3LWRC

Structure of h/aca rnp bound to a substrate rna containing 4su
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
total genus 39
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwrC00
3CCRF 3HAXD 3CCJF 2CZWA 1VQMF 3OBWA 3CCUF 2OTJF 1VQ4F 3CG6A 1W3EX 3CXCF 5GANK 3CCQF 1RLGA 1KD1H 3NVIB 3NVKE 1NJIH 5EO3A 1YJ9F 3CCVF 3CC7F 4BY9D 5A2QM 1KC8H 1YJNF 3JAMM 3RA6A 2VGMA 2LBXA 2OHWA 3MCAB 3FFMA 5G4VC 1M90H 5FJ4C 1GO0A 1T0KB 1YJWF 2QA4F 3J81M 3NK6A 4BW0B 3HJWC 3LWRC 3J80M 3PAFA 3RA5A 1W41A 1H7MA 1JJ2F 3CCMF 5DCVA 3CCLF 1VQ6F 5EWRA 3GYQA 1GO1A 3LWPC 3CC4F 2KG4A 2FC3A 1Q81H 1DT9A 3G4SF 2QI2A 1Q86H 1K8AH 1VQ9F 1W42A 1YHQF 2VGNA 1X7OA 4X3MA 3LWQC 1IPAA 2HVYD 2ALEA 2KTUA 1RA4A 3V7QA 4X3LA 5FLXM 1E7KA 3CC2F 4TZZA 5IT9M 1GZ0A 1XBIA 3VMFB 1VQPF 3OW2F 3CPQA 3IR9A 1Q7YH 2I6DA 3I56F 1W2BF 3VI6A 5GIOC 5GIPC 3I55F 3PLAC 3CCSF 2LBWA 3OBYA 3JCMM 3LWOC 1PXWA 2AIFA 3NK7A 2QEXF 1VQ5F 3O85A 3SIVA 5G4UC 3N4YA 3E1YA 1VQNF 2KTVA 4NUTA 3AGKA 1QVGF 1VQLF 1CN7A 1VQ7F 2WALA 3N4ZA 1K9MH 3LWVC 3G71F 2JNBA 1S72F 1NMUB 1VQKF 1KQSF 2OTLF 3CD6F 1X7PA 3LFOA 3SIUA 1VQOF 1K73H 1M1KH 3V7EA 4LCKA 1CK2A 1YI2F 1SDSA 3CMAF 2OZBA 5GINC 3E20B 3CCEF 1YIJF 1VQ8F 3NMUC 3CMEF 5GAPK 3WXMB 3G6EF 4C4WC 1Q82H 2BO1A 1ZWZA 3ON1A 1QVFF 1X52A 3J7AR 1W40A 1N8RH 1YITF 3CPWF
chains in the Genus database with same CATH superfamily
2R751 3CCRF 2CZWA 2DYYA 3F0DA 5EZYB 2Q1YA 4O2AB 3JVHA 5LP6B 1VQ4F 1TUBB 3CG6A 3RYFA 4G4YA 1W3EX 3CB2A 5J2UA 5LYJB 4ZOLB 1W581 4F6RA 3NVIB 1IV1A 1NJIH 1T0AA 3NVKE 3M4SA 3KIZA 2VAPA 4X1YB 1PF5A 3K12A 3RA6A 1RQ2A 5EIBD 4BT3A 4BT6A 5HY0A 1Z5VA 1RQ7A 4B46A 5J2TB 4LNUB 3EORA 2CW4A 5JCOA 4BT5A 3S02A 2CHTA 3E22B 1COMA 3F0EA 1KNJA 3JASA 3P0ZA 4TV9A 4E6EA 4BVSA 1W5AA 2V9YA 2AIZP 1GO1A 4EB6B 2KG4A 1ODEA 3VOAA 1Q81H 3HKDB 4IHJB 1Q86H 1K8AH 4DXDA 2VXYA 3FPIA 2HRUA 1QU9A 4BT2A 4NQ3A 4YJ3A 4X1YA 1YQNA 3IEWA 4U3JA 5FLXM 3CC2F 3HKCA 3TD5A 3OW2F 3IR9A 3P10A 4TV8A 4X1KB 5KX5B 3D54A 4BVQA 1SZQA 2Z1TA 5KMGA 4X1IB 5J2TA 5GIPC 2LBWA 1W55A 3OBYA 5B8FA 4O2BA 5HY2A 4ERHA 1VQ5F 5JH7B 3O85A 3SIVA 3S0HA 2CWJA 2RHOA 1VH8A 1VQLF 5EB1B 5LOVB 1VQ7F 4EB6A 2IQQA 1JFFB 2BTUA 1KQSF 5CB4A 1XV2A 2ZOVA 3SIUA 4R40B 3WGJA 3VIUA 1SDSA 5LYJA 4U39A 2OZBA 3MCQA 3R0PA 3TD4A 4PWTA 4G88A 1YIJF 2I6RA 3HKCB 3CMEF 4I4TB 1XRGA 5GAPK 3WXMB 1XHOA 1U3PA 3OONA 1W57A 1QVFF 5KMGB 3WJPA 1YITF 3HAXD 3CCJF 4ZHQA 1FNJA 4BT4A 3JASB 4TV9B 1VQMF 4EI7A 3HKBB 2VAWA 5J2UB 2UYNB 1VHAA 3JAKB 2QTPA 2H6LA 1KD1H 1IV4A 4BVTA 5CB4B 4WBNA 5EO3A 5EZYA 1OFUA 5IJ9B 4BY9D 5ITZB 3JAMM 2VGMA 2OHWA 1GO0A 3V4DA 5HXUA 5BMVA 2RHLA 3M84A 3QHDA 5IYZA 4O4IA 3VYUC 1RLUA 3KE1A 3WJRA 3ZO8A 3VOBA 2RB9A 3HKEB 3RA5A 3FBAA 4ZHYB 4X20B 2N48A 2HS3A 5EB0A 3ZP4A 2UZHA 3T80A 1QAHA 5C8YA 3FD5A 4C81A 2H8EA 3QTYA 5LP6A 3IMPA 3HKBA 4I55A 3G4SF 3C9SA 3BYQA 1W42A 2VGNA 4YJ3B 3LWQC 1CLIA 5EYPA 4C8EA 1UI9A 3ERNA 1W59A 5CA0B 2L26A 3N2GB 3WPXA 4EI9A 4X3LA 4YJ2A 1GZ0A 3D01A 1XBIA 1VQPF 3IKEA 2RHJA 4O4JA 1Q7YH 4XCQA 4O4IB 3PLAC 2ZVZA 2B33A 3JCMM 2AIFA 4DRXB 4U3JB 4O4HB 4IIJB 3MDOA 2Z1UA 4G4ZA 3E1YA 4TV8B 4G4VA 2WALA 4TUYA 1K9MH 3LWVC 2HQSC 2DT4A 1NMUB 4B45A 5JVDA 1UFYA 2OTLF 3LFOA 3C8LA 2UYPA 2HP0A 5IJ0B 3V7EA 1YI2F 4ZOLA 5HY4A 3F0GA 4C82A 2ZF8A 3E20B 1IV2A 3CCEF 3NMUC 3G6EF 3JAWB 2BTOA 2PMPA 5BMVB 3JALA 1W40A 2HS4A 1QD9A 3ZOPA 2Q1XA 1N8RH 1JD1A 1FFXA 4I50B 4BT7A 4O4LA 4B62A 1FNKA 3CCUF 2OTJF 3MQWA 3U0OA 5GANK 1U3LA 2ZAUA 1SA0A 3DDNA 5IJ9A 1RLGA 4O2BB 4O2AA 3LDTA 3CCVF 5AVMA 5A2QM 1KC8H 4I55B 1YJNF 2G9IA 3FD6A 4C8GA 3GTZA 5LA6A 3TD3A 5LOVA 5G4VC 1VQVA 1T0KB 2IAFA 2PHNA 2HS0A 1YJWF 5CA0A 4BW0B 4KWEA 3RYIB 3J80M 5JCOC 1W41A 3ELCA 3JALB 1H7MA 4ZK7A 3CCMF 1JJ2F 3WPWA 1R1MA 3CCLF 1VQ6F 3N2KB 3JATA 3LWPC 5LXTB 3RYCB 3WGMA 2HX0A 2FGYA 1W5BA 3ESJA 2QI2A 5GONA 3RYHA 1U40A 4TUYB 4BVRA 5FNVB 5EYPB 3L7QA 2UYJA 1YHQF 2HP3A 1IPAA 2W8BC 5ITZA 2ALEA 2KTUA 2P6YA 5HXZA 4ZI7B 3P4EA 1Q8RA 1E7KA 5IT9M 4TZZA 3KJJA 3JARA 1OAPA 3K0TA 5CA1A 3E22A 3CPQA 3JAKA 3IKFA 2I6DA 3Q8HA 3I7TA 3LWOC 1PXWA 2EWCA 3NK7A 2CHSA 5G4UC 3S0YA 4X1KA 5HWEA 2UYKA 3I3FA 5JQGA 2KTVA 3K14A 4NUTA 2ZVYA 2NMUA 3N4ZA 2Z1EA 2JNBA 1S72F 1FFXB 4I50A 1VQKF 2ZODA 2RHHA 3CD6F 4F6RB 3DC2A 1K73H 4HNAB 5MN6A 1M1KH 5MN5A 1CK2A 1JFFA 3CMAF 1TVKB 4B5CA 3VYSC 1VQ8F 5LA6B 4LNUA 3RE3A 4C4WC 3WGNA 1ONIA 1Q82H 5HP8A 1ZWZA 1X52A 1X25A 2H8CA 2AMTA 3WJQA 1H47A 1W5EA 1W5FA 3WGLA 4X20A 2YYEA 3OBWA 3S0WA 3VTIC 1KNKA 1GX1A 5HY1A 2CVLA 3HKDA 2OTMA 3CXCF 1TUBA 3RYFB 4ZHVA 3CCQF 4FFBA 5MN4A 3M1XA 2CSLA 1YJ9F 2GZLA 3CC7F 1Z5WA 2F9ZC 2VAMA 3QUWA 5IJ0A 4HNAA 2GVIA 2LBXA 3MCAB 3FFMA 1M90H 5FJ4C 1TVKA 3C9TA 3LMEA 4WBNB 2K1SA 2QA4F 5JVDB 3N2GA 3NK6A 3J81M 3S06A 3CYQA 3HTNA 5KX5A 3HJWC 3LWRC 3PAFA 5CA1B 2KGWA 4O4JB 3UT5A 2R6R1 5HP7A 3S03A 3JATB 5DCVA 4IHJA 5EWRA 3GYQA 3CC4F 4O4LB 5LP6C 3RYIA 2IG8A 3GHZA 1JY8A 2FC3A 1DT9A 3V3TA 2YXZA 4I4TA 4G4XA 1VQ9F 4FFBB 3HWUA 1X7OA 4X3MA 2LBTA 4C8IA 3RYCA 2HVYD 4NWOB 5IYZB 1RA4A 3JARB 3KHNA 3V7QA 3VO8A 2HP0B 4DRXA 3VMFB 3HKEA 2GLZA 5EIBC 1W2BF 3I56F 2UYNA 3VI6A 5GIOC 3I55F 3CCSF 2Z01A 4YJ2B 4ZI7A 3F6MA 4X1IA 2MQEA 1J7HA 2QEXF 2LCAA 5EAZA 3UT5B 3N4YA 1VQNF 3K2XA 5JH7A 3AGKA 1QVGF 1CN7A 5LXTA 3KJKA 2BTQB 4M8IA 3G71F 4O4HA 1YGYA 2HRYA 4ZHWA 1X7PA 1NQ3A 1H48A 4G4WA 5JQGB 1VQOF 1JN1A 4RHAA 3B6NA 3VCZA 4LCKA 3N2KA 1DBFA 4RQOA 3JAWA 1SA0B 4EI8A 3F0FA 2Z1FA 5GINC 3IEQA 3WGKA 1IV3A 3LYBA 5C8YB 3CYPB 3VYTC 3C9RA 5GONB 3RYHB 3ZP7A 4ZHQB 4IIJA 3D00A 5FNVA 1VK3A 2BO1A 3ON1A 3J7AR 3C9UA 3MBMA 1U43A 1FSZA 3CPWF
chains in the Genus database with same CATH topology
3CCRF 3HAXD 3CCJF 2CZWA 1VQMF 3OBWA 3CCUF 2OTJF 4EI7A 1VQ4F 5HY1A 3CG6A 1W3EX 3CXCF 5GANK 3CCQF 1RLGA 1KD1H 3NVIB 4BVTA 3NVKE 1NJIH 5EO3A 1YJ9F 3CCVF 3CC7F 4BY9D 5A2QM 1KC8H 1YJNF 2F9ZC 3JAMM 3RA6A 2VGMA 2LBXA 2OHWA 3MCAB 3FFMA 5G4VC 1M90H 5FJ4C 5HY0A 1GO0A 5HXUA 1T0KB 1YJWF 2QA4F 3J81M 3NK6A 4BW0B 3HJWC 3LWRC 3J80M 3PAFA 3RA5A 1W41A 1H7MA 1JJ2F 3CCMF 5DCVA 4BVSA 3CCLF 1VQ6F 5EWRA 3GYQA 1GO1A 3LWPC 3CC4F 2KG4A 2FC3A 1Q81H 2FGYA 1DT9A 3V3TA 2QI2A 3G4SF 1Q86H 1K8AH 1VQ9F 1W42A 4BVRA 1YHQF 2VGNA 1X7OA 4X3MA 3LWQC 1IPAA 2HVYD 4NQ3A 2ALEA 2KTUA 1RA4A 5HXZA 3V7QA 4EI9A 4X3LA 5FLXM 1E7KA 3CC2F 4TZZA 5IT9M 1GZ0A 1XBIA 3VMFB 1VQPF 3OW2F 3CPQA 3IR9A 2GLZA 1Q7YH 2I6DA 4XCQA 3I56F 1W2BF 3VI6A 4BVQA 5GIOC 5GIPC 3I55F 3CCSF 3PLAC 2LBWA 3OBYA 3JCMM 3LWOC 1PXWA 2AIFA 5HY2A 3NK7A 2QEXF 1VQ5F 3O85A 3SIVA 5G4UC 5HWEA 3N4YA 3E1YA 1VQNF 2KTVA 4NUTA 3AGKA 1QVGF 1VQLF 1CN7A 1VQ7F 2WALA 3N4ZA 1K9MH 3LWVC 3G71F 2JNBA 1S72F 1NMUB 1VQKF 1KQSF 2OTLF 3CD6F 1X7PA 3LFOA 3SIUA 1VQOF 1K73H 1M1KH 3V7EA 4LCKA 1CK2A 1YI2F 4EI8A 1SDSA 3CMAF 2OZBA 5HY4A 5GINC 3E20B 3CCEF 1YIJF 1VQ8F 3NMUC 3CMEF 5GAPK 3WXMB 3G6EF 4C4WC 3D00A 1Q82H 2BO1A 1ZWZA 3ON1A 1QVFF 1X52A 3J7AR 1W40A 1N8RH 1YITF 3CPWF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR F;  3HAX D;  3CCJ F;  2CZW A;  1VQM F;  3OBW A;  3CCU F;  2OTJ F;  1VQ4 F;  3CG6 A;  1W3E X;  3CXC F;  5GAN K;  3CCQ F;  1RLG A;  1KD1 H;  3NVI B;  3NVK E;  1NJI H;  5EO3 A;  1YJ9 F;  3CCV F;  3CC7 F;  4BY9 D;  5A2Q M;  1KC8 H;  1YJN F;  3JAM M;  3RA6 A;  2VGM A;  2LBX A;  2OHW A;  3MCA B;  3FFM A;  5G4V C;  1M90 H;  5FJ4 C;  1GO0 A;  1T0K B;  1YJW F;  2QA4 F;  3J81 M;  3NK6 A;  4BW0 B;  3HJW C;  3LWR C;  3J80 M;  3PAF A;  3RA5 A;  1W41 A;  1H7M A;  1JJ2 F;  3CCM F;  5DCV A;  3CCL F;  1VQ6 F;  5EWR A;  3GYQ A;  1GO1 A;  3LWP C;  3CC4 F;  2KG4 A;  2FC3 A;  1Q81 H;  1DT9 A;  3G4S F;  2QI2 A;  1Q86 H;  1K8A H;  1VQ9 F;  1W42 A;  1YHQ F;  2VGN A;  1X7O A;  4X3M A;  3LWQ C;  1IPA A;  2HVY D;  2ALE A;  2KTU A;  1RA4 A;  3V7Q A;  4X3L A;  5FLX M;  1E7K A;  3CC2 F;  4TZZ A;  5IT9 M;  1GZ0 A;  1XBI A;  3VMF B;  1VQP F;  3OW2 F;  3CPQ A;  3IR9 A;  1Q7Y H;  2I6D A;  3I56 F;  1W2B F;  3VI6 A;  5GIO C;  5GIP C;  3I55 F;  3PLA C;  3CCS F;  2LBW A;  3OBY A;  3JCM M;  3LWO C;  1PXW A;  2AIF A;  3NK7 A;  2QEX F;  1VQ5 F;  3O85 A;  3SIV A;  5G4U C;  3N4Y A;  3E1Y A;  1VQN F;  2KTV A;  4NUT A;  3AGK A;  1QVG F;  1VQL F;  1CN7 A;  1VQ7 F;  2WAL A;  3N4Z A;  1K9M H;  3LWV C;  3G71 F;  2JNB A;  1S72 F;  1NMU B;  1VQK F;  1KQS F;  2OTL F;  3CD6 F;  1X7P A;  3LFO A;  3SIU A;  1VQO F;  1K73 H;  1M1K H;  3V7E A;  4LCK A;  1CK2 A;  1YI2 F;  1SDS A;  3CMA F;  2OZB A;  5GIN C;  3E20 B;  3CCE F;  1YIJ F;  1VQ8 F;  3NMU C;  3CME F;  5GAP K;  3WXM B;  3G6E F;  4C4W C;  1Q82 H;  2BO1 A;  1ZWZ A;  3ON1 A;  1QVF F;  1X52 A;  3J7A R;  1W40 A;  1N8R H;  1YIT F;  3CPW F; 
#chains in the Genus database with same CATH topology
 2R75 1;  3CCR F;  2CZW A;  2DYY A;  3F0D A;  5EZY B;  2Q1Y A;  4O2A B;  3JVH A;  5LP6 B;  1VQ4 F;  1TUB B;  3CG6 A;  3RYF A;  4G4Y A;  1W3E X;  3CB2 A;  5J2U A;  5LYJ B;  4ZOL B;  1W58 1;  4F6R A;  3NVI B;  1IV1 A;  1NJI H;  1T0A A;  3NVK E;  3M4S A;  3KIZ A;  2VAP A;  4X1Y B;  1PF5 A;  3K12 A;  3RA6 A;  1RQ2 A;  5EIB D;  4BT3 A;  4BT6 A;  5HY0 A;  1Z5V A;  1RQ7 A;  4B46 A;  5J2T B;  4LNU B;  3EOR A;  2CW4 A;  5JCO A;  4BT5 A;  3S02 A;  2CHT A;  3E22 B;  1COM A;  3F0E A;  1KNJ A;  3JAS A;  3P0Z A;  4TV9 A;  4E6E A;  4BVS A;  1W5A A;  2V9Y A;  2AIZ P;  1GO1 A;  4EB6 B;  2KG4 A;  1ODE A;  3VOA A;  1Q81 H;  3HKD B;  4IHJ B;  1Q86 H;  1K8A H;  4DXD A;  2VXY A;  3FPI A;  2HRU A;  1QU9 A;  4BT2 A;  4NQ3 A;  4YJ3 A;  4X1Y A;  1YQN A;  3IEW A;  4U3J A;  5FLX M;  3CC2 F;  3HKC A;  3TD5 A;  3OW2 F;  3IR9 A;  3P10 A;  4TV8 A;  4X1K B;  5KX5 B;  3D54 A;  4BVQ A;  1SZQ A;  2Z1T A;  5KMG A;  4X1I B;  5J2T A;  5GIP C;  2LBW A;  1W55 A;  3OBY A;  5B8F A;  4O2B A;  5HY2 A;  4ERH A;  1VQ5 F;  5JH7 B;  3O85 A;  3SIV A;  3S0H A;  2CWJ A;  2RHO A;  1VH8 A;  1VQL F;  5EB1 B;  5LOV B;  1VQ7 F;  4EB6 A;  2IQQ A;  1JFF B;  2BTU A;  1KQS F;  5CB4 A;  1XV2 A;  2ZOV A;  3SIU A;  4R40 B;  3WGJ A;  3VIU A;  1SDS A;  5LYJ A;  4U39 A;  2OZB A;  3MCQ A;  3R0P A;  3TD4 A;  4PWT A;  4G88 A;  1YIJ F;  2I6R A;  3HKC B;  3CME F;  4I4T B;  1XRG A;  5GAP K;  3WXM B;  1XHO A;  1U3P A;  3OON A;  1W57 A;  1QVF F;  5KMG B;  3WJP A;  1YIT F;  3HAX D;  3CCJ F;  4ZHQ A;  1FNJ A;  4BT4 A;  3JAS B;  4TV9 B;  1VQM F;  4EI7 A;  3HKB B;  2VAW A;  5J2U B;  2UYN B;  1VHA A;  3JAK B;  2QTP A;  2H6L A;  1KD1 H;  1IV4 A;  4BVT A;  5CB4 B;  4WBN A;  5EO3 A;  5EZY A;  1OFU A;  5IJ9 B;  4BY9 D;  5ITZ B;  3JAM M;  2VGM A;  2OHW A;  1GO0 A;  3V4D A;  5HXU A;  5BMV A;  2RHL A;  3M84 A;  3QHD A;  5IYZ A;  4O4I A;  3VYU C;  1RLU A;  3KE1 A;  3WJR A;  3ZO8 A;  3VOB A;  2RB9 A;  3HKE B;  3RA5 A;  3FBA A;  4ZHY B;  4X20 B;  2N48 A;  2HS3 A;  5EB0 A;  3ZP4 A;  2UZH A;  3T80 A;  1QAH A;  5C8Y A;  3FD5 A;  4C81 A;  2H8E A;  3QTY A;  5LP6 A;  3IMP A;  3HKB A;  4I55 A;  3G4S F;  3C9S A;  3BYQ A;  1W42 A;  2VGN A;  4YJ3 B;  3LWQ C;  1CLI A;  5EYP A;  4C8E A;  1UI9 A;  3ERN A;  1W59 A;  5CA0 B;  2L26 A;  3N2G B;  3WPX A;  4EI9 A;  4X3L A;  4YJ2 A;  1GZ0 A;  3D01 A;  1XBI A;  1VQP F;  3IKE A;  2RHJ A;  4O4J A;  1Q7Y H;  4XCQ A;  4O4I B;  3PLA C;  2ZVZ A;  2B33 A;  3JCM M;  2AIF A;  4DRX B;  4U3J B;  4O4H B;  4IIJ B;  3MDO A;  2Z1U A;  4G4Z A;  3E1Y A;  4TV8 B;  4G4V A;  2WAL A;  4TUY A;  1K9M H;  3LWV C;  2HQS C;  2DT4 A;  1NMU B;  4B45 A;  5JVD A;  1UFY A;  2OTL F;  3LFO A;  3C8L A;  2UYP A;  2HP0 A;  5IJ0 B;  3V7E A;  1YI2 F;  4ZOL A;  5HY4 A;  3F0G A;  4C82 A;  2ZF8 A;  3E20 B;  1IV2 A;  3CCE F;  3NMU C;  3G6E F;  3JAW B;  2BTO A;  2PMP A;  5BMV B;  3JAL A;  1W40 A;  2HS4 A;  1QD9 A;  3ZOP A;  2Q1X A;  1N8R H;  1JD1 A;  1FFX A;  4I50 B;  4BT7 A;  4O4L A;  4B62 A;  1FNK A;  3CCU F;  2OTJ F;  3MQW A;  3U0O A;  5GAN K;  1U3L A;  2ZAU A;  1SA0 A;  3DDN A;  5IJ9 A;  1RLG A;  4O2B B;  4O2A A;  3LDT A;  3CCV F;  5AVM A;  5A2Q M;  1KC8 H;  4I55 B;  1YJN F;  2G9I A;  3FD6 A;  4C8G A;  3GTZ A;  5LA6 A;  3TD3 A;  5LOV A;  5G4V C;  1VQV A;  1T0K B;  2IAF A;  2PHN A;  2HS0 A;  1YJW F;  5CA0 A;  4BW0 B;  4KWE A;  3RYI B;  3J80 M;  5JCO C;  1W41 A;  3ELC A;  3JAL B;  1H7M A;  4ZK7 A;  3CCM F;  1JJ2 F;  3WPW A;  1R1M A;  3CCL F;  1VQ6 F;  3N2K B;  3JAT A;  3LWP C;  5LXT B;  3RYC B;  3WGM A;  2HX0 A;  2FGY A;  1W5B A;  3ESJ A;  2QI2 A;  5GON A;  3RYH A;  1U40 A;  4TUY B;  4BVR A;  5FNV B;  5EYP B;  3L7Q A;  2UYJ A;  1YHQ F;  2HP3 A;  1IPA A;  2W8B C;  5ITZ A;  2ALE A;  2KTU A;  2P6Y A;  5HXZ A;  4ZI7 B;  3P4E A;  1Q8R A;  1E7K A;  5IT9 M;  4TZZ A;  3KJJ A;  3JAR A;  1OAP A;  3K0T A;  5CA1 A;  3E22 A;  3CPQ A;  3JAK A;  3IKF A;  2I6D A;  3Q8H A;  3I7T A;  3LWO C;  1PXW A;  2EWC A;  3NK7 A;  2CHS A;  5G4U C;  3S0Y A;  4X1K A;  5HWE A;  2UYK A;  3I3F A;  5JQG A;  2KTV A;  3K14 A;  4NUT A;  2ZVY A;  2NMU A;  3N4Z A;  2Z1E A;  2JNB A;  1S72 F;  1FFX B;  4I50 A;  1VQK F;  2ZOD A;  2RHH A;  3CD6 F;  4F6R B;  3DC2 A;  1K73 H;  4HNA B;  5MN6 A;  1M1K H;  5MN5 A;  1CK2 A;  1JFF A;  3CMA F;  1TVK B;  4B5C A;  3VYS C;  1VQ8 F;  5LA6 B;  4LNU A;  3RE3 A;  4C4W C;  3WGN A;  1ONI A;  1Q82 H;  5HP8 A;  1ZWZ A;  1X52 A;  1X25 A;  2H8C A;  2AMT A;  3WJQ A;  1H47 A;  1W5E A;  1W5F A;  3WGL A;  4X20 A;  2YYE A;  3OBW A;  3S0W A;  3VTI C;  1KNK A;  1GX1 A;  5HY1 A;  2CVL A;  3HKD A;  2OTM A;  3CXC F;  1TUB A;  3RYF B;  4ZHV A;  3CCQ F;  4FFB A;  5MN4 A;  3M1X A;  2CSL A;  1YJ9 F;  2GZL A;  3CC7 F;  1Z5W A;  2F9Z C;  2VAM A;  3QUW A;  5IJ0 A;  4HNA A;  2GVI A;  2LBX A;  3MCA B;  3FFM A;  1M90 H;  5FJ4 C;  1TVK A;  3C9T A;  3LME A;  4WBN B;  2K1S A;  2QA4 F;  5JVD B;  3N2G A;  3NK6 A;  3J81 M;  3S06 A;  3CYQ A;  3HTN A;  5KX5 A;  3HJW C;  3LWR C;  3PAF A;  5CA1 B;  2KGW A;  4O4J B;  3UT5 A;  2R6R 1;  5HP7 A;  3S03 A;  3JAT B;  5DCV A;  4IHJ A;  5EWR A;  3GYQ A;  3CC4 F;  4O4L B;  5LP6 C;  3RYI A;  2IG8 A;  3GHZ A;  1JY8 A;  2FC3 A;  1DT9 A;  3V3T A;  2YXZ A;  4I4T A;  4G4X A;  1VQ9 F;  4FFB B;  3HWU A;  1X7O A;  4X3M A;  2LBT A;  4C8I A;  3RYC A;  2HVY D;  4NWO B;  5IYZ B;  1RA4 A;  3JAR B;  3KHN A;  3V7Q A;  3VO8 A;  2HP0 B;  4DRX A;  3VMF B;  3HKE A;  2GLZ A;  5EIB C;  1W2B F;  3I56 F;  2UYN A;  3VI6 A;  5GIO C;  3I55 F;  3CCS F;  2Z01 A;  4YJ2 B;  4ZI7 A;  3F6M A;  4X1I A;  2MQE A;  1J7H A;  2QEX F;  2LCA A;  5EAZ A;  3UT5 B;  3N4Y A;  1VQN F;  3K2X A;  5JH7 A;  3AGK A;  1QVG F;  1CN7 A;  5LXT A;  3KJK A;  2BTQ B;  4M8I A;  3G71 F;  4O4H A;  1YGY A;  2HRY A;  4ZHW A;  1X7P A;  1NQ3 A;  1H48 A;  4G4W A;  5JQG B;  1VQO F;  1JN1 A;  4RHA A;  3B6N A;  3VCZ A;  4LCK A;  3N2K A;  1DBF A;  4RQO A;  3JAW A;  1SA0 B;  4EI8 A;  3F0F A;  2Z1F A;  5GIN C;  3IEQ A;  3WGK A;  1IV3 A;  3LYB A;  5C8Y B;  3CYP B;  3VYT C;  3C9R A;  5GON B;  3RYH B;  3ZP7 A;  4ZHQ B;  4IIJ A;  3D00 A;  5FNV A;  1VK3 A;  2BO1 A;  3ON1 A;  3J7A R;  3C9U A;  3MBM A;  1U43 A;  1FSZ A;  3CPW F; 
#chains in the Genus database with same CATH homology
 3CCR F;  3HAX D;  3CCJ F;  2CZW A;  1VQM F;  3OBW A;  3CCU F;  2OTJ F;  4EI7 A;  1VQ4 F;  5HY1 A;  3CG6 A;  1W3E X;  3CXC F;  5GAN K;  3CCQ F;  1RLG A;  1KD1 H;  3NVI B;  4BVT A;  3NVK E;  1NJI H;  5EO3 A;  1YJ9 F;  3CCV F;  3CC7 F;  4BY9 D;  5A2Q M;  1KC8 H;  1YJN F;  2F9Z C;  3JAM M;  3RA6 A;  2VGM A;  2LBX A;  2OHW A;  3MCA B;  3FFM A;  5G4V C;  1M90 H;  5FJ4 C;  5HY0 A;  1GO0 A;  5HXU A;  1T0K B;  1YJW F;  2QA4 F;  3J81 M;  3NK6 A;  4BW0 B;  3HJW C;  3LWR C;  3J80 M;  3PAF A;  3RA5 A;  1W41 A;  1H7M A;  1JJ2 F;  3CCM F;  5DCV A;  4BVS A;  3CCL F;  1VQ6 F;  5EWR A;  3GYQ A;  1GO1 A;  3LWP C;  3CC4 F;  2KG4 A;  2FC3 A;  1Q81 H;  2FGY A;  1DT9 A;  3V3T A;  2QI2 A;  3G4S F;  1Q86 H;  1K8A H;  1VQ9 F;  1W42 A;  4BVR A;  1YHQ F;  2VGN A;  1X7O A;  4X3M A;  3LWQ C;  1IPA A;  2HVY D;  4NQ3 A;  2ALE A;  2KTU A;  1RA4 A;  5HXZ A;  3V7Q A;  4EI9 A;  4X3L A;  5FLX M;  1E7K A;  3CC2 F;  4TZZ A;  5IT9 M;  1GZ0 A;  1XBI A;  3VMF B;  1VQP F;  3OW2 F;  3CPQ A;  3IR9 A;  2GLZ A;  1Q7Y H;  2I6D A;  4XCQ A;  3I56 F;  1W2B F;  3VI6 A;  4BVQ A;  5GIO C;  5GIP C;  3I55 F;  3CCS F;  3PLA C;  2LBW A;  3OBY A;  3JCM M;  3LWO C;  1PXW A;  2AIF A;  5HY2 A;  3NK7 A;  2QEX F;  1VQ5 F;  3O85 A;  3SIV A;  5G4U C;  5HWE A;  3N4Y A;  3E1Y A;  1VQN F;  2KTV A;  4NUT A;  3AGK A;  1QVG F;  1VQL F;  1CN7 A;  1VQ7 F;  2WAL A;  3N4Z A;  1K9M H;  3LWV C;  3G71 F;  2JNB A;  1S72 F;  1NMU B;  1VQK F;  1KQS F;  2OTL F;  3CD6 F;  1X7P A;  3LFO A;  3SIU A;  1VQO F;  1K73 H;  1M1K H;  3V7E A;  4LCK A;  1CK2 A;  1YI2 F;  4EI8 A;  1SDS A;  3CMA F;  2OZB A;  5HY4 A;  5GIN C;  3E20 B;  3CCE F;  1YIJ F;  1VQ8 F;  3NMU C;  3CME F;  5GAP K;  3WXM B;  3G6E F;  4C4W C;  3D00 A;  1Q82 H;  2BO1 A;  1ZWZ A;  3ON1 A;  1QVF F;  1X52 A;  3J7A R;  1W40 A;  1N8R H;  1YIT F;  3CPW F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...