3CPWF

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cpwF00
5FJ4C 1GO0A 3WXMB 1K73H 1W2BF 3CCSF 1QVGF 3NVIB 5DCVA 3CCQF 5G4VC 1NJIH 3RA5A 3CCJF 1Q86H 3LWVC 3LFOA 3NK6A 3IR9A 3VMFB 1GZ0A 5G4UC 3OBYA 5GAPK 1YJWF 2OTJF 3E1YA 3CG6A 2JNBA 1X52A 3RA6A 1KC8H 2QI2A 5A2QM 3LWPC 1XBIA 3JCMM 1QVFF 3CC4F 3OBWA 1H7MA 1X7PA 2I6DA 5GINC 2ALEA 3FFMA 4X3LA 4TZZA 3LWRC 1VQPF 1DT9A 3V7EA 1ZWZA 1Q81H 2KTUA 1YHQF 3CMEF 1VQ9F 3CCEF 1VQ8F 1Q82H 3J80M 1CN7A 1YI2F 1VQOF 1IPAA 3CCUF 3NK7A 5EO3A 4BW0B 1M90H 3V7QA 5FLXM 3O85A 1E7KA 2VGMA 3AGKA 3N4YA 3G71F 1VQLF 1Q7YH 3CCMF 4LCKA 3PLAC 1W40A 3OW2F 1KD1H 1YITF 1X7OA 2BO1A 3CPQA 1VQMF 3CMAF 1SDSA 2HVYD 3NMUC 3LWQC 1RA4A 2QEXF 3J81M 3HJWC 2CZWA 4C4WC 2LBXA 1JJ2F 1VQ5F 2OHWA 3I55F 2KG4A 1M1KH 1YJ9F 3I56F 1W3EX 3CC2F 1YJNF 3G6EF 2OZBA 4X3MA 5GIPC 3LWOC 3CXCF 3CD6F 3NVKE 2OTLF 3GYQA 2KTVA 3G4SF 1GO1A 1PXWA 1VQKF 5GIOC 3JAMM 1K9MH 3E20B 1VQ7F 3CC7F 2QA4F 1YIJF 1S72F 1W41A 1KQSF 5IT9M 1NMUB 2FC3A 1W42A 3MCAB 1T0KB 5EWRA 3SIUA 3CCLF 1RLGA 1K8AH 5GANK 2WALA 3HAXD 3J7AR 1N8RH 1VQNF 3CPWF 1VQ6F 2AIFA 4NUTA 3CCVF 3VI6A 2VGNA 3SIVA 3ON1A 3N4ZA 1VQ4F 3PAFA 3CCRF 2LBWA 1CK2A 4BY9D
chains in the Genus database with same CATH superfamily
5EZYA 5FJ4C 1GO0A 3WXMB 3WGJA 1ODEA 3ZO8A 3QHDA 3CCQF 1TVKA 3LDTA 5G4VC 1QAHA 3HKCA 3CCJF 3JARA 3WGLA 2GLZA 5LA6B 1YJWF 2OTJF 3E1YA 5J2UB 2UYNB 3F0EA 3RA6A 3KIZA 4O2BB 3V4DA 1W5BA 4B5CA 5LYJA 5LXTA 3RYFB 5JH7B 3WGMA 3JCMM 3LWPC 2IAFA 4U3JB 3L7QA 1X7PA 1U3PA 3VIUA 1T0AA 3FFMA 3VCZA 3JALA 3VTIC 4I50B 1DT9A 2L26A 2VAWA 1Q81H 3K2XA 3J80M 1Q82H 4U39A 1CN7A 2OTMA 3WJQA 1YGYA 5LOVA 4BW0B 3S02A 3V7QA 3ERNA 4EI7A 4ZHQA 3K0TA 4ZK7A 2FGYA 1VQLF 5CA1B 5LP6A 1Q7YH 2RHOA 2YYEA 3CYPB 4HNAA 1UFYA 5EYPA 1X7OA 1Z5WA 2NMUA 4IHJA 1KNJA 3GTZA 3CMAF 1X25A 1SDSA 5LP6C 4F6RA 5JCOA 5JVDA 5HXUA 2ZODA 5GONB 2BTUA 5CB4A 5IJ0A 2OHWA 4ZOLA 5EIBD 3CC2F 1YJNF 1W55A 3G6EF 3JASB 2HP0A 4O2AA 4ZHYB 3CYQA 3HKBA 1TUBA 5HP8A 3IMPA 5JCOC 3NVKE 2UYKA 3C9RA 4TV9A 3VYTC 3F6MA 2VXYA 1H48A 3IEQA 1K9MH 2N48A 5LOVB 1VQ7F 5C8YB 3WGNA 3S0WA 3WJRA 4FFBA 3JATA 1W41A 2ZOVA 4X1IB 1NMUB 5KMGB 4ZI7A 4O4HA 3TD3A 1SA0A 5ITZB 2HS4A 5EYPB 2HRUA 1K8AH 5IYZA 3M84A 3K14A 2LBTA 1N8RH 5EAZA 2AIFA 3CCVF 3N4ZA 3RYIA 3PAFA 5MN5A 3VYSC 1JFFB 4ZOLB 4BY9D 1QU9A 4TV8B 1K73H 4C8EA 3HKBB 5LA6A 4G4YA 2B33A 5J2UA 1XRGA 2UYNA 4YJ2B 5J2TB 4O2BA 1QVGF 4TV9B 5KX5B 3NVIB 5DCVA 4BVSA 3U0OA 1NJIH 3RA5A 4X20B 3NK6A 5JQGB 1GZ0A 3CG6A 1KC8H 2Z1EA 2ZAUA 1U40A 1JY8A 1W581 1FFXB 1XBIA 3TD5A 1QVFF 1H7MA 2HS3A 1PF5A 1UI9A 1FNJA 2ALEA 5IJ9B 2H8EA 3LWRC 3V7EA 2IQQA 2G9IA 1ZWZA 2PHNA 1Q8RA 3RYIB 2Z1FA 4BVQA 4C8GA 5CA1A 3JAWB 4BT3A 4DRXA 4B62A 2RHHA 5EO3A 2Z1UA 2P6YA 5FLXM 3IEWA 1DBFA 4WBNB 3AGKA 1U3LA 3F0FA 5GONA 3S06A 1W40A 3DC2A 3OW2F 1YITF 3KJKA 3JASA 1R1MA 3RYCA 5B8FA 2BTOA 3HJWC 4LNUB 2ZVZA 2LBXA 2RB9A 1JJ2F 1VQ5F 2KG4A 1W3EX 1NQ3A 5C8YA 4RHAA 2RHLA 4M8IA 3ZP7A 3GYQA 2GVIA 3G4SF 2QTPA 2CHTA 2W8BC 1VQKF 4X1IA 3JAMM 4DRXB 5KMGA 1ONIA 1H47A 1U43A 1OAPA 5ITZA 4G88A 3BYQA 3ELCA 1S72F 3S0YA 4YJ3A 3MDOA 4DXDA 2DT4A 3K12A 3S03A 4EI9A 3WPXA 1T0KB 3CB2A 5HY2A 3CCLF 1JFFA 3FPIA 3HAXD 4X1YA 4TV8A 3E22B 3CPWF 3N2KA 3RYCB 1VQ6F 4NUTA 5J2TA 4YJ2A 5KX5A 3ON1A 3RE3A 3D54A 1VQ4F 4G4VA 2KGWA 1XV2A 2GZLA 4X20A 5JQGA 4B46A 1W2BF 4XCQA 3LMEA 2Q1XA 1W5AA 4NQ3A 1FFXA 4O4IA 2IG8A 5CA0B 1Q86H 3LFOA 3QTYA 3VMFB 5G4UC 3OBYA 5GAPK 2JNBA 1QD9A 4NWOB 2QI2A 5A2QM 4YJ3B 5IJ9A 2H8CA 4ZHWA 4G4XA 1VHAA 1VK3A 3JAWA 2R6R1 3HKDA 2CVLA 3JAKB 4X3LA 4X1YB 5HXZA 5HY1A 3N2KB 4TZZA 3I7TA 2KTUA 3CMEF 3VOBA 1VQ8F 3CCEF 4WBNA 3GHZA 3JVHA 3OONA 2YXZA 1VQOF 1IPAA 3RYHA 3CCUF 2ZF8A 3NK7A 2CSLA 1M90H 3HTNA 3O85A 1JD1A 5FNVB 2VGMA 3G71F 4O4IB 1RLUA 4LNUA 4TUYA 4LCKA 3FBAA 4C82A 1IV3A 1COMA 4O4JB 4IIJB 4G4ZA 3WJPA 3CPQA 3FD6A 2AIZP 1FSZA 2HVYD 2QEXF 3B6NA 3P0ZA 5HY4A 2HP3A 3ESJA 3I55F 1M1KH 3HKDB 4O4LA 2VAMA 2UYJA 2OZBA 4X3MA 2UYPA 2CWJA 3VYUC 3EORA 3CD6F 3F0GA 2HS0A 2OTLF 4KWEA 4C81A 1GO1A 4I4TB 3RYHB 3E20B 2PMPA 1FNKA 3C8LA 2QA4F 1GX1A 3DDNA 2HRYA 3E22A 4I55A 3V3TA 5IT9M 2H6LA 4TUYB 2FC3A 1W42A 3MCAB 4X1KB 1RQ7A 2Z1TA 5EWRA 3SIUA 3T80A 4ZHVA 2K1SA 3KHNA 5GANK 3J7AR 1VQNF 5EB1B 2AMTA 3C9SA 2VGNA 4BT5A 3CCSF 3C9UA 1CK2A 4O4LB 5CA0A 3R0PA 3M4SA 1YQNA 4R40B 1W57A 2VAPA 1Z5VA 3C9TA 5EB0A 1IV2A 2Q1YA 3LYBA 3TD4A 4EB6B 2R751 2HQSC 5EIBC 5HY0A 5EZYB 2CHSA 3LWVC 2MQEA 3IR9A 4BVTA 1X52A 3WGKA 3JAKA 5BMVA 1TVKB 3VOAA 4I55B 3HKCB 3HWUA 3CC4F 3JARB 3OBWA 2BTQB 3IKEA 2I6DA 5GINC 1W5EA 5LYJB 3I3FA 1XHOA 5HP7A 5LXTB 1VQPF 1YHQF 5FNVA 3UT5A 3P10A 1VQ9F 2V9YA 4G4WA 1W5FA 2CW4A 3VO8A 1YI2F 1VH8A 1IV1A 1JN1A 3JALB 4O4JA 3WPWA 1CLIA 2DYYA 3F0DA 4IIJA 1E7KA 4RQOA 1J7HA 3N4YA 3MQWA 4BT7A 1VQVA 4C8IA 5MN4A 3CCMF 3PLAC 3D01A 4B45A 1KD1H 1SZQA 2ZVYA 2HX0A 2BO1A 4ZHQB 1VQMF 5BMVB 3N2GA 3NMUC 5LP6B 3LWQC 1RA4A 3J81M 2CZWA 4C4WC 4HNAB 3HKEA 4EI8A 4I4TA 3KJJA 1YJ9F 3I56F 4IHJB 5HWEA 5GIPC 3LWOC 4F6RB 3CXCF 5JVDB 3P4EA 3UT5B 1OFUA 5CB4B 5IJ0B 2KTVA 1KNKA 3MBMA 3ZOPA 1PXWA 3S0HA 2UZHA 5GIOC 2RHJA 3D00A 4X1KA 2HP0B 3CC7F 4O2AB 1TUBB 3M1XA 1YIJF 2I6RA 4BT4A 3RYFA 4ERHA 1W59A 5JH7A 1KQSF 3FD5A 3IKFA 4U3JA 4BT2A 3KE1A 4BVRA 2EWCA 3QUWA 4FFBB 4PWTA 1RLGA 5AVMA 2WALA 3JATB 3N2GB 4I50A 2F9ZC 1RQ2A 2LCAA 1IV4A 3VI6A 3SIVA 2Z01A 4E6EA 5MN6A 3HKEB 3MCQA 4O4HB 1SA0B 4EB6A 4ZI7B 3CCRF 3ZP4A 4BT6A 3Q8HA 2LBWA 5IYZB
chains in the Genus database with same CATH topology
5FJ4C 1GO0A 3WXMB 1K73H 1W2BF 3CCSF 1QVGF 3NVIB 4XCQA 5DCVA 3CCQF 4BVSA 4NQ3A 5G4VC 1NJIH 5HY0A 3RA5A 3CCJF 1Q86H 3LWVC 3LFOA 3NK6A 3IR9A 3VMFB 4BVTA 1GZ0A 5G4UC 2GLZA 3OBYA 5GAPK 1YJWF 2OTJF 3E1YA 3CG6A 2JNBA 1X52A 3RA6A 1KC8H 2QI2A 5A2QM 3LWPC 1XBIA 3JCMM 1QVFF 3CC4F 3OBWA 1H7MA 1X7PA 2I6DA 5GINC 2ALEA 3FFMA 4X3LA 5HXZA 5HY1A 4TZZA 3LWRC 1VQPF 1DT9A 3V7EA 1ZWZA 1Q81H 2KTUA 1YHQF 3CMEF 1VQ9F 3CCEF 1VQ8F 1Q82H 3J80M 1CN7A 4BVQA 1YI2F 1VQOF 1IPAA 3CCUF 3NK7A 5EO3A 4BW0B 1M90H 3V7QA 5FLXM 3O85A 1E7KA 4EI7A 2FGYA 2VGMA 3AGKA 3N4YA 3G71F 1VQLF 1Q7YH 3CCMF 4LCKA 3PLAC 1W40A 3OW2F 1KD1H 1YITF 1X7OA 2BO1A 3CPQA 1VQMF 3CMAF 1SDSA 2HVYD 3NMUC 3LWQC 1RA4A 2QEXF 3J81M 3HJWC 2CZWA 4C4WC 5HXUA 2LBXA 5HY4A 1JJ2F 4EI8A 1VQ5F 2OHWA 3I55F 2KG4A 1M1KH 1YJ9F 3I56F 1W3EX 3CC2F 1YJNF 3G6EF 2OZBA 4X3MA 5HWEA 5GIPC 3LWOC 3CXCF 3CD6F 3NVKE 2OTLF 3GYQA 2KTVA 3G4SF 1GO1A 1PXWA 1VQKF 5GIOC 3JAMM 1K9MH 3E20B 3D00A 1VQ7F 3CC7F 2QA4F 1YIJF 1S72F 1W41A 3V3TA 1KQSF 5IT9M 1NMUB 4EI9A 2FC3A 1W42A 3MCAB 4BVRA 1T0KB 5EWRA 5HY2A 3SIUA 3CCLF 1RLGA 1K8AH 5GANK 2WALA 3HAXD 3J7AR 1N8RH 1VQNF 3CPWF 2F9ZC 1VQ6F 2AIFA 4NUTA 3CCVF 3VI6A 2VGNA 3SIVA 3ON1A 3N4ZA 1VQ4F 3PAFA 3CCRF 2LBWA 1CK2A 4BY9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ4 C;  1GO0 A;  3WXM B;  1K73 H;  1W2B F;  3CCS F;  1QVG F;  3NVI B;  5DCV A;  3CCQ F;  5G4V C;  1NJI H;  3RA5 A;  3CCJ F;  1Q86 H;  3LWV C;  3LFO A;  3NK6 A;  3IR9 A;  3VMF B;  1GZ0 A;  5G4U C;  3OBY A;  5GAP K;  1YJW F;  2OTJ F;  3E1Y A;  3CG6 A;  2JNB A;  1X52 A;  3RA6 A;  1KC8 H;  2QI2 A;  5A2Q M;  3LWP C;  1XBI A;  3JCM M;  1QVF F;  3CC4 F;  3OBW A;  1H7M A;  1X7P A;  2I6D A;  5GIN C;  2ALE A;  3FFM A;  4X3L A;  4TZZ A;  3LWR C;  1VQP F;  1DT9 A;  3V7E A;  1ZWZ A;  1Q81 H;  2KTU A;  1YHQ F;  3CME F;  1VQ9 F;  3CCE F;  1VQ8 F;  1Q82 H;  3J80 M;  1CN7 A;  1YI2 F;  1VQO F;  1IPA A;  3CCU F;  3NK7 A;  5EO3 A;  4BW0 B;  1M90 H;  3V7Q A;  5FLX M;  3O85 A;  1E7K A;  2VGM A;  3AGK A;  3N4Y A;  3G71 F;  1VQL F;  1Q7Y H;  3CCM F;  4LCK A;  3PLA C;  1W40 A;  3OW2 F;  1KD1 H;  1YIT F;  1X7O A;  2BO1 A;  3CPQ A;  1VQM F;  3CMA F;  1SDS A;  2HVY D;  3NMU C;  3LWQ C;  1RA4 A;  2QEX F;  3J81 M;  3HJW C;  2CZW A;  4C4W C;  2LBX A;  1JJ2 F;  1VQ5 F;  2OHW A;  3I55 F;  2KG4 A;  1M1K H;  1YJ9 F;  3I56 F;  1W3E X;  3CC2 F;  1YJN F;  3G6E F;  2OZB A;  4X3M A;  5GIP C;  3LWO C;  3CXC F;  3CD6 F;  3NVK E;  2OTL F;  3GYQ A;  2KTV A;  3G4S F;  1GO1 A;  1PXW A;  1VQK F;  5GIO C;  3JAM M;  1K9M H;  3E20 B;  1VQ7 F;  3CC7 F;  2QA4 F;  1YIJ F;  1S72 F;  1W41 A;  1KQS F;  5IT9 M;  1NMU B;  2FC3 A;  1W42 A;  3MCA B;  1T0K B;  5EWR A;  3SIU A;  3CCL F;  1RLG A;  1K8A H;  5GAN K;  2WAL A;  3HAX D;  3J7A R;  1N8R H;  1VQN F;  3CPW F;  1VQ6 F;  2AIF A;  4NUT A;  3CCV F;  3VI6 A;  2VGN A;  3SIV A;  3ON1 A;  3N4Z A;  1VQ4 F;  3PAF A;  3CCR F;  2LBW A;  1CK2 A;  4BY9 D; 
#chains in the Genus database with same CATH topology
 5EZY A;  5FJ4 C;  1GO0 A;  3WXM B;  3WGJ A;  1ODE A;  3ZO8 A;  3QHD A;  3CCQ F;  1TVK A;  3LDT A;  5G4V C;  1QAH A;  3HKC A;  3CCJ F;  3JAR A;  3WGL A;  2GLZ A;  5LA6 B;  1YJW F;  2OTJ F;  3E1Y A;  5J2U B;  2UYN B;  3F0E A;  3RA6 A;  3KIZ A;  4O2B B;  3V4D A;  1W5B A;  4B5C A;  5LYJ A;  5LXT A;  3RYF B;  5JH7 B;  3WGM A;  3JCM M;  3LWP C;  2IAF A;  4U3J B;  3L7Q A;  1X7P A;  1U3P A;  3VIU A;  1T0A A;  3FFM A;  3VCZ A;  3JAL A;  3VTI C;  4I50 B;  1DT9 A;  2L26 A;  2VAW A;  1Q81 H;  3K2X A;  3J80 M;  1Q82 H;  4U39 A;  1CN7 A;  2OTM A;  3WJQ A;  1YGY A;  5LOV A;  4BW0 B;  3S02 A;  3V7Q A;  3ERN A;  4EI7 A;  4ZHQ A;  3K0T A;  4ZK7 A;  2FGY A;  1VQL F;  5CA1 B;  5LP6 A;  1Q7Y H;  2RHO A;  2YYE A;  3CYP B;  4HNA A;  1UFY A;  5EYP A;  1X7O A;  1Z5W A;  2NMU A;  4IHJ A;  1KNJ A;  3GTZ A;  3CMA F;  1X25 A;  1SDS A;  5LP6 C;  4F6R A;  5JCO A;  5JVD A;  5HXU A;  2ZOD A;  5GON B;  2BTU A;  5CB4 A;  5IJ0 A;  2OHW A;  4ZOL A;  5EIB D;  3CC2 F;  1YJN F;  1W55 A;  3G6E F;  3JAS B;  2HP0 A;  4O2A A;  4ZHY B;  3CYQ A;  3HKB A;  1TUB A;  5HP8 A;  3IMP A;  5JCO C;  3NVK E;  2UYK A;  3C9R A;  4TV9 A;  3VYT C;  3F6M A;  2VXY A;  1H48 A;  3IEQ A;  1K9M H;  2N48 A;  5LOV B;  1VQ7 F;  5C8Y B;  3WGN A;  3S0W A;  3WJR A;  4FFB A;  3JAT A;  1W41 A;  2ZOV A;  4X1I B;  1NMU B;  5KMG B;  4ZI7 A;  4O4H A;  3TD3 A;  1SA0 A;  5ITZ B;  2HS4 A;  5EYP B;  2HRU A;  1K8A H;  5IYZ A;  3M84 A;  3K14 A;  2LBT A;  1N8R H;  5EAZ A;  2AIF A;  3CCV F;  3N4Z A;  3RYI A;  3PAF A;  5MN5 A;  3VYS C;  1JFF B;  4ZOL B;  4BY9 D;  1QU9 A;  4TV8 B;  1K73 H;  4C8E A;  3HKB B;  5LA6 A;  4G4Y A;  2B33 A;  5J2U A;  1XRG A;  2UYN A;  4YJ2 B;  5J2T B;  4O2B A;  1QVG F;  4TV9 B;  5KX5 B;  3NVI B;  5DCV A;  4BVS A;  3U0O A;  1NJI H;  3RA5 A;  4X20 B;  3NK6 A;  5JQG B;  1GZ0 A;  3CG6 A;  1KC8 H;  2Z1E A;  2ZAU A;  1U40 A;  1JY8 A;  1W58 1;  1FFX B;  1XBI A;  3TD5 A;  1QVF F;  1H7M A;  2HS3 A;  1PF5 A;  1UI9 A;  1FNJ A;  2ALE A;  5IJ9 B;  2H8E A;  3LWR C;  3V7E A;  2IQQ A;  2G9I A;  1ZWZ A;  2PHN A;  1Q8R A;  3RYI B;  2Z1F A;  4BVQ A;  4C8G A;  5CA1 A;  3JAW B;  4BT3 A;  4DRX A;  4B62 A;  2RHH A;  5EO3 A;  2Z1U A;  2P6Y A;  5FLX M;  3IEW A;  1DBF A;  4WBN B;  3AGK A;  1U3L A;  3F0F A;  5GON A;  3S06 A;  1W40 A;  3DC2 A;  3OW2 F;  1YIT F;  3KJK A;  3JAS A;  1R1M A;  3RYC A;  5B8F A;  2BTO A;  3HJW C;  4LNU B;  2ZVZ A;  2LBX A;  2RB9 A;  1JJ2 F;  1VQ5 F;  2KG4 A;  1W3E X;  1NQ3 A;  5C8Y A;  4RHA A;  2RHL A;  4M8I A;  3ZP7 A;  3GYQ A;  2GVI A;  3G4S F;  2QTP A;  2CHT A;  2W8B C;  1VQK F;  4X1I A;  3JAM M;  4DRX B;  5KMG A;  1ONI A;  1H47 A;  1U43 A;  1OAP A;  5ITZ A;  4G88 A;  3BYQ A;  3ELC A;  1S72 F;  3S0Y A;  4YJ3 A;  3MDO A;  4DXD A;  2DT4 A;  3K12 A;  3S03 A;  4EI9 A;  3WPX A;  1T0K B;  3CB2 A;  5HY2 A;  3CCL F;  1JFF A;  3FPI A;  3HAX D;  4X1Y A;  4TV8 A;  3E22 B;  3CPW F;  3N2K A;  3RYC B;  1VQ6 F;  4NUT A;  5J2T A;  4YJ2 A;  5KX5 A;  3ON1 A;  3RE3 A;  3D54 A;  1VQ4 F;  4G4V A;  2KGW A;  1XV2 A;  2GZL A;  4X20 A;  5JQG A;  4B46 A;  1W2B F;  4XCQ A;  3LME A;  2Q1X A;  1W5A A;  4NQ3 A;  1FFX A;  4O4I A;  2IG8 A;  5CA0 B;  1Q86 H;  3LFO A;  3QTY A;  3VMF B;  5G4U C;  3OBY A;  5GAP K;  2JNB A;  1QD9 A;  4NWO B;  2QI2 A;  5A2Q M;  4YJ3 B;  5IJ9 A;  2H8C A;  4ZHW A;  4G4X A;  1VHA A;  1VK3 A;  3JAW A;  2R6R 1;  3HKD A;  2CVL A;  3JAK B;  4X3L A;  4X1Y B;  5HXZ A;  5HY1 A;  3N2K B;  4TZZ A;  3I7T A;  2KTU A;  3CME F;  3VOB A;  1VQ8 F;  3CCE F;  4WBN A;  3GHZ A;  3JVH A;  3OON A;  2YXZ A;  1VQO F;  1IPA A;  3RYH A;  3CCU F;  2ZF8 A;  3NK7 A;  2CSL A;  1M90 H;  3HTN A;  3O85 A;  1JD1 A;  5FNV B;  2VGM A;  3G71 F;  4O4I B;  1RLU A;  4LNU A;  4TUY A;  4LCK A;  3FBA A;  4C82 A;  1IV3 A;  1COM A;  4O4J B;  4IIJ B;  4G4Z A;  3WJP A;  3CPQ A;  3FD6 A;  2AIZ P;  1FSZ A;  2HVY D;  2QEX F;  3B6N A;  3P0Z A;  5HY4 A;  2HP3 A;  3ESJ A;  3I55 F;  1M1K H;  3HKD B;  4O4L A;  2VAM A;  2UYJ A;  2OZB A;  4X3M A;  2UYP A;  2CWJ A;  3VYU C;  3EOR A;  3CD6 F;  3F0G A;  2HS0 A;  2OTL F;  4KWE A;  4C81 A;  1GO1 A;  4I4T B;  3RYH B;  3E20 B;  2PMP A;  1FNK A;  3C8L A;  2QA4 F;  1GX1 A;  3DDN A;  2HRY A;  3E22 A;  4I55 A;  3V3T A;  5IT9 M;  2H6L A;  4TUY B;  2FC3 A;  1W42 A;  3MCA B;  4X1K B;  1RQ7 A;  2Z1T A;  5EWR A;  3SIU A;  3T80 A;  4ZHV A;  2K1S A;  3KHN A;  5GAN K;  3J7A R;  1VQN F;  5EB1 B;  2AMT A;  3C9S A;  2VGN A;  4BT5 A;  3CCS F;  3C9U A;  1CK2 A;  4O4L B;  5CA0 A;  3R0P A;  3M4S A;  1YQN A;  4R40 B;  1W57 A;  2VAP A;  1Z5V A;  3C9T A;  5EB0 A;  1IV2 A;  2Q1Y A;  3LYB A;  3TD4 A;  4EB6 B;  2R75 1;  2HQS C;  5EIB C;  5HY0 A;  5EZY B;  2CHS A;  3LWV C;  2MQE A;  3IR9 A;  4BVT A;  1X52 A;  3WGK A;  3JAK A;  5BMV A;  1TVK B;  3VOA A;  4I55 B;  3HKC B;  3HWU A;  3CC4 F;  3JAR B;  3OBW A;  2BTQ B;  3IKE A;  2I6D A;  5GIN C;  1W5E A;  5LYJ B;  3I3F A;  1XHO A;  5HP7 A;  5LXT B;  1VQP F;  1YHQ F;  5FNV A;  3UT5 A;  3P10 A;  1VQ9 F;  2V9Y A;  4G4W A;  1W5F A;  2CW4 A;  3VO8 A;  1YI2 F;  1VH8 A;  1IV1 A;  1JN1 A;  3JAL B;  4O4J A;  3WPW A;  1CLI A;  2DYY A;  3F0D A;  4IIJ A;  1E7K A;  4RQO A;  1J7H A;  3N4Y A;  3MQW A;  4BT7 A;  1VQV A;  4C8I A;  5MN4 A;  3CCM F;  3PLA C;  3D01 A;  4B45 A;  1KD1 H;  1SZQ A;  2ZVY A;  2HX0 A;  2BO1 A;  4ZHQ B;  1VQM F;  5BMV B;  3N2G A;  3NMU C;  5LP6 B;  3LWQ C;  1RA4 A;  3J81 M;  2CZW A;  4C4W C;  4HNA B;  3HKE A;  4EI8 A;  4I4T A;  3KJJ A;  1YJ9 F;  3I56 F;  4IHJ B;  5HWE A;  5GIP C;  3LWO C;  4F6R B;  3CXC F;  5JVD B;  3P4E A;  3UT5 B;  1OFU A;  5CB4 B;  5IJ0 B;  2KTV A;  1KNK A;  3MBM A;  3ZOP A;  1PXW A;  3S0H A;  2UZH A;  5GIO C;  2RHJ A;  3D00 A;  4X1K A;  2HP0 B;  3CC7 F;  4O2A B;  1TUB B;  3M1X A;  1YIJ F;  2I6R A;  4BT4 A;  3RYF A;  4ERH A;  1W59 A;  5JH7 A;  1KQS F;  3FD5 A;  3IKF A;  4U3J A;  4BT2 A;  3KE1 A;  4BVR A;  2EWC A;  3QUW A;  4FFB B;  4PWT A;  1RLG A;  5AVM A;  2WAL A;  3JAT B;  3N2G B;  4I50 A;  2F9Z C;  1RQ2 A;  2LCA A;  1IV4 A;  3VI6 A;  3SIV A;  2Z01 A;  4E6E A;  5MN6 A;  3HKE B;  3MCQ A;  4O4H B;  1SA0 B;  4EB6 A;  4ZI7 B;  3CCR F;  3ZP4 A;  4BT6 A;  3Q8H A;  2LBW A;  5IYZ B; 
#chains in the Genus database with same CATH homology
 5FJ4 C;  1GO0 A;  3WXM B;  1K73 H;  1W2B F;  3CCS F;  1QVG F;  3NVI B;  4XCQ A;  5DCV A;  3CCQ F;  4BVS A;  4NQ3 A;  5G4V C;  1NJI H;  5HY0 A;  3RA5 A;  3CCJ F;  1Q86 H;  3LWV C;  3LFO A;  3NK6 A;  3IR9 A;  3VMF B;  4BVT A;  1GZ0 A;  5G4U C;  2GLZ A;  3OBY A;  5GAP K;  1YJW F;  2OTJ F;  3E1Y A;  3CG6 A;  2JNB A;  1X52 A;  3RA6 A;  1KC8 H;  2QI2 A;  5A2Q M;  3LWP C;  1XBI A;  3JCM M;  1QVF F;  3CC4 F;  3OBW A;  1H7M A;  1X7P A;  2I6D A;  5GIN C;  2ALE A;  3FFM A;  4X3L A;  5HXZ A;  5HY1 A;  4TZZ A;  3LWR C;  1VQP F;  1DT9 A;  3V7E A;  1ZWZ A;  1Q81 H;  2KTU A;  1YHQ F;  3CME F;  1VQ9 F;  3CCE F;  1VQ8 F;  1Q82 H;  3J80 M;  1CN7 A;  4BVQ A;  1YI2 F;  1VQO F;  1IPA A;  3CCU F;  3NK7 A;  5EO3 A;  4BW0 B;  1M90 H;  3V7Q A;  5FLX M;  3O85 A;  1E7K A;  4EI7 A;  2FGY A;  2VGM A;  3AGK A;  3N4Y A;  3G71 F;  1VQL F;  1Q7Y H;  3CCM F;  4LCK A;  3PLA C;  1W40 A;  3OW2 F;  1KD1 H;  1YIT F;  1X7O A;  2BO1 A;  3CPQ A;  1VQM F;  3CMA F;  1SDS A;  2HVY D;  3NMU C;  3LWQ C;  1RA4 A;  2QEX F;  3J81 M;  3HJW C;  2CZW A;  4C4W C;  5HXU A;  2LBX A;  5HY4 A;  1JJ2 F;  4EI8 A;  1VQ5 F;  2OHW A;  3I55 F;  2KG4 A;  1M1K H;  1YJ9 F;  3I56 F;  1W3E X;  3CC2 F;  1YJN F;  3G6E F;  2OZB A;  4X3M A;  5HWE A;  5GIP C;  3LWO C;  3CXC F;  3CD6 F;  3NVK E;  2OTL F;  3GYQ A;  2KTV A;  3G4S F;  1GO1 A;  1PXW A;  1VQK F;  5GIO C;  3JAM M;  1K9M H;  3E20 B;  3D00 A;  1VQ7 F;  3CC7 F;  2QA4 F;  1YIJ F;  1S72 F;  1W41 A;  3V3T A;  1KQS F;  5IT9 M;  1NMU B;  4EI9 A;  2FC3 A;  1W42 A;  3MCA B;  4BVR A;  1T0K B;  5EWR A;  5HY2 A;  3SIU A;  3CCL F;  1RLG A;  1K8A H;  5GAN K;  2WAL A;  3HAX D;  3J7A R;  1N8R H;  1VQN F;  3CPW F;  2F9Z C;  1VQ6 F;  2AIF A;  4NUT A;  3CCV F;  3VI6 A;  2VGN A;  3SIV A;  3ON1 A;  3N4Z A;  1VQ4 F;  3PAF A;  3CCR F;  2LBW A;  1CK2 A;  4BY9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...