1JD1A

Crystal structure of yeo7_yeast
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
TTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 13.9 KDA PROTEIN IN FCY2-PET117 INTERGENIC REGI
publication title X-ray structure of Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (Hmf1).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation inhibitor
total genus 36
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1jd1A00
3ZP4A 1QAHA 1NQ3A 3K0TA 1PF5A 3KJJA 5HP8A 1DBFA 1ODEA 2CHTA 3GTZA 3KJKA 3R0PA 2UYPA 3LMEA 2CW4A 2B33A 1ONIA 2OTMA 2CSLA 4NWOB 3M4SA 3D01A 3MQWA 5HP7A 1XRGA 4ZK7A 3I7TA 3ZP7A 1UI9A 3K12A 1J7HA 2DYYA 2UYJA 1X25A 2UYNB 1QD9A 2UYNA 3QUWA 3LYBA 3ZO8A 3ZOPA 1JD1A 1FNKA 2CHSA 2CVLA 3I3FA 3VCZA 1COMA 1QU9A 2IG8A 2UYKA 3V4DA 2CWJA 1UFYA 3L7QA 1XHOA 2EWCA 3M1XA 1FNJA
chains in the Genus database with same CATH superfamily
2Z1TA 2KTUA 1YJ9F 1Q82H 5LYJB 1XBIA 4ZI7A 5IJ9A 1TUBB 4BT4A 3CCLF 4NWOB 3D01A 3N2KB 1FFXB 4EB6B 3JAWA 3JAMM 1PXWA 3LDTA 5KX5B 3ON1A 2Q1YA 4TUYA 5EIBC 5AVMA 5J2UB 1IV4A 2Z1EA 2CHSA 4ZHYB 5FNVA 4X1IA 2UYKA 3V3TA 2RB9A 1GO0A 4TV9B 2F9ZC 4U39A 2PMPA 1YITF 3JATA 4C4WC 2GZLA 1VQ4F 5JH7A 4U3JB 4IIJB 4ZOLA 5GIPC 5IJ9B 1QVGF 2CHTA 2UYPA 3VYTC 2BTUA 2OTJF 3GYQA 3VOAA 2PHNA 4YJ3B 3HAXD 3K12A 1W59A 3ESJA 4LCKA 3NK6A 1X25A 5DCVA 1U40A 2ZVYA 1W57A 5EYPA 5FNVB 1JFFA 1UFYA 4BT2A 1Q86H 2IAFA 1VQLF 1NJIH 5GONB 1OFUA 3JATB 3RA5A 4BT5A 3VCZA 1ZWZA 1W40A 3FPIA 5JVDA 3CMEF 5LP6B 5CA0A 4I55B 3N4YA 2AMTA 1VHAA 5CA1B 4WBNA 3JALA 3CCEF 4NQ3A 3S06A 5IT9M 3S0YA 2H8CA 5EYPB 4TV8B 1QU9A 2HS4A 5EAZA 2CWJA 2NMUA 4G4VA 3HTNA 1VQVA 4X20A 3V7QA 5EB0A 3CCJF 2FC3A 3TD5A 3WJQA 1ODEA 1VQPF 2JNBA 2I6RA 5CA0B 1T0AA 4X1KA 3WGKA 3Q8HA 3MQWA 3P0ZA 1GO1A 2QA4F 4EI9A 2K1SA 2DYYA 1VQOF 3FFMA 2IG8A 2ZOVA 1K9MH 4KWEA 2IQQA 3V4DA 3VOBA 3E20B 4G4WA 4YJ2A 3M1XA 2HVYD 3CCMF 3LFOA 3VMFB 1CN7A 4B62A 2KTVA 3LMEA 2OTMA 4X3LA 3RE3A 3C9SA 3N2GA 4ZK7A 4M8IA 3QTYA 4LNUA 5A2QM 2L26A 1K73H 3CD6F 3ELCA 1VQ7F 4ZHQA 1YJNF 5HY1A 2BTOA 3OBWA 2QTPA 5IJ0B 4YJ2B 1FNJA 3P10A 5EZYA 2FGYA 1IV2A 3EORA 3E1YA 1NMUB 3C9RA 3VYUC 2CW4A 1IPAA 4O4LA 3RYHA 1TVKB 5JCOC 3VTIC 3HJWC 3E22A 2LBWA 5CB4A 2HX0A 3P4EA 4LNUB 4ERHA 1RQ2A 4O4JA 4I50A 4B46A 2RHOA 4ZHQB 3VYSC 3JASB 3WPWA 3KIZA 1GZ0A 4O2BA 1U3PA 5ITZA 3VIUA 2RHHA 5EO3A 2BO1A 3J7AR 3VI6A 3NK7A 5LA6A 4ZI7B 3S03A 1JN1A 2AIZP 3JAKA 4O4LB 2ZODA 2G9IA 3J80M 3I7TA 3JAWB 1T0KB 1YQNA 3E22B 5CB4B 1W5FA 1J7HA 3TD4A 1YHQF 3FBAA 3QUWA 1QD9A 1CK2A 3C9UA 4TUYB 4G4ZA 3F0GA 4O4JB 1JD1A 4I50B 3D00A 4C81A 1M90H 5MN4A 1Z5WA 1W3EX 2YXZA 4O2AA 3MDOA 4X1IB 1VQ6F 3BYQA 1H48A 4O2BB 1RA4A 3HKCA 4PWTA 5LOVA 5ITZB 3ZP4A 3K0TA 5B8FA 5JH7B 5G4UC 5HP8A 3GTZA 5LA6B 3KJKA 4ZOLB 5C8YA 1KNKA 5GINC 3UT5A 3JAKB 3WGLA 1W5AA 3CMAF 2OTLF 3HKDA 2HRUA 3CCSF 5IYZA 2R751 3NVKE 3NMUC 3FD6A 4X3MA 1VQKF 3IR9A 5JCOA 5EB1B 3I56F 3N4ZA 1KNJA 1W55A 1JFFB 4O2AB 2HP3A 3MBMA 2BTQB 3S02A 4BY9D 3HKCB 5LOVB 5FJ4C 5G4VC 2ZVZA 1R1MA 5JVDB 2CSLA 3UT5B 3VO8A 3HKDB 3C9TA 4C82A 5GIOC 4WBNB 5IYZB 2HRYA 1RQ7A 3JALB 2VAWA 4EI8A 3B6NA 2UYNA 5KMGA 1W5EA 3ZO8A 1VH8A 2CVLA 3WGNA 2KGWA 1Q81H 2ALEA 5HWEA 3T80A 1K8AH 4X20B 3NVIB 1QAHA 3V7EA 3WGJA 4BT6A 3MCQA 5LXTA 4BT3A 3M4SA 5BMVA 4X1KB 2HP0A 4DXDA 1YIJF 3C8LA 1XRGA 4BVQA 1VQ9F 1Z5VA 2YYEA 1UI9A 5EIBD 3RYCA 3CC4F 4R40B 5MN6A 2OZBA 2UYJA 3LWOC 3SIVA 3U0OA 5GAPK 2UYNB 3F0DA 4G88A 5FLXM 3LWQC 4X1YA 4I4TA 1JJ2F 4ZHVA 3K14A 1H7MA 1XHOA 2EWCA 1SA0A 3LWPC 5LP6C 3G4SF 1KD1H 3DC2A 4ZHWA 1U3LA 5LYJA 2WALA 5J2TA 3IKEA 1DBFA 2KG4A 4F6RA 4C8EA 3FD5A 4TZZA 3N2KA 5BMVB 2HP0B 2OHWA 4EB6A 1VQNF 2UZHA 1W2BF 3RYCB 3N2GB 4G4XA 3RYFA 3HKBA 3S0WA 3CB2A 4X1YB 1VQ8F 1QVFF 3I3FA 3CYPB 5HXZA 4TV9A 5JQGA 1XV2A 2HS3A 2Q1XA 3LWVC 1DT9A 1KQSF 2MQEA 4U3JA 3HKEA 1IV1A 4IIJA 5EZYB 1X52A 4BVTA 3KHNA 5HY0A 5J2TB 3SIUA 4F6RB 1E7KA 3CC2F 3PAFA 3CYQA 4HNAA 1RLGA 3RYHB 1W42A 4YJ3A 4IHJA 3IMPA 3RYFB 3HKBB 4B5CA 3CCUF 2H8EA 4G4YA 1Q8RA 4BVRA 1H47A 3LYBA 3JCMM 2ZAUA 2ZF8A 1SDSA 3ZOPA 4BW0B 1FSZA 3RA6A 1FNKA 4B45A 3M84A 4EI7A 3LWRC 2VXYA 4RQOA 4FFBA 3CPQA 5JQGB 3WGMA 3CCRF 5GONA 2Z1FA 1W581 1S72F 4NUTA 2P6YA 2RHJA 2Z01A 3HKEB 4DRXA 1PF5A 1YGYA 5LP6A 1N8RH 4I55A 1ONIA 2B33A 3CXCF 4HNAB 5CA1A 5HP7A 3OONA 4IHJB 1W41A 2GVIA 4E6EA 3K2XA 1KC8H 4TV8A 3TD3A 1VK3A 4RHAA 1COMA 4FFBB 3OBYA 3MCAB 1VQMF 1IV3A 2H6LA 3D54A 2CZWA 3IEQA 1Q7YH 2QI2A 4DRXB 3IEWA 2VAMA 3JARA 1U43A 3F6MA 3KE1A 3R0PA 5HXUA 3PLAC 3RYIA 1M1KH 3WXMB 3OW2F 5C8YB 2N48A 3I55F 2LBTA 3ZP7A 3AGKA 1X7PA 2VGNA 4C8IA 1VQ5F 2GLZA 3ERNA 1OAPA 3G6EF 2RHLA 3QHDA 4XCQA 2QEXF 3CC7F 3CCVF 1YJWF 3CPWF 5EWRA 1RLUA 2R6R1 1NQ3A 3JARB 2DT4A 2AIFA 4C8GA 5HY4A 3RYIB 2I6DA 3GHZA 4O4IA 3G71F 2Z1UA 1YI2F 3HWUA 3WJPA 3WJRA 2HQSC 4O4HA 3IKFA 5KMGB 2VAPA 3CCQF 4BVSA 1JY8A 5HY2A 5GANK 5IJ0A 1GX1A 3J81M 2W8BC 3JVHA 3WPXA 3F0FA 2VGMA 3KJJA 1TUBA 1X7OA 5LXTB 4O4IB 4BT7A 1TVKA 1FFXA 1CLIA 3S0HA 3CG6A 5MN5A 5KX5A 1SZQA 4O4HB 5J2UA 2HS0A 2V9YA 3F0EA 4I4TB 2LBXA 2LCAA 3JASA 3DDNA 3L7QA 1W5BA 3O85A 1SA0B
chains in the Genus database with same CATH topology
3ZP4A 1QAHA 1NQ3A 3K0TA 1PF5A 3KJJA 5HP8A 1DBFA 1ODEA 2CHTA 3GTZA 3KJKA 3R0PA 2UYPA 3LMEA 2CW4A 2B33A 1ONIA 2OTMA 2CSLA 4NWOB 3M4SA 3D01A 3MQWA 5HP7A 1XRGA 4ZK7A 3I7TA 3ZP7A 1UI9A 3K12A 1J7HA 2DYYA 2UYJA 1X25A 2UYNB 1QD9A 2UYNA 3QUWA 3LYBA 3ZO8A 3ZOPA 1JD1A 1FNKA 2CHSA 2CVLA 3I3FA 3VCZA 1COMA 1QU9A 2IG8A 2UYKA 3V4DA 2CWJA 1UFYA 3L7QA 1XHOA 2EWCA 3M1XA 1FNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZP4 A;  1QAH A;  1NQ3 A;  3K0T A;  1PF5 A;  3KJJ A;  5HP8 A;  1DBF A;  1ODE A;  2CHT A;  3GTZ A;  3KJK A;  3R0P A;  2UYP A;  3LME A;  2CW4 A;  2B33 A;  1ONI A;  2OTM A;  2CSL A;  4NWO B;  3M4S A;  3D01 A;  3MQW A;  5HP7 A;  1XRG A;  4ZK7 A;  3I7T A;  3ZP7 A;  1UI9 A;  3K12 A;  1J7H A;  2DYY A;  2UYJ A;  1X25 A;  2UYN B;  1QD9 A;  2UYN A;  3QUW A;  3LYB A;  3ZO8 A;  3ZOP A;  1JD1 A;  1FNK A;  2CHS A;  2CVL A;  3I3F A;  3VCZ A;  1COM A;  1QU9 A;  2IG8 A;  2UYK A;  3V4D A;  2CWJ A;  1UFY A;  3L7Q A;  1XHO A;  2EWC A;  3M1X A;  1FNJ A; 
#chains in the Genus database with same CATH topology
 2Z1T A;  2KTU A;  1YJ9 F;  1Q82 H;  5LYJ B;  1XBI A;  4ZI7 A;  5IJ9 A;  1TUB B;  4BT4 A;  3CCL F;  4NWO B;  3D01 A;  3N2K B;  1FFX B;  4EB6 B;  3JAW A;  3JAM M;  1PXW A;  3LDT A;  5KX5 B;  3ON1 A;  2Q1Y A;  4TUY A;  5EIB C;  5AVM A;  5J2U B;  1IV4 A;  2Z1E A;  2CHS A;  4ZHY B;  5FNV A;  4X1I A;  2UYK A;  3V3T A;  2RB9 A;  1GO0 A;  4TV9 B;  2F9Z C;  4U39 A;  2PMP A;  1YIT F;  3JAT A;  4C4W C;  2GZL A;  1VQ4 F;  5JH7 A;  4U3J B;  4IIJ B;  4ZOL A;  5GIP C;  5IJ9 B;  1QVG F;  2CHT A;  2UYP A;  3VYT C;  2BTU A;  2OTJ F;  3GYQ A;  3VOA A;  2PHN A;  4YJ3 B;  3HAX D;  3K12 A;  1W59 A;  3ESJ A;  4LCK A;  3NK6 A;  1X25 A;  5DCV A;  1U40 A;  2ZVY A;  1W57 A;  5EYP A;  5FNV B;  1JFF A;  1UFY A;  4BT2 A;  1Q86 H;  2IAF A;  1VQL F;  1NJI H;  5GON B;  1OFU A;  3JAT B;  3RA5 A;  4BT5 A;  3VCZ A;  1ZWZ A;  1W40 A;  3FPI A;  5JVD A;  3CME F;  5LP6 B;  5CA0 A;  4I55 B;  3N4Y A;  2AMT A;  1VHA A;  5CA1 B;  4WBN A;  3JAL A;  3CCE F;  4NQ3 A;  3S06 A;  5IT9 M;  3S0Y A;  2H8C A;  5EYP B;  4TV8 B;  1QU9 A;  2HS4 A;  5EAZ A;  2CWJ A;  2NMU A;  4G4V A;  3HTN A;  1VQV A;  4X20 A;  3V7Q A;  5EB0 A;  3CCJ F;  2FC3 A;  3TD5 A;  3WJQ A;  1ODE A;  1VQP F;  2JNB A;  2I6R A;  5CA0 B;  1T0A A;  4X1K A;  3WGK A;  3Q8H A;  3MQW A;  3P0Z A;  1GO1 A;  2QA4 F;  4EI9 A;  2K1S A;  2DYY A;  1VQO F;  3FFM A;  2IG8 A;  2ZOV A;  1K9M H;  4KWE A;  2IQQ A;  3V4D A;  3VOB A;  3E20 B;  4G4W A;  4YJ2 A;  3M1X A;  2HVY D;  3CCM F;  3LFO A;  3VMF B;  1CN7 A;  4B62 A;  2KTV A;  3LME A;  2OTM A;  4X3L A;  3RE3 A;  3C9S A;  3N2G A;  4ZK7 A;  4M8I A;  3QTY A;  4LNU A;  5A2Q M;  2L26 A;  1K73 H;  3CD6 F;  3ELC A;  1VQ7 F;  4ZHQ A;  1YJN F;  5HY1 A;  2BTO A;  3OBW A;  2QTP A;  5IJ0 B;  4YJ2 B;  1FNJ A;  3P10 A;  5EZY A;  2FGY A;  1IV2 A;  3EOR A;  3E1Y A;  1NMU B;  3C9R A;  3VYU C;  2CW4 A;  1IPA A;  4O4L A;  3RYH A;  1TVK B;  5JCO C;  3VTI C;  3HJW C;  3E22 A;  2LBW A;  5CB4 A;  2HX0 A;  3P4E A;  4LNU B;  4ERH A;  1RQ2 A;  4O4J A;  4I50 A;  4B46 A;  2RHO A;  4ZHQ B;  3VYS C;  3JAS B;  3WPW A;  3KIZ A;  1GZ0 A;  4O2B A;  1U3P A;  5ITZ A;  3VIU A;  2RHH A;  5EO3 A;  2BO1 A;  3J7A R;  3VI6 A;  3NK7 A;  5LA6 A;  4ZI7 B;  3S03 A;  1JN1 A;  2AIZ P;  3JAK A;  4O4L B;  2ZOD A;  2G9I A;  3J80 M;  3I7T A;  3JAW B;  1T0K B;  1YQN A;  3E22 B;  5CB4 B;  1W5F A;  1J7H A;  3TD4 A;  1YHQ F;  3FBA A;  3QUW A;  1QD9 A;  1CK2 A;  3C9U A;  4TUY B;  4G4Z A;  3F0G A;  4O4J B;  1JD1 A;  4I50 B;  3D00 A;  4C81 A;  1M90 H;  5MN4 A;  1Z5W A;  1W3E X;  2YXZ A;  4O2A A;  3MDO A;  4X1I B;  1VQ6 F;  3BYQ A;  1H48 A;  4O2B B;  1RA4 A;  3HKC A;  4PWT A;  5LOV A;  5ITZ B;  3ZP4 A;  3K0T A;  5B8F A;  5JH7 B;  5G4U C;  5HP8 A;  3GTZ A;  5LA6 B;  3KJK A;  4ZOL B;  5C8Y A;  1KNK A;  5GIN C;  3UT5 A;  3JAK B;  3WGL A;  1W5A A;  3CMA F;  2OTL F;  3HKD A;  2HRU A;  3CCS F;  5IYZ A;  2R75 1;  3NVK E;  3NMU C;  3FD6 A;  4X3M A;  1VQK F;  3IR9 A;  5JCO A;  5EB1 B;  3I56 F;  3N4Z A;  1KNJ A;  1W55 A;  1JFF B;  4O2A B;  2HP3 A;  3MBM A;  2BTQ B;  3S02 A;  4BY9 D;  3HKC B;  5LOV B;  5FJ4 C;  5G4V C;  2ZVZ A;  1R1M A;  5JVD B;  2CSL A;  3UT5 B;  3VO8 A;  3HKD B;  3C9T A;  4C82 A;  5GIO C;  4WBN B;  5IYZ B;  2HRY A;  1RQ7 A;  3JAL B;  2VAW A;  4EI8 A;  3B6N A;  2UYN A;  5KMG A;  1W5E A;  3ZO8 A;  1VH8 A;  2CVL A;  3WGN A;  2KGW A;  1Q81 H;  2ALE A;  5HWE A;  3T80 A;  1K8A H;  4X20 B;  3NVI B;  1QAH A;  3V7E A;  3WGJ A;  4BT6 A;  3MCQ A;  5LXT A;  4BT3 A;  3M4S A;  5BMV A;  4X1K B;  2HP0 A;  4DXD A;  1YIJ F;  3C8L A;  1XRG A;  4BVQ A;  1VQ9 F;  1Z5V A;  2YYE A;  1UI9 A;  5EIB D;  3RYC A;  3CC4 F;  4R40 B;  5MN6 A;  2OZB A;  2UYJ A;  3LWO C;  3SIV A;  3U0O A;  5GAP K;  2UYN B;  3F0D A;  4G88 A;  5FLX M;  3LWQ C;  4X1Y A;  4I4T A;  1JJ2 F;  4ZHV A;  3K14 A;  1H7M A;  1XHO A;  2EWC A;  1SA0 A;  3LWP C;  5LP6 C;  3G4S F;  1KD1 H;  3DC2 A;  4ZHW A;  1U3L A;  5LYJ A;  2WAL A;  5J2T A;  3IKE A;  1DBF A;  2KG4 A;  4F6R A;  4C8E A;  3FD5 A;  4TZZ A;  3N2K A;  5BMV B;  2HP0 B;  2OHW A;  4EB6 A;  1VQN F;  2UZH A;  1W2B F;  3RYC B;  3N2G B;  4G4X A;  3RYF A;  3HKB A;  3S0W A;  3CB2 A;  4X1Y B;  1VQ8 F;  1QVF F;  3I3F A;  3CYP B;  5HXZ A;  4TV9 A;  5JQG A;  1XV2 A;  2HS3 A;  2Q1X A;  3LWV C;  1DT9 A;  1KQS F;  2MQE A;  4U3J A;  3HKE A;  1IV1 A;  4IIJ A;  5EZY B;  1X52 A;  4BVT A;  3KHN A;  5HY0 A;  5J2T B;  3SIU A;  4F6R B;  1E7K A;  3CC2 F;  3PAF A;  3CYQ A;  4HNA A;  1RLG A;  3RYH B;  1W42 A;  4YJ3 A;  4IHJ A;  3IMP A;  3RYF B;  3HKB B;  4B5C A;  3CCU F;  2H8E A;  4G4Y A;  1Q8R A;  4BVR A;  1H47 A;  3LYB A;  3JCM M;  2ZAU A;  2ZF8 A;  1SDS A;  3ZOP A;  4BW0 B;  1FSZ A;  3RA6 A;  1FNK A;  4B45 A;  3M84 A;  4EI7 A;  3LWR C;  2VXY A;  4RQO A;  4FFB A;  3CPQ A;  5JQG B;  3WGM A;  3CCR F;  5GON A;  2Z1F A;  1W58 1;  1S72 F;  4NUT A;  2P6Y A;  2RHJ A;  2Z01 A;  3HKE B;  4DRX A;  1PF5 A;  1YGY A;  5LP6 A;  1N8R H;  4I55 A;  1ONI A;  2B33 A;  3CXC F;  4HNA B;  5CA1 A;  5HP7 A;  3OON A;  4IHJ B;  1W41 A;  2GVI A;  4E6E A;  3K2X A;  1KC8 H;  4TV8 A;  3TD3 A;  1VK3 A;  4RHA A;  1COM A;  4FFB B;  3OBY A;  3MCA B;  1VQM F;  1IV3 A;  2H6L A;  3D54 A;  2CZW A;  3IEQ A;  1Q7Y H;  2QI2 A;  4DRX B;  3IEW A;  2VAM A;  3JAR A;  1U43 A;  3F6M A;  3KE1 A;  3R0P A;  5HXU A;  3PLA C;  3RYI A;  1M1K H;  3WXM B;  3OW2 F;  5C8Y B;  2N48 A;  3I55 F;  2LBT A;  3ZP7 A;  3AGK A;  1X7P A;  2VGN A;  4C8I A;  1VQ5 F;  2GLZ A;  3ERN A;  1OAP A;  3G6E F;  2RHL A;  3QHD A;  4XCQ A;  2QEX F;  3CC7 F;  3CCV F;  1YJW F;  3CPW F;  5EWR A;  1RLU A;  2R6R 1;  1NQ3 A;  3JAR B;  2DT4 A;  2AIF A;  4C8G A;  5HY4 A;  3RYI B;  2I6D A;  3GHZ A;  4O4I A;  3G71 F;  2Z1U A;  1YI2 F;  3HWU A;  3WJP A;  3WJR A;  2HQS C;  4O4H A;  3IKF A;  5KMG B;  2VAP A;  3CCQ F;  4BVS A;  1JY8 A;  5HY2 A;  5GAN K;  5IJ0 A;  1GX1 A;  3J81 M;  2W8B C;  3JVH A;  3WPX A;  3F0F A;  2VGM A;  3KJJ A;  1TUB A;  1X7O A;  5LXT B;  4O4I B;  4BT7 A;  1TVK A;  1FFX A;  1CLI A;  3S0H A;  3CG6 A;  5MN5 A;  5KX5 A;  1SZQ A;  4O4H B;  5J2U A;  2HS0 A;  2V9Y A;  3F0E A;  4I4T B;  2LBX A;  2LCA A;  3JAS A;  3DDN A;  3L7Q A;  1W5B A;  3O85 A;  1SA0 B; 
#chains in the Genus database with same CATH homology
 3ZP4 A;  1QAH A;  1NQ3 A;  3K0T A;  1PF5 A;  3KJJ A;  5HP8 A;  1DBF A;  1ODE A;  2CHT A;  3GTZ A;  3KJK A;  3R0P A;  2UYP A;  3LME A;  2CW4 A;  2B33 A;  1ONI A;  2OTM A;  2CSL A;  4NWO B;  3M4S A;  3D01 A;  3MQW A;  5HP7 A;  1XRG A;  4ZK7 A;  3I7T A;  3ZP7 A;  1UI9 A;  3K12 A;  1J7H A;  2DYY A;  2UYJ A;  1X25 A;  2UYN B;  1QD9 A;  2UYN A;  3QUW A;  3LYB A;  3ZO8 A;  3ZOP A;  1JD1 A;  1FNK A;  2CHS A;  2CVL A;  3I3F A;  3VCZ A;  1COM A;  1QU9 A;  2IG8 A;  2UYK A;  3V4D A;  2CWJ A;  1UFY A;  3L7Q A;  1XHO A;  2EWC A;  3M1X A;  1FNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...