1KD1H

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1kd1H00
2JNBA 1Q7YH 3GYQA 3CCUF 5EWRA 1PXWA 2VGNA 3N4YA 1CK2A 5GIPC 3NVKE 2QEXF 2KTVA 1VQ7F 1VQKF 1X7OA 3CCVF 1X52A 1SDSA 3CC4F 1YJNF 1K73H 1YJ9F 2BO1A 1E7KA 1YITF 3OBWA 2FC3A 1W40A 3NK7A 2OTJF 1IPAA 1VQPF 4TZZA 2HVYD 5GANK 3LWVC 2KG4A 1M1KH 5G4VC 3J7AR 3CCMF 1VQOF 3CD6F 3CCLF 1W2BF 1YI2F 2I6DA 3WXMB 1Q81H 3N4ZA 1NJIH 1RLGA 3RA6A 1YJWF 1QVFF 1RA4A 2AIFA 3J81M 2WALA 3AGKA 5GIOC 3G6EF 2LBXA 3CC7F 3NMUC 1VQ8F 3HJWC 5G4UC 3OW2F 4X3LA 1VQ6F 3OBYA 3G71F 3SIUA 1S72F 3E20B 5A2QM 3CMAF 1GZ0A 3LWOC 4BW0B 3J80M 2QA4F 3CCRF 3I55F 1XBIA 3CPQA 3LWRC 3PLAC 2VGMA 1N8RH 3NVIB 1YHQF 2LBWA 3VI6A 3I56F 1W42A 2CZWA 3O85A 4NUTA 3LWQC 1KC8H 5GINC 3LFOA 3JAMM 3SIVA 2QI2A 5EO3A 1VQLF 1VQMF 3V7QA 2OZBA 1DT9A 3V7EA 1K9MH 2ALEA 5FLXM 4LCKA 3CMEF 3CCJF 1X7PA 3LWPC 1Q86H 3FFMA 3PAFA 4BY9D 4C4WC 3CPWF 3ON1A 1NMUB 3CXCF 3CCEF 3VMFB 1W3EX 1KQSF 1VQ9F 1YIJF 1VQNF 3JCMM 3CCQF 1CN7A 1Q82H 5IT9M 1W41A 4X3MA 2OTLF 1VQ4F 1GO1A 3CCSF 3MCAB 1QVGF 1ZWZA 2OHWA 3G4SF 1M90H 3CC2F 5DCVA 1T0KB 1H7MA 1VQ5F 3RA5A 5GAPK 1GO0A 3HAXD 5FJ4C 1K8AH 3CG6A 2KTUA 3IR9A 1JJ2F 3NK6A 3E1YA 1KD1H
chains in the Genus database with same CATH superfamily
1ODEA 2JNBA 4ERHA 1RLUA 3QUWA 2DYYA 3P10A 2QEXF 1VQ7F 1VQKF 1X7OA 2GZLA 2L26A 3DDNA 1K73H 2BO1A 1IV4A 3C9RA 1E7KA 3OBWA 5HXZA 1W40A 3CYQA 2W8BC 1IPAA 4BT7A 5JQGA 1VQPF 1X25A 3C9TA 5GANK 1M1KH 3J7AR 3CB2A 4O4JA 5J2UB 4G4YA 3WJPA 3HKBA 5ITZA 3CCLF 3CD6F 3JAWB 3WXMB 3C9SA 3N2KB 1NJIH 5LXTA 4O2BA 2HP0A 1CLIA 4O4LB 1Q8RA 4O4HA 4M8IA 3ZO8A 2F9ZC 4BVRA 4ZI7A 4DXDA 4FFBA 4B5CA 3CC7F 1ONIA 5HY1A 4X1KA 5KX5A 4IHJA 1GX1A 5IJ9A 3D54A 3OBYA 4ZHQA 1JFFB 3SIUA 3VCZA 3N2GB 1GZ0A 3LWOC 1J7HA 4U3JB 3CYPB 3S06A 3CPQA 3VYSC 2QTPA 1UI9A 5CB4B 4G4ZA 1N8RH 2LBWA 3FPIA 5CA0A 3RYFB 4PWTA 5KMGA 3JAMM 2P6YA 2QI2A 5EO3A 4U39A 1VQLF 1H47A 2CVLA 3V7QA 2OZBA 5CB4A 5EB1B 3ZOPA 1DT9A 3JASB 3V7EA 2UYKA 4ZOLA 3UT5A 4F6RB 1K9MH 4LNUB 3CMEF 2YXZA 1Q86H 5MN4A 2PHNA 1SA0B 4R40B 3K2XA 1NMUB 1COMA 4TV8B 2CHTA 4ZOLB 5EAZA 3UT5B 2UYNB 1KNJA 3CCQF 3EORA 1Q82H 1Z5VA 2HP0B 3TD3A 5IT9M 4X3MA 1IV2A 4BT5A 3MCAB 2HQSC 1QVGF 1ZWZA 2OHWA 1VQVA 4BT3A 2ZODA 5DCVA 5J2UA 3IEWA 5LA6A 3MBMA 5HY0A 3WPWA 5FJ4C 1QD9A 5MN6A 2HRYA 3JALA 3F0GA 3NK6A 3E1YA 1JY8A 1Q7YH 3CCUF 3N4YA 1CK2A 5GIPC 4NWOB 5AVMA 5LP6B 4TV9A 1SDSA 2RHJA 1XHOA 2VAMA 2GLZA 3E22A 4X1KB 4G4XA 3C8LA 4X1YB 2GVIA 5EYPB 5CA1B 3JARB 1W55A 1NQ3A 4O4HB 3NK7A 5JQGB 2OTJF 4ZHVA 4TZZA 5LOVB 4YJ3B 4BT2A 1R1MA 4O4IB 1W2BF 2I6DA 3N4ZA 2BTQB 1VH8A 3S0HA 3JVHA 2VAPA 5LOVA 4I4TA 3RA6A 4X20A 1FFXA 1QVFF 2R751 2AIFA 2VAWA 3ZP4A 2MQEA 2HP3A 4G4WA 3HKCB 2LBXA 3C9UA 5HY4A 3WGJA 3NMUC 5HY2A 3HJWC 1IV1A 4X3LA 5EIBD 3TD5A 5JVDB 1VQ6F 1T0AA 2I6RA 5C8YB 3CMAF 3WGNA 3J80M 3I3FA 3MDOA 3T80A 1W581 2AMTA 3FD6A 4EI9A 1YHQF 4X1IA 4HNAA 2FGYA 1W42A 3I56F 1RQ2A 1KC8H 1XRGA 3M4SA 3JATA 4O2AB 3LFOA 3F0DA 5LYJA 3SIVA 5LA6B 1VQMF 2Z1FA 3HKEA 4NQ3A 4YJ3A 4LCKA 4I50A 2HS3A 4BVSA 5MN5A 3LWPC 4BY9D 4C4WC 3PAFA 4C82A 4ZHQB 2HS4A 3WGMA 3JARA 4YJ2B 5KX5B 2H8CA 2RHOA 1W3EX 4TUYA 4WBNB 4IIJA 1KQSF 1VQ9F 1VQNF 4O4LA 3JAKA 4EB6A 1TUBA 1W41A 1VQ4F 3MCQA 3N2KA 2HS0A 1M90H 1H7MA 1VQ5F 3RA5A 5GAPK 1OAPA 1W5EA 2Q1YA 2DT4A 3WJQA 4I55B 3DC2A 3CG6A 3RE3A 1PXWA 3M1XA 1KD1H 3HKEB 5EWRA 4BT4A 5IYZB 1YQNA 5GONA 1TUBB 5BMVB 2IAFA 4B62A 3NVKE 2CWJA 2K1SA 1U43A 1W59A 1YJNF 4XCQA 1RQ7A 4EI7A 2FC3A 1H48A 4DRXA 2BTOA 3RYIA 2HX0A 3VOAA 3F6MA 3JAKB 4BVQA 2HVYD 2KG4A 4I50B 5HP8A 3CCMF 4F6RA 1YI2F 1U3LA 3JALB 4KWEA 1Q81H 2BTUA 5HWEA 3IMPA 5LYJB 1YJWF 1RA4A 2UYPA 3F0EA 3RYFA 5CA0B 1W5AA 2NMUA 3S0WA 5GIOC 3HTNA 3B6NA 5FNVA 4ZHWA 3KE1A 5G4UC 3OW2F 4RHAA 2AIZP 3HKDA 3E20B 5C8YA 3RYHA 5IJ9B 4WBNA 3I55F 4IHJB 4C8GA 1VHAA 4ZHYB 2VGMA 1IV3A 3GHZA 5EIBC 2ZOVA 4C8EA 4NUTA 2ZVZA 3O85A 3LWQC 3TD4A 5GINC 2H8EA 4B46A 1Z5WA 3IKEA 5BMVA 3VO8A 2UZHA 3JAWA 1W5FA 3BYQA 3HKBB 5ITZB 5FLXM 4BT6A 3LMEA 3VTIC 1X7PA 4I55A 3V3TA 3RYHB 2UYJA 4BVTA 4HNAB 3S03A 3ERNA 5GONB 2H6LA 1FNJA 1VK3A 2Z01A 2Z1TA 1YIJF 3JCMM 3VYTC 4E6EA 4EB6B 2IQQA 1JFFA 3IEQA 2ZAUA 5HXUA 2OTLF 2B33A 1JN1A 1GO1A 2OTMA 3ELCA 1U3PA 4X1YA 4ZI7B 3E22B 1T0KB 3KJKA 1SA0A 1XV2A 3IKFA 3HKDB 1K8AH 5LXTB 2CSLA 3ZP7A 5JCOC 5J2TB 3ESJA 1JJ2F 3M84A 3JASA 3HKCA 4O4IA 2R6R1 5EZYA 3GYQA 4B45A 2VGNA 2RHLA 1PF5A 3K14A 2Z1EA 3F0FA 2ZVYA 2KTVA 3RYCB 1FFXB 3CCVF 5KMGB 1X52A 3CC4F 3V4DA 5FNVB 1YJ9F 1YITF 3WJRA 4TV8A 1U40A 3KIZA 3VOBA 1QU9A 3K0TA 5LP6A 3GTZA 5JVDA 3LWVC 3QHDA 5G4VC 4LNUA 2CW4A 4IIJB 3OONA 3Q8HA 1VQOF 1TVKB 1YGYA 3D00A 5JH7B 2HRUA 1RLGA 3U0OA 2IG8A 3VIUA 3KHNA 4O2BB 3RYIB 4C81A 2V9YA 3J81M 3FBAA 4G88A 2G9IA 1UFYA 2WALA 3AGKA 3G6EF 2ZF8A 1FSZA 1VQ8F 4O4JB 2YYEA 3WGLA 1SZQA 2LBTA 3G71F 1W5BA 3N2GA 3D01A 3RYCA 1S72F 5A2QM 3MQWA 2Z1UA 3WPXA 4BW0B 2QA4F 3CCRF 2Q1XA 1XBIA 5IYZA 2N48A 4ZK7A 3P0ZA 3LWRC 3PLAC 5EB0A 3NVIB 5J2TA 3VI6A 2CZWA 3LYBA 4G4VA 2LCAA 3I7TA 4X1IB 4RQOA 4DRXB 3QTYA 3FD5A 1W57A 2UYNA 1KNKA 1QAHA 1TVKA 2ALEA 3LDTA 4YJ2A 3VYUC 3CCJF 3L7QA 3FFMA 3CPWF 1JD1A 4X20B 2CHSA 3KJJA 3ON1A 3CXCF 5HP7A 4TUYB 3CCEF 1FNKA 2KGWA 3VMFB 1OFUA 2PMPA 5JCOA 5IJ0B 3R0PA 4U3JA 3S0YA 4C8IA 1CN7A 3HWUA 3WGKA 3JATB 4O2AA 4I4TB 3S02A 5CA1A 2RB9A 5IJ0A 3CCSF 5EZYB 3G4SF 3P4EA 2VXYA 3CC2F 1DBFA 5B8FA 4EI8A 4TV9B 1GO0A 3HAXD 2EWCA 2KTUA 3IR9A 3K12A 5LP6C 5EYPA 5JH7A 2RHHA 4FFBB
chains in the Genus database with same CATH topology
2JNBA 1Q7YH 3GYQA 3CCUF 5EWRA 1PXWA 2VGNA 3N4YA 1CK2A 5GIPC 3NVKE 2QEXF 2KTVA 1VQ7F 1VQKF 1X7OA 3CCVF 1X52A 1SDSA 3CC4F 1YJNF 2GLZA 4XCQA 1K73H 1YJ9F 2BO1A 1E7KA 1YITF 3OBWA 4EI7A 5HXZA 2FC3A 1W40A 3NK7A 2OTJF 1IPAA 1VQPF 4BVQA 4TZZA 2HVYD 5GANK 3LWVC 2KG4A 1M1KH 5G4VC 3J7AR 3CCMF 1VQOF 3CD6F 3CCLF 1W2BF 1YI2F 3D00A 2I6DA 3WXMB 1Q81H 3N4ZA 1NJIH 1RLGA 3RA6A 5HWEA 1YJWF 1QVFF 1RA4A 2AIFA 2F9ZC 3J81M 4BVRA 2WALA 3AGKA 5GIOC 3G6EF 2LBXA 3CC7F 5HY1A 5HY4A 3NMUC 1VQ8F 5HY2A 3HJWC 5G4UC 3OW2F 4X3LA 1VQ6F 3OBYA 3G71F 3SIUA 1S72F 3E20B 5A2QM 3CMAF 1GZ0A 3LWOC 4BW0B 3J80M 2QA4F 3CCRF 3I55F 1XBIA 3CPQA 3LWRC 3PLAC 2VGMA 1N8RH 3NVIB 1YHQF 4EI9A 2LBWA 3VI6A 2FGYA 1W42A 2CZWA 3O85A 4NUTA 3LWQC 3I56F 1KC8H 5GINC 3LFOA 3JAMM 3SIVA 2QI2A 5EO3A 1VQLF 1VQMF 3V7QA 2OZBA 1DT9A 3V7EA 4NQ3A 1K9MH 2ALEA 5FLXM 4LCKA 3CMEF 4BVSA 3CCJF 1X7PA 3LWPC 3V3TA 3FFMA 3PAFA 1Q86H 4BY9D 3CPWF 4C4WC 4BVTA 3ON1A 1NMUB 3CXCF 3CCEF 3VMFB 1W3EX 1KQSF 1VQ9F 1YIJF 1VQNF 3JCMM 3CCQF 1CN7A 1Q82H 5IT9M 1W41A 4X3MA 2OTLF 5HXUA 1VQ4F 1GO1A 3CCSF 3MCAB 1QVGF 1ZWZA 2OHWA 3G4SF 1M90H 3CC2F 5DCVA 1T0KB 1H7MA 1VQ5F 5HY0A 3RA5A 5GAPK 4EI8A 1GO0A 3HAXD 5FJ4C 1K8AH 3CG6A 2KTUA 3IR9A 1JJ2F 3NK6A 3E1YA 1KD1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNB A;  1Q7Y H;  3GYQ A;  3CCU F;  5EWR A;  1PXW A;  2VGN A;  3N4Y A;  1CK2 A;  5GIP C;  3NVK E;  2QEX F;  2KTV A;  1VQ7 F;  1VQK F;  1X7O A;  3CCV F;  1X52 A;  1SDS A;  3CC4 F;  1YJN F;  1K73 H;  1YJ9 F;  2BO1 A;  1E7K A;  1YIT F;  3OBW A;  2FC3 A;  1W40 A;  3NK7 A;  2OTJ F;  1IPA A;  1VQP F;  4TZZ A;  2HVY D;  5GAN K;  3LWV C;  2KG4 A;  1M1K H;  5G4V C;  3J7A R;  3CCM F;  1VQO F;  3CD6 F;  3CCL F;  1W2B F;  1YI2 F;  2I6D A;  3WXM B;  1Q81 H;  3N4Z A;  1NJI H;  1RLG A;  3RA6 A;  1YJW F;  1QVF F;  1RA4 A;  2AIF A;  3J81 M;  2WAL A;  3AGK A;  5GIO C;  3G6E F;  2LBX A;  3CC7 F;  3NMU C;  1VQ8 F;  3HJW C;  5G4U C;  3OW2 F;  4X3L A;  1VQ6 F;  3OBY A;  3G71 F;  3SIU A;  1S72 F;  3E20 B;  5A2Q M;  3CMA F;  1GZ0 A;  3LWO C;  4BW0 B;  3J80 M;  2QA4 F;  3CCR F;  3I55 F;  1XBI A;  3CPQ A;  3LWR C;  3PLA C;  2VGM A;  1N8R H;  3NVI B;  1YHQ F;  2LBW A;  3VI6 A;  3I56 F;  1W42 A;  2CZW A;  3O85 A;  4NUT A;  3LWQ C;  1KC8 H;  5GIN C;  3LFO A;  3JAM M;  3SIV A;  2QI2 A;  5EO3 A;  1VQL F;  1VQM F;  3V7Q A;  2OZB A;  1DT9 A;  3V7E A;  1K9M H;  2ALE A;  5FLX M;  4LCK A;  3CME F;  3CCJ F;  1X7P A;  3LWP C;  1Q86 H;  3FFM A;  3PAF A;  4BY9 D;  4C4W C;  3CPW F;  3ON1 A;  1NMU B;  3CXC F;  3CCE F;  3VMF B;  1W3E X;  1KQS F;  1VQ9 F;  1YIJ F;  1VQN F;  3JCM M;  3CCQ F;  1CN7 A;  1Q82 H;  5IT9 M;  1W41 A;  4X3M A;  2OTL F;  1VQ4 F;  1GO1 A;  3CCS F;  3MCA B;  1QVG F;  1ZWZ A;  2OHW A;  3G4S F;  1M90 H;  3CC2 F;  5DCV A;  1T0K B;  1H7M A;  1VQ5 F;  3RA5 A;  5GAP K;  1GO0 A;  3HAX D;  5FJ4 C;  1K8A H;  3CG6 A;  2KTU A;  3IR9 A;  1JJ2 F;  3NK6 A;  3E1Y A;  1KD1 H; 
#chains in the Genus database with same CATH topology
 1ODE A;  2JNB A;  4ERH A;  1RLU A;  3QUW A;  2DYY A;  3P10 A;  2QEX F;  1VQ7 F;  1VQK F;  1X7O A;  2GZL A;  2L26 A;  3DDN A;  1K73 H;  2BO1 A;  1IV4 A;  3C9R A;  1E7K A;  3OBW A;  5HXZ A;  1W40 A;  3CYQ A;  2W8B C;  1IPA A;  4BT7 A;  5JQG A;  1VQP F;  1X25 A;  3C9T A;  5GAN K;  1M1K H;  3J7A R;  3CB2 A;  4O4J A;  5J2U B;  4G4Y A;  3WJP A;  3HKB A;  5ITZ A;  3CCL F;  3CD6 F;  3JAW B;  3WXM B;  3C9S A;  3N2K B;  1NJI H;  5LXT A;  4O2B A;  2HP0 A;  1CLI A;  4O4L B;  1Q8R A;  4O4H A;  4M8I A;  3ZO8 A;  2F9Z C;  4BVR A;  4ZI7 A;  4DXD A;  4FFB A;  4B5C A;  3CC7 F;  1ONI A;  5HY1 A;  4X1K A;  5KX5 A;  4IHJ A;  1GX1 A;  5IJ9 A;  3D54 A;  3OBY A;  4ZHQ A;  1JFF B;  3SIU A;  3VCZ A;  3N2G B;  1GZ0 A;  3LWO C;  1J7H A;  4U3J B;  3CYP B;  3S06 A;  3CPQ A;  3VYS C;  2QTP A;  1UI9 A;  5CB4 B;  4G4Z A;  1N8R H;  2LBW A;  3FPI A;  5CA0 A;  3RYF B;  4PWT A;  5KMG A;  3JAM M;  2P6Y A;  2QI2 A;  5EO3 A;  4U39 A;  1VQL F;  1H47 A;  2CVL A;  3V7Q A;  2OZB A;  5CB4 A;  5EB1 B;  3ZOP A;  1DT9 A;  3JAS B;  3V7E A;  2UYK A;  4ZOL A;  3UT5 A;  4F6R B;  1K9M H;  4LNU B;  3CME F;  2YXZ A;  1Q86 H;  5MN4 A;  2PHN A;  1SA0 B;  4R40 B;  3K2X A;  1NMU B;  1COM A;  4TV8 B;  2CHT A;  4ZOL B;  5EAZ A;  3UT5 B;  2UYN B;  1KNJ A;  3CCQ F;  3EOR A;  1Q82 H;  1Z5V A;  2HP0 B;  3TD3 A;  5IT9 M;  4X3M A;  1IV2 A;  4BT5 A;  3MCA B;  2HQS C;  1QVG F;  1ZWZ A;  2OHW A;  1VQV A;  4BT3 A;  2ZOD A;  5DCV A;  5J2U A;  3IEW A;  5LA6 A;  3MBM A;  5HY0 A;  3WPW A;  5FJ4 C;  1QD9 A;  5MN6 A;  2HRY A;  3JAL A;  3F0G A;  3NK6 A;  3E1Y A;  1JY8 A;  1Q7Y H;  3CCU F;  3N4Y A;  1CK2 A;  5GIP C;  4NWO B;  5AVM A;  5LP6 B;  4TV9 A;  1SDS A;  2RHJ A;  1XHO A;  2VAM A;  2GLZ A;  3E22 A;  4X1K B;  4G4X A;  3C8L A;  4X1Y B;  2GVI A;  5EYP B;  5CA1 B;  3JAR B;  1W55 A;  1NQ3 A;  4O4H B;  3NK7 A;  5JQG B;  2OTJ F;  4ZHV A;  4TZZ A;  5LOV B;  4YJ3 B;  4BT2 A;  1R1M A;  4O4I B;  1W2B F;  2I6D A;  3N4Z A;  2BTQ B;  1VH8 A;  3S0H A;  3JVH A;  2VAP A;  5LOV A;  4I4T A;  3RA6 A;  4X20 A;  1FFX A;  1QVF F;  2R75 1;  2AIF A;  2VAW A;  3ZP4 A;  2MQE A;  2HP3 A;  4G4W A;  3HKC B;  2LBX A;  3C9U A;  5HY4 A;  3WGJ A;  3NMU C;  5HY2 A;  3HJW C;  1IV1 A;  4X3L A;  5EIB D;  3TD5 A;  5JVD B;  1VQ6 F;  1T0A A;  2I6R A;  5C8Y B;  3CMA F;  3WGN A;  3J80 M;  3I3F A;  3MDO A;  3T80 A;  1W58 1;  2AMT A;  3FD6 A;  4EI9 A;  1YHQ F;  4X1I A;  4HNA A;  2FGY A;  1W42 A;  3I56 F;  1RQ2 A;  1KC8 H;  1XRG A;  3M4S A;  3JAT A;  4O2A B;  3LFO A;  3F0D A;  5LYJ A;  3SIV A;  5LA6 B;  1VQM F;  2Z1F A;  3HKE A;  4NQ3 A;  4YJ3 A;  4LCK A;  4I50 A;  2HS3 A;  4BVS A;  5MN5 A;  3LWP C;  4BY9 D;  4C4W C;  3PAF A;  4C82 A;  4ZHQ B;  2HS4 A;  3WGM A;  3JAR A;  4YJ2 B;  5KX5 B;  2H8C A;  2RHO A;  1W3E X;  4TUY A;  4WBN B;  4IIJ A;  1KQS F;  1VQ9 F;  1VQN F;  4O4L A;  3JAK A;  4EB6 A;  1TUB A;  1W41 A;  1VQ4 F;  3MCQ A;  3N2K A;  2HS0 A;  1M90 H;  1H7M A;  1VQ5 F;  3RA5 A;  5GAP K;  1OAP A;  1W5E A;  2Q1Y A;  2DT4 A;  3WJQ A;  4I55 B;  3DC2 A;  3CG6 A;  3RE3 A;  1PXW A;  3M1X A;  1KD1 H;  3HKE B;  5EWR A;  4BT4 A;  5IYZ B;  1YQN A;  5GON A;  1TUB B;  5BMV B;  2IAF A;  4B62 A;  3NVK E;  2CWJ A;  2K1S A;  1U43 A;  1W59 A;  1YJN F;  4XCQ A;  1RQ7 A;  4EI7 A;  2FC3 A;  1H48 A;  4DRX A;  2BTO A;  3RYI A;  2HX0 A;  3VOA A;  3F6M A;  3JAK B;  4BVQ A;  2HVY D;  2KG4 A;  4I50 B;  5HP8 A;  3CCM F;  4F6R A;  1YI2 F;  1U3L A;  3JAL B;  4KWE A;  1Q81 H;  2BTU A;  5HWE A;  3IMP A;  5LYJ B;  1YJW F;  1RA4 A;  2UYP A;  3F0E A;  3RYF A;  5CA0 B;  1W5A A;  2NMU A;  3S0W A;  5GIO C;  3HTN A;  3B6N A;  5FNV A;  4ZHW A;  3KE1 A;  5G4U C;  3OW2 F;  4RHA A;  2AIZ P;  3HKD A;  3E20 B;  5C8Y A;  3RYH A;  5IJ9 B;  4WBN A;  3I55 F;  4IHJ B;  4C8G A;  1VHA A;  4ZHY B;  2VGM A;  1IV3 A;  3GHZ A;  5EIB C;  2ZOV A;  4C8E A;  4NUT A;  2ZVZ A;  3O85 A;  3LWQ C;  3TD4 A;  5GIN C;  2H8E A;  4B46 A;  1Z5W A;  3IKE A;  5BMV A;  3VO8 A;  2UZH A;  3JAW A;  1W5F A;  3BYQ A;  3HKB B;  5ITZ B;  5FLX M;  4BT6 A;  3LME A;  3VTI C;  1X7P A;  4I55 A;  3V3T A;  3RYH B;  2UYJ A;  4BVT A;  4HNA B;  3S03 A;  3ERN A;  5GON B;  2H6L A;  1FNJ A;  1VK3 A;  2Z01 A;  2Z1T A;  1YIJ F;  3JCM M;  3VYT C;  4E6E A;  4EB6 B;  2IQQ A;  1JFF A;  3IEQ A;  2ZAU A;  5HXU A;  2OTL F;  2B33 A;  1JN1 A;  1GO1 A;  2OTM A;  3ELC A;  1U3P A;  4X1Y A;  4ZI7 B;  3E22 B;  1T0K B;  3KJK A;  1SA0 A;  1XV2 A;  3IKF A;  3HKD B;  1K8A H;  5LXT B;  2CSL A;  3ZP7 A;  5JCO C;  5J2T B;  3ESJ A;  1JJ2 F;  3M84 A;  3JAS A;  3HKC A;  4O4I A;  2R6R 1;  5EZY A;  3GYQ A;  4B45 A;  2VGN A;  2RHL A;  1PF5 A;  3K14 A;  2Z1E A;  3F0F A;  2ZVY A;  2KTV A;  3RYC B;  1FFX B;  3CCV F;  5KMG B;  1X52 A;  3CC4 F;  3V4D A;  5FNV B;  1YJ9 F;  1YIT F;  3WJR A;  4TV8 A;  1U40 A;  3KIZ A;  3VOB A;  1QU9 A;  3K0T A;  5LP6 A;  3GTZ A;  5JVD A;  3LWV C;  3QHD A;  5G4V C;  4LNU A;  2CW4 A;  4IIJ B;  3OON A;  3Q8H A;  1VQO F;  1TVK B;  1YGY A;  3D00 A;  5JH7 B;  2HRU A;  1RLG A;  3U0O A;  2IG8 A;  3VIU A;  3KHN A;  4O2B B;  3RYI B;  4C81 A;  2V9Y A;  3J81 M;  3FBA A;  4G88 A;  2G9I A;  1UFY A;  2WAL A;  3AGK A;  3G6E F;  2ZF8 A;  1FSZ A;  1VQ8 F;  4O4J B;  2YYE A;  3WGL A;  1SZQ A;  2LBT A;  3G71 F;  1W5B A;  3N2G A;  3D01 A;  3RYC A;  1S72 F;  5A2Q M;  3MQW A;  2Z1U A;  3WPX A;  4BW0 B;  2QA4 F;  3CCR F;  2Q1X A;  1XBI A;  5IYZ A;  2N48 A;  4ZK7 A;  3P0Z A;  3LWR C;  3PLA C;  5EB0 A;  3NVI B;  5J2T A;  3VI6 A;  2CZW A;  3LYB A;  4G4V A;  2LCA A;  3I7T A;  4X1I B;  4RQO A;  4DRX B;  3QTY A;  3FD5 A;  1W57 A;  2UYN A;  1KNK A;  1QAH A;  1TVK A;  2ALE A;  3LDT A;  4YJ2 A;  3VYU C;  3CCJ F;  3L7Q A;  3FFM A;  3CPW F;  1JD1 A;  4X20 B;  2CHS A;  3KJJ A;  3ON1 A;  3CXC F;  5HP7 A;  4TUY B;  3CCE F;  1FNK A;  2KGW A;  3VMF B;  1OFU A;  2PMP A;  5JCO A;  5IJ0 B;  3R0P A;  4U3J A;  3S0Y A;  4C8I A;  1CN7 A;  3HWU A;  3WGK A;  3JAT B;  4O2A A;  4I4T B;  3S02 A;  5CA1 A;  2RB9 A;  5IJ0 A;  3CCS F;  5EZY B;  3G4S F;  3P4E A;  2VXY A;  3CC2 F;  1DBF A;  5B8F A;  4EI8 A;  4TV9 B;  1GO0 A;  3HAX D;  2EWC A;  2KTU A;  3IR9 A;  3K12 A;  5LP6 C;  5EYP A;  5JH7 A;  2RHH A;  4FFB B; 
#chains in the Genus database with same CATH homology
 2JNB A;  1Q7Y H;  3GYQ A;  3CCU F;  5EWR A;  1PXW A;  2VGN A;  3N4Y A;  1CK2 A;  5GIP C;  3NVK E;  2QEX F;  2KTV A;  1VQ7 F;  1VQK F;  1X7O A;  3CCV F;  1X52 A;  1SDS A;  3CC4 F;  1YJN F;  2GLZ A;  4XCQ A;  1K73 H;  1YJ9 F;  2BO1 A;  1E7K A;  1YIT F;  3OBW A;  4EI7 A;  5HXZ A;  2FC3 A;  1W40 A;  3NK7 A;  2OTJ F;  1IPA A;  1VQP F;  4BVQ A;  4TZZ A;  2HVY D;  5GAN K;  3LWV C;  2KG4 A;  1M1K H;  5G4V C;  3J7A R;  3CCM F;  1VQO F;  3CD6 F;  3CCL F;  1W2B F;  1YI2 F;  3D00 A;  2I6D A;  3WXM B;  1Q81 H;  3N4Z A;  1NJI H;  1RLG A;  3RA6 A;  5HWE A;  1YJW F;  1QVF F;  1RA4 A;  2AIF A;  2F9Z C;  3J81 M;  4BVR A;  2WAL A;  3AGK A;  5GIO C;  3G6E F;  2LBX A;  3CC7 F;  5HY1 A;  5HY4 A;  3NMU C;  1VQ8 F;  5HY2 A;  3HJW C;  5G4U C;  3OW2 F;  4X3L A;  1VQ6 F;  3OBY A;  3G71 F;  3SIU A;  1S72 F;  3E20 B;  5A2Q M;  3CMA F;  1GZ0 A;  3LWO C;  4BW0 B;  3J80 M;  2QA4 F;  3CCR F;  3I55 F;  1XBI A;  3CPQ A;  3LWR C;  3PLA C;  2VGM A;  1N8R H;  3NVI B;  1YHQ F;  4EI9 A;  2LBW A;  3VI6 A;  2FGY A;  1W42 A;  2CZW A;  3O85 A;  4NUT A;  3LWQ C;  3I56 F;  1KC8 H;  5GIN C;  3LFO A;  3JAM M;  3SIV A;  2QI2 A;  5EO3 A;  1VQL F;  1VQM F;  3V7Q A;  2OZB A;  1DT9 A;  3V7E A;  4NQ3 A;  1K9M H;  2ALE A;  5FLX M;  4LCK A;  3CME F;  4BVS A;  3CCJ F;  1X7P A;  3LWP C;  3V3T A;  3FFM A;  3PAF A;  1Q86 H;  4BY9 D;  3CPW F;  4C4W C;  4BVT A;  3ON1 A;  1NMU B;  3CXC F;  3CCE F;  3VMF B;  1W3E X;  1KQS F;  1VQ9 F;  1YIJ F;  1VQN F;  3JCM M;  3CCQ F;  1CN7 A;  1Q82 H;  5IT9 M;  1W41 A;  4X3M A;  2OTL F;  5HXU A;  1VQ4 F;  1GO1 A;  3CCS F;  3MCA B;  1QVG F;  1ZWZ A;  2OHW A;  3G4S F;  1M90 H;  3CC2 F;  5DCV A;  1T0K B;  1H7M A;  1VQ5 F;  5HY0 A;  3RA5 A;  5GAP K;  4EI8 A;  1GO0 A;  3HAX D;  5FJ4 C;  1K8A H;  3CG6 A;  2KTU A;  3IR9 A;  1JJ2 F;  3NK6 A;  3E1Y A;  1KD1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...