1JD1A

Crystal structure of yeo7_yeast
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
126
structure length
126
Chain Sequence
TTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIAAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (Hmf1).
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation inhibitor
molecule keywords HYPOTHETICAL 13.9 KDA PROTEIN IN FCY2-PET117 INTERGENIC REGI
total genus 36
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1jd1A00
2CWJA 2DYYA 2B33A 2EWCA 3I3FA 3LYBA 3MQWA 5HP7A 3LMEA 3M1XA 3V4DA 1FNKA 1DBFA 1JD1A 1NQ3A 1COMA 3ZP7A 2UYJA 1QU9A 3VCZA 1QD9A 2CSLA 2CHSA 1QAHA 3GTZA 1FNJA 1XHOA 2UYNA 3KJJA 3D01A 3M4SA 3L7QA 3R0PA 2UYPA 3K0TA 1UI9A 3QUWA 1X25A 5HP8A 1PF5A 2OTMA 3ZOPA 3K12A 4ZK7A 2IG8A 2UYKA 1XRGA 3I7TA 2CHTA 3ZO8A 1ODEA 1ONIA 3KJKA 3ZP4A 2CVLA 2UYNB 1UFYA 4NWOB 1J7HA 2CW4A
chains in the Genus database with same CATH superfamily
5JVDA 1RLGA 2DYYA 3OW2F 2BO1A 3QHDA 1KNKA 1RQ7A 5JCOC 2RHOA 3JAWA 3ZP7A 4X1KB 2KG4A 1QD9A 2HP0A 3N2KA 4G4ZA 1Z5VA 1W5FA 4TZZA 3UT5B 3CCVF 5MN4A 3R0PA 5GIOC 1UI9A 1S72F 4O4LA 3ZOPA 1QVFF 5J2TB 3I56F 3CPQA 3TD5A 2KGWA 3VYSC 1ODEA 4KWEA 4HNAA 1ONIA 2VAWA 4LNUA 4O2AA 1H48A 5EYPA 2LBTA 3O85A 5ITZB 1U43A 2CWJA 4O4IA 1RA4A 2ZODA 1JD1A 4RQOA 5BMVB 4BT2A 3BYQA 5LA6A 3SIUA 2HRUA 4C8EA 1Q86H 3C9SA 3VYTC 3IKEA 4O2BB 1GO0A 3RYIB 2LBXA 3HTNA 3JAKB 4IIJA 3S0HA 3G71F 4BVRA 3MCQA 1K73H 3F6MA 3M1XA 5HXZA 4O4HA 5BMVA 1KC8H 1W2BF 3S0WA 4ZI7A 3LWVC 3WGKA 3Q8HA 3HKDB 3NVKE 2W8BC 4ZHQA 3WXMB 1X25A 4YJ3B 1JY8A 1CLIA 3CCSF 5FLXM 3S02A 3S0YA 1VQ9F 3E1YA 1GO1A 2G9IA 3LWPC 3JALB 3JATB 4U3JB 5LA6B 4EI7A 3LWOC 5GONA 3IEQA 4BT3A 3KIZA 4RHAA 2R6R1 2Z1EA 3D01A 3F0FA 1JN1A 3HKEB 3DDNA 5GAPK 1W41A 3G6EF 3K0TA 1YGYA 3QUWA 5KMGA 4C81A 3J7AR 5JQGB 2QTPA 3RA6A 3K2XA 2CHTA 3CMAF 2V9YA 4ZOLA 4O4IB 3CG6A 3JALA 3WGJA 1TVKA 4ZHVA 3K14A 2HX0A 1GX1A 3CMEF 4TUYA 1JJ2F 3RE3A 3CPWF 4WBNA 1R1MA 3CCRF 3NMUC 3ESJA 2CSLA 4X1IA 3V3TA 5LXTA 5LP6C 3JATA 4U3JA 5HY1A 3CC7F 2H8EA 2FGYA 2Z1TA 5CA0B 3WPXA 1PF5A 3OBYA 4EI9A 3HKBB 5EIBC 4X1KA 1VQ7F 4I4TB 5GIPC 1KD1H 2HS4A 3JAWB 1YHQF 2R751 4EB6A 4NWOB 3CC4F 3N2KB 5J2UB 4IHJB 4TUYB 1Q82H 1DT9A 4X3MA 3V4DA 4X20B 1DBFA 1W55A 1VK3A 5FJ4C 5HY0A 3JASB 3NVIB 1JFFB 2GVIA 5HP8A 5A2QM 1Z5WA 2H8CA 4ZK7A 3CCQF 3J81M 4U39A 1VQNF 2Q1XA 3HKDA 1W5EA 4ERHA 1IV2A 4FFBB 4O4JB 4G4WA 3CCLF 5GANK 3V7EA 3CCMF 5IJ9A 2YYEA 3TD4A 1U3PA 1W42A 1NQ3A 2PMPA 2GZLA 1QU9A 3VYUC 2Z01A 3VOBA 3RYFA 4B45A 2JNBA 4C8IA 1Q81H 1FNJA 1FFXB 1ZWZA 4TV8A 4BW0B 1OFUA 2Z1FA 1VQ8F 5CB4B 2UYPA 1JFFA 2GLZA 5JCOA 2F9ZC 4DRXA 2IG8A 1YIJF 1U3LA 3D54A 3JVHA 1TVKB 3MCAB 4G4XA 5MN6A 3C8LA 1YJ9F 1M90H 3NK6A 3RYCB 4YJ2B 3HJWC 2YXZA 1M1KH 4X3LA 3CCUF 2B33A 3FD6A 1Q7YH 3RYIA 2RB9A 3FBAA 2QEXF 1COMA 2HS3A 3S03A 2L26A 5C8YB 2OZBA 2RHHA 4O4HB 5IYZA 3RYHB 2OTMA 3K12A 5EAZA 3DC2A 3U0OA 4BT5A 5GONB 5LXTB 5HWEA 4C82A 3HKCA 3ELCA 4G4VA 2VGNA 4BVSA 1KNJA 3GHZA 2VGMA 2UZHA 2ZOVA 2EWCA 2QI2A 2NMUA 1W40A 3FFMA 4LCKA 2Z1UA 5IJ0B 1FSZA 1YJNF 2IQQA 4R40B 2UYJA 5LYJB 1H7MA 4I4TA 1IV3A 3ON1A 4X1YB 1VQ6F 3VO8A 1VQVA 3OONA 3P10A 3M4SA 1KQSF 3RYHA 4I50B 3CYPB 2VAPA 4PWTA 4FFBA 4O4JA 3VI6A 5KX5B 3HKCB 2HRYA 3LDTA 4M8IA 3JARA 1VQLF 1CK2A 3HKEA 3TD3A 4C8GA 5JVDB 3S06A 3N4YA 1QVGF 2ZF8A 5C8YA 1T0KB 3E20B 2I6RA 5MN5A 2HP3A 1NMUB 3IMPA 3CC2F 2LCAA 3HAXD 3RYFB 2HVYD 3CCJF 3UT5A 4E6EA 3D00A 1XHOA 3E22A 3CD6F 4BVQA 4I50A 3LFOA 4B46A 4YJ3A 3KE1A 3VTIC 4YJ2A 1YJWF 1W581 3T80A 5EZYA 1H47A 2HQSC 5ITZA 4NQ3A 5EIBD 5CB4A 4O2AB 2AMTA 1FFXA 3GYQA 5HP7A 3JASA 2ZAUA 2K1SA 1W5AA 1VQOF 4ZOLB 5HXUA 1QAHA 2ALEA 1TUBA 5EWRA 5IYZB 2P6YA 4DXDA 3L7QA 1XV2A 3FD5A 3V7QA 4O2BA 3WGLA 4IIJB 3VIUA 3ZO8A 3ZP4A 2CVLA 4C4WC 1UFYA 3E22B 2H6LA 4X1YA 2HS0A 5G4UC 3JAMM 3RA5A 3G4SF 1VQPF 2LBWA 3N2GA 5EZYB 2Q1YA 5LOVB 4F6RB 4ZHWA 4WBNB 2BTUA 1RLUA 2CHSA 3HWUA 2UYNA 3IKFA 3OBWA 5G4VC 2KTUA 1VH8A 4EB6B 3WJRA 1X7PA 4IHJA 2N48A 1SA0B 4BT7A 5CA1A 4TV8B 1NJIH 4TV9B 1W57A 3HKBA 4BVTA 3I7TA 3J80M 4LNUB 3LWQC 1IV1A 3FPIA 1T0AA 3C9UA 5HY2A 3P0ZA 2FC3A 4BT6A 1VQ5F 3KJKA 1W59A 1XBIA 3EORA 3F0DA 3LYBA 3P4EA 5FNVB 3MQWA 3CB2A 3N2GB 3SIVA 5HY4A 5JH7A 1IV4A 1VQMF 3F0EA 3JARB 1IPAA 5LOVA 3B6NA 2OTJF 1X7OA 3IR9A 5JQGA 2MQEA 4NUTA 1CN7A 1VQKF 2I6DA 2CZWA 2DT4A 5IJ0A 2KTVA 4XCQA 2UYNB 4BY9D 2AIFA 3I3FA 1OAPA 1SDSA 5JH7B 4I55A 5J2TA 5KX5A 1VQ4F 1GZ0A 3VOAA 1TUBB 5IJ9B 3F0GA 3ERNA 1E7KA 2RHJA 2PHNA 1U40A 5CA0A 3WPWA 1YQNA 2OHWA 5EB1B 5B8FA 3WJPA 2UYKA 1VHAA 4DRXB 4ZI7B 3AGKA 1Q8RA 5EB0A 5LP6B 1YITF 1SZQA 5DCVA 2OTLF 2VXYA 3QTYA 3WJQA 3WGMA 4F6RA 4ZHQB 3N4ZA 3NK7A 3MDOA 1W5BA 3LMEA 1K9MH 4X20A 1SA0A 5CA1B 5KMGB 2BTOA 3JAKA 1X52A 4G4YA 2AIZP 4EI8A 4BT4A 3KHNA 5AVMA 3CXCF 1XRGA 1PXWA 3JCMM 2ZVYA 1K8AH 3C9TA 3I55F 3IEWA 3PAFA 3MBMA 2IAFA 3CCEF 1J7HA 4TV9A 5GINC 1RQ2A 3WGNA 2ZVZA 2QA4F 1FNKA 3VMFB 4X1IB 2HP0B 3VCZA 2WALA 4HNAB 5LP6A 5LYJA 2RHLA 3GTZA 3KJJA 4B62A 4ZHYB 5EO3A 5EYPB 1W3EX 3PLAC 5FNVA 5IT9M 4B5CA 3LWRC 4O4LB 1N8RH 3CYQA 3RYCA 3M84A 5J2UA 1YI2F 3C9RA 4G88A 2CW4A 2BTQB 2VAMA 4I55B
chains in the Genus database with same CATH topology
2CWJA 2DYYA 2B33A 2EWCA 3I3FA 3LYBA 3MQWA 5HP7A 3LMEA 3M1XA 3V4DA 1FNKA 1DBFA 1JD1A 1NQ3A 1COMA 3ZP7A 2UYJA 1QU9A 3VCZA 1QD9A 2CSLA 2CHSA 1QAHA 3GTZA 1FNJA 1XHOA 2UYNA 3KJJA 3D01A 3M4SA 3L7QA 3R0PA 2UYPA 3K0TA 1UI9A 3QUWA 1X25A 5HP8A 1PF5A 2OTMA 3ZOPA 3K12A 4ZK7A 2IG8A 2UYKA 1XRGA 3I7TA 2CHTA 3ZO8A 1ODEA 1ONIA 3KJKA 3ZP4A 2CVLA 2UYNB 1UFYA 4NWOB 1J7HA 2CW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWJ A;  2DYY A;  2B33 A;  2EWC A;  3I3F A;  3LYB A;  3MQW A;  5HP7 A;  3LME A;  3M1X A;  3V4D A;  1FNK A;  1DBF A;  1JD1 A;  1NQ3 A;  1COM A;  3ZP7 A;  2UYJ A;  1QU9 A;  3VCZ A;  1QD9 A;  2CSL A;  2CHS A;  1QAH A;  3GTZ A;  1FNJ A;  1XHO A;  2UYN A;  3KJJ A;  3D01 A;  3M4S A;  3L7Q A;  3R0P A;  2UYP A;  3K0T A;  1UI9 A;  3QUW A;  1X25 A;  5HP8 A;  1PF5 A;  2OTM A;  3ZOP A;  3K12 A;  4ZK7 A;  2IG8 A;  2UYK A;  1XRG A;  3I7T A;  2CHT A;  3ZO8 A;  1ODE A;  1ONI A;  3KJK A;  3ZP4 A;  2CVL A;  2UYN B;  1UFY A;  4NWO B;  1J7H A;  2CW4 A; 
#chains in the Genus database with same CATH topology
 5JVD A;  1RLG A;  2DYY A;  3OW2 F;  2BO1 A;  3QHD A;  1KNK A;  1RQ7 A;  5JCO C;  2RHO A;  3JAW A;  3ZP7 A;  4X1K B;  2KG4 A;  1QD9 A;  2HP0 A;  3N2K A;  4G4Z A;  1Z5V A;  1W5F A;  4TZZ A;  3UT5 B;  3CCV F;  5MN4 A;  3R0P A;  5GIO C;  1UI9 A;  1S72 F;  4O4L A;  3ZOP A;  1QVF F;  5J2T B;  3I56 F;  3CPQ A;  3TD5 A;  2KGW A;  3VYS C;  1ODE A;  4KWE A;  4HNA A;  1ONI A;  2VAW A;  4LNU A;  4O2A A;  1H48 A;  5EYP A;  2LBT A;  3O85 A;  5ITZ B;  1U43 A;  2CWJ A;  4O4I A;  1RA4 A;  2ZOD A;  1JD1 A;  4RQO A;  5BMV B;  4BT2 A;  3BYQ A;  5LA6 A;  3SIU A;  2HRU A;  4C8E A;  1Q86 H;  3C9S A;  3VYT C;  3IKE A;  4O2B B;  1GO0 A;  3RYI B;  2LBX A;  3HTN A;  3JAK B;  4IIJ A;  3S0H A;  3G71 F;  4BVR A;  3MCQ A;  1K73 H;  3F6M A;  3M1X A;  5HXZ A;  4O4H A;  5BMV A;  1KC8 H;  1W2B F;  3S0W A;  4ZI7 A;  3LWV C;  3WGK A;  3Q8H A;  3HKD B;  3NVK E;  2W8B C;  4ZHQ A;  3WXM B;  1X25 A;  4YJ3 B;  1JY8 A;  1CLI A;  3CCS F;  5FLX M;  3S02 A;  3S0Y A;  1VQ9 F;  3E1Y A;  1GO1 A;  2G9I A;  3LWP C;  3JAL B;  3JAT B;  4U3J B;  5LA6 B;  4EI7 A;  3LWO C;  5GON A;  3IEQ A;  4BT3 A;  3KIZ A;  4RHA A;  2R6R 1;  2Z1E A;  3D01 A;  3F0F A;  1JN1 A;  3HKE B;  3DDN A;  5GAP K;  1W41 A;  3G6E F;  3K0T A;  1YGY A;  3QUW A;  5KMG A;  4C81 A;  3J7A R;  5JQG B;  2QTP A;  3RA6 A;  3K2X A;  2CHT A;  3CMA F;  2V9Y A;  4ZOL A;  4O4I B;  3CG6 A;  3JAL A;  3WGJ A;  1TVK A;  4ZHV A;  3K14 A;  2HX0 A;  1GX1 A;  3CME F;  4TUY A;  1JJ2 F;  3RE3 A;  3CPW F;  4WBN A;  1R1M A;  3CCR F;  3NMU C;  3ESJ A;  2CSL A;  4X1I A;  3V3T A;  5LXT A;  5LP6 C;  3JAT A;  4U3J A;  5HY1 A;  3CC7 F;  2H8E A;  2FGY A;  2Z1T A;  5CA0 B;  3WPX A;  1PF5 A;  3OBY A;  4EI9 A;  3HKB B;  5EIB C;  4X1K A;  1VQ7 F;  4I4T B;  5GIP C;  1KD1 H;  2HS4 A;  3JAW B;  1YHQ F;  2R75 1;  4EB6 A;  4NWO B;  3CC4 F;  3N2K B;  5J2U B;  4IHJ B;  4TUY B;  1Q82 H;  1DT9 A;  4X3M A;  3V4D A;  4X20 B;  1DBF A;  1W55 A;  1VK3 A;  5FJ4 C;  5HY0 A;  3JAS B;  3NVI B;  1JFF B;  2GVI A;  5HP8 A;  5A2Q M;  1Z5W A;  2H8C A;  4ZK7 A;  3CCQ F;  3J81 M;  4U39 A;  1VQN F;  2Q1X A;  3HKD A;  1W5E A;  4ERH A;  1IV2 A;  4FFB B;  4O4J B;  4G4W A;  3CCL F;  5GAN K;  3V7E A;  3CCM F;  5IJ9 A;  2YYE A;  3TD4 A;  1U3P A;  1W42 A;  1NQ3 A;  2PMP A;  2GZL A;  1QU9 A;  3VYU C;  2Z01 A;  3VOB A;  3RYF A;  4B45 A;  2JNB A;  4C8I A;  1Q81 H;  1FNJ A;  1FFX B;  1ZWZ A;  4TV8 A;  4BW0 B;  1OFU A;  2Z1F A;  1VQ8 F;  5CB4 B;  2UYP A;  1JFF A;  2GLZ A;  5JCO A;  2F9Z C;  4DRX A;  2IG8 A;  1YIJ F;  1U3L A;  3D54 A;  3JVH A;  1TVK B;  3MCA B;  4G4X A;  5MN6 A;  3C8L A;  1YJ9 F;  1M90 H;  3NK6 A;  3RYC B;  4YJ2 B;  3HJW C;  2YXZ A;  1M1K H;  4X3L A;  3CCU F;  2B33 A;  3FD6 A;  1Q7Y H;  3RYI A;  2RB9 A;  3FBA A;  2QEX F;  1COM A;  2HS3 A;  3S03 A;  2L26 A;  5C8Y B;  2OZB A;  2RHH A;  4O4H B;  5IYZ A;  3RYH B;  2OTM A;  3K12 A;  5EAZ A;  3DC2 A;  3U0O A;  4BT5 A;  5GON B;  5LXT B;  5HWE A;  4C82 A;  3HKC A;  3ELC A;  4G4V A;  2VGN A;  4BVS A;  1KNJ A;  3GHZ A;  2VGM A;  2UZH A;  2ZOV A;  2EWC A;  2QI2 A;  2NMU A;  1W40 A;  3FFM A;  4LCK A;  2Z1U A;  5IJ0 B;  1FSZ A;  1YJN F;  2IQQ A;  4R40 B;  2UYJ A;  5LYJ B;  1H7M A;  4I4T A;  1IV3 A;  3ON1 A;  4X1Y B;  1VQ6 F;  3VO8 A;  1VQV A;  3OON A;  3P10 A;  3M4S A;  1KQS F;  3RYH A;  4I50 B;  3CYP B;  2VAP A;  4PWT A;  4FFB A;  4O4J A;  3VI6 A;  5KX5 B;  3HKC B;  2HRY A;  3LDT A;  4M8I A;  3JAR A;  1VQL F;  1CK2 A;  3HKE A;  3TD3 A;  4C8G A;  5JVD B;  3S06 A;  3N4Y A;  1QVG F;  2ZF8 A;  5C8Y A;  1T0K B;  3E20 B;  2I6R A;  5MN5 A;  2HP3 A;  1NMU B;  3IMP A;  3CC2 F;  2LCA A;  3HAX D;  3RYF B;  2HVY D;  3CCJ F;  3UT5 A;  4E6E A;  3D00 A;  1XHO A;  3E22 A;  3CD6 F;  4BVQ A;  4I50 A;  3LFO A;  4B46 A;  4YJ3 A;  3KE1 A;  3VTI C;  4YJ2 A;  1YJW F;  1W58 1;  3T80 A;  5EZY A;  1H47 A;  2HQS C;  5ITZ A;  4NQ3 A;  5EIB D;  5CB4 A;  4O2A B;  2AMT A;  1FFX A;  3GYQ A;  5HP7 A;  3JAS A;  2ZAU A;  2K1S A;  1W5A A;  1VQO F;  4ZOL B;  5HXU A;  1QAH A;  2ALE A;  1TUB A;  5EWR A;  5IYZ B;  2P6Y A;  4DXD A;  3L7Q A;  1XV2 A;  3FD5 A;  3V7Q A;  4O2B A;  3WGL A;  4IIJ B;  3VIU A;  3ZO8 A;  3ZP4 A;  2CVL A;  4C4W C;  1UFY A;  3E22 B;  2H6L A;  4X1Y A;  2HS0 A;  5G4U C;  3JAM M;  3RA5 A;  3G4S F;  1VQP F;  2LBW A;  3N2G A;  5EZY B;  2Q1Y A;  5LOV B;  4F6R B;  4ZHW A;  4WBN B;  2BTU A;  1RLU A;  2CHS A;  3HWU A;  2UYN A;  3IKF A;  3OBW A;  5G4V C;  2KTU A;  1VH8 A;  4EB6 B;  3WJR A;  1X7P A;  4IHJ A;  2N48 A;  1SA0 B;  4BT7 A;  5CA1 A;  4TV8 B;  1NJI H;  4TV9 B;  1W57 A;  3HKB A;  4BVT A;  3I7T A;  3J80 M;  4LNU B;  3LWQ C;  1IV1 A;  3FPI A;  1T0A A;  3C9U A;  5HY2 A;  3P0Z A;  2FC3 A;  4BT6 A;  1VQ5 F;  3KJK A;  1W59 A;  1XBI A;  3EOR A;  3F0D A;  3LYB A;  3P4E A;  5FNV B;  3MQW A;  3CB2 A;  3N2G B;  3SIV A;  5HY4 A;  5JH7 A;  1IV4 A;  1VQM F;  3F0E A;  3JAR B;  1IPA A;  5LOV A;  3B6N A;  2OTJ F;  1X7O A;  3IR9 A;  5JQG A;  2MQE A;  4NUT A;  1CN7 A;  1VQK F;  2I6D A;  2CZW A;  2DT4 A;  5IJ0 A;  2KTV A;  4XCQ A;  2UYN B;  4BY9 D;  2AIF A;  3I3F A;  1OAP A;  1SDS A;  5JH7 B;  4I55 A;  5J2T A;  5KX5 A;  1VQ4 F;  1GZ0 A;  3VOA A;  1TUB B;  5IJ9 B;  3F0G A;  3ERN A;  1E7K A;  2RHJ A;  2PHN A;  1U40 A;  5CA0 A;  3WPW A;  1YQN A;  2OHW A;  5EB1 B;  5B8F A;  3WJP A;  2UYK A;  1VHA A;  4DRX B;  4ZI7 B;  3AGK A;  1Q8R A;  5EB0 A;  5LP6 B;  1YIT F;  1SZQ A;  5DCV A;  2OTL F;  2VXY A;  3QTY A;  3WJQ A;  3WGM A;  4F6R A;  4ZHQ B;  3N4Z A;  3NK7 A;  3MDO A;  1W5B A;  3LME A;  1K9M H;  4X20 A;  1SA0 A;  5CA1 B;  5KMG B;  2BTO A;  3JAK A;  1X52 A;  4G4Y A;  2AIZ P;  4EI8 A;  4BT4 A;  3KHN A;  5AVM A;  3CXC F;  1XRG A;  1PXW A;  3JCM M;  2ZVY A;  1K8A H;  3C9T A;  3I55 F;  3IEW A;  3PAF A;  3MBM A;  2IAF A;  3CCE F;  1J7H A;  4TV9 A;  5GIN C;  1RQ2 A;  3WGN A;  2ZVZ A;  2QA4 F;  1FNK A;  3VMF B;  4X1I B;  2HP0 B;  3VCZ A;  2WAL A;  4HNA B;  5LP6 A;  5LYJ A;  2RHL A;  3GTZ A;  3KJJ A;  4B62 A;  4ZHY B;  5EO3 A;  5EYP B;  1W3E X;  3PLA C;  5FNV A;  5IT9 M;  4B5C A;  3LWR C;  4O4L B;  1N8R H;  3CYQ A;  3RYC A;  3M84 A;  5J2U A;  1YI2 F;  3C9R A;  4G88 A;  2CW4 A;  2BTQ B;  2VAM A;  4I55 B; 
#chains in the Genus database with same CATH homology
 2CWJ A;  2DYY A;  2B33 A;  2EWC A;  3I3F A;  3LYB A;  3MQW A;  5HP7 A;  3LME A;  3M1X A;  3V4D A;  1FNK A;  1DBF A;  1JD1 A;  1NQ3 A;  1COM A;  3ZP7 A;  2UYJ A;  1QU9 A;  3VCZ A;  1QD9 A;  2CSL A;  2CHS A;  1QAH A;  3GTZ A;  1FNJ A;  1XHO A;  2UYN A;  3KJJ A;  3D01 A;  3M4S A;  3L7Q A;  3R0P A;  2UYP A;  3K0T A;  1UI9 A;  3QUW A;  1X25 A;  5HP8 A;  1PF5 A;  2OTM A;  3ZOP A;  3K12 A;  4ZK7 A;  2IG8 A;  2UYK A;  1XRG A;  3I7T A;  2CHT A;  3ZO8 A;  1ODE A;  1ONI A;  3KJK A;  3ZP4 A;  2CVL A;  2UYN B;  1UFY A;  4NWO B;  1J7H A;  2CW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...