1JD1A

Crystal structure of yeo7_yeast
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
TTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation inhibitor
molecule keywords HYPOTHETICAL 13.9 KDA PROTEIN IN FCY2-PET117 INTERGENIC REGI
publication title X-ray structure of Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (Hmf1).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1jd1A00
5HP8A 3K0TA 2OTMA 2CHSA 3KJKA 1JD1A 2EWCA 1QAHA 2CHTA 3M4SA 3M1XA 2UYKA 3D01A 2UYNA 5HP7A 3MQWA 3V4DA 1XRGA 3L7QA 3LMEA 3QUWA 3ZP4A 3ZP7A 4ZK7A 3I3FA 3VCZA 2IG8A 1J7HA 2CWJA 1ODEA 1PF5A 3KJJA 3K12A 2CSLA 1QD9A 1FNKA 1FNJA 1QU9A 1COMA 2B33A 1X25A 2UYPA 3GTZA 3LYBA 1UI9A 2CVLA 3I7TA 4NWOB 2CW4A 3ZOPA 1NQ3A 1XHOA 2DYYA 3ZO8A 2UYNB 1UFYA 1DBFA 3R0PA 2UYJA 1ONIA
chains in the Genus database with same CATH superfamily
3S06A 2LCAA 2OTMA 3IEQA 1RQ7A 2HQSC 3VTIC 4O4HA 1JFFA 5JVDB 1W5BA 3RYHA 4ZI7B 3G6EF 1VQ8F 4G4ZA 4TV8A 1SA0A 1YJNF 3RYCA 5EYPA 2NMUA 3SIVA 4FFBA 3HKCA 3CG6A 3WJQA 3HKEA 5KMGB 3ESJA 3JARA 2ZAUA 4X1KB 1U43A 3CCSF 3HTNA 2RB9A 1VK3A 4O4IB 3CCVF 3MBMA 1K8AH 3WJPA 1TUBA 3O85A 1Q81H 1VQLF 2WALA 2CHTA 1M1KH 3RYFB 4DRXA 4EI7A 3JAWA 2BTOA 4LNUB 4B46A 3CCJF 3WPXA 2HRUA 1W57A 1YGYA 3QTYA 2KG4A 1QD9A 1X7PA 2GVIA 1QU9A 3S03A 3RE3A 2QTPA 3F0EA 5AVMA 2K1SA 2YYEA 3B6NA 3JATB 2HP3A 3ZO8A 4IHJB 3RYIB 1X52A 1IPAA 3LFOA 4BVTA 1VQMF 4BY9D 3M1XA 4ZHQA 3VI6A 5ITZB 2RHJA 3ZP4A 4I55A 3AGKA 5J2TA 1QVFF 3JALB 5HY1A 5LYJB 1FNKA 5JQGA 3JCMM 5MN6A 1UI9A 1OAPA 5CA1A 2HS3A 2Z1EA 2VGMA 2ZODA 3CMAF 5J2UA 1IV4A 5HY2A 3WGLA 4BW0B 2UYNB 5MN5A 4BT2A 2JNBA 5GIOC 2BTQB 1GX1A 1VQ5F 3PLAC 2AIZP 3LWPC 1JJ2F 3F0GA 1FFXA 2VAMA 3IEWA 3J80M 3E1YA 3CXCF 3KE1A 3HKDA 3QUWA 2OZBA 3CCEF 1XV2A 3VOBA 4BVQA 3F0FA 3CYPB 1FNJA 3KHNA 1W42A 5KX5B 4C82A 3DC2A 3OBYA 4XCQA 2LBXA 1RQ2A 4IIJA 4O4HB 1JFFB 3OBWA 3CCLF 5EIBC 3S02A 3WGNA 2HP0A 3LWQC 3F0DA 4RQOA 4G4WA 5GONA 5IJ0A 4TV8B 3C8LA 1SA0B 1VQ6F 3RYCB 1QAHA 1JY8A 1E7KA 4KWEA 4FFBB 3HKCB 4G4YA 2H6LA 3HKEB 3FFMA 3JARB 3P10A 4U39A 1GZ0A 1IV1A 2ZOVA 3WJRA 2ZF8A 4NWOB 3V3TA 1TUBB 2BTUA 1KD1H 3IKEA 3C9UA 1W5AA 1KNJA 3E22A 3R0PA 3Q8HA 5LXTA 1X7OA 3CC2F 5C8YA 2VAWA 3JAWB 1CN7A 1U3PA 2AMTA 1YJ9F 5B8FA 3M4SA 3MQWA 3G71F 3L7QA 4U3JA 3PAFA 4TV9A 2CSLA 3CD6F 5IT9M 1YHQF 3LYBA 3GTZA 5GIPC 1TVKA 3JAMM 2CZWA 2CW4A 1YQNA 2V9YA 1W5FA 3F6MA 2DYYA 1H48A 2F9ZC 4WBNA 2QA4F 3S0WA 3VIUA 2R751 4X1IA 4ZHQB 5LOVA 4O2AA 2GLZA 4I55B 5J2TB 2KGWA 3GHZA 3J7AR 2UZHA 3V4DA 4ZK7A 5JQGB 5CA1B 3HKBA 1PF5A 5J2UB 1GO0A 2PMPA 4BT6A 3CMEF 2RHOA 4X1YA 2UYPA 3C9SA 2R6R1 3TD5A 3WXMB 1CLIA 1K9MH 5KX5A 2FC3A 3MCQA 5DCVA 1FFXB 1RLGA 1T0KB 3HKDB 3KJKA 5JH7A 3N4YA 2KTUA 1W59A 1ZWZA 2P6YA 3LDTA 4YJ2B 1RA4A 4ZHVA 4TUYA 5HP7A 3QHDA 3LMEA 4C4WC 4R40B 2IG8A 4BT5A 2VGNA 4I50A 1KNKA 4I4TA 4IIJB 4ZHWA 2Z1UA 3UT5A 2OTLF 4ZOLB 4BT4A 3I55F 2IQQA 4PWTA 2HP0B 3N2GA 4B62A 5LP6A 5GONB 5IJ0B 1IV2A 3P4EA 5EAZA 1H47A 3K14A 3ON1A 3D00A 5EB0A 2OHWA 5EO3A 3HJWC 4O4IA 3WGJA 1Q8RA 5JCOA 3WPWA 2YXZA 4BT7A 1XRGA 5EZYA 2MQEA 2RHLA 2CWJA 1SDSA 2PHNA 3MCAB 3KJJA 3CYQA 4BT3A 3E22B 4EB6B 3IR9A 3SIUA 5LXTB 5C8YB 4C81A 5IYZA 5GANK 1VQNF 3TD3A 4X3MA 5IJ9A 5HXUA 3FBAA 1SZQA 2RHHA 4HNAA 1ONIA 3TD4A 3HAXD 3RYHB 5BMVA 3OONA 4O2BA 1K73H 2BO1A 3M84A 4U3JB 4YJ3A 5EIBD 1W5EA 1Q7YH 2EWCA 1YITF 5EYPB 3G4SF 3V7QA 3RA5A 1TVKB 3VYTC 5GAPK 5HY4A 4WBNB 4B45A 1YI2F 4X1IB 5LP6C 3BYQA 5CB4A 3U0OA 1VQPF 4X3LA 3CCRF 3P0ZA 1S72F 4C8GA 4DRXB 2CHSA 3HKBB 2I6RA 5JCOC 1Z5VA 4G4VA 3JASA 4X20A 3C9RA 4X1YB 2Q1YA 1W2BF 2Z1TA 3VO8A 1H7MA 1W3EX 3CB2A 1VQKF 1ODEA 1VQ9F 2LBTA 4DXDA 1W581 3GYQA 4O4LA 3CPQA 1PXWA 5LA6A 3HWUA 1VQVA 5JH7B 3DDNA 3N2KA 1NQ3A 3N4ZA 2H8CA 2HS4A 4TZZA 1DBFA 3E20B 3IKFA 4I50B 2GZLA 1VQOF 2HS0A 1VQ7F 4I4TB 3OW2F 3UT5B 4ERHA 3V7EA 3IMPA 1JN1A 2ZVYA 3N2GB 3CCUF 5LP6B 5G4UC 2ALEA 2B33A 1CK2A 3JAKA 4O4JA 3NK6A 5FNVA 1VHAA 1YIJF 3FD6A 1XHOA 1U3LA 1DT9A 3NVIB 5EZYB 1VH8A 3K0TA 3J81M 1NJIH 4NUTA 2UYKA 5CA0A 4F6RA 5HWEA 1T0AA 3LWRC 2KTVA 2ZVZA 1J7HA 2VXYA 4M8IA 2QEXF 5IYZB 5JVDA 3LWOC 3KIZA 4ZI7A 5IJ9B 5HXZA 2CVLA 4HNAB 5BMVB 4O2BB 4YJ3B 2QI2A 4C8EA 5KMGA 1XBIA 3I56F 2UYJA 1Q82H 3MDOA 5HP8A 1NMUB 4X1KA 1Z5WA 1YJWF 1Q86H 1JD1A 1KC8H 4B5CA 3VYUC 1IV3A 3I3FA 3VCZA 5CB4B 1M90H 3VOAA 2AIFA 4G88A 4RHAA 2N48A 3JVHA 2IAFA 3RYFA 3VYSC 3EORA 4LNUA 2VAPA 3NVKE 1W55A 3I7TA 5FLXM 5HY0A 3RA6A 4G4XA 3NMUC 2HRYA 5EWRA 3ZOPA 4C8IA 2I6DA 3JASB 2G9IA 4X20B 3CC4F 1GO1A 5G4VC 2HX0A 3JATA 3NK7A 4IHJA 3D01A 1QVGF 3RYIA 3VMFB 4O4LB 3CCMF 3T80A 4BVRA 4TV9B 2LBWA 1RLUA 3S0YA 1KQSF 5LA6B 4YJ2A 3LWVC 4ZHYB 2Q1XA 3N2KB 3C9TA 5EB1B 5FJ4C 5ITZA 1COMA 4E6EA 2OTJF 5LOVB 4EI8A 2Z01A 3JALA 4O2AB 5LYJA 3CCQF 2H8EA 4ZOLA 3ELCA 4BVSA 3S0HA 2L26A 2DT4A 2FGYA 3FD5A 3CPWF 1W40A 1U40A 2HVYD 1N8RH 2UYNA 5MN4A 3JAKB 4O4JB 3ZP7A 5FNVB 3K2XA 5A2QM 2Z1FA 3K12A 1FSZA 1R1MA 3FPIA 1W41A 4LCKA 1X25A 4EI9A 4NQ3A 2W8BC 5GINC 3WGMA 3ERNA 3D54A 4EB6A 1VQ4F 5CA0B 1OFUA 3CC7F 3WGKA 1UFYA 4F6RB 4TUYB
chains in the Genus database with same CATH topology
5HP8A 3K0TA 2OTMA 2CHSA 3KJKA 1JD1A 2EWCA 1QAHA 2CHTA 3M4SA 3M1XA 2UYKA 3D01A 2UYNA 5HP7A 3MQWA 3V4DA 1XRGA 3L7QA 3LMEA 3QUWA 3ZP4A 3ZP7A 4ZK7A 3I3FA 3VCZA 2IG8A 1J7HA 2CWJA 1ODEA 1PF5A 3KJJA 3K12A 2CSLA 1QD9A 1FNKA 1FNJA 1QU9A 1COMA 2B33A 1X25A 2UYPA 3GTZA 3LYBA 1UI9A 2CVLA 3I7TA 4NWOB 2CW4A 3ZOPA 1NQ3A 1XHOA 2DYYA 3ZO8A 2UYNB 1UFYA 1DBFA 3R0PA 2UYJA 1ONIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HP8 A;  3K0T A;  2OTM A;  2CHS A;  3KJK A;  1JD1 A;  2EWC A;  1QAH A;  2CHT A;  3M4S A;  3M1X A;  2UYK A;  3D01 A;  2UYN A;  5HP7 A;  3MQW A;  3V4D A;  1XRG A;  3L7Q A;  3LME A;  3QUW A;  3ZP4 A;  3ZP7 A;  4ZK7 A;  3I3F A;  3VCZ A;  2IG8 A;  1J7H A;  2CWJ A;  1ODE A;  1PF5 A;  3KJJ A;  3K12 A;  2CSL A;  1QD9 A;  1FNK A;  1FNJ A;  1QU9 A;  1COM A;  2B33 A;  1X25 A;  2UYP A;  3GTZ A;  3LYB A;  1UI9 A;  2CVL A;  3I7T A;  4NWO B;  2CW4 A;  3ZOP A;  1NQ3 A;  1XHO A;  2DYY A;  3ZO8 A;  2UYN B;  1UFY A;  1DBF A;  3R0P A;  2UYJ A;  1ONI A; 
#chains in the Genus database with same CATH topology
 3S06 A;  2LCA A;  2OTM A;  3IEQ A;  1RQ7 A;  2HQS C;  3VTI C;  4O4H A;  1JFF A;  5JVD B;  1W5B A;  3RYH A;  4ZI7 B;  3G6E F;  1VQ8 F;  4G4Z A;  4TV8 A;  1SA0 A;  1YJN F;  3RYC A;  5EYP A;  2NMU A;  3SIV A;  4FFB A;  3HKC A;  3CG6 A;  3WJQ A;  3HKE A;  5KMG B;  3ESJ A;  3JAR A;  2ZAU A;  4X1K B;  1U43 A;  3CCS F;  3HTN A;  2RB9 A;  1VK3 A;  4O4I B;  3CCV F;  3MBM A;  1K8A H;  3WJP A;  1TUB A;  3O85 A;  1Q81 H;  1VQL F;  2WAL A;  2CHT A;  1M1K H;  3RYF B;  4DRX A;  4EI7 A;  3JAW A;  2BTO A;  4LNU B;  4B46 A;  3CCJ F;  3WPX A;  2HRU A;  1W57 A;  1YGY A;  3QTY A;  2KG4 A;  1QD9 A;  1X7P A;  2GVI A;  1QU9 A;  3S03 A;  3RE3 A;  2QTP A;  3F0E A;  5AVM A;  2K1S A;  2YYE A;  3B6N A;  3JAT B;  2HP3 A;  3ZO8 A;  4IHJ B;  3RYI B;  1X52 A;  1IPA A;  3LFO A;  4BVT A;  1VQM F;  4BY9 D;  3M1X A;  4ZHQ A;  3VI6 A;  5ITZ B;  2RHJ A;  3ZP4 A;  4I55 A;  3AGK A;  5J2T A;  1QVF F;  3JAL B;  5HY1 A;  5LYJ B;  1FNK A;  5JQG A;  3JCM M;  5MN6 A;  1UI9 A;  1OAP A;  5CA1 A;  2HS3 A;  2Z1E A;  2VGM A;  2ZOD A;  3CMA F;  5J2U A;  1IV4 A;  5HY2 A;  3WGL A;  4BW0 B;  2UYN B;  5MN5 A;  4BT2 A;  2JNB A;  5GIO C;  2BTQ B;  1GX1 A;  1VQ5 F;  3PLA C;  2AIZ P;  3LWP C;  1JJ2 F;  3F0G A;  1FFX A;  2VAM A;  3IEW A;  3J80 M;  3E1Y A;  3CXC F;  3KE1 A;  3HKD A;  3QUW A;  2OZB A;  3CCE F;  1XV2 A;  3VOB A;  4BVQ A;  3F0F A;  3CYP B;  1FNJ A;  3KHN A;  1W42 A;  5KX5 B;  4C82 A;  3DC2 A;  3OBY A;  4XCQ A;  2LBX A;  1RQ2 A;  4IIJ A;  4O4H B;  1JFF B;  3OBW A;  3CCL F;  5EIB C;  3S02 A;  3WGN A;  2HP0 A;  3LWQ C;  3F0D A;  4RQO A;  4G4W A;  5GON A;  5IJ0 A;  4TV8 B;  3C8L A;  1SA0 B;  1VQ6 F;  3RYC B;  1QAH A;  1JY8 A;  1E7K A;  4KWE A;  4FFB B;  3HKC B;  4G4Y A;  2H6L A;  3HKE B;  3FFM A;  3JAR B;  3P10 A;  4U39 A;  1GZ0 A;  1IV1 A;  2ZOV A;  3WJR A;  2ZF8 A;  4NWO B;  3V3T A;  1TUB B;  2BTU A;  1KD1 H;  3IKE A;  3C9U A;  1W5A A;  1KNJ A;  3E22 A;  3R0P A;  3Q8H A;  5LXT A;  1X7O A;  3CC2 F;  5C8Y A;  2VAW A;  3JAW B;  1CN7 A;  1U3P A;  2AMT A;  1YJ9 F;  5B8F A;  3M4S A;  3MQW A;  3G71 F;  3L7Q A;  4U3J A;  3PAF A;  4TV9 A;  2CSL A;  3CD6 F;  5IT9 M;  1YHQ F;  3LYB A;  3GTZ A;  5GIP C;  1TVK A;  3JAM M;  2CZW A;  2CW4 A;  1YQN A;  2V9Y A;  1W5F A;  3F6M A;  2DYY A;  1H48 A;  2F9Z C;  4WBN A;  2QA4 F;  3S0W A;  3VIU A;  2R75 1;  4X1I A;  4ZHQ B;  5LOV A;  4O2A A;  2GLZ A;  4I55 B;  5J2T B;  2KGW A;  3GHZ A;  3J7A R;  2UZH A;  3V4D A;  4ZK7 A;  5JQG B;  5CA1 B;  3HKB A;  1PF5 A;  5J2U B;  1GO0 A;  2PMP A;  4BT6 A;  3CME F;  2RHO A;  4X1Y A;  2UYP A;  3C9S A;  2R6R 1;  3TD5 A;  3WXM B;  1CLI A;  1K9M H;  5KX5 A;  2FC3 A;  3MCQ A;  5DCV A;  1FFX B;  1RLG A;  1T0K B;  3HKD B;  3KJK A;  5JH7 A;  3N4Y A;  2KTU A;  1W59 A;  1ZWZ A;  2P6Y A;  3LDT A;  4YJ2 B;  1RA4 A;  4ZHV A;  4TUY A;  5HP7 A;  3QHD A;  3LME A;  4C4W C;  4R40 B;  2IG8 A;  4BT5 A;  2VGN A;  4I50 A;  1KNK A;  4I4T A;  4IIJ B;  4ZHW A;  2Z1U A;  3UT5 A;  2OTL F;  4ZOL B;  4BT4 A;  3I55 F;  2IQQ A;  4PWT A;  2HP0 B;  3N2G A;  4B62 A;  5LP6 A;  5GON B;  5IJ0 B;  1IV2 A;  3P4E A;  5EAZ A;  1H47 A;  3K14 A;  3ON1 A;  3D00 A;  5EB0 A;  2OHW A;  5EO3 A;  3HJW C;  4O4I A;  3WGJ A;  1Q8R A;  5JCO A;  3WPW A;  2YXZ A;  4BT7 A;  1XRG A;  5EZY A;  2MQE A;  2RHL A;  2CWJ A;  1SDS A;  2PHN A;  3MCA B;  3KJJ A;  3CYQ A;  4BT3 A;  3E22 B;  4EB6 B;  3IR9 A;  3SIU A;  5LXT B;  5C8Y B;  4C81 A;  5IYZ A;  5GAN K;  1VQN F;  3TD3 A;  4X3M A;  5IJ9 A;  5HXU A;  3FBA A;  1SZQ A;  2RHH A;  4HNA A;  1ONI A;  3TD4 A;  3HAX D;  3RYH B;  5BMV A;  3OON A;  4O2B A;  1K73 H;  2BO1 A;  3M84 A;  4U3J B;  4YJ3 A;  5EIB D;  1W5E A;  1Q7Y H;  2EWC A;  1YIT F;  5EYP B;  3G4S F;  3V7Q A;  3RA5 A;  1TVK B;  3VYT C;  5GAP K;  5HY4 A;  4WBN B;  4B45 A;  1YI2 F;  4X1I B;  5LP6 C;  3BYQ A;  5CB4 A;  3U0O A;  1VQP F;  4X3L A;  3CCR F;  3P0Z A;  1S72 F;  4C8G A;  4DRX B;  2CHS A;  3HKB B;  2I6R A;  5JCO C;  1Z5V A;  4G4V A;  3JAS A;  4X20 A;  3C9R A;  4X1Y B;  2Q1Y A;  1W2B F;  2Z1T A;  3VO8 A;  1H7M A;  1W3E X;  3CB2 A;  1VQK F;  1ODE A;  1VQ9 F;  2LBT A;  4DXD A;  1W58 1;  3GYQ A;  4O4L A;  3CPQ A;  1PXW A;  5LA6 A;  3HWU A;  1VQV A;  5JH7 B;  3DDN A;  3N2K A;  1NQ3 A;  3N4Z A;  2H8C A;  2HS4 A;  4TZZ A;  1DBF A;  3E20 B;  3IKF A;  4I50 B;  2GZL A;  1VQO F;  2HS0 A;  1VQ7 F;  4I4T B;  3OW2 F;  3UT5 B;  4ERH A;  3V7E A;  3IMP A;  1JN1 A;  2ZVY A;  3N2G B;  3CCU F;  5LP6 B;  5G4U C;  2ALE A;  2B33 A;  1CK2 A;  3JAK A;  4O4J A;  3NK6 A;  5FNV A;  1VHA A;  1YIJ F;  3FD6 A;  1XHO A;  1U3L A;  1DT9 A;  3NVI B;  5EZY B;  1VH8 A;  3K0T A;  3J81 M;  1NJI H;  4NUT A;  2UYK A;  5CA0 A;  4F6R A;  5HWE A;  1T0A A;  3LWR C;  2KTV A;  2ZVZ A;  1J7H A;  2VXY A;  4M8I A;  2QEX F;  5IYZ B;  5JVD A;  3LWO C;  3KIZ A;  4ZI7 A;  5IJ9 B;  5HXZ A;  2CVL A;  4HNA B;  5BMV B;  4O2B B;  4YJ3 B;  2QI2 A;  4C8E A;  5KMG A;  1XBI A;  3I56 F;  2UYJ A;  1Q82 H;  3MDO A;  5HP8 A;  1NMU B;  4X1K A;  1Z5W A;  1YJW F;  1Q86 H;  1JD1 A;  1KC8 H;  4B5C A;  3VYU C;  1IV3 A;  3I3F A;  3VCZ A;  5CB4 B;  1M90 H;  3VOA A;  2AIF A;  4G88 A;  4RHA A;  2N48 A;  3JVH A;  2IAF A;  3RYF A;  3VYS C;  3EOR A;  4LNU A;  2VAP A;  3NVK E;  1W55 A;  3I7T A;  5FLX M;  5HY0 A;  3RA6 A;  4G4X A;  3NMU C;  2HRY A;  5EWR A;  3ZOP A;  4C8I A;  2I6D A;  3JAS B;  2G9I A;  4X20 B;  3CC4 F;  1GO1 A;  5G4V C;  2HX0 A;  3JAT A;  3NK7 A;  4IHJ A;  3D01 A;  1QVG F;  3RYI A;  3VMF B;  4O4L B;  3CCM F;  3T80 A;  4BVR A;  4TV9 B;  2LBW A;  1RLU A;  3S0Y A;  1KQS F;  5LA6 B;  4YJ2 A;  3LWV C;  4ZHY B;  2Q1X A;  3N2K B;  3C9T A;  5EB1 B;  5FJ4 C;  5ITZ A;  1COM A;  4E6E A;  2OTJ F;  5LOV B;  4EI8 A;  2Z01 A;  3JAL A;  4O2A B;  5LYJ A;  3CCQ F;  2H8E A;  4ZOL A;  3ELC A;  4BVS A;  3S0H A;  2L26 A;  2DT4 A;  2FGY A;  3FD5 A;  3CPW F;  1W40 A;  1U40 A;  2HVY D;  1N8R H;  2UYN A;  5MN4 A;  3JAK B;  4O4J B;  3ZP7 A;  5FNV B;  3K2X A;  5A2Q M;  2Z1F A;  3K12 A;  1FSZ A;  1R1M A;  3FPI A;  1W41 A;  4LCK A;  1X25 A;  4EI9 A;  4NQ3 A;  2W8B C;  5GIN C;  3WGM A;  3ERN A;  3D54 A;  4EB6 A;  1VQ4 F;  5CA0 B;  1OFU A;  3CC7 F;  3WGK A;  1UFY A;  4F6R B;  4TUY B; 
#chains in the Genus database with same CATH homology
 5HP8 A;  3K0T A;  2OTM A;  2CHS A;  3KJK A;  1JD1 A;  2EWC A;  1QAH A;  2CHT A;  3M4S A;  3M1X A;  2UYK A;  3D01 A;  2UYN A;  5HP7 A;  3MQW A;  3V4D A;  1XRG A;  3L7Q A;  3LME A;  3QUW A;  3ZP4 A;  3ZP7 A;  4ZK7 A;  3I3F A;  3VCZ A;  2IG8 A;  1J7H A;  2CWJ A;  1ODE A;  1PF5 A;  3KJJ A;  3K12 A;  2CSL A;  1QD9 A;  1FNK A;  1FNJ A;  1QU9 A;  1COM A;  2B33 A;  1X25 A;  2UYP A;  3GTZ A;  3LYB A;  1UI9 A;  2CVL A;  3I7T A;  4NWO B;  2CW4 A;  3ZOP A;  1NQ3 A;  1XHO A;  2DYY A;  3ZO8 A;  2UYN B;  1UFY A;  1DBF A;  3R0P A;  2UYJ A;  1ONI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...