1KD1H

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kd1H00
3V7QA 1W41A 3HJWC 2HVYD 1YJWF 1X7PA 5FLXM 2BO1A 3CCSF 1X7OA 1Q82H 1KQSF 1VQ8F 1K73H 3SIVA 1X52A 3CD6F 1GO1A 1Q81H 2KG4A 5GINC 1YJNF 1NMUB 1IPAA 3CCJF 1GO0A 2FC3A 5GIOC 1VQ7F 3NVKE 1N8RH 2KTVA 5EWRA 1VQLF 2CZWA 3CPQA 1VQ9F 1M1KH 3O85A 1YHQF 2I6DA 5IT9M 3AGKA 3NK6A 4NUTA 3HAXD 3G71F 5G4UC 4BY9D 3LWQC 1M90H 3J81M 1JJ2F 1VQPF 5GIPC 3CPWF 3VI6A 3LWOC 3FFMA 3LWPC 4TZZA 3NMUC 3SIUA 2QI2A 3CMAF 3CCUF 3V7EA 3LWRC 4LCKA 1QVGF 3E20B 1W42A 5FJ4C 1K8AH 3LFOA 2QEXF 1PXWA 3CCRF 3JCMM 4C4WC 3GYQA 2VGNA 3NK7A 2JNBA 1YI2F 5G4VC 1S72F 1DT9A 3I56F 1GZ0A 2VGMA 1VQ6F 3RA5A 3CC2F 3J7AR 3CXCF 1VQ5F 3OBYA 3WXMB 2OHWA 3I55F 1KC8H 1VQNF 3CG6A 5EO3A 3NVIB 1XBIA 1YJ9F 1T0KB 1W2BF 3MCAB 5A2QM 2LBXA 5DCVA 3CC4F 3J80M 2WALA 1VQOF 3CCEF 2OZBA 3ON1A 1YIJF 3G4SF 3CCMF 1K9MH 3PAFA 2AIFA 3LWVC 1VQMF 1Q86H 2LBWA 1E7KA 2OTLF 4X3LA 1VQ4F 3PLAC 1CK2A 1VQKF 1RA4A 3VMFB 2KTUA 3JAMM 3OBWA 1YITF 5GAPK 3N4YA 2OTJF 1Q7YH 3N4ZA 1CN7A 3E1YA 3CCQF 3CCLF 3G6EF 4BW0B 3CMEF 1RLGA 4X3MA 1NJIH 1H7MA 3IR9A 1ZWZA 3OW2F 2ALEA 2QA4F 3CCVF 1SDSA 1W3EX 3RA6A 5GANK 1W40A 1QVFF 3CC7F 1KD1H
chains in the Genus database with same CATH superfamily
1R1MA 4O2AB 4BVTA 2B33A 3TD4A 4LNUB 4I50B 2ZOVA 1Q82H 3JAKB 3N2KA 1VK3A 4YJ3B 3CD6F 5GINC 3KIZA 1YJNF 3CCJF 1T0AA 3JARB 3ELCA 3K12A 1W5FA 5GIOC 1VQ7F 1N8RH 3V3TA 5EB1B 1M1KH 5J2UB 5JQGA 4YJ2B 4ZHWA 3NK6A 3JALA 2CW4A 3JAWB 3QUWA 5G4UC 2RB9A 1IV1A 3TD3A 1VQPF 3WGJA 5GIPC 4TV8A 3K0TA 5AVMA 2VXYA 4ZK7A 4ZI7B 2LBTA 5BMVA 4G4YA 2UYKA 3CMAF 3IEWA 4LCKA 3LDTA 5FJ4C 5J2TA 2HS0A 2CWJA 3CCRF 3GYQA 1JY8A 3IMPA 4WBNA 3F0DA 3KHNA 3FPIA 1IV3A 5EYPA 5LP6A 4I4TA 3JALB 4BT7A 1OFUA 3S0YA 1X25A 3CC2F 3P0ZA 4IHJA 4TV8B 1RLUA 3I55F 1KC8H 5HY2A 2H6LA 3C9RA 4I55B 4BT6A 3CG6A 2PHNA 5EO3A 1XBIA 1T0KB 3D01A 2GVIA 1UI9A 3TD5A 5HY0A 3WJQA 4C81A 2LBXA 3N2GB 3ZP7A 1W2BF 2Z1TA 1QD9A 1VQOF 4ZHVA 2DT4A 3CCEF 5J2TB 1DBFA 3WJRA 5JVDA 4ZHQA 2UYNB 3G4SF 2H8CA 3L7QA 4O4LB 3PAFA 3WPXA 3HWUA 5EYPB 2LBWA 3HKBA 2OTLF 1VQ4F 5EIBD 3D00A 3PLAC 2LCAA 4I4TB 4PWTA 2VAPA 2GLZA 1RQ7A 4EI8A 3N4YA 4DRXA 3I7TA 1Q7YH 4O4HA 4IHJB 4O4JA 1ONIA 1NJIH 1JFFB 2Z1UA 1XHOA 3OW2F 2QA4F 4IIJA 5GANK 3RYIA 5JCOC 1W5AA 1KD1H 4I50A 5JVDB 3V7QA 1W41A 4ZHQB 1W57A 4FFBA 1CLIA 3VOAA 3VYUC 4U39A 4YJ3A 1X7PA 5FLXM 4BVRA 1JD1A 3RYCA 1J7HA 3SIVA 5C8YA 1GO1A 2KG4A 1NMUB 2BTUA 5CB4B 2FC3A 1IV4A 4RHAA 1VH8A 2CSLA 3U0OA 3BYQA 3HTNA 4DRXB 3CPQA 1U3PA 2R6R1 2Z1FA 5IYZB 1U40A 2I6DA 2UYJA 5IT9M 3AGKA 4NUTA 4O4JB 2HP0B 3LWQC 1M90H 1W581 1Z5VA 1JJ2F 3RYIB 4ZI7A 1VQVA 5LOVB 2GZLA 2R751 3FFMA 3LWPC 4TZZA 4FFBB 3SIUA 2QI2A 1Z5WA 3CCUF 3S03A 3V7EA 2IQQA 3DC2A 1YGYA 3RYCB 5C8YB 4TV9B 5MN4A 2ZVYA 4KWEA 4F6RA 3P10A 3HKDB 3I3FA 4ZHYB 1S72F 3I56F 1GZ0A 1QAHA 3UT5B 4ERHA 5LXTB 2FGYA 3RA5A 3ZO8A 2VAWA 3WGKA 3CYPB 3CXCF 2CVLA 3F6MA 4I55A 3OBYA 5LP6C 5EIBC 3WPWA 5HY4A 1SZQA 3VO8A 2IAFA 3ZOPA 3N2GA 3GHZA 5IJ0B 1YJ9F 3OONA 3JATA 3VYTC 5KX5B 5A2QM 3CC4F 3J80M 2Z1EA 2UYNA 5IJ9A 2WALA 2HRUA 4R40B 4O4LA 1YIJF 3CCMF 2K1SA 3GTZA 4F6RB 1K9MH 1W59A 3RE3A 1Q86H 4NQ3A 1CK2A 1RA4A 3VMFB 2QTPA 3S0HA 2HP3A 2DYYA 5GAPK 3RYHA 3KJKA 1XV2A 5HWEA 5JH7A 1JFFA 3JASA 3MBMA 3F0EA 3ZP4A 2L26A 1RLGA 5CA0A 2ALEA 3VCZA 3JATB 4EI7A 4G4ZA 3HKCA 4O4IA 3JVHA 5IJ9B 1FNJA 5HXUA 3HJWC 4HNAB 2HVYD 1U43A 3WGLA 1YJWF 3DDNA 5LYJB 1X7OA 4B62A 4DXDA 1KQSF 5CB4A 3ERNA 1Q81H 1TVKA 2PMPA 3RYFA 2H8EA 3K2XA 4E6EA 2ZODA 2ZAUA 1SA0B 5FNVA 1Q8RA 3MQWA 3RYHB 5IYZA 2CZWA 1U3LA 2EWCA 2HP0A 4BT3A 5JH7B 3O85A 2N48A 3JASB 1YHQF 1KNJA 3MDOA 3IKEA 1GX1A 3HAXD 5CA0B 3QHDA 3J81M 4TUYA 2HX0A 5LOVA 2IG8A 4X1YB 1XRGA 3HKCB 3C9UA 4O4IB 3CPWF 3VI6A 3LWOC 3NMUC 4X1KB 1KNKA 4O2BA 5EB0A 4BT4A 3LWRC 3WGMA 1QVGF 4B5CA 4TV9A 1JN1A 3ESJA 1W42A 1TVKB 1K8AH 4RQOA 3RYFB 3M84A 2QEXF 1PXWA 3HKDA 3JCMM 2ZVZA 1W5EA 4C4WC 5FNVB 2UYPA 2VGNA 1TUBA 2JNBA 4BVQA 3UT5A 4B46A 5G4VC 3S06A 4ZOLB 1YI2F 5LXTA 1DT9A 4BT2A 4G4WA 3HKEA 4TUYB 3C8LA 3WGNA 5MN5A 4U3JA 5JCOA 2OHWA 2BTOA 5IJ0A 5ITZA 5KX5A 5CA1A 3MCQA 3F0GA 4XCQA 3QTYA 4O2BB 1NQ3A 5DCVA 2HS4A 3VTIC 2AMTA 3ON1A 5KMGA 1FFXB 3KE1A 5EZYA 2V9YA 1TUBB 2HRYA 2AIZP 1VQMF 1E7KA 4X3LA 4NWOB 1YQNA 1VQKF 1OAPA 3FD5A 3JAMM 3OBWA 3HKEB 1YITF 1VHAA 1FSZA 5HP8A 4U3JB 1CN7A 3K14A 3CCQF 5B8FA 3CCLF 2CHTA 5ITZB 4M8IA 4BW0B 3CMEF 5CA1B 1H7MA 2G9IA 3IR9A 3CCVF 1SDSA 5HY1A 4X1IB 1W55A 4HNAA 4G4VA 5LYJA 5KMGB 3IEQA 5EZYB 2BO1A 3CCSF 4G4XA 1VQ8F 1K73H 1X52A 1SA0A 3D54A 2ZF8A 1IPAA 3N2KB 1GO0A 2NMUA 3S0WA 5MN6A 3NVKE 4BVSA 2KTVA 5EWRA 1VQLF 1VQ9F 2OTMA 1IV2A 4X20A 2Q1XA 3G71F 5JQGB 4X1YA 4BY9D 3FBAA 2HS3A 3IKFA 3M1XA 4X1KA 2VAMA 3R0PA 2BTQB 5HP7A 1PF5A 3E20B 5BMVB 3S02A 4C8EA 3LFOA 5GONA 4ZOLA 3NK7A 2RHOA 3Q8HA 4BT5A 4B45A 4WBNB 1COMA 5LP6B 2VGMA 1VQ6F 4X20B 4C8IA 4EB6A 3KJJA 1FNKA 3V4DA 2F9ZC 3J7AR 1VQ5F 3WJPA 4EI9A 2RHLA 3M4SA 3WXMB 3B6NA 2Z01A 1W5BA 3LYBA 1VQNF 3CB2A 4C82A 3NVIB 2HQSC 2RHHA 3MCAB 2Q1YA 2MQEA 2YYEA 3P4EA 1FFXA 5LA6A 3E22A 3T80A 5GONB 2CHSA 2RHJA 4O2AA 2OZBA 3VOBA 1H47A 3C9SA 4LNUA 1RQ2A 2AIFA 3VYSC 2UZHA 3JAKA 3LWVC 5EAZA 1QU9A 2P6YA 2KTUA 3HKBB 3JARA 1ODEA 2W8BC 3F0FA 4EB6B 2OTJF 5HXZA 4C8GA 3N4ZA 5J2UA 3E1YA 3C9TA 2KGWA 4YJ2A 2I6RA 3G6EF 4O4HB 3JAWA 4X3MA 1UFYA 4G88A 4X1IA 3VIUA 1ZWZA 3EORA 2YXZA 3LMEA 1W3EX 3RA6A 1W40A 3CYQA 1QVFF 3FD6A 5LA6B 3CC7F 4IIJB 3E22B 1H48A
chains in the Genus database with same CATH topology
3V7QA 1W41A 4BVTA 3HJWC 2HVYD 1YJWF 1X7PA 5FLXM 2BO1A 4BVRA 3CCSF 1X7OA 1Q82H 1KQSF 1VQ8F 1K73H 3SIVA 1X52A 3CD6F 1GO1A 1Q81H 2KG4A 5GINC 1YJNF 1NMUB 1IPAA 3CCJF 1GO0A 2FC3A 5GIOC 1VQ7F 3NVKE 4BVSA 1N8RH 2KTVA 5EWRA 1VQLF 2CZWA 3CPQA 3V3TA 1VQ9F 1M1KH 3O85A 1YHQF 2I6DA 5IT9M 3AGKA 3NK6A 4NUTA 3HAXD 3G71F 5G4UC 4BY9D 3LWQC 1M90H 3J81M 1JJ2F 1VQPF 5GIPC 3CPWF 3VI6A 3LWOC 3FFMA 3LWPC 4TZZA 3NMUC 3SIUA 2QI2A 3CMAF 3CCUF 3V7EA 3LWRC 4LCKA 1QVGF 3E20B 1W42A 5FJ4C 1K8AH 3LFOA 2QEXF 1PXWA 3CCRF 3JCMM 4C4WC 3GYQA 2VGNA 3NK7A 2JNBA 4BVQA 1YI2F 5G4VC 1S72F 1DT9A 3I56F 1GZ0A 2VGMA 1VQ6F 2FGYA 3RA5A 2F9ZC 3CC2F 3J7AR 3CXCF 1VQ5F 4EI9A 3OBYA 3WXMB 2OHWA 3I55F 1KC8H 5HY2A 1VQNF 5HY4A 3CG6A 5EO3A 4XCQA 3NVIB 1XBIA 1YJ9F 1T0KB 1W2BF 5HY0A 3MCAB 2LBXA 5A2QM 5DCVA 3CC4F 3J80M 2WALA 1VQOF 3CCEF 2OZBA 3ON1A 1YIJF 3G4SF 3CCMF 1K9MH 3PAFA 2AIFA 3LWVC 4NQ3A 1VQMF 2LBWA 1Q86H 1E7KA 2OTLF 4X3LA 1VQ4F 3D00A 3PLAC 1CK2A 1VQKF 1RA4A 3VMFB 2KTUA 3JAMM 3OBWA 1YITF 2GLZA 5GAPK 4EI8A 3N4YA 2OTJF 5HXZA 5HWEA 3N4ZA 1Q7YH 1CN7A 3E1YA 3CCQF 3CCLF 3G6EF 4BW0B 3CMEF 1RLGA 4X3MA 1NJIH 1H7MA 3IR9A 1ZWZA 3OW2F 2ALEA 2QA4F 3CCVF 1SDSA 5HY1A 1W3EX 4EI7A 3RA6A 5GANK 1W40A 1QVFF 5HXUA 3CC7F 1KD1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7Q A;  1W41 A;  3HJW C;  2HVY D;  1YJW F;  1X7P A;  5FLX M;  2BO1 A;  3CCS F;  1X7O A;  1Q82 H;  1KQS F;  1VQ8 F;  1K73 H;  3SIV A;  1X52 A;  3CD6 F;  1GO1 A;  1Q81 H;  2KG4 A;  5GIN C;  1YJN F;  1NMU B;  1IPA A;  3CCJ F;  1GO0 A;  2FC3 A;  5GIO C;  1VQ7 F;  3NVK E;  1N8R H;  2KTV A;  5EWR A;  1VQL F;  2CZW A;  3CPQ A;  1VQ9 F;  1M1K H;  3O85 A;  1YHQ F;  2I6D A;  5IT9 M;  3AGK A;  3NK6 A;  4NUT A;  3HAX D;  3G71 F;  5G4U C;  4BY9 D;  3LWQ C;  1M90 H;  3J81 M;  1JJ2 F;  1VQP F;  5GIP C;  3CPW F;  3VI6 A;  3LWO C;  3FFM A;  3LWP C;  4TZZ A;  3NMU C;  3SIU A;  2QI2 A;  3CMA F;  3CCU F;  3V7E A;  3LWR C;  4LCK A;  1QVG F;  3E20 B;  1W42 A;  5FJ4 C;  1K8A H;  3LFO A;  2QEX F;  1PXW A;  3CCR F;  3JCM M;  4C4W C;  3GYQ A;  2VGN A;  3NK7 A;  2JNB A;  1YI2 F;  5G4V C;  1S72 F;  1DT9 A;  3I56 F;  1GZ0 A;  2VGM A;  1VQ6 F;  3RA5 A;  3CC2 F;  3J7A R;  3CXC F;  1VQ5 F;  3OBY A;  3WXM B;  2OHW A;  3I55 F;  1KC8 H;  1VQN F;  3CG6 A;  5EO3 A;  3NVI B;  1XBI A;  1YJ9 F;  1T0K B;  1W2B F;  3MCA B;  5A2Q M;  2LBX A;  5DCV A;  3CC4 F;  3J80 M;  2WAL A;  1VQO F;  3CCE F;  2OZB A;  3ON1 A;  1YIJ F;  3G4S F;  3CCM F;  1K9M H;  3PAF A;  2AIF A;  3LWV C;  1VQM F;  1Q86 H;  2LBW A;  1E7K A;  2OTL F;  4X3L A;  1VQ4 F;  3PLA C;  1CK2 A;  1VQK F;  1RA4 A;  3VMF B;  2KTU A;  3JAM M;  3OBW A;  1YIT F;  5GAP K;  3N4Y A;  2OTJ F;  1Q7Y H;  3N4Z A;  1CN7 A;  3E1Y A;  3CCQ F;  3CCL F;  3G6E F;  4BW0 B;  3CME F;  1RLG A;  4X3M A;  1NJI H;  1H7M A;  3IR9 A;  1ZWZ A;  3OW2 F;  2ALE A;  2QA4 F;  3CCV F;  1SDS A;  1W3E X;  3RA6 A;  5GAN K;  1W40 A;  1QVF F;  3CC7 F;  1KD1 H; 
#chains in the Genus database with same CATH topology
 1R1M A;  4O2A B;  4BVT A;  2B33 A;  3TD4 A;  4LNU B;  4I50 B;  2ZOV A;  1Q82 H;  3JAK B;  3N2K A;  1VK3 A;  4YJ3 B;  3CD6 F;  5GIN C;  3KIZ A;  1YJN F;  3CCJ F;  1T0A A;  3JAR B;  3ELC A;  3K12 A;  1W5F A;  5GIO C;  1VQ7 F;  1N8R H;  3V3T A;  5EB1 B;  1M1K H;  5J2U B;  5JQG A;  4YJ2 B;  4ZHW A;  3NK6 A;  3JAL A;  2CW4 A;  3JAW B;  3QUW A;  5G4U C;  2RB9 A;  1IV1 A;  3TD3 A;  1VQP F;  3WGJ A;  5GIP C;  4TV8 A;  3K0T A;  5AVM A;  2VXY A;  4ZK7 A;  4ZI7 B;  2LBT A;  5BMV A;  4G4Y A;  2UYK A;  3CMA F;  3IEW A;  4LCK A;  3LDT A;  5FJ4 C;  5J2T A;  2HS0 A;  2CWJ A;  3CCR F;  3GYQ A;  1JY8 A;  3IMP A;  4WBN A;  3F0D A;  3KHN A;  3FPI A;  1IV3 A;  5EYP A;  5LP6 A;  4I4T A;  3JAL B;  4BT7 A;  1OFU A;  3S0Y A;  1X25 A;  3CC2 F;  3P0Z A;  4IHJ A;  4TV8 B;  1RLU A;  3I55 F;  1KC8 H;  5HY2 A;  2H6L A;  3C9R A;  4I55 B;  4BT6 A;  3CG6 A;  2PHN A;  5EO3 A;  1XBI A;  1T0K B;  3D01 A;  2GVI A;  1UI9 A;  3TD5 A;  5HY0 A;  3WJQ A;  4C81 A;  2LBX A;  3N2G B;  3ZP7 A;  1W2B F;  2Z1T A;  1QD9 A;  1VQO F;  4ZHV A;  2DT4 A;  3CCE F;  5J2T B;  1DBF A;  3WJR A;  5JVD A;  4ZHQ A;  2UYN B;  3G4S F;  2H8C A;  3L7Q A;  4O4L B;  3PAF A;  3WPX A;  3HWU A;  5EYP B;  2LBW A;  3HKB A;  2OTL F;  1VQ4 F;  5EIB D;  3D00 A;  3PLA C;  2LCA A;  4I4T B;  4PWT A;  2VAP A;  2GLZ A;  1RQ7 A;  4EI8 A;  3N4Y A;  4DRX A;  3I7T A;  1Q7Y H;  4O4H A;  4IHJ B;  4O4J A;  1ONI A;  1NJI H;  1JFF B;  2Z1U A;  1XHO A;  3OW2 F;  2QA4 F;  4IIJ A;  5GAN K;  3RYI A;  5JCO C;  1W5A A;  1KD1 H;  4I50 A;  5JVD B;  3V7Q A;  1W41 A;  4ZHQ B;  1W57 A;  4FFB A;  1CLI A;  3VOA A;  3VYU C;  4U39 A;  4YJ3 A;  1X7P A;  5FLX M;  4BVR A;  1JD1 A;  3RYC A;  1J7H A;  3SIV A;  5C8Y A;  1GO1 A;  2KG4 A;  1NMU B;  2BTU A;  5CB4 B;  2FC3 A;  1IV4 A;  4RHA A;  1VH8 A;  2CSL A;  3U0O A;  3BYQ A;  3HTN A;  4DRX B;  3CPQ A;  1U3P A;  2R6R 1;  2Z1F A;  5IYZ B;  1U40 A;  2I6D A;  2UYJ A;  5IT9 M;  3AGK A;  4NUT A;  4O4J B;  2HP0 B;  3LWQ C;  1M90 H;  1W58 1;  1Z5V A;  1JJ2 F;  3RYI B;  4ZI7 A;  1VQV A;  5LOV B;  2GZL A;  2R75 1;  3FFM A;  3LWP C;  4TZZ A;  4FFB B;  3SIU A;  2QI2 A;  1Z5W A;  3CCU F;  3S03 A;  3V7E A;  2IQQ A;  3DC2 A;  1YGY A;  3RYC B;  5C8Y B;  4TV9 B;  5MN4 A;  2ZVY A;  4KWE A;  4F6R A;  3P10 A;  3HKD B;  3I3F A;  4ZHY B;  1S72 F;  3I56 F;  1GZ0 A;  1QAH A;  3UT5 B;  4ERH A;  5LXT B;  2FGY A;  3RA5 A;  3ZO8 A;  2VAW A;  3WGK A;  3CYP B;  3CXC F;  2CVL A;  3F6M A;  4I55 A;  3OBY A;  5LP6 C;  5EIB C;  3WPW A;  5HY4 A;  1SZQ A;  3VO8 A;  2IAF A;  3ZOP A;  3N2G A;  3GHZ A;  5IJ0 B;  1YJ9 F;  3OON A;  3JAT A;  3VYT C;  5KX5 B;  5A2Q M;  3CC4 F;  3J80 M;  2Z1E A;  2UYN A;  5IJ9 A;  2WAL A;  2HRU A;  4R40 B;  4O4L A;  1YIJ F;  3CCM F;  2K1S A;  3GTZ A;  4F6R B;  1K9M H;  1W59 A;  3RE3 A;  1Q86 H;  4NQ3 A;  1CK2 A;  1RA4 A;  3VMF B;  2QTP A;  3S0H A;  2HP3 A;  2DYY A;  5GAP K;  3RYH A;  3KJK A;  1XV2 A;  5HWE A;  5JH7 A;  1JFF A;  3JAS A;  3MBM A;  3F0E A;  3ZP4 A;  2L26 A;  1RLG A;  5CA0 A;  2ALE A;  3VCZ A;  3JAT B;  4EI7 A;  4G4Z A;  3HKC A;  4O4I A;  3JVH A;  5IJ9 B;  1FNJ A;  5HXU A;  3HJW C;  4HNA B;  2HVY D;  1U43 A;  3WGL A;  1YJW F;  3DDN A;  5LYJ B;  1X7O A;  4B62 A;  4DXD A;  1KQS F;  5CB4 A;  3ERN A;  1Q81 H;  1TVK A;  2PMP A;  3RYF A;  2H8E A;  3K2X A;  4E6E A;  2ZOD A;  2ZAU A;  1SA0 B;  5FNV A;  1Q8R A;  3MQW A;  3RYH B;  5IYZ A;  2CZW A;  1U3L A;  2EWC A;  2HP0 A;  4BT3 A;  5JH7 B;  3O85 A;  2N48 A;  3JAS B;  1YHQ F;  1KNJ A;  3MDO A;  3IKE A;  1GX1 A;  3HAX D;  5CA0 B;  3QHD A;  3J81 M;  4TUY A;  2HX0 A;  5LOV A;  2IG8 A;  4X1Y B;  1XRG A;  3HKC B;  3C9U A;  4O4I B;  3CPW F;  3VI6 A;  3LWO C;  3NMU C;  4X1K B;  1KNK A;  4O2B A;  5EB0 A;  4BT4 A;  3LWR C;  3WGM A;  1QVG F;  4B5C A;  4TV9 A;  1JN1 A;  3ESJ A;  1W42 A;  1TVK B;  1K8A H;  4RQO A;  3RYF B;  3M84 A;  2QEX F;  1PXW A;  3HKD A;  3JCM M;  2ZVZ A;  1W5E A;  4C4W C;  5FNV B;  2UYP A;  2VGN A;  1TUB A;  2JNB A;  4BVQ A;  3UT5 A;  4B46 A;  5G4V C;  3S06 A;  4ZOL B;  1YI2 F;  5LXT A;  1DT9 A;  4BT2 A;  4G4W A;  3HKE A;  4TUY B;  3C8L A;  3WGN A;  5MN5 A;  4U3J A;  5JCO A;  2OHW A;  2BTO A;  5IJ0 A;  5ITZ A;  5KX5 A;  5CA1 A;  3MCQ A;  3F0G A;  4XCQ A;  3QTY A;  4O2B B;  1NQ3 A;  5DCV A;  2HS4 A;  3VTI C;  2AMT A;  3ON1 A;  5KMG A;  1FFX B;  3KE1 A;  5EZY A;  2V9Y A;  1TUB B;  2HRY A;  2AIZ P;  1VQM F;  1E7K A;  4X3L A;  4NWO B;  1YQN A;  1VQK F;  1OAP A;  3FD5 A;  3JAM M;  3OBW A;  3HKE B;  1YIT F;  1VHA A;  1FSZ A;  5HP8 A;  4U3J B;  1CN7 A;  3K14 A;  3CCQ F;  5B8F A;  3CCL F;  2CHT A;  5ITZ B;  4M8I A;  4BW0 B;  3CME F;  5CA1 B;  1H7M A;  2G9I A;  3IR9 A;  3CCV F;  1SDS A;  5HY1 A;  4X1I B;  1W55 A;  4HNA A;  4G4V A;  5LYJ A;  5KMG B;  3IEQ A;  5EZY B;  2BO1 A;  3CCS F;  4G4X A;  1VQ8 F;  1K73 H;  1X52 A;  1SA0 A;  3D54 A;  2ZF8 A;  1IPA A;  3N2K B;  1GO0 A;  2NMU A;  3S0W A;  5MN6 A;  3NVK E;  4BVS A;  2KTV A;  5EWR A;  1VQL F;  1VQ9 F;  2OTM A;  1IV2 A;  4X20 A;  2Q1X A;  3G71 F;  5JQG B;  4X1Y A;  4BY9 D;  3FBA A;  2HS3 A;  3IKF A;  3M1X A;  4X1K A;  2VAM A;  3R0P A;  2BTQ B;  5HP7 A;  1PF5 A;  3E20 B;  5BMV B;  3S02 A;  4C8E A;  3LFO A;  5GON A;  4ZOL A;  3NK7 A;  2RHO A;  3Q8H A;  4BT5 A;  4B45 A;  4WBN B;  1COM A;  5LP6 B;  2VGM A;  1VQ6 F;  4X20 B;  4C8I A;  4EB6 A;  3KJJ A;  1FNK A;  3V4D A;  2F9Z C;  3J7A R;  1VQ5 F;  3WJP A;  4EI9 A;  2RHL A;  3M4S A;  3WXM B;  3B6N A;  2Z01 A;  1W5B A;  3LYB A;  1VQN F;  3CB2 A;  4C82 A;  3NVI B;  2HQS C;  2RHH A;  3MCA B;  2Q1Y A;  2MQE A;  2YYE A;  3P4E A;  1FFX A;  5LA6 A;  3E22 A;  3T80 A;  5GON B;  2CHS A;  2RHJ A;  4O2A A;  2OZB A;  3VOB A;  1H47 A;  3C9S A;  4LNU A;  1RQ2 A;  2AIF A;  3VYS C;  2UZH A;  3JAK A;  3LWV C;  5EAZ A;  1QU9 A;  2P6Y A;  2KTU A;  3HKB B;  3JAR A;  1ODE A;  2W8B C;  3F0F A;  4EB6 B;  2OTJ F;  5HXZ A;  4C8G A;  3N4Z A;  5J2U A;  3E1Y A;  3C9T A;  2KGW A;  4YJ2 A;  2I6R A;  3G6E F;  4O4H B;  3JAW A;  4X3M A;  1UFY A;  4G88 A;  4X1I A;  3VIU A;  1ZWZ A;  3EOR A;  2YXZ A;  3LME A;  1W3E X;  3RA6 A;  1W40 A;  3CYQ A;  1QVF F;  3FD6 A;  5LA6 B;  3CC7 F;  4IIJ B;  3E22 B;  1H48 A; 
#chains in the Genus database with same CATH homology
 3V7Q A;  1W41 A;  4BVT A;  3HJW C;  2HVY D;  1YJW F;  1X7P A;  5FLX M;  2BO1 A;  4BVR A;  3CCS F;  1X7O A;  1Q82 H;  1KQS F;  1VQ8 F;  1K73 H;  3SIV A;  1X52 A;  3CD6 F;  1GO1 A;  1Q81 H;  2KG4 A;  5GIN C;  1YJN F;  1NMU B;  1IPA A;  3CCJ F;  1GO0 A;  2FC3 A;  5GIO C;  1VQ7 F;  3NVK E;  4BVS A;  1N8R H;  2KTV A;  5EWR A;  1VQL F;  2CZW A;  3CPQ A;  3V3T A;  1VQ9 F;  1M1K H;  3O85 A;  1YHQ F;  2I6D A;  5IT9 M;  3AGK A;  3NK6 A;  4NUT A;  3HAX D;  3G71 F;  5G4U C;  4BY9 D;  3LWQ C;  1M90 H;  3J81 M;  1JJ2 F;  1VQP F;  5GIP C;  3CPW F;  3VI6 A;  3LWO C;  3FFM A;  3LWP C;  4TZZ A;  3NMU C;  3SIU A;  2QI2 A;  3CMA F;  3CCU F;  3V7E A;  3LWR C;  4LCK A;  1QVG F;  3E20 B;  1W42 A;  5FJ4 C;  1K8A H;  3LFO A;  2QEX F;  1PXW A;  3CCR F;  3JCM M;  4C4W C;  3GYQ A;  2VGN A;  3NK7 A;  2JNB A;  4BVQ A;  1YI2 F;  5G4V C;  1S72 F;  1DT9 A;  3I56 F;  1GZ0 A;  2VGM A;  1VQ6 F;  2FGY A;  3RA5 A;  2F9Z C;  3CC2 F;  3J7A R;  3CXC F;  1VQ5 F;  4EI9 A;  3OBY A;  3WXM B;  2OHW A;  3I55 F;  1KC8 H;  5HY2 A;  1VQN F;  5HY4 A;  3CG6 A;  5EO3 A;  4XCQ A;  3NVI B;  1XBI A;  1YJ9 F;  1T0K B;  1W2B F;  5HY0 A;  3MCA B;  2LBX A;  5A2Q M;  5DCV A;  3CC4 F;  3J80 M;  2WAL A;  1VQO F;  3CCE F;  2OZB A;  3ON1 A;  1YIJ F;  3G4S F;  3CCM F;  1K9M H;  3PAF A;  2AIF A;  3LWV C;  4NQ3 A;  1VQM F;  2LBW A;  1Q86 H;  1E7K A;  2OTL F;  4X3L A;  1VQ4 F;  3D00 A;  3PLA C;  1CK2 A;  1VQK F;  1RA4 A;  3VMF B;  2KTU A;  3JAM M;  3OBW A;  1YIT F;  2GLZ A;  5GAP K;  4EI8 A;  3N4Y A;  2OTJ F;  5HXZ A;  5HWE A;  3N4Z A;  1Q7Y H;  1CN7 A;  3E1Y A;  3CCQ F;  3CCL F;  3G6E F;  4BW0 B;  3CME F;  1RLG A;  4X3M A;  1NJI H;  1H7M A;  3IR9 A;  1ZWZ A;  3OW2 F;  2ALE A;  2QA4 F;  3CCV F;  1SDS A;  5HY1 A;  1W3E X;  4EI7 A;  3RA6 A;  5GAN K;  1W40 A;  1QVF F;  5HXU A;  3CC7 F;  1KD1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...