3LWRC

Structure of h/aca rnp bound to a substrate rna containing 4su
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 39
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwrC00
1ZWZA 5EWRA 3V7EA 2JNBA 3CD6F 5GAPK 1W41A 5GANK 5GINC 1Q86H 1XBIA 1N8RH 2QI2A 4NUTA 4BW0B 3I55F 3CMEF 1VQ7F 3JAMM 1GZ0A 2KTVA 1W42A 3CC2F 3J7AR 1X52A 1H7MA 1X7PA 2FC3A 3OBYA 2I6DA 1NJIH 3IR9A 1PXWA 1YJWF 2BO1A 1VQ6F 4LCKA 3G71F 3CPQA 1K8AH 3N4YA 1W40A 3CG6A 2LBWA 5GIOC 3CCMF 1YITF 1K73H 5G4VC 2CZWA 3CPWF 1YHQF 4TZZA 1YJNF 1W2BF 1QVGF 5FJ4C 2ALEA 1Q81H 2KG4A 3NK6A 3CC7F 1VQOF 1YIJF 3NK7A 2KTUA 2VGNA 5FLXM 5IT9M 3JCMM 3LWQC 3E1YA 5EO3A 1X7OA 3CXCF 2OZBA 3VI6A 3NMUC 1M1KH 3SIVA 1JJ2F 2OHWA 3WXMB 3CCEF 1KC8H 2QEXF 4C4WC 3CCUF 3HJWC 3MCAB 1VQKF 5GIPC 1VQ5F 1SDSA 2QA4F 1GO1A 3SIUA 1RLGA 3RA5A 1VQPF 3CCVF 2HVYD 1QVFF 1GO0A 3LWOC 1VQ4F 3CCJF 3NVIB 3NVKE 3VMFB 2VGMA 3PLAC 4X3LA 3J80M 3G6EF 3CCLF 1KD1H 1VQ8F 1CN7A 5G4UC 1Q7YH 1VQNF 4X3MA 3AGKA 3FFMA 1CK2A 3V7QA 2OTLF 1IPAA 3PAFA 3I56F 3LWRC 2WALA 3OW2F 3ON1A 3LWVC 5A2QM 3LWPC 1T0KB 2AIFA 3CC4F 1VQLF 3GYQA 1Q82H 3G4SF 3CCQF 4BY9D 3N4ZA 3CCSF 1VQMF 1RA4A 3O85A 3LFOA 1M90H 3CMAF 1K9MH 2OTJF 1NMUB 3RA6A 1S72F 3E20B 1W3EX 1YJ9F 5DCVA 1YI2F 3CCRF 1E7KA 3HAXD 1DT9A 1KQSF 1VQ9F 3OBWA 3J81M 2LBXA
chains in the Genus database with same CATH superfamily
5KX5B 3RYHB 4ZHVA 3N2GB 3HKCA 1W59A 3V7EA 2JNBA 4ERHA 4DRXA 1N8RH 5HY4A 5HP7A 3HWUA 2QI2A 2B33A 4TUYA 3JAMM 3R0PA 5HP8A 3ZP4A 1X7PA 1T0AA 2UZHA 4B5CA 5J2UA 2G9IA 4C81A 1RLUA 3GTZA 2Z01A 2AIZP 3F0GA 2GLZA 3FD6A 1K8AH 3D54A 1TUBA 1W40A 3VOBA 3HKDB 4O4JB 4O2AB 3CPWF 5EZYB 3HKBB 1FNKA 2ZAUA 4FFBB 5EIBD 1IV1A 4EB6A 3C9RA 3C9TA 3IEQA 2ALEA 1Q81H 2KG4A 4BT3A 5KX5A 2CHTA 5CA0B 4BT7A 3WJRA 1YIJF 3IKEA 2KTUA 4G4XA 5FLXM 4G4ZA 5EYPB 3TD5A 3KJJA 3S02A 2RHJA 1W5EA 1SA0B 1JJ2F 2OHWA 4RQOA 4ZHQA 2DT4A 3WXMB 1JFFA 1RQ2A 4X20B 3CCEF 1FSZA 2RHOA 3MCAB 1VQKF 1GO1A 5HY2A 1RLGA 1VQPF 3QHDA 2HVYD 1U3PA 3F0EA 3M4SA 3CCJF 3NVKE 3LDTA 5LA6B 3RYFA 1FNJA 3D00A 4IHJA 4O2AA 5JQGB 3B6NA 3CCLF 1VQ8F 2Q1XA 1VQNF 4U3JA 4C8EA 3KIZA 3RYCB 5CA1B 3V7QA 4TV8B 2FGYA 5MN4A 4O2BB 4G4YA 1X25A 3JASB 3ON1A 3LWVC 1T0KB 2N48A 4O4HB 4B45A 2AIFA 3DC2A 3JAKA 5ITZA 2UYNB 3VOAA 3G4SF 3CCQF 3L7QA 1KNJA 4LNUA 2H8CA 1M90H 1H48A 3ERNA 3JALB 3S06A 2CVLA 5C8YB 4O4LB 3P0ZA 3F6MA 2RB9A 3VCZA 3HKCB 3BYQA 3CCRF 3VTIC 3CYQA 1VQ9F 3UT5A 3J81M 3VYSC 4BVTA 5EWRA 1IV3A 3WPWA 5IJ0A 3QUWA 4TUYB 2I6RA 2L26A 4BVQA 3EORA 1W41A 5GANK 1JD1A 2W8BC 2IAFA 5GINC 2CSLA 4C8IA 4BW0B 2Z1EA 1VQ7F 4YJ2A 4PWTA 1W42A 1X52A 1W5AA 4DXDA 3VIUA 4M8IA 1NJIH 1TUBB 3IR9A 4ZHYB 3WJPA 2BO1A 4R40B 3F0DA 3WGKA 4LCKA 5J2TA 3G71F 4EB6B 5C8YA 3CCMF 5GIOC 1YITF 5G4VC 3S0HA 1YJNF 1DBFA 3C9SA 3F0FA 2HS0A 1YQNA 3WGMA 1XHOA 3NK7A 5HY0A 3HTNA 4ZHQB 1JFFB 3CXCF 3VI6A 1ONIA 5JVDA 3NMUC 1QU9A 3SIVA 2CW4A 1W57A 1KC8H 2QEXF 3CCUF 3HJWC 4X1YA 3V3TA 2H8EA 1U43A 5HXUA 5GIPC 1SDSA 3RYFB 3SIUA 4IHJB 1W5BA 2ZVYA 5EIBC 5GONA 1QVFF 2BTUA 2QTPA 2PHNA 5AVMA 3LWOC 4HNAA 1NQ3A 5FNVA 4U3JB 4C8GA 1XRGA 3WJQA 3ZOPA 4ZK7A 3Q8HA 5G4UC 1U40A 5HY1A 2IQQA 3JAKB 3AGKA 4I4TB 5ITZB 1KNKA 2OTLF 1H47A 3JATA 4LNUB 4BVRA 4XCQA 5LOVA 3LWPC 2BTQB 5KMGA 3CC4F 1Q82H 5HXZA 1PF5A 4BY9D 3RYIA 2Z1TA 3CCSF 3CYPB 4X1IA 3VYTC 5LXTA 3LFOA 4G4VA 2OTJF 1NMUB 3K12A 3RA6A 3UT5B 1R1MA 3MCQA 2HP0A 3P10A 5IJ0B 1FFXA 4BT2A 2VAWA 1E7KA 3MQWA 2ZF8A 3TD3A 1ZWZA 3GHZA 3K14A 5LYJA 1UFYA 2VAMA 4YJ2B 5IYZB 2HRUA 3CD6F 1RQ7A 4WBNA 4I4TA 2VXYA 1Q86H 3JARB 1XBIA 3KE1A 3I55F 1GZ0A 2KTVA 5J2TB 3CC2F 4BVSA 3WGNA 2UYKA 2FC3A 3OBYA 4X1KA 3JVHA 2UYJA 1YJWF 3S0YA 5CB4A 3CPQA 3U0OA 3D01A 3N4YA 4ZOLA 3JAWA 3CG6A 1VHAA 2HQSC 2LBWA 2CZWA 3VO8A 4IIJA 2YXZA 2Z1FA 2KGWA 1YHQF 1QVGF 5JVDB 4E6EA 2ZODA 3TD4A 3T80A 5HWEA 5JH7A 5IYZA 2VGNA 3N2KA 3IEWA 5IT9M 3JCMM 3E1YA 5EO3A 4B62A 3DDNA 2OZBA 3JARA 3K2XA 4BT6A 4X1YB 5GONB 4HNAB 2LCAA 3HKEA 2QA4F 5FNVB 3K0TA 2CHSA 1JN1A 3KHNA 4ZI7A 2YYEA 3E22A 1COMA 1VQ4F 5MN6A 3NVIB 2HX0A 1VK3A 3VMFB 1TVKB 3PLAC 2P6YA 4X3LA 1KD1H 3I7TA 4O4IA 5EB0A 3IMPA 3JATB 2AMTA 4I50A 1SZQA 5LOVB 5BMVA 3FPIA 5KMGB 3FFMA 3LMEA 2PMPA 3CB2A 1IPAA 3RYIB 3PAFA 4X1IB 3WPXA 2WALA 4YJ3A 2Z1UA 3S0WA 5LXTB 1UI9A 5LP6A 3OONA 4BT4A 4EI9A 1VH8A 2UYPA 2Q1YA 2HP0B 5JCOC 1VQMF 1FFXB 3O85A 4I55A 2RHLA 4U39A 4EI8A 2CWJA 2BTOA 3C8LA 2HS4A 1S72F 3MDOA 1W3EX 3QTYA 4KWEA 1YJ9F 2F9ZC 3MBMA 2GZLA 5IJ9A 5LYJB 5EAZA 1TVKA 1KQSF 1YGYA 2V9YA 4WBNB 3OBWA 1Q7YH 4ZHWA 3WGJA 2IG8A 2LBXA 4F6RA 5GAPK 1GX1A 3C9UA 4TV9A 4C82A 3RYHA 4X1KB 3N2GA 4NUTA 3CMEF 2EWCA 5CB4B 1Z5VA 3J7AR 1W55A 1H7MA 4ZOLB 2I6DA 2DYYA 3JAWB 1PXWA 2H6LA 4G4WA 1VQ6F 2R751 4IIJB 1VQVA 1ODEA 4EI7A 1OAPA 1Q8RA 1IV2A 5LP6C 1K73H 5JH7B 3S03A 3M84A 5EB1B 1XV2A 3N2KB 4TZZA 1W2BF 5FJ4C 1IV4A 3NK6A 3HKDA 4O4JA 3CC7F 1VQOF 3IKFA 5EZYA 3HKBA 4FFBA 3LWQC 3P4EA 1X7OA 1JY8A 3LYBA 3ELCA 5CA0A 1M1KH 3HKEB 4RHAA 2R6R1 2GVIA 5EYPA 2K1SA 4ZI7B 4C4WC 3E22B 1VQ5F 3WGLA 1SA0A 2HS3A 3RA5A 2HP3A 3CCVF 4X20A 1GO0A 4O4IB 3I3FA 2VGMA 4I50B 5JCOA 2ZOVA 5BMVB 3FBAA 3J80M 1CLIA 3G6EF 5MN5A 1QD9A 1CN7A 3ZO8A 3ZP7A 2VAPA 4YJ3B 5LA6A 3V4DA 2ZVZA 3ESJA 1W5FA 4X3MA 4DRXB 5B8FA 5JQGA 5LP6B 1J7HA 3RE3A 1CK2A 2OTMA 3I56F 2HRYA 3LWRC 3OW2F 5A2QM 4I55B 1W581 1VQLF 3GYQA 3RYCA 2RHHA 5CA1A 4TV8A 3FD5A 5J2UB 3N4ZA 4O2BA 1OFUA 1QAHA 3JASA 3KJKA 3M1XA 4NWOB 1RA4A 5IJ9B 4O4HA 4NQ3A 2LBTA 3CMAF 1K9MH 2UYNA 1Z5WA 3VYUC 4F6RB 3E20B 2MQEA 4BT5A 4G88A 4B46A 5DCVA 1YI2F 3HAXD 1U3LA 1DT9A 3JALA 2NMUA 4O4LA 4TV9B
chains in the Genus database with same CATH topology
1ZWZA 4BVTA 5EWRA 3V7EA 2JNBA 4BVQA 3CD6F 5GAPK 1W41A 5GANK 5GINC 1Q86H 1XBIA 1N8RH 5HY4A 2QI2A 4NUTA 4BW0B 3I55F 3CMEF 1VQ7F 3JAMM 1GZ0A 2KTVA 1W42A 3CC2F 3J7AR 1X52A 4BVSA 1H7MA 1X7PA 2FC3A 3OBYA 2I6DA 1NJIH 3IR9A 1PXWA 1YJWF 2BO1A 1VQ6F 4LCKA 3G71F 3CPQA 4EI7A 2GLZA 1K8AH 3N4YA 1W40A 3CG6A 2LBWA 5GIOC 3CCMF 1YITF 1K73H 5G4VC 2CZWA 3CPWF 1YHQF 4TZZA 1YJNF 1W2BF 1QVGF 5FJ4C 2ALEA 1Q81H 2KG4A 3NK6A 3CC7F 5HWEA 1VQOF 1YIJF 5HY0A 3NK7A 2KTUA 2VGNA 5FLXM 5IT9M 3JCMM 3LWQC 3E1YA 5EO3A 1X7OA 3CXCF 2OZBA 3VI6A 3NMUC 1M1KH 3SIVA 1JJ2F 2OHWA 3WXMB 3CCEF 1KC8H 2QEXF 4C4WC 3CCUF 3HJWC 3MCAB 3V3TA 5HXUA 5GIPC 1VQ5F 1VQKF 1SDSA 2QA4F 1GO1A 3SIUA 5HY2A 1RLGA 3RA5A 1VQPF 3CCVF 2HVYD 1QVFF 1GO0A 3LWOC 1VQ4F 3CCJF 3NVIB 3NVKE 3VMFB 2VGMA 3PLAC 3D00A 4X3LA 3J80M 3G6EF 3CCLF 1KD1H 1VQ8F 1CN7A 5G4UC 1Q7YH 5HY1A 1VQNF 4X3MA 3AGKA 3FFMA 1CK2A 3V7QA 2OTLF 2FGYA 1IPAA 3PAFA 3I56F 3LWRC 2WALA 3OW2F 3ON1A 4XCQA 4BVRA 5A2QM 3LWPC 3LWVC 2AIFA 1T0KB 3CC4F 1VQLF 3GYQA 1Q82H 5HXZA 3G4SF 3CCQF 4BY9D 3N4ZA 4EI9A 3CCSF 1VQMF 1RA4A 3O85A 3LFOA 4NQ3A 1M90H 4EI8A 3CMAF 1K9MH 2OTJF 1NMUB 3RA6A 1S72F 3E20B 1W3EX 1YJ9F 2F9ZC 5DCVA 1YI2F 3CCRF 1E7KA 3HAXD 1DT9A 1KQSF 1VQ9F 3OBWA 3J81M 2LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWZ A;  5EWR A;  3V7E A;  2JNB A;  3CD6 F;  5GAP K;  1W41 A;  5GAN K;  5GIN C;  1Q86 H;  1XBI A;  1N8R H;  2QI2 A;  4NUT A;  4BW0 B;  3I55 F;  3CME F;  1VQ7 F;  3JAM M;  1GZ0 A;  2KTV A;  1W42 A;  3CC2 F;  3J7A R;  1X52 A;  1H7M A;  1X7P A;  2FC3 A;  3OBY A;  2I6D A;  1NJI H;  3IR9 A;  1PXW A;  1YJW F;  2BO1 A;  1VQ6 F;  4LCK A;  3G71 F;  3CPQ A;  1K8A H;  3N4Y A;  1W40 A;  3CG6 A;  2LBW A;  5GIO C;  3CCM F;  1YIT F;  1K73 H;  5G4V C;  2CZW A;  3CPW F;  1YHQ F;  4TZZ A;  1YJN F;  1W2B F;  1QVG F;  5FJ4 C;  2ALE A;  1Q81 H;  2KG4 A;  3NK6 A;  3CC7 F;  1VQO F;  1YIJ F;  3NK7 A;  2KTU A;  2VGN A;  5FLX M;  5IT9 M;  3JCM M;  3LWQ C;  3E1Y A;  5EO3 A;  1X7O A;  3CXC F;  2OZB A;  3VI6 A;  3NMU C;  1M1K H;  3SIV A;  1JJ2 F;  2OHW A;  3WXM B;  3CCE F;  1KC8 H;  2QEX F;  4C4W C;  3CCU F;  3HJW C;  3MCA B;  1VQK F;  5GIP C;  1VQ5 F;  1SDS A;  2QA4 F;  1GO1 A;  3SIU A;  1RLG A;  3RA5 A;  1VQP F;  3CCV F;  2HVY D;  1QVF F;  1GO0 A;  3LWO C;  1VQ4 F;  3CCJ F;  3NVI B;  3NVK E;  3VMF B;  2VGM A;  3PLA C;  4X3L A;  3J80 M;  3G6E F;  3CCL F;  1KD1 H;  1VQ8 F;  1CN7 A;  5G4U C;  1Q7Y H;  1VQN F;  4X3M A;  3AGK A;  3FFM A;  1CK2 A;  3V7Q A;  2OTL F;  1IPA A;  3PAF A;  3I56 F;  3LWR C;  2WAL A;  3OW2 F;  3ON1 A;  3LWV C;  5A2Q M;  3LWP C;  1T0K B;  2AIF A;  3CC4 F;  1VQL F;  3GYQ A;  1Q82 H;  3G4S F;  3CCQ F;  4BY9 D;  3N4Z A;  3CCS F;  1VQM F;  1RA4 A;  3O85 A;  3LFO A;  1M90 H;  3CMA F;  1K9M H;  2OTJ F;  1NMU B;  3RA6 A;  1S72 F;  3E20 B;  1W3E X;  1YJ9 F;  5DCV A;  1YI2 F;  3CCR F;  1E7K A;  3HAX D;  1DT9 A;  1KQS F;  1VQ9 F;  3OBW A;  3J81 M;  2LBX A; 
#chains in the Genus database with same CATH topology
 5KX5 B;  3RYH B;  4ZHV A;  3N2G B;  3HKC A;  1W59 A;  3V7E A;  2JNB A;  4ERH A;  4DRX A;  1N8R H;  5HY4 A;  5HP7 A;  3HWU A;  2QI2 A;  2B33 A;  4TUY A;  3JAM M;  3R0P A;  5HP8 A;  3ZP4 A;  1X7P A;  1T0A A;  2UZH A;  4B5C A;  5J2U A;  2G9I A;  4C81 A;  1RLU A;  3GTZ A;  2Z01 A;  2AIZ P;  3F0G A;  2GLZ A;  3FD6 A;  1K8A H;  3D54 A;  1TUB A;  1W40 A;  3VOB A;  3HKD B;  4O4J B;  4O2A B;  3CPW F;  5EZY B;  3HKB B;  1FNK A;  2ZAU A;  4FFB B;  5EIB D;  1IV1 A;  4EB6 A;  3C9R A;  3C9T A;  3IEQ A;  2ALE A;  1Q81 H;  2KG4 A;  4BT3 A;  5KX5 A;  2CHT A;  5CA0 B;  4BT7 A;  3WJR A;  1YIJ F;  3IKE A;  2KTU A;  4G4X A;  5FLX M;  4G4Z A;  5EYP B;  3TD5 A;  3KJJ A;  3S02 A;  2RHJ A;  1W5E A;  1SA0 B;  1JJ2 F;  2OHW A;  4RQO A;  4ZHQ A;  2DT4 A;  3WXM B;  1JFF A;  1RQ2 A;  4X20 B;  3CCE F;  1FSZ A;  2RHO A;  3MCA B;  1VQK F;  1GO1 A;  5HY2 A;  1RLG A;  1VQP F;  3QHD A;  2HVY D;  1U3P A;  3F0E A;  3M4S A;  3CCJ F;  3NVK E;  3LDT A;  5LA6 B;  3RYF A;  1FNJ A;  3D00 A;  4IHJ A;  4O2A A;  5JQG B;  3B6N A;  3CCL F;  1VQ8 F;  2Q1X A;  1VQN F;  4U3J A;  4C8E A;  3KIZ A;  3RYC B;  5CA1 B;  3V7Q A;  4TV8 B;  2FGY A;  5MN4 A;  4O2B B;  4G4Y A;  1X25 A;  3JAS B;  3ON1 A;  3LWV C;  1T0K B;  2N48 A;  4O4H B;  4B45 A;  2AIF A;  3DC2 A;  3JAK A;  5ITZ A;  2UYN B;  3VOA A;  3G4S F;  3CCQ F;  3L7Q A;  1KNJ A;  4LNU A;  2H8C A;  1M90 H;  1H48 A;  3ERN A;  3JAL B;  3S06 A;  2CVL A;  5C8Y B;  4O4L B;  3P0Z A;  3F6M A;  2RB9 A;  3VCZ A;  3HKC B;  3BYQ A;  3CCR F;  3VTI C;  3CYQ A;  1VQ9 F;  3UT5 A;  3J81 M;  3VYS C;  4BVT A;  5EWR A;  1IV3 A;  3WPW A;  5IJ0 A;  3QUW A;  4TUY B;  2I6R A;  2L26 A;  4BVQ A;  3EOR A;  1W41 A;  5GAN K;  1JD1 A;  2W8B C;  2IAF A;  5GIN C;  2CSL A;  4C8I A;  4BW0 B;  2Z1E A;  1VQ7 F;  4YJ2 A;  4PWT A;  1W42 A;  1X52 A;  1W5A A;  4DXD A;  3VIU A;  4M8I A;  1NJI H;  1TUB B;  3IR9 A;  4ZHY B;  3WJP A;  2BO1 A;  4R40 B;  3F0D A;  3WGK A;  4LCK A;  5J2T A;  3G71 F;  4EB6 B;  5C8Y A;  3CCM F;  5GIO C;  1YIT F;  5G4V C;  3S0H A;  1YJN F;  1DBF A;  3C9S A;  3F0F A;  2HS0 A;  1YQN A;  3WGM A;  1XHO A;  3NK7 A;  5HY0 A;  3HTN A;  4ZHQ B;  1JFF B;  3CXC F;  3VI6 A;  1ONI A;  5JVD A;  3NMU C;  1QU9 A;  3SIV A;  2CW4 A;  1W57 A;  1KC8 H;  2QEX F;  3CCU F;  3HJW C;  4X1Y A;  3V3T A;  2H8E A;  1U43 A;  5HXU A;  5GIP C;  1SDS A;  3RYF B;  3SIU A;  4IHJ B;  1W5B A;  2ZVY A;  5EIB C;  5GON A;  1QVF F;  2BTU A;  2QTP A;  2PHN A;  5AVM A;  3LWO C;  4HNA A;  1NQ3 A;  5FNV A;  4U3J B;  4C8G A;  1XRG A;  3WJQ A;  3ZOP A;  4ZK7 A;  3Q8H A;  5G4U C;  1U40 A;  5HY1 A;  2IQQ A;  3JAK B;  3AGK A;  4I4T B;  5ITZ B;  1KNK A;  2OTL F;  1H47 A;  3JAT A;  4LNU B;  4BVR A;  4XCQ A;  5LOV A;  3LWP C;  2BTQ B;  5KMG A;  3CC4 F;  1Q82 H;  5HXZ A;  1PF5 A;  4BY9 D;  3RYI A;  2Z1T A;  3CCS F;  3CYP B;  4X1I A;  3VYT C;  5LXT A;  3LFO A;  4G4V A;  2OTJ F;  1NMU B;  3K12 A;  3RA6 A;  3UT5 B;  1R1M A;  3MCQ A;  2HP0 A;  3P10 A;  5IJ0 B;  1FFX A;  4BT2 A;  2VAW A;  1E7K A;  3MQW A;  2ZF8 A;  3TD3 A;  1ZWZ A;  3GHZ A;  3K14 A;  5LYJ A;  1UFY A;  2VAM A;  4YJ2 B;  5IYZ B;  2HRU A;  3CD6 F;  1RQ7 A;  4WBN A;  4I4T A;  2VXY A;  1Q86 H;  3JAR B;  1XBI A;  3KE1 A;  3I55 F;  1GZ0 A;  2KTV A;  5J2T B;  3CC2 F;  4BVS A;  3WGN A;  2UYK A;  2FC3 A;  3OBY A;  4X1K A;  3JVH A;  2UYJ A;  1YJW F;  3S0Y A;  5CB4 A;  3CPQ A;  3U0O A;  3D01 A;  3N4Y A;  4ZOL A;  3JAW A;  3CG6 A;  1VHA A;  2HQS C;  2LBW A;  2CZW A;  3VO8 A;  4IIJ A;  2YXZ A;  2Z1F A;  2KGW A;  1YHQ F;  1QVG F;  5JVD B;  4E6E A;  2ZOD A;  3TD4 A;  3T80 A;  5HWE A;  5JH7 A;  5IYZ A;  2VGN A;  3N2K A;  3IEW A;  5IT9 M;  3JCM M;  3E1Y A;  5EO3 A;  4B62 A;  3DDN A;  2OZB A;  3JAR A;  3K2X A;  4BT6 A;  4X1Y B;  5GON B;  4HNA B;  2LCA A;  3HKE A;  2QA4 F;  5FNV B;  3K0T A;  2CHS A;  1JN1 A;  3KHN A;  4ZI7 A;  2YYE A;  3E22 A;  1COM A;  1VQ4 F;  5MN6 A;  3NVI B;  2HX0 A;  1VK3 A;  3VMF B;  1TVK B;  3PLA C;  2P6Y A;  4X3L A;  1KD1 H;  3I7T A;  4O4I A;  5EB0 A;  3IMP A;  3JAT B;  2AMT A;  4I50 A;  1SZQ A;  5LOV B;  5BMV A;  3FPI A;  5KMG B;  3FFM A;  3LME A;  2PMP A;  3CB2 A;  1IPA A;  3RYI B;  3PAF A;  4X1I B;  3WPX A;  2WAL A;  4YJ3 A;  2Z1U A;  3S0W A;  5LXT B;  1UI9 A;  5LP6 A;  3OON A;  4BT4 A;  4EI9 A;  1VH8 A;  2UYP A;  2Q1Y A;  2HP0 B;  5JCO C;  1VQM F;  1FFX B;  3O85 A;  4I55 A;  2RHL A;  4U39 A;  4EI8 A;  2CWJ A;  2BTO A;  3C8L A;  2HS4 A;  1S72 F;  3MDO A;  1W3E X;  3QTY A;  4KWE A;  1YJ9 F;  2F9Z C;  3MBM A;  2GZL A;  5IJ9 A;  5LYJ B;  5EAZ A;  1TVK A;  1KQS F;  1YGY A;  2V9Y A;  4WBN B;  3OBW A;  1Q7Y H;  4ZHW A;  3WGJ A;  2IG8 A;  2LBX A;  4F6R A;  5GAP K;  1GX1 A;  3C9U A;  4TV9 A;  4C82 A;  3RYH A;  4X1K B;  3N2G A;  4NUT A;  3CME F;  2EWC A;  5CB4 B;  1Z5V A;  3J7A R;  1W55 A;  1H7M A;  4ZOL B;  2I6D A;  2DYY A;  3JAW B;  1PXW A;  2H6L A;  4G4W A;  1VQ6 F;  2R75 1;  4IIJ B;  1VQV A;  1ODE A;  4EI7 A;  1OAP A;  1Q8R A;  1IV2 A;  5LP6 C;  1K73 H;  5JH7 B;  3S03 A;  3M84 A;  5EB1 B;  1XV2 A;  3N2K B;  4TZZ A;  1W2B F;  5FJ4 C;  1IV4 A;  3NK6 A;  3HKD A;  4O4J A;  3CC7 F;  1VQO F;  3IKF A;  5EZY A;  3HKB A;  4FFB A;  3LWQ C;  3P4E A;  1X7O A;  1JY8 A;  3LYB A;  3ELC A;  5CA0 A;  1M1K H;  3HKE B;  4RHA A;  2R6R 1;  2GVI A;  5EYP A;  2K1S A;  4ZI7 B;  4C4W C;  3E22 B;  1VQ5 F;  3WGL A;  1SA0 A;  2HS3 A;  3RA5 A;  2HP3 A;  3CCV F;  4X20 A;  1GO0 A;  4O4I B;  3I3F A;  2VGM A;  4I50 B;  5JCO A;  2ZOV A;  5BMV B;  3FBA A;  3J80 M;  1CLI A;  3G6E F;  5MN5 A;  1QD9 A;  1CN7 A;  3ZO8 A;  3ZP7 A;  2VAP A;  4YJ3 B;  5LA6 A;  3V4D A;  2ZVZ A;  3ESJ A;  1W5F A;  4X3M A;  4DRX B;  5B8F A;  5JQG A;  5LP6 B;  1J7H A;  3RE3 A;  1CK2 A;  2OTM A;  3I56 F;  2HRY A;  3LWR C;  3OW2 F;  5A2Q M;  4I55 B;  1W58 1;  1VQL F;  3GYQ A;  3RYC A;  2RHH A;  5CA1 A;  4TV8 A;  3FD5 A;  5J2U B;  3N4Z A;  4O2B A;  1OFU A;  1QAH A;  3JAS A;  3KJK A;  3M1X A;  4NWO B;  1RA4 A;  5IJ9 B;  4O4H A;  4NQ3 A;  2LBT A;  3CMA F;  1K9M H;  2UYN A;  1Z5W A;  3VYU C;  4F6R B;  3E20 B;  2MQE A;  4BT5 A;  4G88 A;  4B46 A;  5DCV A;  1YI2 F;  3HAX D;  1U3L A;  1DT9 A;  3JAL A;  2NMU A;  4O4L A;  4TV9 B; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  4BVT A;  5EWR A;  3V7E A;  2JNB A;  4BVQ A;  3CD6 F;  5GAP K;  1W41 A;  5GAN K;  5GIN C;  1Q86 H;  1XBI A;  1N8R H;  5HY4 A;  2QI2 A;  4NUT A;  4BW0 B;  3I55 F;  3CME F;  1VQ7 F;  3JAM M;  1GZ0 A;  2KTV A;  1W42 A;  3CC2 F;  3J7A R;  1X52 A;  4BVS A;  1H7M A;  1X7P A;  2FC3 A;  3OBY A;  2I6D A;  1NJI H;  3IR9 A;  1PXW A;  1YJW F;  2BO1 A;  1VQ6 F;  4LCK A;  3G71 F;  3CPQ A;  4EI7 A;  2GLZ A;  1K8A H;  3N4Y A;  1W40 A;  3CG6 A;  2LBW A;  5GIO C;  3CCM F;  1YIT F;  1K73 H;  5G4V C;  2CZW A;  3CPW F;  1YHQ F;  4TZZ A;  1YJN F;  1W2B F;  1QVG F;  5FJ4 C;  2ALE A;  1Q81 H;  2KG4 A;  3NK6 A;  3CC7 F;  5HWE A;  1VQO F;  1YIJ F;  5HY0 A;  3NK7 A;  2KTU A;  2VGN A;  5FLX M;  5IT9 M;  3JCM M;  3LWQ C;  3E1Y A;  5EO3 A;  1X7O A;  3CXC F;  2OZB A;  3VI6 A;  3NMU C;  1M1K H;  3SIV A;  1JJ2 F;  2OHW A;  3WXM B;  3CCE F;  1KC8 H;  2QEX F;  4C4W C;  3CCU F;  3HJW C;  3MCA B;  3V3T A;  5HXU A;  5GIP C;  1VQ5 F;  1VQK F;  1SDS A;  2QA4 F;  1GO1 A;  3SIU A;  5HY2 A;  1RLG A;  3RA5 A;  1VQP F;  3CCV F;  2HVY D;  1QVF F;  1GO0 A;  3LWO C;  1VQ4 F;  3CCJ F;  3NVI B;  3NVK E;  3VMF B;  2VGM A;  3PLA C;  3D00 A;  4X3L A;  3J80 M;  3G6E F;  3CCL F;  1KD1 H;  1VQ8 F;  1CN7 A;  5G4U C;  1Q7Y H;  5HY1 A;  1VQN F;  4X3M A;  3AGK A;  3FFM A;  1CK2 A;  3V7Q A;  2OTL F;  2FGY A;  1IPA A;  3PAF A;  3I56 F;  3LWR C;  2WAL A;  3OW2 F;  3ON1 A;  4XCQ A;  4BVR A;  5A2Q M;  3LWP C;  3LWV C;  2AIF A;  1T0K B;  3CC4 F;  1VQL F;  3GYQ A;  1Q82 H;  5HXZ A;  3G4S F;  3CCQ F;  4BY9 D;  3N4Z A;  4EI9 A;  3CCS F;  1VQM F;  1RA4 A;  3O85 A;  3LFO A;  4NQ3 A;  1M90 H;  4EI8 A;  3CMA F;  1K9M H;  2OTJ F;  1NMU B;  3RA6 A;  1S72 F;  3E20 B;  1W3E X;  1YJ9 F;  2F9Z C;  5DCV A;  1YI2 F;  3CCR F;  1E7K A;  3HAX D;  1DT9 A;  1KQS F;  1VQ9 F;  3OBW A;  3J81 M;  2LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...