3LWRC

Structure of h/aca rnp bound to a substrate rna containing 4su
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna binding protein/rna
total genus 39
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3lwrC00
3CCUF 4LCKA 1T0KB 1H7MA 1PXWA 3CC7F 5G4UC 2VGNA 3NK6A 3CC4F 3FFMA 5IT9M 1KD1H 1GO1A 3PLAC 3CPWF 1GO0A 5EO3A 1KQSF 3ON1A 3CMEF 1VQ6F 1YI2F 1Q7YH 3G4SF 4TZZA 1VQ9F 3CCEF 1VQMF 5FJ4C 3J81M 1X7PA 2ALEA 1W42A 5DCVA 1RLGA 1S72F 1M90H 2OHWA 1W40A 3CPQA 1Q81H 2QA4F 5G4VC 3NVIB 2VGMA 3OW2F 3LWRC 4BW0B 2QI2A 5EWRA 3V7QA 1QVFF 4NUTA 3HAXD 3JAMM 1W41A 5GIPC 2WALA 1YJWF 1CK2A 2QEXF 3SIVA 3MCAB 1VQLF 3OBYA 1W2BF 2BO1A 3NVKE 1X52A 5FLXM 1JJ2F 3E1YA 3O85A 3E20B 1VQNF 3RA5A 1VQ4F 3G71F 2OZBA 2KTUA 1W3EX 1N8RH 5GIOC 1GZ0A 3CCSF 3OBWA 3PAFA 1CN7A 3CMAF 1RA4A 3N4ZA 3LWQC 2KTVA 3CXCF 1VQPF 2JNBA 3LWOC 1YITF 3LWVC 3HJWC 3CCLF 1K73H 2AIFA 1X7OA 3CCVF 3AGKA 3WXMB 1NJIH 3VI6A 2HVYD 2FC3A 3JCMM 1YJNF 1KC8H 1VQ7F 3SIUA 5GANK 1K8AH 3CCRF 3NK7A 3CD6F 3CCJF 4BY9D 1XBIA 5GAPK 3RA6A 3CCMF 1Q82H 1QVGF 1Q86H 3LWPC 3G6EF 3J80M 3GYQA 1VQKF 1YJ9F 3I56F 2OTJF 3I55F 4X3LA 3V7EA 2CZWA 2KG4A 1YIJF 1VQ8F 3VMFB 1ZWZA 2OTLF 3J7AR 2I6DA 5A2QM 1K9MH 3LFOA 1M1KH 1IPAA 1NMUB 4X3MA 4C4WC 3NMUC 3CG6A 1VQ5F 5GINC 1DT9A 3IR9A 3CCQF 1SDSA 1YHQF 3N4YA 1VQOF 2LBXA 3CC2F 1E7KA 2LBWA
chains in the Genus database with same CATH superfamily
2PHNA 5B8FA 4YJ3A 3IKEA 4I55A 1H48A 4O4HA 2IAFA 5FNVA 4O2AB 3CC7F 2VGNA 3N2KA 2HQSC 3VYUC 2HX0A 2Z1EA 3FFMA 5IT9M 1GO0A 4EI8A 2CHTA 2RHLA 2UYNA 5EIBD 3VYSC 3F0DA 4X1YB 1KNKA 4HNAB 4B46A 5CB4A 3ESJA 3TD5A 4B5CA 3D00A 2FGYA 1RLGA 3CPQA 4G4VA 1Q81H 4F6RB 5IJ9A 3K0TA 4C8EA 3OW2F 4NQ3A 2KGWA 4I50B 3RYHB 3VTIC 5LYJA 5LXTB 4EB6A 2QI2A 5EWRA 1JFFB 2Q1YA 1IV1A 1X25A 3E22B 1CK2A 3D54A 4WBNB 3MCAB 4O4IA 1W2BF 4I55B 5FLXM 4TV8B 5FNVB 3RE3A 3N2KB 3O85A 3HWUA 4YJ2A 1TVKA 3RA5A 2LCAA 3RYCA 4B62A 1U40A 5EIBC 3OBWA 3PAFA 4IHJB 3CMAF 2KTVA 2UYNB 2N48A 3CXCF 2CSLA 3QHDA 3LWOC 1YITF 1J7HA 1SA0A 3JALA 3HJWC 3P0ZA 1U43A 5JCOA 1W5FA 3AGKA 1VHAA 1XV2A 3SIUA 1QU9A 3Q8HA 3NK7A 3CCRF 5LYJB 5GAPK 3WGKA 1QVGF 4EI9A 3G6EF 4BVQA 1Q8RA 2HS3A 3GYQA 1VQKF 1IV4A 3I56F 3VYTC 3LYBA 2CZWA 4TUYA 4PWTA 3T80A 2MQEA 1E7KA 2OTLF 4YJ2B 1TVKB 1K9MH 4ZHVA 1FNKA 3RYCB 2AIZP 3VIUA 4U39A 5BMVA 4C4WC 3CG6A 4X1KA 3P4EA 2Q1XA 3QTYA 5EYPA 3F0FA 3WPWA 1YHQF 2ZAUA 2EWCA 1SA0B 3JALB 2LBXA 2LBWA 2VAPA 1VQVA 5HP8A 1DBFA 1IV3A 1PXWA 5MN4A 2B33A 3JATA 4X1IA 1JY8A 3CC4F 1TUBA 5JH7A 1GO1A 3FBAA 3CPWF 4ZOLA 1KQSF 3B6NA 3F6MA 1GX1A 3CMEF 2H8CA 3U0OA 3KE1A 4B45A 3G4SF 3WJQA 1VQ9F 4TUYB 4C8IA 3F0GA 1KNJA 3M84A 3BYQA 5ITZA 4O4LA 1S72F 2OHWA 3FPIA 1RQ7A 3HKBB 5BMVB 3C9UA 4DRXA 3V3TA 2Z1TA 4BT3A 4BW0B 4X1KB 5GONA 5J2TA 1VH8A 3KJKA 3V4DA 3K2XA 5EYPB 5KX5B 2Z1FA 2YYEA 3C8LA 5GIPC 2WALA 1YJWF 5LP6A 3ZP4A 2QEXF 3SIVA 5HY4A 1VQLF 3JAWA 2BTOA 3OBYA 2Z01A 2BO1A 3NVKE 1FNJA 1RQ2A 3JATB 3E1YA 1W59A 2CVLA 1TUBB 5JH7B 1VQNF 1YQNA 1IV2A 1VQ4F 3G71F 3UT5A 1W3EX 1N8RH 2GLZA 4ZOLB 1GZ0A 5LP6C 3MCQA 1RA4A 3LWQC 4ZK7A 2Z1UA 2ZOVA 3S06A 1COMA 3IMPA 1W5BA 5EB1B 4C8GA 1X7OA 5ITZB 5J2UB 3ZO8A 3I3FA 3WXMB 1FSZA 1JN1A 2HVYD 4YJ3B 2GZLA 4O4HB 1K8AH 4DRXB 3CD6F 2BTQB 5MN6A 3CCJF 5MN5A 3HTNA 5J2TB 3DC2A 3RA6A 1Q82H 1W581 1UI9A 1T0AA 2IQQA 3JAWB 2L26A 4BT6A 3I55F 2KG4A 1YIJF 3WPXA 4R40B 1ZWZA 2CHSA 1UFYA 1FFXA 5CB4B 5HXZA 3LFOA 1IPAA 2HS0A 4BT2A 5HXUA 4ZHQA 4I4TA 3NMUC 5IJ9B 1DT9A 3IR9A 3WGJA 1QAHA 3S0WA 2HP3A 1U3LA 4EB6B 3WGLA 1SZQA 5CA0A 4E6EA 4LCKA 3RYIA 1H7MA 1OAPA 3ERNA 4O4IB 4FFBA 2ZVZA 1QD9A 4ZHYB 1KD1H 3PLAC 4NWOB 4EI7A 5EO3A 3LDTA 3JASA 2UZHA 3D01A 5EZYA 1VQ6F 1YI2F 2PMPA 4ERHA 1Q7YH 3WJRA 2HP0A 1PF5A 3N2GA 4TZZA 3ELCA 1W5EA 3CCEF 5HWEA 3C9SA 1VQMF 5FJ4C 5HP7A 1X7PA 1W42A 2ALEA 2ZVYA 3LMEA 1FFXB 3JARA 3FD5A 3TD3A 5G4VC 2RHJA 2VGMA 1CLIA 4ZHQB 3LWRC 5LOVA 4I4TB 1XHOA 2DYYA 2IG8A 2BTUA 1QVFF 4NUTA 3TD4A 1H47A 1U3PA 3JAMM 5CA0B 2ZODA 3MBMA 5IYZA 3RYIB 1JD1A 3P10A 4BVTA 3VOAA 3L7QA 2KTUA 3ZOPA 4RHAA 5EZYB 3MQWA 5EAZA 4G4WA 3DDNA 4BT5A 2HP0B 4O4JA 4IIJA 3N2GB 2W8BC 3WGNA 5HY2A 3CCLF 3EORA 4F6RA 3S02A 3CCVF 2GVIA 3JARB 4O2BA 3RYHA 4I50A 1KC8H 5LA6A 5GANK 4G88A 5LOVB 2P6YA 4X1IB 1XBIA 4X20A 4U3JA 2R6R1 4LNUA 1Q86H 4RQOA 3I7TA 3CB2A 4TV8A 2RB9A 2OTJF 3R0PA 5IYZB 2CWJA 4G4XA 3WJPA 2CW4A 2UYPA 4BT7A 3HKDA 3J7AR 3S0YA 2YXZA 4DXDA 2I6DA 2V9YA 5A2QM 1Z5VA 4IHJA 4BVSA 3QUWA 4O4LB 1NMUB 3KJJA 5AVMA 4X3MA 5IJ0A 5C8YA 3CCQF 4O4JB 4C81A 4IIJB 3F0EA 5GONB 3N4YA 3CC2F 3CCUF 4G4ZA 1T0KB 5LP6B 4TV9A 4O2BB 3K12A 2I6RA 2H6LA 3VCZA 5G4UC 4G4YA 5LA6B 2ZF8A 3NK6A 3FD6A 2UYKA 2H8EA 2UYJA 5HY0A 4X20B 3ON1A 4U3JB 4LNUB 2OTMA 2RHHA 3MDOA 3UT5B 2G9IA 3IKFA 4KWEA 5CA1A 2HRUA 5KMGA 1ODEA 3J81M 3RYFA 1YGYA 3HKDB 3JAKA 3WGMA 5DCVA 3IEQA 1M90H 1W40A 4M8IA 3VO8A 2QA4F 5JVDA 3NVIB 3JVHA 1R1MA 5IJ0B 2NMUA 4BVRA 5C8YB 3GHZA 3C9TA 2VAWA 3V7QA 4C82A 1XRGA 3GTZA 3HAXD 3CYPB 1W41A 4ZI7A 1OFUA 1X52A 3M1XA 4TV9B 3ZP7A 1JJ2F 1Z5WA 3S03A 3HKEA 3E20B 1RLUA 3HKCA 5JQGA 3CYQA 2OZBA 2QTPA 5JCOC 5GIOC 3CCSF 3VOBA 1CN7A 1W5AA 1W57A 3C9RA 3N4ZA 3KHNA 1VQPF 2JNBA 5CA1B 5KMGB 3LWVC 3RYFB 4ZHWA 3JAKB 1K73H 3HKBA 2AIFA 3M4SA 1NJIH 4O2AA 3VI6A 2FC3A 3JCMM 2HRYA 1YJNF 1VQ7F 5JVDB 5KX5A 4FFBB 2AMTA 4BY9D 3CCMF 1ONIA 3IEWA 3KIZA 3LWPC 3J80M 2VXYA 2HS4A 3JASB 2VAMA 1YJ9F 4ZI7B 2F9ZC 4X3LA 2K1SA 4XCQA 3V7EA 4X1YA 5EB0A 1NQ3A 4HNAA 1VQ8F 1VK3A 3VMFB 4BT4A 3HKEB 2R751 3HKCB 3K14A 2LBTA 5JQGB 1W55A 1M1KH 2DT4A 5HY1A 5LXTA 1VQ5F 3OONA 5GINC 1JFFA 1SDSA 3E22A 1VQOF 5J2UA 2RHOA 3S0HA 4WBNA
chains in the Genus database with same CATH topology
3CCUF 4LCKA 1T0KB 1H7MA 1PXWA 3CC7F 5G4UC 2VGNA 3NK6A 3CC4F 3FFMA 5IT9M 1KD1H 1GO1A 3PLAC 4EI7A 3CPWF 5HY0A 1GO0A 5EO3A 1KQSF 3ON1A 4EI8A 3CMEF 1VQ6F 1YI2F 1Q7YH 3G4SF 4TZZA 1VQ9F 3CCEF 5HWEA 1VQMF 5FJ4C 3J81M 1X7PA 2ALEA 1W42A 3D00A 5DCVA 2FGYA 1RLGA 1S72F 1M90H 2OHWA 1W40A 3CPQA 1Q81H 2QA4F 5G4VC 3NVIB 2VGMA 3OW2F 4NQ3A 3LWRC 3V3TA 4BVRA 4BW0B 2QI2A 5EWRA 3V7QA 1QVFF 4NUTA 3HAXD 3JAMM 1W41A 5GIPC 2WALA 1YJWF 1CK2A 2QEXF 3SIVA 3MCAB 5HY4A 1VQLF 3OBYA 1W2BF 2BO1A 3NVKE 1X52A 5FLXM 4BVTA 1JJ2F 3E1YA 3O85A 3E20B 1VQNF 3RA5A 1VQ4F 3G71F 2OZBA 2KTUA 1W3EX 2GLZA 1N8RH 5GIOC 1GZ0A 3CCSF 3OBWA 3PAFA 1CN7A 3CMAF 1RA4A 3N4ZA 3LWQC 2KTVA 3CXCF 1VQPF 2JNBA 3LWOC 1YITF 3LWVC 3HJWC 5HY2A 3CCLF 1K73H 2AIFA 1X7OA 3CCVF 3AGKA 3WXMB 1NJIH 3VI6A 2HVYD 2FC3A 3JCMM 1YJNF 1KC8H 1VQ7F 3SIUA 5GANK 1K8AH 3CCRF 3NK7A 3CD6F 3CCJF 4BY9D 1XBIA 5GAPK 3RA6A 3CCMF 1Q82H 1QVGF 1Q86H 4EI9A 3LWPC 4BVQA 3G6EF 3J80M 3GYQA 1VQKF 1YJ9F 3I56F 2OTJF 3I55F 2F9ZC 4X3LA 2CZWA 4XCQA 2KG4A 3V7EA 1YIJF 1VQ8F 3VMFB 1ZWZA 2OTLF 3J7AR 2I6DA 5A2QM 1K9MH 5HXZA 4BVSA 3LFOA 1M1KH 1IPAA 1NMUB 4X3MA 5HXUA 4C4WC 5HY1A 3NMUC 3CG6A 1VQ5F 5GINC 1DT9A 3IR9A 3CCQF 1SDSA 1YHQF 3N4YA 1VQOF 2LBXA 3CC2F 1E7KA 2LBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU F;  4LCK A;  1T0K B;  1H7M A;  1PXW A;  3CC7 F;  5G4U C;  2VGN A;  3NK6 A;  3CC4 F;  3FFM A;  5IT9 M;  1KD1 H;  1GO1 A;  3PLA C;  3CPW F;  1GO0 A;  5EO3 A;  1KQS F;  3ON1 A;  3CME F;  1VQ6 F;  1YI2 F;  1Q7Y H;  3G4S F;  4TZZ A;  1VQ9 F;  3CCE F;  1VQM F;  5FJ4 C;  3J81 M;  1X7P A;  2ALE A;  1W42 A;  5DCV A;  1RLG A;  1S72 F;  1M90 H;  2OHW A;  1W40 A;  3CPQ A;  1Q81 H;  2QA4 F;  5G4V C;  3NVI B;  2VGM A;  3OW2 F;  3LWR C;  4BW0 B;  2QI2 A;  5EWR A;  3V7Q A;  1QVF F;  4NUT A;  3HAX D;  3JAM M;  1W41 A;  5GIP C;  2WAL A;  1YJW F;  1CK2 A;  2QEX F;  3SIV A;  3MCA B;  1VQL F;  3OBY A;  1W2B F;  2BO1 A;  3NVK E;  1X52 A;  5FLX M;  1JJ2 F;  3E1Y A;  3O85 A;  3E20 B;  1VQN F;  3RA5 A;  1VQ4 F;  3G71 F;  2OZB A;  2KTU A;  1W3E X;  1N8R H;  5GIO C;  1GZ0 A;  3CCS F;  3OBW A;  3PAF A;  1CN7 A;  3CMA F;  1RA4 A;  3N4Z A;  3LWQ C;  2KTV A;  3CXC F;  1VQP F;  2JNB A;  3LWO C;  1YIT F;  3LWV C;  3HJW C;  3CCL F;  1K73 H;  2AIF A;  1X7O A;  3CCV F;  3AGK A;  3WXM B;  1NJI H;  3VI6 A;  2HVY D;  2FC3 A;  3JCM M;  1YJN F;  1KC8 H;  1VQ7 F;  3SIU A;  5GAN K;  1K8A H;  3CCR F;  3NK7 A;  3CD6 F;  3CCJ F;  4BY9 D;  1XBI A;  5GAP K;  3RA6 A;  3CCM F;  1Q82 H;  1QVG F;  1Q86 H;  3LWP C;  3G6E F;  3J80 M;  3GYQ A;  1VQK F;  1YJ9 F;  3I56 F;  2OTJ F;  3I55 F;  4X3L A;  3V7E A;  2CZW A;  2KG4 A;  1YIJ F;  1VQ8 F;  3VMF B;  1ZWZ A;  2OTL F;  3J7A R;  2I6D A;  5A2Q M;  1K9M H;  3LFO A;  1M1K H;  1IPA A;  1NMU B;  4X3M A;  4C4W C;  3NMU C;  3CG6 A;  1VQ5 F;  5GIN C;  1DT9 A;  3IR9 A;  3CCQ F;  1SDS A;  1YHQ F;  3N4Y A;  1VQO F;  2LBX A;  3CC2 F;  1E7K A;  2LBW A; 
#chains in the Genus database with same CATH topology
 2PHN A;  5B8F A;  4YJ3 A;  3IKE A;  4I55 A;  1H48 A;  4O4H A;  2IAF A;  5FNV A;  4O2A B;  3CC7 F;  2VGN A;  3N2K A;  2HQS C;  3VYU C;  2HX0 A;  2Z1E A;  3FFM A;  5IT9 M;  1GO0 A;  4EI8 A;  2CHT A;  2RHL A;  2UYN A;  5EIB D;  3VYS C;  3F0D A;  4X1Y B;  1KNK A;  4HNA B;  4B46 A;  5CB4 A;  3ESJ A;  3TD5 A;  4B5C A;  3D00 A;  2FGY A;  1RLG A;  3CPQ A;  4G4V A;  1Q81 H;  4F6R B;  5IJ9 A;  3K0T A;  4C8E A;  3OW2 F;  4NQ3 A;  2KGW A;  4I50 B;  3RYH B;  3VTI C;  5LYJ A;  5LXT B;  4EB6 A;  2QI2 A;  5EWR A;  1JFF B;  2Q1Y A;  1IV1 A;  1X25 A;  3E22 B;  1CK2 A;  3D54 A;  4WBN B;  3MCA B;  4O4I A;  1W2B F;  4I55 B;  5FLX M;  4TV8 B;  5FNV B;  3RE3 A;  3N2K B;  3O85 A;  3HWU A;  4YJ2 A;  1TVK A;  3RA5 A;  2LCA A;  3RYC A;  4B62 A;  1U40 A;  5EIB C;  3OBW A;  3PAF A;  4IHJ B;  3CMA F;  2KTV A;  2UYN B;  2N48 A;  3CXC F;  2CSL A;  3QHD A;  3LWO C;  1YIT F;  1J7H A;  1SA0 A;  3JAL A;  3HJW C;  3P0Z A;  1U43 A;  5JCO A;  1W5F A;  3AGK A;  1VHA A;  1XV2 A;  3SIU A;  1QU9 A;  3Q8H A;  3NK7 A;  3CCR F;  5LYJ B;  5GAP K;  3WGK A;  1QVG F;  4EI9 A;  3G6E F;  4BVQ A;  1Q8R A;  2HS3 A;  3GYQ A;  1VQK F;  1IV4 A;  3I56 F;  3VYT C;  3LYB A;  2CZW A;  4TUY A;  4PWT A;  3T80 A;  2MQE A;  1E7K A;  2OTL F;  4YJ2 B;  1TVK B;  1K9M H;  4ZHV A;  1FNK A;  3RYC B;  2AIZ P;  3VIU A;  4U39 A;  5BMV A;  4C4W C;  3CG6 A;  4X1K A;  3P4E A;  2Q1X A;  3QTY A;  5EYP A;  3F0F A;  3WPW A;  1YHQ F;  2ZAU A;  2EWC A;  1SA0 B;  3JAL B;  2LBX A;  2LBW A;  2VAP A;  1VQV A;  5HP8 A;  1DBF A;  1IV3 A;  1PXW A;  5MN4 A;  2B33 A;  3JAT A;  4X1I A;  1JY8 A;  3CC4 F;  1TUB A;  5JH7 A;  1GO1 A;  3FBA A;  3CPW F;  4ZOL A;  1KQS F;  3B6N A;  3F6M A;  1GX1 A;  3CME F;  2H8C A;  3U0O A;  3KE1 A;  4B45 A;  3G4S F;  3WJQ A;  1VQ9 F;  4TUY B;  4C8I A;  3F0G A;  1KNJ A;  3M84 A;  3BYQ A;  5ITZ A;  4O4L A;  1S72 F;  2OHW A;  3FPI A;  1RQ7 A;  3HKB B;  5BMV B;  3C9U A;  4DRX A;  3V3T A;  2Z1T A;  4BT3 A;  4BW0 B;  4X1K B;  5GON A;  5J2T A;  1VH8 A;  3KJK A;  3V4D A;  3K2X A;  5EYP B;  5KX5 B;  2Z1F A;  2YYE A;  3C8L A;  5GIP C;  2WAL A;  1YJW F;  5LP6 A;  3ZP4 A;  2QEX F;  3SIV A;  5HY4 A;  1VQL F;  3JAW A;  2BTO A;  3OBY A;  2Z01 A;  2BO1 A;  3NVK E;  1FNJ A;  1RQ2 A;  3JAT B;  3E1Y A;  1W59 A;  2CVL A;  1TUB B;  5JH7 B;  1VQN F;  1YQN A;  1IV2 A;  1VQ4 F;  3G71 F;  3UT5 A;  1W3E X;  1N8R H;  2GLZ A;  4ZOL B;  1GZ0 A;  5LP6 C;  3MCQ A;  1RA4 A;  3LWQ C;  4ZK7 A;  2Z1U A;  2ZOV A;  3S06 A;  1COM A;  3IMP A;  1W5B A;  5EB1 B;  4C8G A;  1X7O A;  5ITZ B;  5J2U B;  3ZO8 A;  3I3F A;  3WXM B;  1FSZ A;  1JN1 A;  2HVY D;  4YJ3 B;  2GZL A;  4O4H B;  1K8A H;  4DRX B;  3CD6 F;  2BTQ B;  5MN6 A;  3CCJ F;  5MN5 A;  3HTN A;  5J2T B;  3DC2 A;  3RA6 A;  1Q82 H;  1W58 1;  1UI9 A;  1T0A A;  2IQQ A;  3JAW B;  2L26 A;  4BT6 A;  3I55 F;  2KG4 A;  1YIJ F;  3WPX A;  4R40 B;  1ZWZ A;  2CHS A;  1UFY A;  1FFX A;  5CB4 B;  5HXZ A;  3LFO A;  1IPA A;  2HS0 A;  4BT2 A;  5HXU A;  4ZHQ A;  4I4T A;  3NMU C;  5IJ9 B;  1DT9 A;  3IR9 A;  3WGJ A;  1QAH A;  3S0W A;  2HP3 A;  1U3L A;  4EB6 B;  3WGL A;  1SZQ A;  5CA0 A;  4E6E A;  4LCK A;  3RYI A;  1H7M A;  1OAP A;  3ERN A;  4O4I B;  4FFB A;  2ZVZ A;  1QD9 A;  4ZHY B;  1KD1 H;  3PLA C;  4NWO B;  4EI7 A;  5EO3 A;  3LDT A;  3JAS A;  2UZH A;  3D01 A;  5EZY A;  1VQ6 F;  1YI2 F;  2PMP A;  4ERH A;  1Q7Y H;  3WJR A;  2HP0 A;  1PF5 A;  3N2G A;  4TZZ A;  3ELC A;  1W5E A;  3CCE F;  5HWE A;  3C9S A;  1VQM F;  5FJ4 C;  5HP7 A;  1X7P A;  1W42 A;  2ALE A;  2ZVY A;  3LME A;  1FFX B;  3JAR A;  3FD5 A;  3TD3 A;  5G4V C;  2RHJ A;  2VGM A;  1CLI A;  4ZHQ B;  3LWR C;  5LOV A;  4I4T B;  1XHO A;  2DYY A;  2IG8 A;  2BTU A;  1QVF F;  4NUT A;  3TD4 A;  1H47 A;  1U3P A;  3JAM M;  5CA0 B;  2ZOD A;  3MBM A;  5IYZ A;  3RYI B;  1JD1 A;  3P10 A;  4BVT A;  3VOA A;  3L7Q A;  2KTU A;  3ZOP A;  4RHA A;  5EZY B;  3MQW A;  5EAZ A;  4G4W A;  3DDN A;  4BT5 A;  2HP0 B;  4O4J A;  4IIJ A;  3N2G B;  2W8B C;  3WGN A;  5HY2 A;  3CCL F;  3EOR A;  4F6R A;  3S02 A;  3CCV F;  2GVI A;  3JAR B;  4O2B A;  3RYH A;  4I50 A;  1KC8 H;  5LA6 A;  5GAN K;  4G88 A;  5LOV B;  2P6Y A;  4X1I B;  1XBI A;  4X20 A;  4U3J A;  2R6R 1;  4LNU A;  1Q86 H;  4RQO A;  3I7T A;  3CB2 A;  4TV8 A;  2RB9 A;  2OTJ F;  3R0P A;  5IYZ B;  2CWJ A;  4G4X A;  3WJP A;  2CW4 A;  2UYP A;  4BT7 A;  3HKD A;  3J7A R;  3S0Y A;  2YXZ A;  4DXD A;  2I6D A;  2V9Y A;  5A2Q M;  1Z5V A;  4IHJ A;  4BVS A;  3QUW A;  4O4L B;  1NMU B;  3KJJ A;  5AVM A;  4X3M A;  5IJ0 A;  5C8Y A;  3CCQ F;  4O4J B;  4C81 A;  4IIJ B;  3F0E A;  5GON B;  3N4Y A;  3CC2 F;  3CCU F;  4G4Z A;  1T0K B;  5LP6 B;  4TV9 A;  4O2B B;  3K12 A;  2I6R A;  2H6L A;  3VCZ A;  5G4U C;  4G4Y A;  5LA6 B;  2ZF8 A;  3NK6 A;  3FD6 A;  2UYK A;  2H8E A;  2UYJ A;  5HY0 A;  4X20 B;  3ON1 A;  4U3J B;  4LNU B;  2OTM A;  2RHH A;  3MDO A;  3UT5 B;  2G9I A;  3IKF A;  4KWE A;  5CA1 A;  2HRU A;  5KMG A;  1ODE A;  3J81 M;  3RYF A;  1YGY A;  3HKD B;  3JAK A;  3WGM A;  5DCV A;  3IEQ A;  1M90 H;  1W40 A;  4M8I A;  3VO8 A;  2QA4 F;  5JVD A;  3NVI B;  3JVH A;  1R1M A;  5IJ0 B;  2NMU A;  4BVR A;  5C8Y B;  3GHZ A;  3C9T A;  2VAW A;  3V7Q A;  4C82 A;  1XRG A;  3GTZ A;  3HAX D;  3CYP B;  1W41 A;  4ZI7 A;  1OFU A;  1X52 A;  3M1X A;  4TV9 B;  3ZP7 A;  1JJ2 F;  1Z5W A;  3S03 A;  3HKE A;  3E20 B;  1RLU A;  3HKC A;  5JQG A;  3CYQ A;  2OZB A;  2QTP A;  5JCO C;  5GIO C;  3CCS F;  3VOB A;  1CN7 A;  1W5A A;  1W57 A;  3C9R A;  3N4Z A;  3KHN A;  1VQP F;  2JNB A;  5CA1 B;  5KMG B;  3LWV C;  3RYF B;  4ZHW A;  3JAK B;  1K73 H;  3HKB A;  2AIF A;  3M4S A;  1NJI H;  4O2A A;  3VI6 A;  2FC3 A;  3JCM M;  2HRY A;  1YJN F;  1VQ7 F;  5JVD B;  5KX5 A;  4FFB B;  2AMT A;  4BY9 D;  3CCM F;  1ONI A;  3IEW A;  3KIZ A;  3LWP C;  3J80 M;  2VXY A;  2HS4 A;  3JAS B;  2VAM A;  1YJ9 F;  4ZI7 B;  2F9Z C;  4X3L A;  2K1S A;  4XCQ A;  3V7E A;  4X1Y A;  5EB0 A;  1NQ3 A;  4HNA A;  1VQ8 F;  1VK3 A;  3VMF B;  4BT4 A;  3HKE B;  2R75 1;  3HKC B;  3K14 A;  2LBT A;  5JQG B;  1W55 A;  1M1K H;  2DT4 A;  5HY1 A;  5LXT A;  1VQ5 F;  3OON A;  5GIN C;  1JFF A;  1SDS A;  3E22 A;  1VQO F;  5J2U A;  2RHO A;  3S0H A;  4WBN A; 
#chains in the Genus database with same CATH homology
 3CCU F;  4LCK A;  1T0K B;  1H7M A;  1PXW A;  3CC7 F;  5G4U C;  2VGN A;  3NK6 A;  3CC4 F;  3FFM A;  5IT9 M;  1KD1 H;  1GO1 A;  3PLA C;  4EI7 A;  3CPW F;  5HY0 A;  1GO0 A;  5EO3 A;  1KQS F;  3ON1 A;  4EI8 A;  3CME F;  1VQ6 F;  1YI2 F;  1Q7Y H;  3G4S F;  4TZZ A;  1VQ9 F;  3CCE F;  5HWE A;  1VQM F;  5FJ4 C;  3J81 M;  1X7P A;  2ALE A;  1W42 A;  3D00 A;  5DCV A;  2FGY A;  1RLG A;  1S72 F;  1M90 H;  2OHW A;  1W40 A;  3CPQ A;  1Q81 H;  2QA4 F;  5G4V C;  3NVI B;  2VGM A;  3OW2 F;  4NQ3 A;  3LWR C;  3V3T A;  4BVR A;  4BW0 B;  2QI2 A;  5EWR A;  3V7Q A;  1QVF F;  4NUT A;  3HAX D;  3JAM M;  1W41 A;  5GIP C;  2WAL A;  1YJW F;  1CK2 A;  2QEX F;  3SIV A;  3MCA B;  5HY4 A;  1VQL F;  3OBY A;  1W2B F;  2BO1 A;  3NVK E;  1X52 A;  5FLX M;  4BVT A;  1JJ2 F;  3E1Y A;  3O85 A;  3E20 B;  1VQN F;  3RA5 A;  1VQ4 F;  3G71 F;  2OZB A;  2KTU A;  1W3E X;  2GLZ A;  1N8R H;  5GIO C;  1GZ0 A;  3CCS F;  3OBW A;  3PAF A;  1CN7 A;  3CMA F;  1RA4 A;  3N4Z A;  3LWQ C;  2KTV A;  3CXC F;  1VQP F;  2JNB A;  3LWO C;  1YIT F;  3LWV C;  3HJW C;  5HY2 A;  3CCL F;  1K73 H;  2AIF A;  1X7O A;  3CCV F;  3AGK A;  3WXM B;  1NJI H;  3VI6 A;  2HVY D;  2FC3 A;  3JCM M;  1YJN F;  1KC8 H;  1VQ7 F;  3SIU A;  5GAN K;  1K8A H;  3CCR F;  3NK7 A;  3CD6 F;  3CCJ F;  4BY9 D;  1XBI A;  5GAP K;  3RA6 A;  3CCM F;  1Q82 H;  1QVG F;  1Q86 H;  4EI9 A;  3LWP C;  4BVQ A;  3G6E F;  3J80 M;  3GYQ A;  1VQK F;  1YJ9 F;  3I56 F;  2OTJ F;  3I55 F;  2F9Z C;  4X3L A;  2CZW A;  4XCQ A;  2KG4 A;  3V7E A;  1YIJ F;  1VQ8 F;  3VMF B;  1ZWZ A;  2OTL F;  3J7A R;  2I6D A;  5A2Q M;  1K9M H;  5HXZ A;  4BVS A;  3LFO A;  1M1K H;  1IPA A;  1NMU B;  4X3M A;  5HXU A;  4C4W C;  5HY1 A;  3NMU C;  3CG6 A;  1VQ5 F;  5GIN C;  1DT9 A;  3IR9 A;  3CCQ F;  1SDS A;  1YHQ F;  3N4Y A;  1VQO F;  2LBX A;  3CC2 F;  1E7K A;  2LBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...