KX5 B;  3FD6 A;  1X25 A;  1W5A A;  1GZ0 A;  2QEX F;  3WPW A;  3V3T A;  4FFB A;  3HKD B;  2LCA A;  3TD5 A;  4FFB B;  4TZZ A;  1W5F A;  3K0T A;  3RYH A;  4X1K A;  1JJ2 F;  3RYH B;  3FD5 A;  3LDT A;  4YJ3 A;  2Q1X A;  5GAN K;  1W5E A;  5EO3 A;  5EIB D;  2H6L A;  4X3M A;  3WJR A;  5AVM A;  3VTI C;  2VXY A;  3CC2 F;  5HY4 A;  3V7Q A;  3DDN A;  1ODE A;  1N8R H;  5DCV A;  1CN7 A;  4C81 A;  3OW2 F;  4C8I A;  1R1M A;  4HNA A;  2UYK A;  3G71 F;  2LBT A;  2RHL A;  5ITZ B;  1XV2 A;  1Q82 H;  1X7O A;  4BW0 B;  3RYF A;  3NK7 A;  3GHZ A;  4IHJ A;  1RA4 A;  3RYF B;  2PHN A;  2DT4 A;  1VQP F;  3PAF A;  3RE3 A;  3WGK A;  3HTN A;  1TVK A;  3SIV A;  2LBW A;  3F0F A;  5G4U C;  1Q86 H;  1RLG A;  4B5C A;  4B45 A;  1KQS F;  1W57 A;  5EWR A;  1J7H A;  2ZOD A;  3VIU A;  3NVK E;  3LYB A;  4TUY A;  2IAF A;  1VQK F;  1GO0 A;  4ZHW A;  4TUY B;  3CPW F;  2RHJ A;  4O2A A;  4I55 B;  5HP8 A;  2Q1Y A;  2UZH A;  4O2A B;  3IEW A;  5J2U A;  1JY8 A;  5EIB C;  2Z1U A;  5J2U B;  5JH7 B;  5G4V C;  3FPI A;  2CVL A;  4LNU A;  2FC3 A;  3U0O A;  2Z1E A;  1KD1 H;  1X7P A;  4ZOL A;  1VQ9 F;  4LNU B;  2RHH A;  4G4X A;  4ZOL B;  4G4Z A;  2ZVZ A;  3LWO C;  3CCM F;  1Z5V A;  1OFU A;  2B33 A;  5HWE A;  2HP0 A;  4XCQ A;  5KMG B;  1JFF B;  1W59 A;  4EB6 A;  3VI6 A;  1YQN A;  2HX0 A;  2P6Y A;  3IEQ A;  2ZVY A;  4EB6 B;  5CB4 B;  3JAL B;  4ERH A;  3LWP C;  4I50 A;  1RLU A;  1Z5W A;  1W5B A;  4I50 B;  5CA1 A;  2AMT A;  2UYJ A;  5CA1 B;  2K1S A;  4BT5 A;  2HRU A;  5EB0 A;  1VH8 A;  1CLI A;  4B62 A;  3FFM A;  3VMF B;  2OTL F;  3VOA A;  3G4S F;  3CD6 F;  4O4I A;  2ZF8 A;  3HKC A;  4O4I B;  1XBI A;  3M4S A;  3UT5 A;  3GYQ A;  3UT5 B;  2CSL A;  5MN4 A;  3RYI B;  5EYP A;  1TUB A;  4BT2 A;  3WXM B;  5GIO C;  3HKE B;  5EYP B;  4BVQ A;  2WAL A;  5LYJ B;  4LCK A;  3N4Y A;  2G9I A;  4F6R B;  4U39 A;  3JAR A;  3QTY A;  4TV9 A;  4IIJ A;  3S0H A;  3JAR B;  4X1Y A;  1NQ3 A;  3HKD A;  2VAM A;  5GON A;  4TV9 B;  4IIJ B;  4RQO A;  4X1Y B;  5GON B;  1FNK A;  3CYQ A;  3C9R A;  4O2B A;  3Q8H A;  1T0K B;  2UYN A;  3MQW A;  1YJW F;  4O2B B;  2YYE A;  3KJK A;  2UYN B;  4BT3 A;  3NMU C;  5IT9 M;  1XHO A;  1U40 A;  2HRY A;  3ELC A;  5HY1 A;  3OON A;  1W2B F;  1DT9 A;  3D00 A;  1K9M H;  3RYC A;  1YJ9 F;  3C8L A;  1W42 A;  3RYC B;  1W41 A;  3JCM M;  2KTV A;  5FNV B;  2KTU A;  5JCO C;  1U43 A;  3CPQ A;  1JD1 A;  3F0E A;  5J2T B;  3S02 A;  3WGL A;  5LA6 A;  3K2X A;  4E6E A;  5ITZ A;  1IV4 A;  5LA6 B;  5GIP C;  3CB2 A;  3E22 A;  3HAX D;  3WGJ A;  5IJ0 A;  2CWJ A;  3E22 B;  1M1K H;  5IJ0 B;  3CCU F;  3JAW B;  3J80 M;  3IR9 A;  3K12 A;  5C8Y B;  5LOV B;  1YI2 F;  1SA0 B;  3NVI B;  3T80 A;  3M1X A;  1VQ5 F;  1U3P A;  3HKB A;  5GIN C;  3CME F;  2GZL A;  5MN5 A;  3HKB B;  1VQL F;  3CC7 F;  2VGN A;  3CCR F;  2H8E A;  5B8F A;  2BTO A;  1VQM F;  3VYS C;  1RQ7 A;  3O85 A;  3V7E A;  3N2G B;  4O4L B;  4NWO B;  4R40 B;  4I55 A;  4RHA A;  1VQ8 F;  5JVD B;  5BMV A;  1VQO F;  3QHD A;  5BMV B;  3M84 A;  1ONI A;  5JH7 A;  1NMU B;  4BVS A;  3I55 F;  2HP3 A;  3KIZ A;  4C8E A;  2HS3 A;  4YJ2 B;  3WJP A;  3S03 A;  3VYU C;  3EOR A;  5HXU A;  3D54 A;  1KC8 H;  1PF5 A;  3LWR C;  3C9S A;  2N48 A;  5KMG A;  1JFF A;  3HJW C;  4I4T B;  3OBW A;  2FGY A;  5MN6 A;  5CA0 A;  5CB4 A;  3CMA F;  3JAL A;  2EWC A;  4G4W A;  5CA0 B;  3CC4 F;  1U3L A;  5LP6 C;  3HWU A;  3J7A R;  5EB1 B;  2JNB A;  3VOB A;  3MBM A;  1VQV A;  4BT7 A;  1Q7Y H;  2BTQ B;  1VQN F;  2DYY A;  1W3E X;  4BT6 A;  3IKF A;  4BT4 A;  4EI9 A;  1QVG F;  2MQE A;  2Z1F A; 
#chains in the Genus database with same CATH homology
 1K8A H;  5IT9 M;  2KG4 A;  3PLA C;  1ZWZ A;  1Q82 H;  4NQ3 A;  3E20 B;  1VQ6 F;  1X7O A;  2VGM A;  4BW0 B;  4BY9 D;  3NK7 A;  2F9Z C;  3AGK A;  1RA4 A;  5A2Q M;  5HY1 A;  1VQP F;  5GAP K;  1DT9 A;  3D00 A;  3OBY A;  3PAF A;  1W2B F;  1K9M H;  3CCL F;  2BO1 A;  2HVY D;  3N4Z A;  2ALE A;  3JAM M;  1YJ9 F;  3SIV A;  2LBW A;  1W42 A;  3SIU A;  1W41 A;  5HY0 A;  3JCM M;  2KTV A;  5G4U C;  1Q86 H;  1RLG A;  3CCV F;  2KTU A;  1QVF F;  3CPQ A;  1KQS F;  1PXW A;  3I56 F;  1Q81 H;  5EWR A;  3J81 M;  1VQ4 F;  3MCA B;  3NVK E;  2OZB A;  5GIP C;  1YIJ F;  1VQK F;  3HAX D;  1GO0 A;  3CPW F;  3CCS F;  1X52 A;  3NK6 A;  1M1K H;  3CCU F;  2OTJ F;  3J80 M;  3IR9 A;  1YI2 F;  1K73 H;  3ON1 A;  3CCJ F;  3NVI B;  1YHQ F;  5G4V C;  2QI2 A;  2FC3 A;  1KD1 H;  1VQ5 F;  3LFO A;  1X7P A;  1VQ9 F;  4X3L A;  5GIN C;  3CME F;  5FJ4 C;  3LWQ C;  1VQL F;  3LWO C;  2VGN A;  3CCM F;  3CC7 F;  4NUT A;  3CCR F;  1IPA A;  5FLX M;  5HWE A;  1S72 F;  1VQM F;  3G6E F;  2LBX A;  4XCQ A;  2AIF A;  1YIT F;  3O85 A;  1YJN F;  3VI6 A;  3V7E A;  5HY2 A;  1VQ8 F;  3RA5 A;  4EI8 A;  3LWP C;  1VQO F;  3E1Y A;  5HXZ A;  1NMU B;  4BVS A;  2OHW A;  3RA6 A;  1CK2 A;  3LWV C;  3I55 F;  1GZ0 A;  4BVR A;  2QEX F;  1W40 A;  2GLZ A;  1H7M A;  1SDS A;  3V3T A;  3FFM A;  3VMF B;  2OTL F;  5HXU A;  1KC8 H;  2I6D A;  3G4S F;  3CD6 F;  3LWR C;  4TZZ A;  3CXC F;  1NJI H;  1XBI A;  1VQ7 F;  3HJW C;  3GYQ A;  1JJ2 F;  4C4W C;  3OBW A;  2FGY A;  1M90 H;  3CMA F;  2QA4 F;  3WXM B;  5GIO C;  3CC4 F;  3CCE F;  5GAN K;  4BVQ A;  3CG6 A;  1GO1 A;  2WAL A;  5EO3 A;  4BVT A;  3J7A R;  3N4Y A;  4LCK A;  2CZW A;  4X3M A;  2JNB A;  3CC2 F;  5HY4 A;  3V7Q A;  3CCQ F;  1Q7Y H;  1N8R H;  5DCV A;  1VQN F;  1W3E X;  4EI7 A;  1CN7 A;  3OW2 F;  4EI9 A;  1QVG F;  1T0K B;  3G71 F;  1YJW F;  1E7K A;  3NMU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...