1JD1A

Crystal structure of yeo7_yeast
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
TTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 13.9 KDA PROTEIN IN FCY2-PET117 INTERGENIC REGI
publication title X-ray structure of Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (Hmf1).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation inhibitor
total genus 36
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1jd1A00
3ZO8A 3ZP4A 3K0TA 1JD1A 3I3FA 2DYYA 2UYJA 2UYPA 1J7HA 1QAHA 3VCZA 3KJJA 3ZOPA 3LYBA 3ZP7A 3K12A 3M4SA 3R0PA 1X25A 1COMA 2IG8A 3QUWA 4ZK7A 1PF5A 2CWJA 3KJKA 3MQWA 2OTMA 2UYNA 3D01A 1ONIA 2CHTA 1UFYA 2UYKA 5HP8A 2CHSA 3L7QA 1QD9A 4NWOB 3GTZA 3V4DA 2EWCA 2CW4A 5HP7A 2B33A 3LMEA 2CSLA 2UYNB 1XRGA 1FNKA 3M1XA 1NQ3A 1DBFA 2CVLA 3I7TA 1FNJA 1ODEA 1XHOA 1UI9A 1QU9A
chains in the Genus database with same CATH superfamily
4YJ3B 4C82A 4DXDA 4BVTA 2PMPA 3CCEF 3JALB 3FPIA 3C9RA 3VYUC 4X1IA 2OZBA 2RHOA 4F6RB 1W40A 4BW0B 4HNAB 5CB4A 3CCQF 4ZOLA 4O4JB 2JNBA 1X7PA 3JVHA 5GANK 3FFMA 3NK6A 2HRUA 2G9IA 3S0HA 3WJPA 5G4VC 4ZHVA 3FBAA 5JH7B 2Z1UA 5EYPB 3F6MA 1W57A 5IJ9A 4EI7A 4G4WA 3C9SA 4X20B 3OBYA 3ZP7A 4B46A 1U3PA 4I55B 3ON1A 3M84A 3CC7F 1YJNF 2VAWA 5EZYB 3K14A 4E6EA 2I6DA 2Z1FA 2IG8A 3WGLA 1IV3A 1TUBA 1PF5A 2ZODA 4C81A 4TV9B 4O4HB 1N8RH 3J80M 3HKBA 2FGYA 3KHNA 5BMVA 2H6LA 1FSZA 2V9YA 4G88A 3V7EA 1W42A 1JFFB 4BT3A 4YJ3A 1GX1A 4ZI7B 2K1SA 1FNKA 1E7KA 3JALA 4NUTA 1VQVA 5GINC 1VQOF 4KWEA 5LA6B 4F6RA 2UYPA 1QAHA 2KG4A 2Q1XA 2NMUA 4HNAA 5LP6B 5CA0B 3CB2A 3CXCF 2ALEA 4O4JA 4EI9A 1SA0B 3TD3A 3CCVF 1Q7YH 3HWUA 3HKEB 3LFOA 3RA5A 5JCOC 3JASB 3HJWC 3LDTA 4BT5A 5JH7A 3WJRA 5EYPA 2EWCA 3LMEA 2ZOVA 5IJ0B 4X20A 4BT7A 4I55A 3VMFB 1U3LA 3V3TA 1RQ7A 1QU9A 2HP0B 2BTQB 3CD6F 3IEQA 4TV9A 4O4HA 1IV1A 3C9TA 1W41A 1OFUA 3JAKB 5MN6A 3S02A 5J2TB 1VQ8F 3NK7A 4X3MA 4ZI7A 2HS3A 5LOVB 3TD5A 3S03A 3PAFA 1W5FA 3LWOC 4B5CA 2Q1YA 3P10A 1KQSF 2RHHA 5LA6A 1YJ9F 4ERHA 1NQ3A 4G4YA 4U3JB 5FNVB 5G4UC 5LP6A 2AIZP 5CA0A 3K0TA 5HXZA 4C8EA 1RA4A 2HVYD 3S0YA 3TD4A 3JATB 3HKEA 2BTOA 3JASA 4FFBB 2MQEA 1X25A 1YI2F 1Q86H 1R1MA 2KTUA 1ONIA 1H7MA 5IJ0A 2UYKA 3IKEA 1XV2A 2BTUA 1RLGA 1YJWF 1U40A 3F0FA 1W3EX 2HP0A 1VQ7F 1Z5VA 1KNJA 3VIUA 1VQ4F 1YIJF 2VGMA 3WGKA 2QTPA 5A2QM 2F9ZC 3JAKA 5HY1A 2RHJA 3GHZA 5J2TA 5HWEA 1J7HA 3HKDB 1Q81H 5LOVA 1T0AA 4O4LB 1YHQF 4M8IA 5AVMA 2N48A 2HQSC 3IR9A 2IAFA 3RYFB 1W5EA 4U3JA 5FNVA 4ZHQB 4XCQA 4NWOB 2CW4A 3VTIC 3CMAF 1QVFF 3GYQA 1XRGA 3M1XA 1CLIA 3MCQA 1ODEA 1OAPA 4WBNB 5IT9M 3JATA 2RHLA 4FFBA 4C8GA 3K12A 5JVDB 3HTNA 1VQ5F 3CYPB 2GVIA 4G4ZA 2KTVA 2P6YA 4X1KB 5DCVA 3SIVA 3CCRF 2Z01A 1VK3A 4BVSA 3HKDA 3EORA 4R40B 4O4LA 2QEXF 4TV8B 4BVQA 3ZOPA 2ZF8A 3J7AR 1PXWA 3RYFA 4ZHQA 3I55F 5C8YB 4G4XA 3VO8A 3MQWA 3JARB 1UFYA 1K9MH 5CA1B 2H8EA 3V7QA 1W2BF 3FD6A 4X3LA 5GIPC 2CSLA 3WPWA 3F0DA 1YITF 5FLXM 1ZWZA 4NQ3A 3LWRC 1VQ6F 1QVGF 5JVDA 4C8IA 3CPQA 5EZYA 4O4IB 3N2KB 3P4EA 3E1YA 3O85A 4X1KA 5EWRA 3VI6A 3M4SA 4BY9D 5B8FA 2HS4A 1COMA 5KMGB 3CC4F 1JFFA 1H47A 3G71F 1VQMF 4I4TB 5HY2A 1RLUA 2R751 3NVKE 3J81M 1CN7A 2QA4F 2LBWA 4RHAA 1VH8A 3IKFA 5JQGB 4IIJB 3CYQA 4TV8A 3ESJA 1DBFA 1FNJA 3WGNA 1TVKB 5MN4A 3I56F 3FD5A 4ZHWA 3QTYA 5C8YA 3DDNA 5EO3A 1SA0A 2HP3A 3JARA 3HAXD 2OTJF 1U43A 5CA1A 2OTLF 2AMTA 4ZK7A 4BT2A 1XBIA 2OTMA 1W5AA 1KC8H 5EB1B 2VXYA 1VQLF 1W59A 1VQPF 3CCUF 4B62A 3DC2A 3MDOA 4O4IA 3N2KA 3WPXA 4PWTA 4LNUB 3U0OA 3RYCB 1W581 4TUYB 1K8AH 3LWVC 1X7OA 2DYYA 5KMGA 2ZVZA 2H8CA 4O2AB 1W55A 3JAWB 4G4VA 2GZLA 4I4TA 5KX5B 5EAZA 3JCMM 5JQGA 4IIJA 2UZHA 3D01A 5JCOA 3OONA 5EB0A 1TVKA 3RYHB 1TUBB 3F0GA 2L26A 2YYEA 2UYNB 3VOBA 1VQ9F 1UI9A 4RQOA 3PLAC 3K2XA 3P0ZA 1JD1A 1W5BA 3LWQC 1FFXB 1IPAA 3VCZA 2I6RA 3KJJA 3MBMA 2OHWA 3G6EF 3C8LA 1IV2A 3QUWA 5LXTB 3WXMB 3Q8HA 3C9UA 3CCJF 1VQNF 4EI8A 2ZVYA 1M1KH 4IHJB 2PHNA 2CHSA 4LNUA 4EB6B 4X1YB 3N2GB 4TUYA 3RA6A 3RYCA 3V4DA 3G4SF 3VYTC 4O2AA 2CVLA 4YJ2B 2CZWA 2R6R1 3JAWA 5LP6C 5HP8A 2VAPA 1JN1A 2IQQA 3I3FA 5KX5A 4DRXB 2AIFA 2GLZA 1Q82H 2LBXA 1X52A 4C4WC 1YQNA 2HS0A 3SIUA 3CCMF 1VQKF 5EIBC 4BVRA 3RYHA 2HRYA 3IMPA 2VAMA 3N4YA 5MN5A 3NMUC 3RE3A 2UYNA 2CHTA 5EIBD 3CCLF 3F0EA 2LCAA 3D00A 3GTZA 4WBNA 3WGMA 4U39A 3MCAB 1FFXA 2RB9A 4B45A 2YXZA 2BO1A 3QHDA 3RYIB 3ERNA 4I50B 5GAPK 1Z5WA 1CK2A 5LXTA 4BT6A 3CC2F 5GONB 3UT5B 3S0WA 3S06A 4IHJA 3E20B 3WJQA 3CCSF 3IEWA 1M90H 4EB6A 4X1YA 3N2GA 4O2BB 1VHAA 5IYZB 3KJKA 5FJ4C 1RQ2A 1YGYA 5J2UB 4YJ2A 3CPWF 5ITZB 3OBWA 2B33A 4DRXA 2WALA 5LYJB 3HKCB 2KGWA 3ZO8A 3ZP4A 1GO0A 2FC3A 3JAMM 1Q8RA 1T0KB 3E22B 3NVIB 1H48A 3AGKA 5HY4A 2DT4A 3R0PA 5HY0A 3WGJA 1SZQA 3BYQA 3D54A 4BT4A 4ZHYB 1DT9A 4TZZA 4X1IB 1QD9A 2HX0A 3RYIA 3CMEF 1JJ2F 4I50A 1S72F 2Z1EA 5CB4B 2QI2A 2W8BC 4ZOLB 5GONA 3UT5A 4LCKA 1JY8A 3OW2F 1NMUB 1SDSA 2UYJA 4O2BA 5IYZA 3LYBA 3VYSC 3T80A 3KIZA 5J2UA 5IJ9B 1GO1A 3N4ZA 1KD1H 5ITZA 2LBTA 2Z1TA 2CWJA 1K73H 1IV4A 3ELCA 5HXUA 5LYJA 3B6NA 1GZ0A 3HKCA 1NJIH 2VGNA 3VOAA 3L7QA 1KNKA 3KE1A 3CG6A 5HP7A 5GIOC 3HKBB 5BMVB 3E22A 3I7TA 2ZAUA 1XHOA 3LWPC
chains in the Genus database with same CATH topology
3ZO8A 3ZP4A 3K0TA 1JD1A 3I3FA 2DYYA 2UYJA 2UYPA 1J7HA 1QAHA 3VCZA 3KJJA 3ZOPA 3LYBA 3ZP7A 3K12A 3M4SA 3R0PA 1X25A 1COMA 2IG8A 3QUWA 4ZK7A 1PF5A 2CWJA 3KJKA 3MQWA 2OTMA 2UYNA 3D01A 1ONIA 2CHTA 1UFYA 2UYKA 5HP8A 2CHSA 3L7QA 1QD9A 4NWOB 3GTZA 3V4DA 2EWCA 2CW4A 5HP7A 2B33A 3LMEA 2CSLA 2UYNB 1XRGA 1FNKA 3M1XA 1NQ3A 1DBFA 2CVLA 3I7TA 1FNJA 1ODEA 1XHOA 1UI9A 1QU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZO8 A;  3ZP4 A;  3K0T A;  1JD1 A;  3I3F A;  2DYY A;  2UYJ A;  2UYP A;  1J7H A;  1QAH A;  3VCZ A;  3KJJ A;  3ZOP A;  3LYB A;  3ZP7 A;  3K12 A;  3M4S A;  3R0P A;  1X25 A;  1COM A;  2IG8 A;  3QUW A;  4ZK7 A;  1PF5 A;  2CWJ A;  3KJK A;  3MQW A;  2OTM A;  2UYN A;  3D01 A;  1ONI A;  2CHT A;  1UFY A;  2UYK A;  5HP8 A;  2CHS A;  3L7Q A;  1QD9 A;  4NWO B;  3GTZ A;  3V4D A;  2EWC A;  2CW4 A;  5HP7 A;  2B33 A;  3LME A;  2CSL A;  2UYN B;  1XRG A;  1FNK A;  3M1X A;  1NQ3 A;  1DBF A;  2CVL A;  3I7T A;  1FNJ A;  1ODE A;  1XHO A;  1UI9 A;  1QU9 A; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  4C82 A;  4DXD A;  4BVT A;  2PMP A;  3CCE F;  3JAL B;  3FPI A;  3C9R A;  3VYU C;  4X1I A;  2OZB A;  2RHO A;  4F6R B;  1W40 A;  4BW0 B;  4HNA B;  5CB4 A;  3CCQ F;  4ZOL A;  4O4J B;  2JNB A;  1X7P A;  3JVH A;  5GAN K;  3FFM A;  3NK6 A;  2HRU A;  2G9I A;  3S0H A;  3WJP A;  5G4V C;  4ZHV A;  3FBA A;  5JH7 B;  2Z1U A;  5EYP B;  3F6M A;  1W57 A;  5IJ9 A;  4EI7 A;  4G4W A;  3C9S A;  4X20 B;  3OBY A;  3ZP7 A;  4B46 A;  1U3P A;  4I55 B;  3ON1 A;  3M84 A;  3CC7 F;  1YJN F;  2VAW A;  5EZY B;  3K14 A;  4E6E A;  2I6D A;  2Z1F A;  2IG8 A;  3WGL A;  1IV3 A;  1TUB A;  1PF5 A;  2ZOD A;  4C81 A;  4TV9 B;  4O4H B;  1N8R H;  3J80 M;  3HKB A;  2FGY A;  3KHN A;  5BMV A;  2H6L A;  1FSZ A;  2V9Y A;  4G88 A;  3V7E A;  1W42 A;  1JFF B;  4BT3 A;  4YJ3 A;  1GX1 A;  4ZI7 B;  2K1S A;  1FNK A;  1E7K A;  3JAL A;  4NUT A;  1VQV A;  5GIN C;  1VQO F;  4KWE A;  5LA6 B;  4F6R A;  2UYP A;  1QAH A;  2KG4 A;  2Q1X A;  2NMU A;  4HNA A;  5LP6 B;  5CA0 B;  3CB2 A;  3CXC F;  2ALE A;  4O4J A;  4EI9 A;  1SA0 B;  3TD3 A;  3CCV F;  1Q7Y H;  3HWU A;  3HKE B;  3LFO A;  3RA5 A;  5JCO C;  3JAS B;  3HJW C;  3LDT A;  4BT5 A;  5JH7 A;  3WJR A;  5EYP A;  2EWC A;  3LME A;  2ZOV A;  5IJ0 B;  4X20 A;  4BT7 A;  4I55 A;  3VMF B;  1U3L A;  3V3T A;  1RQ7 A;  1QU9 A;  2HP0 B;  2BTQ B;  3CD6 F;  3IEQ A;  4TV9 A;  4O4H A;  1IV1 A;  3C9T A;  1W41 A;  1OFU A;  3JAK B;  5MN6 A;  3S02 A;  5J2T B;  1VQ8 F;  3NK7 A;  4X3M A;  4ZI7 A;  2HS3 A;  5LOV B;  3TD5 A;  3S03 A;  3PAF A;  1W5F A;  3LWO C;  4B5C A;  2Q1Y A;  3P10 A;  1KQS F;  2RHH A;  5LA6 A;  1YJ9 F;  4ERH A;  1NQ3 A;  4G4Y A;  4U3J B;  5FNV B;  5G4U C;  5LP6 A;  2AIZ P;  5CA0 A;  3K0T A;  5HXZ A;  4C8E A;  1RA4 A;  2HVY D;  3S0Y A;  3TD4 A;  3JAT B;  3HKE A;  2BTO A;  3JAS A;  4FFB B;  2MQE A;  1X25 A;  1YI2 F;  1Q86 H;  1R1M A;  2KTU A;  1ONI A;  1H7M A;  5IJ0 A;  2UYK A;  3IKE A;  1XV2 A;  2BTU A;  1RLG A;  1YJW F;  1U40 A;  3F0F A;  1W3E X;  2HP0 A;  1VQ7 F;  1Z5V A;  1KNJ A;  3VIU A;  1VQ4 F;  1YIJ F;  2VGM A;  3WGK A;  2QTP A;  5A2Q M;  2F9Z C;  3JAK A;  5HY1 A;  2RHJ A;  3GHZ A;  5J2T A;  5HWE A;  1J7H A;  3HKD B;  1Q81 H;  5LOV A;  1T0A A;  4O4L B;  1YHQ F;  4M8I A;  5AVM A;  2N48 A;  2HQS C;  3IR9 A;  2IAF A;  3RYF B;  1W5E A;  4U3J A;  5FNV A;  4ZHQ B;  4XCQ A;  4NWO B;  2CW4 A;  3VTI C;  3CMA F;  1QVF F;  3GYQ A;  1XRG A;  3M1X A;  1CLI A;  3MCQ A;  1ODE A;  1OAP A;  4WBN B;  5IT9 M;  3JAT A;  2RHL A;  4FFB A;  4C8G A;  3K12 A;  5JVD B;  3HTN A;  1VQ5 F;  3CYP B;  2GVI A;  4G4Z A;  2KTV A;  2P6Y A;  4X1K B;  5DCV A;  3SIV A;  3CCR F;  2Z01 A;  1VK3 A;  4BVS A;  3HKD A;  3EOR A;  4R40 B;  4O4L A;  2QEX F;  4TV8 B;  4BVQ A;  3ZOP A;  2ZF8 A;  3J7A R;  1PXW A;  3RYF A;  4ZHQ A;  3I55 F;  5C8Y B;  4G4X A;  3VO8 A;  3MQW A;  3JAR B;  1UFY A;  1K9M H;  5CA1 B;  2H8E A;  3V7Q A;  1W2B F;  3FD6 A;  4X3L A;  5GIP C;  2CSL A;  3WPW A;  3F0D A;  1YIT F;  5FLX M;  1ZWZ A;  4NQ3 A;  3LWR C;  1VQ6 F;  1QVG F;  5JVD A;  4C8I A;  3CPQ A;  5EZY A;  4O4I B;  3N2K B;  3P4E A;  3E1Y A;  3O85 A;  4X1K A;  5EWR A;  3VI6 A;  3M4S A;  4BY9 D;  5B8F A;  2HS4 A;  1COM A;  5KMG B;  3CC4 F;  1JFF A;  1H47 A;  3G71 F;  1VQM F;  4I4T B;  5HY2 A;  1RLU A;  2R75 1;  3NVK E;  3J81 M;  1CN7 A;  2QA4 F;  2LBW A;  4RHA A;  1VH8 A;  3IKF A;  5JQG B;  4IIJ B;  3CYQ A;  4TV8 A;  3ESJ A;  1DBF A;  1FNJ A;  3WGN A;  1TVK B;  5MN4 A;  3I56 F;  3FD5 A;  4ZHW A;  3QTY A;  5C8Y A;  3DDN A;  5EO3 A;  1SA0 A;  2HP3 A;  3JAR A;  3HAX D;  2OTJ F;  1U43 A;  5CA1 A;  2OTL F;  2AMT A;  4ZK7 A;  4BT2 A;  1XBI A;  2OTM A;  1W5A A;  1KC8 H;  5EB1 B;  2VXY A;  1VQL F;  1W59 A;  1VQP F;  3CCU F;  4B62 A;  3DC2 A;  3MDO A;  4O4I A;  3N2K A;  3WPX A;  4PWT A;  4LNU B;  3U0O A;  3RYC B;  1W58 1;  4TUY B;  1K8A H;  3LWV C;  1X7O A;  2DYY A;  5KMG A;  2ZVZ A;  2H8C A;  4O2A B;  1W55 A;  3JAW B;  4G4V A;  2GZL A;  4I4T A;  5KX5 B;  5EAZ A;  3JCM M;  5JQG A;  4IIJ A;  2UZH A;  3D01 A;  5JCO A;  3OON A;  5EB0 A;  1TVK A;  3RYH B;  1TUB B;  3F0G A;  2L26 A;  2YYE A;  2UYN B;  3VOB A;  1VQ9 F;  1UI9 A;  4RQO A;  3PLA C;  3K2X A;  3P0Z A;  1JD1 A;  1W5B A;  3LWQ C;  1FFX B;  1IPA A;  3VCZ A;  2I6R A;  3KJJ A;  3MBM A;  2OHW A;  3G6E F;  3C8L A;  1IV2 A;  3QUW A;  5LXT B;  3WXM B;  3Q8H A;  3C9U A;  3CCJ F;  1VQN F;  4EI8 A;  2ZVY A;  1M1K H;  4IHJ B;  2PHN A;  2CHS A;  4LNU A;  4EB6 B;  4X1Y B;  3N2G B;  4TUY A;  3RA6 A;  3RYC A;  3V4D A;  3G4S F;  3VYT C;  4O2A A;  2CVL A;  4YJ2 B;  2CZW A;  2R6R 1;  3JAW A;  5LP6 C;  5HP8 A;  2VAP A;  1JN1 A;  2IQQ A;  3I3F A;  5KX5 A;  4DRX B;  2AIF A;  2GLZ A;  1Q82 H;  2LBX A;  1X52 A;  4C4W C;  1YQN A;  2HS0 A;  3SIU A;  3CCM F;  1VQK F;  5EIB C;  4BVR A;  3RYH A;  2HRY A;  3IMP A;  2VAM A;  3N4Y A;  5MN5 A;  3NMU C;  3RE3 A;  2UYN A;  2CHT A;  5EIB D;  3CCL F;  3F0E A;  2LCA A;  3D00 A;  3GTZ A;  4WBN A;  3WGM A;  4U39 A;  3MCA B;  1FFX A;  2RB9 A;  4B45 A;  2YXZ A;  2BO1 A;  3QHD A;  3RYI B;  3ERN A;  4I50 B;  5GAP K;  1Z5W A;  1CK2 A;  5LXT A;  4BT6 A;  3CC2 F;  5GON B;  3UT5 B;  3S0W A;  3S06 A;  4IHJ A;  3E20 B;  3WJQ A;  3CCS F;  3IEW A;  1M90 H;  4EB6 A;  4X1Y A;  3N2G A;  4O2B B;  1VHA A;  5IYZ B;  3KJK A;  5FJ4 C;  1RQ2 A;  1YGY A;  5J2U B;  4YJ2 A;  3CPW F;  5ITZ B;  3OBW A;  2B33 A;  4DRX A;  2WAL A;  5LYJ B;  3HKC B;  2KGW A;  3ZO8 A;  3ZP4 A;  1GO0 A;  2FC3 A;  3JAM M;  1Q8R A;  1T0K B;  3E22 B;  3NVI B;  1H48 A;  3AGK A;  5HY4 A;  2DT4 A;  3R0P A;  5HY0 A;  3WGJ A;  1SZQ A;  3BYQ A;  3D54 A;  4BT4 A;  4ZHY B;  1DT9 A;  4TZZ A;  4X1I B;  1QD9 A;  2HX0 A;  3RYI A;  3CME F;  1JJ2 F;  4I50 A;  1S72 F;  2Z1E A;  5CB4 B;  2QI2 A;  2W8B C;  4ZOL B;  5GON A;  3UT5 A;  4LCK A;  1JY8 A;  3OW2 F;  1NMU B;  1SDS A;  2UYJ A;  4O2B A;  5IYZ A;  3LYB A;  3VYS C;  3T80 A;  3KIZ A;  5J2U A;  5IJ9 B;  1GO1 A;  3N4Z A;  1KD1 H;  5ITZ A;  2LBT A;  2Z1T A;  2CWJ A;  1K73 H;  1IV4 A;  3ELC A;  5HXU A;  5LYJ A;  3B6N A;  1GZ0 A;  3HKC A;  1NJI H;  2VGN A;  3VOA A;  3L7Q A;  1KNK A;  3KE1 A;  3CG6 A;  5HP7 A;  5GIO C;  3HKB B;  5BMV B;  3E22 A;  3I7T A;  2ZAU A;  1XHO A;  3LWP C; 
#chains in the Genus database with same CATH homology
 3ZO8 A;  3ZP4 A;  3K0T A;  1JD1 A;  3I3F A;  2DYY A;  2UYJ A;  2UYP A;  1J7H A;  1QAH A;  3VCZ A;  3KJJ A;  3ZOP A;  3LYB A;  3ZP7 A;  3K12 A;  3M4S A;  3R0P A;  1X25 A;  1COM A;  2IG8 A;  3QUW A;  4ZK7 A;  1PF5 A;  2CWJ A;  3KJK A;  3MQW A;  2OTM A;  2UYN A;  3D01 A;  1ONI A;  2CHT A;  1UFY A;  2UYK A;  5HP8 A;  2CHS A;  3L7Q A;  1QD9 A;  4NWO B;  3GTZ A;  3V4D A;  2EWC A;  2CW4 A;  5HP7 A;  2B33 A;  3LME A;  2CSL A;  2UYN B;  1XRG A;  1FNK A;  3M1X A;  1NQ3 A;  1DBF A;  2CVL A;  3I7T A;  1FNJ A;  1ODE A;  1XHO A;  1UI9 A;  1QU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...