1KD1H

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kd1H00
1ZWZA 3J80M 3LFOA 1W41A 1VQPF 5EWRA 3LWPC 1KD1H 5EO3A 3RA6A 3CC2F 3VMFB 4X3LA 3V7QA 3VI6A 5G4UC 1K9MH 5GANK 3NK7A 1VQ6F 4NUTA 3ON1A 3HAXD 4BY9D 3E1YA 3JAMM 1CK2A 1KQSF 3CG6A 1YJ9F 1XBIA 2LBWA 3PLAC 3CXCF 2KG4A 3CCSF 1GZ0A 3CPQA 1W2BF 5IT9M 5FLXM 3LWQC 3CCQF 3CCRF 3I55F 1S72F 1VQMF 2QI2A 1YJWF 2OTJF 1VQ7F 3CCUF 2FC3A 3PAFA 1YIJF 1SDSA 1X7OA 3E20B 1GO0A 1M90H 3G6EF 3OBWA 1IPAA 1X52A 3OW2F 1YI2F 2ALEA 1YHQF 2OTLF 1K73H 1YITF 1VQKF 3CD6F 1CN7A 3LWOC 3SIVA 3SIUA 3CCVF 4BW0B 1PXWA 3N4YA 3LWVC 3NMUC 3AGKA 3J81M 3I56F 1H7MA 1VQLF 1VQ4F 5GIPC 2JNBA 3CMEF 2VGMA 3LWRC 2QA4F 1RA4A 3CC4F 1Q82H 3NVKE 1W3EX 1Q81H 2CZWA 3NVIB 3JCMM 1JJ2F 5G4VC 5FJ4C 1Q86H 4C4WC 3NK6A 1W42A 5GAPK 3G4SF 1QVGF 3IR9A 3CCJF 1NJIH 3FFMA 1W40A 2HVYD 4TZZA 1X7PA 3OBYA 2BO1A 1KC8H 1VQ9F 5DCVA 1VQOF 2OHWA 2QEXF 3WXMB 5A2QM 1RLGA 1VQNF 3J7AR 1VQ5F 2KTVA 1T0KB 1M1KH 3GYQA 2KTUA 3CCLF 4LCKA 2VGNA 3O85A 2AIFA 1NMUB 3G71F 2LBXA 3CCMF 1N8RH 3CPWF 1QVFF 1VQ8F 3CCEF 1GO1A 3MCAB 2WALA 5GIOC 1K8AH 3RA5A 1YJNF 1Q7YH 3CMAF 5GINC 1E7KA 4X3MA 2OZBA 3V7EA 2I6DA 3N4ZA 3CC7F 3HJWC 1DT9A
chains in the Genus database with same CATH superfamily
1ZWZA 5EB1B 2RHLA 4U3JB 3JAKB 1W59A 2HP0B 4NQ3A 4O4JA 2I6RA 5EAZA 1VQPF 5EWRA 3N2GB 4B5CA 3JASB 3MBMA 3VCZA 3FD6A 3HKDB 2ZVZA 2CHSA 3JAWB 4X1IB 3K12A 5JVDA 3P10A 5GANK 1K9MH 4C81A 3WJQA 4ZOLA 3S0WA 3RYFA 3E1YA 3JAMM 2HS4A 1KQSF 5C8YA 5HXZA 5HY0A 2LBWA 3IKEA 4ZHQA 5J2UA 3WPWA 3CCSF 1VQVA 1TVKA 5IT9M 3CCQF 3LWQC 2ZAUA 1QAHA 3WGKA 2BTUA 1S72F 3ZP7A 2OTMA 1YJWF 4F6RA 1VQ7F 3PAFA 1SDSA 1X7OA 3M1XA 4TV9B 3OBWA 2HP3A 1IPAA 2R751 2W8BC 4ZI7B 2ZODA 4IIJA 1FFXB 3OW2F 2ALEA 2HRUA 2LCAA 5CB4A 3CYQA 1CN7A 3SIVA 1SA0A 3N4YA 3LWVC 4E6EA 3JVHA 4FFBB 1OAPA 5CA0B 3K14A 2Q1YA 2IAFA 3CC4F 4C8GA 2UYNA 2H6LA 2CZWA 3RYCA 5J2TB 1JN1A 5G4VC 1Q86H 1QVGF 2N48A 2HQSC 3QTYA 5JVDB 4C8IA 3FBAA 2HVYD 2BO1A 4ZOLB 2DYYA 1W5FA 4G4VA 3RYFB 4O4HA 5EIBD 4BT2A 5C8YB 1RLGA 4ZHQB 5FNVA 5J2UB 4BVTA 5KX5A 1M1KH 3GYQA 1QU9A 4ZHWA 1TVKB 3HTNA 4BT3A 3C9TA 1FSZA 3O85A 4WBNA 3G71F 4I4TA 3R0PA 4YJ2A 3F0GA 3MCAB 3DC2A 3L7QA 1SZQA 3VOAA 1Q7YH 3I3FA 5LP6A 4O4LA 1JY8A 4R40B 3D54A 3K2XA 3QUWA 3S06A 3JALB 5MN6A 4IIJB 1ONIA 1Z5VA 3C9RA 2YXZA 3CC7F 1GX1A 5CB4B 3ZP4A 4ERHA 3IEWA 1SA0B 3WGNA 4BVSA 3RYHA 3C9SA 2UYJA 3VIUA 3VMFB 3VI6A 3V7QA 3DDNA 1TUBB 2Z1EA 3LYBA 5EZYA 3RE3A 1ODEA 4NUTA 3IMPA 3HAXD 4BVQA 3C8LA 4EB6A 4O4IA 5IYZB 2UYNB 1XBIA 3RYCB 4LNUA 2Z1FA 3CPQA 5HY1A 3LMEA 2KGWA 2UZHA 4X20B 5FLXM 2L26A 3K0TA 4B62A 1VQMF 5GONA 2QI2A 2PHNA 5LP6C 3U0OA 2OTJF 4O4HB 1W55A 3KJKA 4IHJA 5FNVB 5KX5B 1X52A 4WBNB 1YQNA 1YI2F 1COMA 4B46A 1YHQF 3F0EA 3V4DA 4I4TB 1J7HA 2P6YA 2RHHA 1YITF 4YJ2B 2LBTA 4B45A 1IV2A 4O2AA 2YYEA 5LXTA 3CCVF 3SIUA 4EI9A 4O4LB 3AGKA 3D01A 3M4SA 2HX0A 1H7MA 2VXYA 1VQ4F 1FNJA 3D00A 2B33A 4I55A 3TD4A 4I50A 4DRXB 5LOVB 3LWRC 2QA4F 1IV3A 1W3EX 3HKBA 1W5BA 5EB0A 3RYHB 3NVIB 5CA1A 3RYIA 4EI7A 4C4WC 3NK6A 1W42A 3G4SF 3IR9A 5AVMA 3CCJF 1NJIH 3FFMA 4KWEA 5LA6A 1KC8H 4X1KB 1VQ9F 5DCVA 1VQOF 2RHOA 2QEXF 4EB6B 2F9ZC 5A2QM 1VQNF 2EWCA 3KE1A 2KTVA 4BT6A 1VQ5F 5IJ0A 3ESJA 2H8EA 3FPIA 4G4ZA 3VO8A 3ERNA 2R6R1 2VAMA 1GO1A 5GONB 3MDOA 2IG8A 1K8AH 2H8CA 4O4JB 1PF5A 4XCQA 5HP7A 4G88A 3CMAF 1JFFA 1U43A 4IHJB 5GINC 1E7KA 3MCQA 2OZBA 2MQEA 2I6DA 3WGMA 3KIZA 3KJJA 4ZHVA 2V9YA 3IEQA 4O2AB 5LXTB 4BT7A 2BTOA 4C82A 1W41A 2VAPA 5EO3A 3RA6A 3CC2F 3P0ZA 4X3LA 2ZVYA 3CB2A 2VAWA 1W5EA 4I55B 1T0AA 2UYKA 3NK7A 4I50B 4F6RB 1VQ6F 3JARA 3JATA 3GHZA 3VTIC 3CG6A 3HKBB 2RB9A 4G4WA 4U3JA 5CA1B 1W57A 2HP0A 2KG4A 3MQWA 4RQOA 3N2GA 3JASA 3CCRF 4X1IA 1CLIA 2BTQB 3T80A 5LA6B 5KMGA 3CCUF 3ELCA 2CVLA 3E20B 3I7TA 3VYUC 3G6EF 1M90H 3F0DA 3TD3A 1IV1A 5IJ0B 3LDTA 2CHTA 1U3LA 4EI8A 1K73H 5JCOC 4HNAA 5EIBC 1VQKF 3CD6F 2CSLA 2Z01A 2QTPA 3S0YA 1JFFB 4BVRA 3WGJA 3WJRA 1W581 2HRYA 4BT5A 1OFUA 5JH7A 1UI9A 2JNBA 3BYQA 3M84A 1VHAA 1FNKA 1Q82H 3NVKE 1Q81H 3CYPB 3WGLA 3JCMM 1JJ2F 1U3PA 2GZLA 2Z1UA 5MN5A 2GVIA 3F0FA 3HKCA 3V3TA 5ITZA 4TZZA 3QHDA 5IJ9A 3OBYA 4NWOB 3JARB 5LP6B 3JATB 2OHWA 3J7AR 3N2KA 4YJ3A 5J2TA 3CCLF 2AIFA 1NMUB 2LBXA 1N8RH 4TUYA 3CPWF 2K1SA 1VQ8F 3CCEF 3ZO8A 5KMGB 5GIOC 1R1MA 3RA5A 5BMVA 1YJNF 5JQGA 5MN4A 1Z5WA 4X3MA 3WPXA 5HY2A 5EZYB 3V7EA 5LYJA 1XV2A 4HNAB 3UT5A 3F6MA 4O4IB 1XRGA 1JD1A 2CWJA 3GTZA 4X1YA 3J80M 1DBFA 4LNUB 3LFOA 3LWPC 4G4YA 1KD1H 3EORA 3HKEA 2GLZA 3JALA 5EYPA 5JH7B 5G4UC 1YGYA 3ON1A 4O2BA 3VOBA 4BY9D 1Q8RA 1CK2A 4PWTA 1YJ9F 2UYPA 1KNJA 3S02A 2DT4A 3PLAC 3CXCF 1X25A 1GZ0A 1W2BF 3I55F 3C9UA 3HKCB 5JCOA 5ITZB 1TUBA 5IJ9B 3P4EA 4C8EA 3E22A 3IKFA 2FC3A 1YIJF 1U40A 4TV8A 3FD5A 5IYZA 2PMPA 1GO0A 2HS3A 2ZF8A 3N2KB 4YJ3B 3WJPA 2AIZP 3ZOPA 4X20A 2OTLF 3Q8HA 4TUYB 1XHOA 1H48A 3LWOC 4ZHYB 4BW0B 5BMVB 2ZOVA 1PXWA 3JAKA 3NMUC 3RYIB 5JQGB 3OONA 3VYTC 3S0HA 3J81M 3I56F 1VQLF 1RQ7A 3HKDA 3JAWA 5GIPC 5LYJB 3CMEF 2VGMA 3UT5B 2AMTA 5B8FA 1RA4A 2Z1TA 4BT4A 4M8IA 4X1YB 2RHJA 4G4XA 1W5AA 5FJ4C 3TD5A 5GAPK 4U39A 3HKEB 2CW4A 1KNKA 4DXDA 5EYPB 1UFYA 1VK3A 2Q1XA 1W40A 1X7PA 4O2BB 5HY4A 4DRXA 5LOVA 3WXMB 5HWEA 3S03A 5HXUA 4TV9A 1T0KB 1H47A 1VH8A 4ZI7A 2KTUA 4LCKA 1FFXA 1NQ3A 2G9IA 2VGNA 3CCMF 2HS0A 2IQQA 3VYSC 3HWUA 1QVFF 2WALA 4ZK7A 3B6NA 1RLUA 3E22B 4X1KA 1QD9A 2NMUA 4TV8B 2FGYA 1RQ2A 4RHAA 5HP8A 1IV4A 3N4ZA 4FFBA 5CA0A 3HJWC 1DT9A 3KHNA
chains in the Genus database with same CATH topology
1ZWZA 3J80M 4BVSA 3LFOA 1W41A 4NQ3A 1VQPF 5EWRA 3LWPC 1KD1H 5EO3A 3RA6A 3CC2F 2GLZA 3VMFB 4X3LA 3V7QA 3VI6A 5G4UC 1K9MH 5GANK 3NK7A 1VQ6F 4NUTA 3ON1A 3HAXD 4BVQA 4BY9D 3E1YA 3JAMM 1CK2A 1KQSF 3CG6A 5HXZA 5HY0A 1YJ9F 1XBIA 2LBWA 3PLAC 3CXCF 2KG4A 3CCSF 1GZ0A 3CPQA 5HY1A 1W2BF 5IT9M 5FLXM 3LWQC 3CCQF 3CCRF 3I55F 1S72F 1VQMF 2QI2A 1YJWF 2OTJF 1VQ7F 3CCUF 2FC3A 3PAFA 1YIJF 1SDSA 1X7OA 3E20B 1GO0A 1M90H 3G6EF 3OBWA 1IPAA 1X52A 3OW2F 1YI2F 2ALEA 1YHQF 2OTLF 4EI8A 1K73H 1YITF 1VQKF 3CD6F 1CN7A 3LWOC 3SIVA 3SIUA 3CCVF 4BW0B 4EI9A 1PXWA 3N4YA 3LWVC 3NMUC 4BVRA 3AGKA 3J81M 3I56F 1H7MA 1VQLF 1VQ4F 3D00A 5GIPC 2JNBA 3CMEF 2VGMA 3LWRC 2QA4F 1RA4A 3CC4F 1Q82H 3NVKE 1W3EX 1Q81H 2CZWA 3NVIB 3JCMM 1JJ2F 5G4VC 4EI7A 1Q86H 4C4WC 5FJ4C 3NK6A 1W42A 5GAPK 3G4SF 1QVGF 3IR9A 3CCJF 1NJIH 3FFMA 1W40A 3V3TA 2HVYD 4TZZA 1X7PA 3OBYA 2BO1A 1KC8H 5HY4A 1VQ9F 5DCVA 1VQOF 2OHWA 2QEXF 3WXMB 2F9ZC 5A2QM 1RLGA 5HWEA 1VQNF 5HXUA 3J7AR 1VQ5F 2KTVA 1T0KB 4BVTA 1M1KH 3GYQA 2KTUA 3CCLF 4LCKA 2VGNA 3O85A 2AIFA 1NMUB 3G71F 2LBXA 3CCMF 1N8RH 3CPWF 1QVFF 1VQ8F 3CCEF 1GO1A 3MCAB 2WALA 5GIOC 1K8AH 3RA5A 1YJNF 1Q7YH 4XCQA 3CMAF 5GINC 2FGYA 1E7KA 4X3MA 5HY2A 2OZBA 3V7EA 2I6DA 3N4ZA 3CC7F 3HJWC 1DT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWZ A;  3J80 M;  3LFO A;  1W41 A;  1VQP F;  5EWR A;  3LWP C;  1KD1 H;  5EO3 A;  3RA6 A;  3CC2 F;  3VMF B;  4X3L A;  3V7Q A;  3VI6 A;  5G4U C;  1K9M H;  5GAN K;  3NK7 A;  1VQ6 F;  4NUT A;  3ON1 A;  3HAX D;  4BY9 D;  3E1Y A;  3JAM M;  1CK2 A;  1KQS F;  3CG6 A;  1YJ9 F;  1XBI A;  2LBW A;  3PLA C;  3CXC F;  2KG4 A;  3CCS F;  1GZ0 A;  3CPQ A;  1W2B F;  5IT9 M;  5FLX M;  3LWQ C;  3CCQ F;  3CCR F;  3I55 F;  1S72 F;  1VQM F;  2QI2 A;  1YJW F;  2OTJ F;  1VQ7 F;  3CCU F;  2FC3 A;  3PAF A;  1YIJ F;  1SDS A;  1X7O A;  3E20 B;  1GO0 A;  1M90 H;  3G6E F;  3OBW A;  1IPA A;  1X52 A;  3OW2 F;  1YI2 F;  2ALE A;  1YHQ F;  2OTL F;  1K73 H;  1YIT F;  1VQK F;  3CD6 F;  1CN7 A;  3LWO C;  3SIV A;  3SIU A;  3CCV F;  4BW0 B;  1PXW A;  3N4Y A;  3LWV C;  3NMU C;  3AGK A;  3J81 M;  3I56 F;  1H7M A;  1VQL F;  1VQ4 F;  5GIP C;  2JNB A;  3CME F;  2VGM A;  3LWR C;  2QA4 F;  1RA4 A;  3CC4 F;  1Q82 H;  3NVK E;  1W3E X;  1Q81 H;  2CZW A;  3NVI B;  3JCM M;  1JJ2 F;  5G4V C;  5FJ4 C;  1Q86 H;  4C4W C;  3NK6 A;  1W42 A;  5GAP K;  3G4S F;  1QVG F;  3IR9 A;  3CCJ F;  1NJI H;  3FFM A;  1W40 A;  2HVY D;  4TZZ A;  1X7P A;  3OBY A;  2BO1 A;  1KC8 H;  1VQ9 F;  5DCV A;  1VQO F;  2OHW A;  2QEX F;  3WXM B;  5A2Q M;  1RLG A;  1VQN F;  3J7A R;  1VQ5 F;  2KTV A;  1T0K B;  1M1K H;  3GYQ A;  2KTU A;  3CCL F;  4LCK A;  2VGN A;  3O85 A;  2AIF A;  1NMU B;  3G71 F;  2LBX A;  3CCM F;  1N8R H;  3CPW F;  1QVF F;  1VQ8 F;  3CCE F;  1GO1 A;  3MCA B;  2WAL A;  5GIO C;  1K8A H;  3RA5 A;  1YJN F;  1Q7Y H;  3CMA F;  5GIN C;  1E7K A;  4X3M A;  2OZB A;  3V7E A;  2I6D A;  3N4Z A;  3CC7 F;  3HJW C;  1DT9 A; 
#chains in the Genus database with same CATH topology
 1ZWZ A;  5EB1 B;  2RHL A;  4U3J B;  3JAK B;  1W59 A;  2HP0 B;  4NQ3 A;  4O4J A;  2I6R A;  5EAZ A;  1VQP F;  5EWR A;  3N2G B;  4B5C A;  3JAS B;  3MBM A;  3VCZ A;  3FD6 A;  3HKD B;  2ZVZ A;  2CHS A;  3JAW B;  4X1I B;  3K12 A;  5JVD A;  3P10 A;  5GAN K;  1K9M H;  4C81 A;  3WJQ A;  4ZOL A;  3S0W A;  3RYF A;  3E1Y A;  3JAM M;  2HS4 A;  1KQS F;  5C8Y A;  5HXZ A;  5HY0 A;  2LBW A;  3IKE A;  4ZHQ A;  5J2U A;  3WPW A;  3CCS F;  1VQV A;  1TVK A;  5IT9 M;  3CCQ F;  3LWQ C;  2ZAU A;  1QAH A;  3WGK A;  2BTU A;  1S72 F;  3ZP7 A;  2OTM A;  1YJW F;  4F6R A;  1VQ7 F;  3PAF A;  1SDS A;  1X7O A;  3M1X A;  4TV9 B;  3OBW A;  2HP3 A;  1IPA A;  2R75 1;  2W8B C;  4ZI7 B;  2ZOD A;  4IIJ A;  1FFX B;  3OW2 F;  2ALE A;  2HRU A;  2LCA A;  5CB4 A;  3CYQ A;  1CN7 A;  3SIV A;  1SA0 A;  3N4Y A;  3LWV C;  4E6E A;  3JVH A;  4FFB B;  1OAP A;  5CA0 B;  3K14 A;  2Q1Y A;  2IAF A;  3CC4 F;  4C8G A;  2UYN A;  2H6L A;  2CZW A;  3RYC A;  5J2T B;  1JN1 A;  5G4V C;  1Q86 H;  1QVG F;  2N48 A;  2HQS C;  3QTY A;  5JVD B;  4C8I A;  3FBA A;  2HVY D;  2BO1 A;  4ZOL B;  2DYY A;  1W5F A;  4G4V A;  3RYF B;  4O4H A;  5EIB D;  4BT2 A;  5C8Y B;  1RLG A;  4ZHQ B;  5FNV A;  5J2U B;  4BVT A;  5KX5 A;  1M1K H;  3GYQ A;  1QU9 A;  4ZHW A;  1TVK B;  3HTN A;  4BT3 A;  3C9T A;  1FSZ A;  3O85 A;  4WBN A;  3G71 F;  4I4T A;  3R0P A;  4YJ2 A;  3F0G A;  3MCA B;  3DC2 A;  3L7Q A;  1SZQ A;  3VOA A;  1Q7Y H;  3I3F A;  5LP6 A;  4O4L A;  1JY8 A;  4R40 B;  3D54 A;  3K2X A;  3QUW A;  3S06 A;  3JAL B;  5MN6 A;  4IIJ B;  1ONI A;  1Z5V A;  3C9R A;  2YXZ A;  3CC7 F;  1GX1 A;  5CB4 B;  3ZP4 A;  4ERH A;  3IEW A;  1SA0 B;  3WGN A;  4BVS A;  3RYH A;  3C9S A;  2UYJ A;  3VIU A;  3VMF B;  3VI6 A;  3V7Q A;  3DDN A;  1TUB B;  2Z1E A;  3LYB A;  5EZY A;  3RE3 A;  1ODE A;  4NUT A;  3IMP A;  3HAX D;  4BVQ A;  3C8L A;  4EB6 A;  4O4I A;  5IYZ B;  2UYN B;  1XBI A;  3RYC B;  4LNU A;  2Z1F A;  3CPQ A;  5HY1 A;  3LME A;  2KGW A;  2UZH A;  4X20 B;  5FLX M;  2L26 A;  3K0T A;  4B62 A;  1VQM F;  5GON A;  2QI2 A;  2PHN A;  5LP6 C;  3U0O A;  2OTJ F;  4O4H B;  1W55 A;  3KJK A;  4IHJ A;  5FNV B;  5KX5 B;  1X52 A;  4WBN B;  1YQN A;  1YI2 F;  1COM A;  4B46 A;  1YHQ F;  3F0E A;  3V4D A;  4I4T B;  1J7H A;  2P6Y A;  2RHH A;  1YIT F;  4YJ2 B;  2LBT A;  4B45 A;  1IV2 A;  4O2A A;  2YYE A;  5LXT A;  3CCV F;  3SIU A;  4EI9 A;  4O4L B;  3AGK A;  3D01 A;  3M4S A;  2HX0 A;  1H7M A;  2VXY A;  1VQ4 F;  1FNJ A;  3D00 A;  2B33 A;  4I55 A;  3TD4 A;  4I50 A;  4DRX B;  5LOV B;  3LWR C;  2QA4 F;  1IV3 A;  1W3E X;  3HKB A;  1W5B A;  5EB0 A;  3RYH B;  3NVI B;  5CA1 A;  3RYI A;  4EI7 A;  4C4W C;  3NK6 A;  1W42 A;  3G4S F;  3IR9 A;  5AVM A;  3CCJ F;  1NJI H;  3FFM A;  4KWE A;  5LA6 A;  1KC8 H;  4X1K B;  1VQ9 F;  5DCV A;  1VQO F;  2RHO A;  2QEX F;  4EB6 B;  2F9Z C;  5A2Q M;  1VQN F;  2EWC A;  3KE1 A;  2KTV A;  4BT6 A;  1VQ5 F;  5IJ0 A;  3ESJ A;  2H8E A;  3FPI A;  4G4Z A;  3VO8 A;  3ERN A;  2R6R 1;  2VAM A;  1GO1 A;  5GON B;  3MDO A;  2IG8 A;  1K8A H;  2H8C A;  4O4J B;  1PF5 A;  4XCQ A;  5HP7 A;  4G88 A;  3CMA F;  1JFF A;  1U43 A;  4IHJ B;  5GIN C;  1E7K A;  3MCQ A;  2OZB A;  2MQE A;  2I6D A;  3WGM A;  3KIZ A;  3KJJ A;  4ZHV A;  2V9Y A;  3IEQ A;  4O2A B;  5LXT B;  4BT7 A;  2BTO A;  4C82 A;  1W41 A;  2VAP A;  5EO3 A;  3RA6 A;  3CC2 F;  3P0Z A;  4X3L A;  2ZVY A;  3CB2 A;  2VAW A;  1W5E A;  4I55 B;  1T0A A;  2UYK A;  3NK7 A;  4I50 B;  4F6R B;  1VQ6 F;  3JAR A;  3JAT A;  3GHZ A;  3VTI C;  3CG6 A;  3HKB B;  2RB9 A;  4G4W A;  4U3J A;  5CA1 B;  1W57 A;  2HP0 A;  2KG4 A;  3MQW A;  4RQO A;  3N2G A;  3JAS A;  3CCR F;  4X1I A;  1CLI A;  2BTQ B;  3T80 A;  5LA6 B;  5KMG A;  3CCU F;  3ELC A;  2CVL A;  3E20 B;  3I7T A;  3VYU C;  3G6E F;  1M90 H;  3F0D A;  3TD3 A;  1IV1 A;  5IJ0 B;  3LDT A;  2CHT A;  1U3L A;  4EI8 A;  1K73 H;  5JCO C;  4HNA A;  5EIB C;  1VQK F;  3CD6 F;  2CSL A;  2Z01 A;  2QTP A;  3S0Y A;  1JFF B;  4BVR A;  3WGJ A;  3WJR A;  1W58 1;  2HRY A;  4BT5 A;  1OFU A;  5JH7 A;  1UI9 A;  2JNB A;  3BYQ A;  3M84 A;  1VHA A;  1FNK A;  1Q82 H;  3NVK E;  1Q81 H;  3CYP B;  3WGL A;  3JCM M;  1JJ2 F;  1U3P A;  2GZL A;  2Z1U A;  5MN5 A;  2GVI A;  3F0F A;  3HKC A;  3V3T A;  5ITZ A;  4TZZ A;  3QHD A;  5IJ9 A;  3OBY A;  4NWO B;  3JAR B;  5LP6 B;  3JAT B;  2OHW A;  3J7A R;  3N2K A;  4YJ3 A;  5J2T A;  3CCL F;  2AIF A;  1NMU B;  2LBX A;  1N8R H;  4TUY A;  3CPW F;  2K1S A;  1VQ8 F;  3CCE F;  3ZO8 A;  5KMG B;  5GIO C;  1R1M A;  3RA5 A;  5BMV A;  1YJN F;  5JQG A;  5MN4 A;  1Z5W A;  4X3M A;  3WPX A;  5HY2 A;  5EZY B;  3V7E A;  5LYJ A;  1XV2 A;  4HNA B;  3UT5 A;  3F6M A;  4O4I B;  1XRG A;  1JD1 A;  2CWJ A;  3GTZ A;  4X1Y A;  3J80 M;  1DBF A;  4LNU B;  3LFO A;  3LWP C;  4G4Y A;  1KD1 H;  3EOR A;  3HKE A;  2GLZ A;  3JAL A;  5EYP A;  5JH7 B;  5G4U C;  1YGY A;  3ON1 A;  4O2B A;  3VOB A;  4BY9 D;  1Q8R A;  1CK2 A;  4PWT A;  1YJ9 F;  2UYP A;  1KNJ A;  3S02 A;  2DT4 A;  3PLA C;  3CXC F;  1X25 A;  1GZ0 A;  1W2B F;  3I55 F;  3C9U A;  3HKC B;  5JCO A;  5ITZ B;  1TUB A;  5IJ9 B;  3P4E A;  4C8E A;  3E22 A;  3IKF A;  2FC3 A;  1YIJ F;  1U40 A;  4TV8 A;  3FD5 A;  5IYZ A;  2PMP A;  1GO0 A;  2HS3 A;  2ZF8 A;  3N2K B;  4YJ3 B;  3WJP A;  2AIZ P;  3ZOP A;  4X20 A;  2OTL F;  3Q8H A;  4TUY B;  1XHO A;  1H48 A;  3LWO C;  4ZHY B;  4BW0 B;  5BMV B;  2ZOV A;  1PXW A;  3JAK A;  3NMU C;  3RYI B;  5JQG B;  3OON A;  3VYT C;  3S0H A;  3J81 M;  3I56 F;  1VQL F;  1RQ7 A;  3HKD A;  3JAW A;  5GIP C;  5LYJ B;  3CME F;  2VGM A;  3UT5 B;  2AMT A;  5B8F A;  1RA4 A;  2Z1T A;  4BT4 A;  4M8I A;  4X1Y B;  2RHJ A;  4G4X A;  1W5A A;  5FJ4 C;  3TD5 A;  5GAP K;  4U39 A;  3HKE B;  2CW4 A;  1KNK A;  4DXD A;  5EYP B;  1UFY A;  1VK3 A;  2Q1X A;  1W40 A;  1X7P A;  4O2B B;  5HY4 A;  4DRX A;  5LOV A;  3WXM B;  5HWE A;  3S03 A;  5HXU A;  4TV9 A;  1T0K B;  1H47 A;  1VH8 A;  4ZI7 A;  2KTU A;  4LCK A;  1FFX A;  1NQ3 A;  2G9I A;  2VGN A;  3CCM F;  2HS0 A;  2IQQ A;  3VYS C;  3HWU A;  1QVF F;  2WAL A;  4ZK7 A;  3B6N A;  1RLU A;  3E22 B;  4X1K A;  1QD9 A;  2NMU A;  4TV8 B;  2FGY A;  1RQ2 A;  4RHA A;  5HP8 A;  1IV4 A;  3N4Z A;  4FFB A;  5CA0 A;  3HJW C;  1DT9 A;  3KHN A; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  3J80 M;  4BVS A;  3LFO A;  1W41 A;  4NQ3 A;  1VQP F;  5EWR A;  3LWP C;  1KD1 H;  5EO3 A;  3RA6 A;  3CC2 F;  2GLZ A;  3VMF B;  4X3L A;  3V7Q A;  3VI6 A;  5G4U C;  1K9M H;  5GAN K;  3NK7 A;  1VQ6 F;  4NUT A;  3ON1 A;  3HAX D;  4BVQ A;  4BY9 D;  3E1Y A;  3JAM M;  1CK2 A;  1KQS F;  3CG6 A;  5HXZ A;  5HY0 A;  1YJ9 F;  1XBI A;  2LBW A;  3PLA C;  3CXC F;  2KG4 A;  3CCS F;  1GZ0 A;  3CPQ A;  5HY1 A;  1W2B F;  5IT9 M;  5FLX M;  3LWQ C;  3CCQ F;  3CCR F;  3I55 F;  1S72 F;  1VQM F;  2QI2 A;  1YJW F;  2OTJ F;  1VQ7 F;  3CCU F;  2FC3 A;  3PAF A;  1YIJ F;  1SDS A;  1X7O A;  3E20 B;  1GO0 A;  1M90 H;  3G6E F;  3OBW A;  1IPA A;  1X52 A;  3OW2 F;  1YI2 F;  2ALE A;  1YHQ F;  2OTL F;  4EI8 A;  1K73 H;  1YIT F;  1VQK F;  3CD6 F;  1CN7 A;  3LWO C;  3SIV A;  3SIU A;  3CCV F;  4BW0 B;  4EI9 A;  1PXW A;  3N4Y A;  3LWV C;  3NMU C;  4BVR A;  3AGK A;  3J81 M;  3I56 F;  1H7M A;  1VQL F;  1VQ4 F;  3D00 A;  5GIP C;  2JNB A;  3CME F;  2VGM A;  3LWR C;  2QA4 F;  1RA4 A;  3CC4 F;  1Q82 H;  3NVK E;  1W3E X;  1Q81 H;  2CZW A;  3NVI B;  3JCM M;  1JJ2 F;  5G4V C;  4EI7 A;  1Q86 H;  4C4W C;  5FJ4 C;  3NK6 A;  1W42 A;  5GAP K;  3G4S F;  1QVG F;  3IR9 A;  3CCJ F;  1NJI H;  3FFM A;  1W40 A;  3V3T A;  2HVY D;  4TZZ A;  1X7P A;  3OBY A;  2BO1 A;  1KC8 H;  5HY4 A;  1VQ9 F;  5DCV A;  1VQO F;  2OHW A;  2QEX F;  3WXM B;  2F9Z C;  5A2Q M;  1RLG A;  5HWE A;  1VQN F;  5HXU A;  3J7A R;  1VQ5 F;  2KTV A;  1T0K B;  4BVT A;  1M1K H;  3GYQ A;  2KTU A;  3CCL F;  4LCK A;  2VGN A;  3O85 A;  2AIF A;  1NMU B;  3G71 F;  2LBX A;  3CCM F;  1N8R H;  3CPW F;  1QVF F;  1VQ8 F;  3CCE F;  1GO1 A;  3MCA B;  2WAL A;  5GIO C;  1K8A H;  3RA5 A;  1YJN F;  1Q7Y H;  4XCQ A;  3CMA F;  5GIN C;  2FGY A;  1E7K A;  4X3M A;  5HY2 A;  2OZB A;  3V7E A;  2I6D A;  3N4Z A;  3CC7 F;  3HJW C;  1DT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...