3LWRC

Structure of h/aca rnp bound to a substrate rna containing 4su
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
molecule keywords Pseudouridine synthase Cbf5
total genus 39
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwrC00
4X3MA 1CK2A 3CPWF 2OTLF 1GZ0A 3N4ZA 1YJWF 1KD1H 1K9MH 1T0KB 1ZWZA 3VI6A 1JJ2F 1GO1A 3O85A 1Q7YH 1M90H 3E1YA 3CMAF 3RA5A 1KC8H 5FJ4C 3OW2F 1VQ4F 3CC7F 1YITF 3NVIB 3CCLF 2JNBA 1VQ5F 4BY9D 2QEXF 3OBYA 2HVYD 3I55F 3V7EA 3E20B 3CC2F 1YI2F 1KQSF 1YJNF 1VQPF 4C4WC 4LCKA 1YJ9F 1YIJF 3JCMM 1Q86H 1W40A 5GIPC 3CCMF 3LWVC 2OTJF 3HJWC 5GINC 3LWOC 1NMUB 2LBWA 1W41A 1H7MA 2ALEA 2QI2A 5GAPK 5G4UC 1VQ9F 1VQLF 2FC3A 3N4YA 3MCAB 3CXCF 3SIVA 1W2BF 3OBWA 3AGKA 3G4SF 3NMUC 3G6EF 3G71F 1X52A 3J80M 3CD6F 4TZZA 1VQKF 3CCUF 3CCSF 1DT9A 1N8RH 2I6DA 3NVKE 4X3LA 1W3EX 1NJIH 3CCEF 1IPAA 2CZWA 2LBXA 1CN7A 3J7AR 3PAFA 1QVGF 3CMEF 2KTUA 5IT9M 3ON1A 1VQ8F 2OZBA 2VGMA 5GANK 3CCRF 2OHWA 5FLXM 2AIFA 2KTVA 1GO0A 2VGNA 3CG6A 4NUTA 3NK6A 3CC4F 1QVFF 3LWPC 3CPQA 5EWRA 3CCVF 3VMFB 1VQMF 1YHQF 2WALA 3LFOA 3RA6A 1VQOF 3HAXD 5A2QM 1E7KA 1SDSA 1S72F 1Q81H 1X7OA 1X7PA 3WXMB 1RA4A 1VQNF 1XBIA 3CCJF 2BO1A 3LWQC 3I56F 2KG4A 1K73H 3GYQA 3SIUA 1M1KH 5EO3A 4BW0B 1VQ6F 3FFMA 1Q82H 3CCQF 5DCVA 3NK7A 1K8AH 5G4VC 3JAMM 3J81M 2QA4F 1RLGA 3LWRC 3PLAC 1PXWA 1W42A 3V7QA 5GIOC 1VQ7F 3IR9A
chains in the Genus database with same CATH superfamily
3MDOA 4DRXA 1YJWF 3WJRA 4ZHWA 3FPIA 3HKDB 1JJ2F 3O85A 1RQ2A 3VCZA 3V4DA 4TV9A 1QD9A 3UT5B 5EYPA 1U3PA 3M4SA 3CCLF 2PHNA 3P0ZA 1W57A 1VQ5F 4BY9D 5ITZA 2ZAUA 3OONA 3JALB 1KNKA 3CC2F 3S02A 4FFBB 1YI2F 1KQSF 2Q1XA 4F6RA 4EI9A 1TVKB 4BVSA 3KIZA 4O4LB 1XV2A 4EB6A 4G4VA 3LWVC 5MN5A 1NMUB 3TD4A 1W41A 5LA6A 1QU9A 1SA0B 2ZVZA 5HXUA 3JARB 1VQ9F 2IQQA 3CB2A 3P10A 4O4HA 1VQLF 5LP6B 3UT5A 3SIVA 1FFXA 2AMTA 2VXYA 3AGKA 5CA1B 1JN1A 3RYFA 3G4SF 3G6EF 4O4IA 3G71F 1J7HA 3CYQA 3WPXA 5MN4A 1W581 4YJ2B 1PF5A 2CVLA 4O4IB 3NVKE 1W3EX 1NJIH 2GLZA 1IPAA 5KX5B 4ERHA 5LP6A 3J7AR 2VAMA 2NMUA 3I7TA 5IT9M 3ON1A 4B45A 5LYJA 4M8IA 5EAZA 1H47A 3RYHA 5FLXM 2I6RA 2VAWA 5JH7B 5GONB 1COMA 1QAHA 3GTZA 2VGNA 2N48A 4NUTA 3VYSC 3WGKA 3CPQA 3MCQA 3CCVF 4IIJB 1TUBB 1VQMF 4C81A 1YHQF 3HKEA 4X1KA 5EB1B 2Q1YA 4ZI7A 1JD1A 1Q81H 5BMVA 3B6NA 3DC2A 5FNVA 3WGLA 3IKEA 2IAFA 3GYQA 4RHAA 3RE3A 1YGYA 2UYPA 5EO3A 5JCOA 3CYPB 2OTMA 4X20B 3FD5A 2HS3A 1ODEA 1Q82H 4R40B 1W5AA 4YJ3B 3NK7A 2LBTA 4O4HB 3WGNA 4BVTA 4O2AB 5G4VC 3N2KB 3FBAA 3P4EA 1W5BA 2QA4F 3K2XA 3HKBA 3LYBA 3E22B 5EZYA 4O4JA 5FNVB 5B8FA 1VQ7F 1YQNA 4LNUB 1CK2A 1FNJA 1T0KB 3VI6A 2KGWA 4YJ3A 1U40A 3JASB 3RYCA 4G4XA 4ZOLA 3E1YA 2DYYA 1KC8H 2ZF8A 4U3JA 1VQ4F 3CC7F 3RYFB 2YYEA 5HP7A 2Z01A 3JATB 2QEXF 3OBYA 4G4ZA 4O2BA 1W5FA 2B33A 3HKCB 2UYNB 5C8YB 2RHHA 4C8EA 1YJ9F 1YIJF 1U3LA 4C8GA 2CHSA 1W40A 4G4YA 5C8YA 4ZHQB 5CA0B 3VOBA 5GIPC 2OTJF 5IJ9A 5JQGB 1VHAA 5GINC 3IEWA 3LWOC 3Q8HA 2LBWA 1H7MA 1Q8RA 2ALEA 2UYNA 5CA0A 4ZHQA 3JAKA 5G4UC 2FC3A 2YXZA 3JAWB 3MCAB 3CXCF 3M84A 2L26A 1SA0A 1JY8A 5IJ0A 5JQGA 1VH8A 1VQKF 3K12A 2PMPA 4TV8B 1OAPA 1VK3A 4X1YB 2CZWA 2LBXA 4G88A 3VIUA 2G9IA 4EI8A 1CN7A 2HX0A 3PAFA 5EIBD 3EORA 1IV2A 3U0OA 2ZOVA 5DCVA 1Z5VA 3ESJA 1JFFA 5HXZA 2H8EA 2KTVA 1GO0A 4ZK7A 2HS4A 4X1KB 3QTYA 2CHTA 3NK6A 3CC4F 1QVFF 5BMVB 5AVMA 5J2UA 4O4LA 3HAXD 1IV3A 3C9UA 4I50A 3CCJF 2BO1A 3LDTA 3I56F 3HKEB 1K73H 4XCQA 1M1KH 4G4WA 3E22A 5EZYB 5MN6A 3FFMA 1K8AH 3JAMM 3JVHA 1RLGA 2ZVYA 5HY2A 3LWRC 1NQ3A 3PLAC 3V7QA 5IJ0B 5GIOC 4HNAA 4BVQA 3IMPA 2HRUA 3HTNA 4X3MA 5JH7A 1R1MA 3CPWF 1GZ0A 1IV1A 3N4ZA 1KD1H 1K9MH 1ZWZA 4TUYB 4X1IA 2RHJA 5CB4B 3I3FA 4BT2A 5JCOC 3F0DA 3CMAF 2F9ZC 5LA6B 3T80A 3TD5A 5FJ4C 4X1YA 2CW4A 3JAKB 2UZHA 3D54A 4HNAB 3QUWA 3ERNA 1DBFA 3HWUA 5CA1A 1YITF 2HP0A 3LMEA 1W55A 2JNBA 2HVYD 3FD6A 3V7EA 5J2UB 5IYZA 3WJPA 4B62A 4C82A 1SZQA 2HS0A 1GX1A 4NQ3A 4O4JB 4U3JB 1VQPF 1YJNF 4LCKA 5LOVB 2W8BC 5JVDA 3S0HA 3RYIA 4I50B 4BT6A 3D01A 3CCMF 5HWEA 2V9YA 1TVKA 5KMGA 4IHJA 3WGJA 4DXDA 2BTOA 4EB6B 3C9SA 1ONIA 5GAPK 3HKBB 2P6YA 2R6R1 4U39A 3F0FA 4I4TA 1W5EA 5LXTA 2CSLA 1X52A 3JATA 4BT4A 5ITZB 5J2TB 3C8LA 3CCUF 4LNUA 3CCSF 1KNJA 4FFBA 5LXTB 2HQSC 4I55A 4X3LA 4TUYA 3VTIC 5HY1A 1XRGA 4X20A 3CCEF 3C9RA 3RYIB 4I4TB 3F6MA 4BT3A 5EIBC 3VYUC 3N2GA 2OZBA 1H48A 4TV9B 5KX5A 3CCRF 4BT7A 2RHOA 3L7QA 1TUBA 2AIFA 5HY4A 4DRXB 3S0YA 4ZHVA 4TV8A 3CG6A 3K0TA 2RHLA 5EWRA 1W59A 2HP3A 3ZP4A 3D00A 3KHNA 3RA6A 1VQOF 5LYJB 1S72F 1X7PA 1XBIA 4IHJB 4PWTA 3S03A 3LWQC 2HP0B 2FGYA 5HP8A 4E6EA 3KJJA 3CCQF 3S06A 2Z1TA 3V3TA 3HKCA 3J81M 1W42A 2H8CA 3WGMA 3MBMA 4BT5A 5CB4A 1IV4A 3ZP7A 2BTUA 2OTLF 3VYTC 3VOAA 3WPWA 2H6LA 3ZO8A 1GO1A 3N2KA 4WBNB 1Q7YH 5EYPB 1M90H 2LCAA 3RA5A 1XHOA 4F6RB 3OW2F 2K1SA 1RQ7A 4NWOB 3JALA 3N2GB 3NVIB 3I55F 4ZOLB 3E20B 2AIZP 3K14A 2GVIA 1Z5WA 4C4WC 2GZLA 5KMGB 3ZOPA 3JCMM 1Q86H 2CWJA 4RQOA 1VQVA 1FSZA 1OFUA 3HKDA 3HJWC 5LOVA 1FNKA 1UFYA 2Z1FA 3F0EA 3KJKA 5EB0A 1T0AA 3ELCA 4O2AA 5IYZB 2QI2A 4I55B 2MQEA 4ZHYB 5GONA 3KE1A 3IKFA 3IEQA 5J2TA 3N4YA 4B46A 1W2BF 3OBWA 2HRYA 4BVRA 3NMUC 1U43A 2UYKA 3DDNA 3J80M 2QTPA 3CD6F 3S0WA 4TZZA 3VO8A 1FFXB 3JASA 1DT9A 1N8RH 2I6DA 4WBNA 3TD3A 3C9TA 2Z1UA 4KWEA 2EWCA 4X1IB 5JVDB 3R0PA 3JAWA 3WJQA 4C8IA 3F0GA 4YJ2A 1CLIA 3RYHB 1QVGF 3CMEF 2KTUA 1X25A 1VQ8F 4ZI7B 2VGMA 3BYQA 5GANK 3MQWA 5HY0A 2OHWA 4O2BB 2ZODA 2IG8A 2RB9A 2BTQB 2DT4A 3LWPC 4EI7A 3VMFB 2WALA 3LFOA 5A2QM 2Z1EA 1E7KA 1SDSA 1X7OA 1RLUA 1RA4A 3WXMB 1VQNF 3GHZA 4IIJA 2KG4A 3SIUA 5IJ9B 5LP6C 1UI9A 4BW0B 1VQ6F 3JARA 4B5CA 2VAPA 1PXWA 3M1XA 2UYJA 2R751 1JFFB 3QHDA 3IR9A 3RYCB
chains in the Genus database with same CATH topology
4X3MA 1CK2A 3CPWF 2OTLF 1GZ0A 3N4ZA 1YJWF 1KD1H 1K9MH 1T0KB 1ZWZA 3VI6A 1JJ2F 1GO1A 3O85A 1Q7YH 1M90H 3E1YA 3CMAF 3RA5A 2F9ZC 1KC8H 5FJ4C 3OW2F 1VQ4F 3CC7F 1YITF 3NVIB 3CCLF 2JNBA 1VQ5F 4BY9D 2QEXF 3OBYA 2HVYD 3I55F 3V7EA 3E20B 3CC2F 1YI2F 1KQSF 4NQ3A 1YJNF 4EI9A 1VQPF 4C4WC 4LCKA 4BVSA 1YJ9F 1YIJF 3JCMM 1Q86H 1W40A 5GIPC 3CCMF 3LWVC 2OTJF 5HWEA 3HJWC 5GINC 3LWOC 1NMUB 2LBWA 1W41A 1H7MA 2ALEA 2QI2A 5HXUA 5GAPK 5G4UC 1VQ9F 1VQLF 2FC3A 3N4YA 3MCAB 3CXCF 3SIVA 1W2BF 3OBWA 3AGKA 3G4SF 4BVRA 3NMUC 3G6EF 3G71F 1X52A 3J80M 3CD6F 4TZZA 1VQKF 3CCUF 3CCSF 1DT9A 1N8RH 2I6DA 3NVKE 4X3LA 1W3EX 5HY1A 1NJIH 2GLZA 3CCEF 1IPAA 2CZWA 2LBXA 4EI8A 1CN7A 3J7AR 3PAFA 1QVGF 3CMEF 2KTUA 5IT9M 3ON1A 1VQ8F 2OZBA 2VGMA 5GANK 3CCRF 5HXZA 5HY0A 2OHWA 5FLXM 5HY4A 2AIFA 2KTVA 1GO0A 2VGNA 3CG6A 4NUTA 3NK6A 3CC4F 1QVFF 3LWPC 3CPQA 5EWRA 3CCVF 4EI7A 3VMFB 1VQMF 1YHQF 2WALA 3LFOA 3D00A 3RA6A 1VQOF 3HAXD 5A2QM 1E7KA 1SDSA 1S72F 1Q81H 1X7OA 1X7PA 3WXMB 1RA4A 1VQNF 1XBIA 3CCJF 2BO1A 3LWQC 3I56F 2KG4A 1K73H 3GYQA 3SIUA 4XCQA 2FGYA 1M1KH 5EO3A 4BW0B 1VQ6F 3FFMA 4BVTA 3CCQF 1Q82H 3NK7A 5DCVA 1K8AH 3V3TA 5G4VC 3JAMM 3J81M 2QA4F 1RLGA 5HY2A 3LWRC 3PLAC 1PXWA 1W42A 3V7QA 5GIOC 1VQ7F 3IR9A 4BVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3M A;  1CK2 A;  3CPW F;  2OTL F;  1GZ0 A;  3N4Z A;  1YJW F;  1KD1 H;  1K9M H;  1T0K B;  1ZWZ A;  3VI6 A;  1JJ2 F;  1GO1 A;  3O85 A;  1Q7Y H;  1M90 H;  3E1Y A;  3CMA F;  3RA5 A;  1KC8 H;  5FJ4 C;  3OW2 F;  1VQ4 F;  3CC7 F;  1YIT F;  3NVI B;  3CCL F;  2JNB A;  1VQ5 F;  4BY9 D;  2QEX F;  3OBY A;  2HVY D;  3I55 F;  3V7E A;  3E20 B;  3CC2 F;  1YI2 F;  1KQS F;  1YJN F;  1VQP F;  4C4W C;  4LCK A;  1YJ9 F;  1YIJ F;  3JCM M;  1Q86 H;  1W40 A;  5GIP C;  3CCM F;  3LWV C;  2OTJ F;  3HJW C;  5GIN C;  3LWO C;  1NMU B;  2LBW A;  1W41 A;  1H7M A;  2ALE A;  2QI2 A;  5GAP K;  5G4U C;  1VQ9 F;  1VQL F;  2FC3 A;  3N4Y A;  3MCA B;  3CXC F;  3SIV A;  1W2B F;  3OBW A;  3AGK A;  3G4S F;  3NMU C;  3G6E F;  3G71 F;  1X52 A;  3J80 M;  3CD6 F;  4TZZ A;  1VQK F;  3CCU F;  3CCS F;  1DT9 A;  1N8R H;  2I6D A;  3NVK E;  4X3L A;  1W3E X;  1NJI H;  3CCE F;  1IPA A;  2CZW A;  2LBX A;  1CN7 A;  3J7A R;  3PAF A;  1QVG F;  3CME F;  2KTU A;  5IT9 M;  3ON1 A;  1VQ8 F;  2OZB A;  2VGM A;  5GAN K;  3CCR F;  2OHW A;  5FLX M;  2AIF A;  2KTV A;  1GO0 A;  2VGN A;  3CG6 A;  4NUT A;  3NK6 A;  3CC4 F;  1QVF F;  3LWP C;  3CPQ A;  5EWR A;  3CCV F;  3VMF B;  1VQM F;  1YHQ F;  2WAL A;  3LFO A;  3RA6 A;  1VQO F;  3HAX D;  5A2Q M;  1E7K A;  1SDS A;  1S72 F;  1Q81 H;  1X7O A;  1X7P A;  3WXM B;  1RA4 A;  1VQN F;  1XBI A;  3CCJ F;  2BO1 A;  3LWQ C;  3I56 F;  2KG4 A;  1K73 H;  3GYQ A;  3SIU A;  1M1K H;  5EO3 A;  4BW0 B;  1VQ6 F;  3FFM A;  1Q82 H;  3CCQ F;  5DCV A;  3NK7 A;  1K8A H;  5G4V C;  3JAM M;  3J81 M;  2QA4 F;  1RLG A;  3LWR C;  3PLA C;  1PXW A;  1W42 A;  3V7Q A;  5GIO C;  1VQ7 F;  3IR9 A; 
#chains in the Genus database with same CATH topology
 3MDO A;  4DRX A;  1YJW F;  3WJR A;  4ZHW A;  3FPI A;  3HKD B;  1JJ2 F;  3O85 A;  1RQ2 A;  3VCZ A;  3V4D A;  4TV9 A;  1QD9 A;  3UT5 B;  5EYP A;  1U3P A;  3M4S A;  3CCL F;  2PHN A;  3P0Z A;  1W57 A;  1VQ5 F;  4BY9 D;  5ITZ A;  2ZAU A;  3OON A;  3JAL B;  1KNK A;  3CC2 F;  3S02 A;  4FFB B;  1YI2 F;  1KQS F;  2Q1X A;  4F6R A;  4EI9 A;  1TVK B;  4BVS A;  3KIZ A;  4O4L B;  1XV2 A;  4EB6 A;  4G4V A;  3LWV C;  5MN5 A;  1NMU B;  3TD4 A;  1W41 A;  5LA6 A;  1QU9 A;  1SA0 B;  2ZVZ A;  5HXU A;  3JAR B;  1VQ9 F;  2IQQ A;  3CB2 A;  3P10 A;  4O4H A;  1VQL F;  5LP6 B;  3UT5 A;  3SIV A;  1FFX A;  2AMT A;  2VXY A;  3AGK A;  5CA1 B;  1JN1 A;  3RYF A;  3G4S F;  3G6E F;  4O4I A;  3G71 F;  1J7H A;  3CYQ A;  3WPX A;  5MN4 A;  1W58 1;  4YJ2 B;  1PF5 A;  2CVL A;  4O4I B;  3NVK E;  1W3E X;  1NJI H;  2GLZ A;  1IPA A;  5KX5 B;  4ERH A;  5LP6 A;  3J7A R;  2VAM A;  2NMU A;  3I7T A;  5IT9 M;  3ON1 A;  4B45 A;  5LYJ A;  4M8I A;  5EAZ A;  1H47 A;  3RYH A;  5FLX M;  2I6R A;  2VAW A;  5JH7 B;  5GON B;  1COM A;  1QAH A;  3GTZ A;  2VGN A;  2N48 A;  4NUT A;  3VYS C;  3WGK A;  3CPQ A;  3MCQ A;  3CCV F;  4IIJ B;  1TUB B;  1VQM F;  4C81 A;  1YHQ F;  3HKE A;  4X1K A;  5EB1 B;  2Q1Y A;  4ZI7 A;  1JD1 A;  1Q81 H;  5BMV A;  3B6N A;  3DC2 A;  5FNV A;  3WGL A;  3IKE A;  2IAF A;  3GYQ A;  4RHA A;  3RE3 A;  1YGY A;  2UYP A;  5EO3 A;  5JCO A;  3CYP B;  2OTM A;  4X20 B;  3FD5 A;  2HS3 A;  1ODE A;  1Q82 H;  4R40 B;  1W5A A;  4YJ3 B;  3NK7 A;  2LBT A;  4O4H B;  3WGN A;  4BVT A;  4O2A B;  5G4V C;  3N2K B;  3FBA A;  3P4E A;  1W5B A;  2QA4 F;  3K2X A;  3HKB A;  3LYB A;  3E22 B;  5EZY A;  4O4J A;  5FNV B;  5B8F A;  1VQ7 F;  1YQN A;  4LNU B;  1CK2 A;  1FNJ A;  1T0K B;  3VI6 A;  2KGW A;  4YJ3 A;  1U40 A;  3JAS B;  3RYC A;  4G4X A;  4ZOL A;  3E1Y A;  2DYY A;  1KC8 H;  2ZF8 A;  4U3J A;  1VQ4 F;  3CC7 F;  3RYF B;  2YYE A;  5HP7 A;  2Z01 A;  3JAT B;  2QEX F;  3OBY A;  4G4Z A;  4O2B A;  1W5F A;  2B33 A;  3HKC B;  2UYN B;  5C8Y B;  2RHH A;  4C8E A;  1YJ9 F;  1YIJ F;  1U3L A;  4C8G A;  2CHS A;  1W40 A;  4G4Y A;  5C8Y A;  4ZHQ B;  5CA0 B;  3VOB A;  5GIP C;  2OTJ F;  5IJ9 A;  5JQG B;  1VHA A;  5GIN C;  3IEW A;  3LWO C;  3Q8H A;  2LBW A;  1H7M A;  1Q8R A;  2ALE A;  2UYN A;  5CA0 A;  4ZHQ A;  3JAK A;  5G4U C;  2FC3 A;  2YXZ A;  3JAW B;  3MCA B;  3CXC F;  3M84 A;  2L26 A;  1SA0 A;  1JY8 A;  5IJ0 A;  5JQG A;  1VH8 A;  1VQK F;  3K12 A;  2PMP A;  4TV8 B;  1OAP A;  1VK3 A;  4X1Y B;  2CZW A;  2LBX A;  4G88 A;  3VIU A;  2G9I A;  4EI8 A;  1CN7 A;  2HX0 A;  3PAF A;  5EIB D;  3EOR A;  1IV2 A;  3U0O A;  2ZOV A;  5DCV A;  1Z5V A;  3ESJ A;  1JFF A;  5HXZ A;  2H8E A;  2KTV A;  1GO0 A;  4ZK7 A;  2HS4 A;  4X1K B;  3QTY A;  2CHT A;  3NK6 A;  3CC4 F;  1QVF F;  5BMV B;  5AVM A;  5J2U A;  4O4L A;  3HAX D;  1IV3 A;  3C9U A;  4I50 A;  3CCJ F;  2BO1 A;  3LDT A;  3I56 F;  3HKE B;  1K73 H;  4XCQ A;  1M1K H;  4G4W A;  3E22 A;  5EZY B;  5MN6 A;  3FFM A;  1K8A H;  3JAM M;  3JVH A;  1RLG A;  2ZVY A;  5HY2 A;  3LWR C;  1NQ3 A;  3PLA C;  3V7Q A;  5IJ0 B;  5GIO C;  4HNA A;  4BVQ A;  3IMP A;  2HRU A;  3HTN A;  4X3M A;  5JH7 A;  1R1M A;  3CPW F;  1GZ0 A;  1IV1 A;  3N4Z A;  1KD1 H;  1K9M H;  1ZWZ A;  4TUY B;  4X1I A;  2RHJ A;  5CB4 B;  3I3F A;  4BT2 A;  5JCO C;  3F0D A;  3CMA F;  2F9Z C;  5LA6 B;  3T80 A;  3TD5 A;  5FJ4 C;  4X1Y A;  2CW4 A;  3JAK B;  2UZH A;  3D54 A;  4HNA B;  3QUW A;  3ERN A;  1DBF A;  3HWU A;  5CA1 A;  1YIT F;  2HP0 A;  3LME A;  1W55 A;  2JNB A;  2HVY D;  3FD6 A;  3V7E A;  5J2U B;  5IYZ A;  3WJP A;  4B62 A;  4C82 A;  1SZQ A;  2HS0 A;  1GX1 A;  4NQ3 A;  4O4J B;  4U3J B;  1VQP F;  1YJN F;  4LCK A;  5LOV B;  2W8B C;  5JVD A;  3S0H A;  3RYI A;  4I50 B;  4BT6 A;  3D01 A;  3CCM F;  5HWE A;  2V9Y A;  1TVK A;  5KMG A;  4IHJ A;  3WGJ A;  4DXD A;  2BTO A;  4EB6 B;  3C9S A;  1ONI A;  5GAP K;  3HKB B;  2P6Y A;  2R6R 1;  4U39 A;  3F0F A;  4I4T A;  1W5E A;  5LXT A;  2CSL A;  1X52 A;  3JAT A;  4BT4 A;  5ITZ B;  5J2T B;  3C8L A;  3CCU F;  4LNU A;  3CCS F;  1KNJ A;  4FFB A;  5LXT B;  2HQS C;  4I55 A;  4X3L A;  4TUY A;  3VTI C;  5HY1 A;  1XRG A;  4X20 A;  3CCE F;  3C9R A;  3RYI B;  4I4T B;  3F6M A;  4BT3 A;  5EIB C;  3VYU C;  3N2G A;  2OZB A;  1H48 A;  4TV9 B;  5KX5 A;  3CCR F;  4BT7 A;  2RHO A;  3L7Q A;  1TUB A;  2AIF A;  5HY4 A;  4DRX B;  3S0Y A;  4ZHV A;  4TV8 A;  3CG6 A;  3K0T A;  2RHL A;  5EWR A;  1W59 A;  2HP3 A;  3ZP4 A;  3D00 A;  3KHN A;  3RA6 A;  1VQO F;  5LYJ B;  1S72 F;  1X7P A;  1XBI A;  4IHJ B;  4PWT A;  3S03 A;  3LWQ C;  2HP0 B;  2FGY A;  5HP8 A;  4E6E A;  3KJJ A;  3CCQ F;  3S06 A;  2Z1T A;  3V3T A;  3HKC A;  3J81 M;  1W42 A;  2H8C A;  3WGM A;  3MBM A;  4BT5 A;  5CB4 A;  1IV4 A;  3ZP7 A;  2BTU A;  2OTL F;  3VYT C;  3VOA A;  3WPW A;  2H6L A;  3ZO8 A;  1GO1 A;  3N2K A;  4WBN B;  1Q7Y H;  5EYP B;  1M90 H;  2LCA A;  3RA5 A;  1XHO A;  4F6R B;  3OW2 F;  2K1S A;  1RQ7 A;  4NWO B;  3JAL A;  3N2G B;  3NVI B;  3I55 F;  4ZOL B;  3E20 B;  2AIZ P;  3K14 A;  2GVI A;  1Z5W A;  4C4W C;  2GZL A;  5KMG B;  3ZOP A;  3JCM M;  1Q86 H;  2CWJ A;  4RQO A;  1VQV A;  1FSZ A;  1OFU A;  3HKD A;  3HJW C;  5LOV A;  1FNK A;  1UFY A;  2Z1F A;  3F0E A;  3KJK A;  5EB0 A;  1T0A A;  3ELC A;  4O2A A;  5IYZ B;  2QI2 A;  4I55 B;  2MQE A;  4ZHY B;  5GON A;  3KE1 A;  3IKF A;  3IEQ A;  5J2T A;  3N4Y A;  4B46 A;  1W2B F;  3OBW A;  2HRY A;  4BVR A;  3NMU C;  1U43 A;  2UYK A;  3DDN A;  3J80 M;  2QTP A;  3CD6 F;  3S0W A;  4TZZ A;  3VO8 A;  1FFX B;  3JAS A;  1DT9 A;  1N8R H;  2I6D A;  4WBN A;  3TD3 A;  3C9T A;  2Z1U A;  4KWE A;  2EWC A;  4X1I B;  5JVD B;  3R0P A;  3JAW A;  3WJQ A;  4C8I A;  3F0G A;  4YJ2 A;  1CLI A;  3RYH B;  1QVG F;  3CME F;  2KTU A;  1X25 A;  1VQ8 F;  4ZI7 B;  2VGM A;  3BYQ A;  5GAN K;  3MQW A;  5HY0 A;  2OHW A;  4O2B B;  2ZOD A;  2IG8 A;  2RB9 A;  2BTQ B;  2DT4 A;  3LWP C;  4EI7 A;  3VMF B;  2WAL A;  3LFO A;  5A2Q M;  2Z1E A;  1E7K A;  1SDS A;  1X7O A;  1RLU A;  1RA4 A;  3WXM B;  1VQN F;  3GHZ A;  4IIJ A;  2KG4 A;  3SIU A;  5IJ9 B;  5LP6 C;  1UI9 A;  4BW0 B;  1VQ6 F;  3JAR A;  4B5C A;  2VAP A;  1PXW A;  3M1X A;  2UYJ A;  2R75 1;  1JFF B;  3QHD A;  3IR9 A;  3RYC B; 
#chains in the Genus database with same CATH homology
 4X3M A;  1CK2 A;  3CPW F;  2OTL F;  1GZ0 A;  3N4Z A;  1YJW F;  1KD1 H;  1K9M H;  1T0K B;  1ZWZ A;  3VI6 A;  1JJ2 F;  1GO1 A;  3O85 A;  1Q7Y H;  1M90 H;  3E1Y A;  3CMA F;  3RA5 A;  2F9Z C;  1KC8 H;  5FJ4 C;  3OW2 F;  1VQ4 F;  3CC7 F;  1YIT F;  3NVI B;  3CCL F;  2JNB A;  1VQ5 F;  4BY9 D;  2QEX F;  3OBY A;  2HVY D;  3I55 F;  3V7E A;  3E20 B;  3CC2 F;  1YI2 F;  1KQS F;  4NQ3 A;  1YJN F;  4EI9 A;  1VQP F;  4C4W C;  4LCK A;  4BVS A;  1YJ9 F;  1YIJ F;  3JCM M;  1Q86 H;  1W40 A;  5GIP C;  3CCM F;  3LWV C;  2OTJ F;  5HWE A;  3HJW C;  5GIN C;  3LWO C;  1NMU B;  2LBW A;  1W41 A;  1H7M A;  2ALE A;  2QI2 A;  5HXU A;  5GAP K;  5G4U C;  1VQ9 F;  1VQL F;  2FC3 A;  3N4Y A;  3MCA B;  3CXC F;  3SIV A;  1W2B F;  3OBW A;  3AGK A;  3G4S F;  4BVR A;  3NMU C;  3G6E F;  3G71 F;  1X52 A;  3J80 M;  3CD6 F;  4TZZ A;  1VQK F;  3CCU F;  3CCS F;  1DT9 A;  1N8R H;  2I6D A;  3NVK E;  4X3L A;  1W3E X;  5HY1 A;  1NJI H;  2GLZ A;  3CCE F;  1IPA A;  2CZW A;  2LBX A;  4EI8 A;  1CN7 A;  3J7A R;  3PAF A;  1QVG F;  3CME F;  2KTU A;  5IT9 M;  3ON1 A;  1VQ8 F;  2OZB A;  2VGM A;  5GAN K;  3CCR F;  5HXZ A;  5HY0 A;  2OHW A;  5FLX M;  5HY4 A;  2AIF A;  2KTV A;  1GO0 A;  2VGN A;  3CG6 A;  4NUT A;  3NK6 A;  3CC4 F;  1QVF F;  3LWP C;  3CPQ A;  5EWR A;  3CCV F;  4EI7 A;  3VMF B;  1VQM F;  1YHQ F;  2WAL A;  3LFO A;  3D00 A;  3RA6 A;  1VQO F;  3HAX D;  5A2Q M;  1E7K A;  1SDS A;  1S72 F;  1Q81 H;  1X7O A;  1X7P A;  3WXM B;  1RA4 A;  1VQN F;  1XBI A;  3CCJ F;  2BO1 A;  3LWQ C;  3I56 F;  2KG4 A;  1K73 H;  3GYQ A;  3SIU A;  4XCQ A;  2FGY A;  1M1K H;  5EO3 A;  4BW0 B;  1VQ6 F;  3FFM A;  4BVT A;  3CCQ F;  1Q82 H;  3NK7 A;  5DCV A;  1K8A H;  3V3T A;  5G4V C;  3JAM M;  3J81 M;  2QA4 F;  1RLG A;  5HY2 A;  3LWR C;  3PLA C;  1PXW A;  1W42 A;  3V7Q A;  5GIO C;  1VQ7 F;  3IR9 A;  4BVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...