3CPWF

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cpwF00
2OTJF 2LBXA 3CCEF 3E1YA 3N4ZA 1SDSA 4C4WC 1Q86H 2JNBA 2WALA 1VQMF 1YI2F 3J7AR 1YJWF 4X3LA 1K73H 1VQ7F 2CZWA 3NK7A 1YJNF 1PXWA 1KD1H 2BO1A 3WXMB 3RA6A 1QVGF 1H7MA 3CMAF 1RLGA 1Q7YH 3CC2F 2I6DA 1W2BF 1K9MH 1T0KB 1S72F 5GANK 2OHWA 3G6EF 5FJ4C 2OTLF 3LWPC 1YITF 1VQ9F 3CCMF 1NMUB 2KTVA 3GYQA 1N8RH 1XBIA 5GINC 1YJ9F 3FFMA 3LWOC 1K8AH 5GIOC 4NUTA 3MCAB 1VQ6F 5DCVA 2FC3A 3I56F 1E7KA 3OBWA 3HJWC 3J81M 3SIUA 3I55F 1VQOF 2VGMA 3RA5A 1X7PA 1DT9A 3CCLF 4X3MA 1VQ4F 3O85A 2QI2A 3CCVF 1X52A 1GO0A 3LWRC 3CC4F 3LFOA 1NJIH 5FLXM 1IPAA 1CK2A 1KC8H 1W40A 3CCRF 1YIJF 1M90H 3NK6A 1M1KH 3E20B 1VQ8F 3J80M 3V7QA 3G4SF 1Q81H 1W3EX 2KTUA 1VQKF 5G4UC 4BW0B 1W42A 3LWVC 5EO3A 3N4YA 1QVFF 1VQPF 5GIPC 3V7EA 2AIFA 2QEXF 1VQLF 3AGKA 3CXCF 3G71F 3NVIB 3CD6F 3JAMM 1X7OA 1GZ0A 3PLAC 1CN7A 3CCSF 3CG6A 3CPWF 2KG4A 3OW2F 3OBYA 1KQSF 3HAXD 5IT9M 3JCMM 5A2QM 1ZWZA 3IR9A 3PAFA 3CMEF 4BY9D 5EWRA 3CCJF 2HVYD 4LCKA 1JJ2F 3VI6A 1GO1A 1Q82H 2LBWA 3NMUC 3CC7F 1W41A 3SIVA 3CPQA 3ON1A 2VGNA 1VQNF 4TZZA 1VQ5F 3CCUF 1YHQF 2OZBA 5G4VC 3VMFB 1RA4A 2QA4F 2ALEA 3NVKE 3CCQF 5GAPK 3LWQC
chains in the Genus database with same CATH superfamily
1T0AA 3JARB 5JH7A 3S0HA 5CA1B 1TVKB 3N4ZA 4EB6A 2HS3A 4G4VA 3EORA 2CWJA 4WBNA 3M84A 5CA0A 2L26A 3JASA 4X20B 1FNKA 1VQMF 1PF5A 2QTPA 3N2KB 2OTMA 3KJJA 1K73H 5BMVA 1QAHA 2GZLA 4O4IB 4F6RA 1RLGA 1Q7YH 4I50A 4HNAA 3MBMA 3ZP7A 4I55A 3LWPC 1YITF 1VQ9F 3CCMF 1NMUB 3GYQA 4TUYB 2Q1XA 3HKCB 3ESJA 1YJ9F 1U3LA 5GIOC 1JD1A 3F0GA 3D54A 2K1SA 3RYFA 2HS0A 3I56F 4BT5A 3OBWA 5LYJA 3VYUC 4BT6A 1GX1A 5LP6B 1XHOA 3F0FA 3S0WA 3M4SA 1VQ4F 3WJQA 2UYNA 1X52A 2HS4A 3K12A 1CLIA 1QU9A 5EYPA 4X1IB 3Q8HA 4O2BA 3ELCA 3TD4A 5FLXM 1IPAA 2H6LA 3KHNA 4G4YA 5FNVB 4ZHQB 3BYQA 5J2UA 4KWEA 3VOAA 1Q81H 3R0PA 1VQKF 5G4UC 1TUBB 1W42A 3JATA 3ZP4A 5HP7A 4U3JA 5EO3A 1U3PA 3VO8A 2VAWA 5LOVB 1YGYA 3G71F 3CD6F 4RQOA 2FGYA 5IYZB 3OW2F 3OBYA 4BVTA 3GTZA 5IT9M 2R6R1 3KE1A 2Z01A 5HY1A 1FFXB 5C8YB 5IJ0B 3C9RA 5HY4A 3CPQA 2UYJA 1VQNF 3FBAA 3F6MA 3RYIB 2NMUA 4B5CA 2OZBA 5ITZA 3HKDA 3VMFB 4EI7A 3E22B 1ONIA 5EAZA 3WGJA 5HY0A 3CCQF 5GONB 1W581 5GAPK 3P4EA 3KIZA 1SA0A 2LBXA 4NQ3A 4BT7A 1W5FA 3CCEF 3E1YA 3LYBA 4ZOLB 4X1KA 5EIBD 4O4HA 1RQ2A 4YJ2B 3D01A 5CB4A 1YI2F 4O4JA 3F0EA 1JFFB 5IJ9A 3S02A 4ERHA 3NK7A 3DC2A 5JVDA 4O4LA 5AVMA 4LNUB 4BT2A 4I4TB 2BTUA 4O4IA 2RHOA 3FPIA 1FSZA 2ZOVA 5FJ4C 2OTLF 5EZYA 3V4DA 2Z1UA 3RYCB 2KTVA 1W59A 1IV1A 2BTQB 4BVRA 1J7HA 4E6EA 3FFMA 2LBTA 3FD5A 5DCVA 2LCAA 3T80A 2HRYA 3HKEB 1IV3A 3UT5B 4ZI7A 1E7KA 3HJWC 3B6NA 1R1MA 1ODEA 2N48A 3I55F 3RA5A 5JQGB 1X7PA 3CCLF 3O85A 3CCVF 2AIZP 5LP6A 3LWRC 5LA6B 4G4WA 4DXDA 2BTOA 2EWCA 1M1KH 2VAPA 3HKBB 1VQ8F 1U40A 3J80M 1KNKA 1H48A 4O2AA 3RYHB 3MDOA 3WGNA 1QVFF 3N4YA 3LDTA 5GIPC 5MN5A 2AIFA 4TV9B 3NVIB 1VQLF 3AGKA 1TUBA 3QHDA 3CXCF 3JAMM 5JH7B 5MN6A 2ZF8A 4FFBA 4ZHYB 4EB6B 3PLAC 1W5BA 1VK3A 2KG4A 4WBNB 3VYTC 5CA0B 2IAFA 1DBFA 3TD3A 3JASB 2HX0A 1KNJA 3N2GA 4BT4A 3ERNA 2VXYA 5MN4A 2RB9A 1Z5VA 2I6RA 3JAWB 5EWRA 3CMEF 2HVYD 4LCKA 4PWTA 5KMGA 1H47A 1GO1A 2RHLA 1Q82H 4YJ3B 1SZQA 4BT3A 4C8GA 4F6RB 3LMEA 3P10A 1FFXA 1VQ5F 2KGWA 5JCOA 1RA4A 2QA4F 2ALEA 1XV2A 4C8IA 3S0YA 1X25A 4I55B 5LP6C 3LWQC 3S03A 2Z1FA 1RQ7A 4IHJB 4B45A 2OTJF 1OAPA 4TV8B 4G4ZA 1IV4A 4RHAA 5J2TB 1SDSA 3VYSC 1RLUA 1VH8A 3S06A 3IKFA 3RYFB 3KJKA 3V3TA 4X3LA 3WJPA 2Z1TA 3JALA 2DT4A 3JAKA 3WXMB 2CSLA 3CYQA 4IIJA 3CC2F 2I6DA 5EYPB 4BVSA 3C9SA 4M8IA 2IG8A 1W2BF 4O2BB 1T0KB 3WGKA 1S72F 2PMPA 3HWUA 2OHWA 3K2XA 4LNUA 3G6EF 3HTNA 5HXZA 3I3FA 5J2UB 3C8LA 3WJRA 4ZK7A 1N8RH 3JATB 3JARA 3I7TA 4U3JB 4DRXB 5CA1A 1TVKA 1K8AH 3C9TA 3C9UA 1Q8RA 4NUTA 3VIUA 2RHHA 3MCAB 1VQ6F 5EB0A 3QUWA 2YYEA 5JCOC 4X20A 2MQEA 4NWOB 3CYPB 3N2KA 3RE3A 2VGMA 1UI9A 4X3MA 3IKEA 3K14A 1IV2A 3JVHA 4G88A 2DYYA 4C82A 1CK2A 1W5AA 1KC8H 1YIJF 1M90H 3NK6A 3E20B 1W3EX 3U0OA 3HKDB 4TUYA 2G9IA 1QD9A 2HP3A 5KX5B 3HKCA 5LXTB 2CVLA 3LWVC 3MCQA 3QTYA 3F0DA 2QEXF 3IEQA 1SA0B 2ZODA 4X1YB 3ZO8A 4X1KB 1CN7A 2HP0B 5EB1B 3IMPA 3CCSF 1YQNA 3CG6A 1NQ3A 3D00A 4O4HB 2CW4A 3HAXD 5EIBC 2GLZA 1ZWZA 3IR9A 3VTIC 5A2QM 5CB4B 4BY9D 4O4JB 3VCZA 5IJ9B 3P0ZA 5JVDB 2HQSC 3JAWA 4O4LB 4X1IA 3L7QA 3CC7F 3SIVA 2UZHA 2W8BC 2H8EA 2VGNA 5FNVA 4ZHWA 4ZHQA 4TZZA 2CHSA 4YJ3A 1YHQF 2RHJA 1OFUA 2R751 3ZOPA 2Z1EA 3NVKE 5EZYB 1JN1A 2F9ZC 4BVQA 3WGLA 5LOVA 1VHAA 4G4XA 3WPXA 3WGMA 2B33A 3CB2A 5IYZA 4C4WC 4IHJA 2P6YA 1Q86H 3FD6A 4TV8A 1UFYA 2GVIA 4C8EA 5J2TA 4ZI7B 1JY8A 2JNBA 2WALA 4XCQA 3J7AR 5BMVB 3K0TA 1YJWF 2HRUA 1VQ7F 2CZWA 1YJNF 2CHTA 1PXWA 1KD1H 2BO1A 5C8YA 4I50B 5IJ0A 1VQVA 3RA6A 1QVGF 1H7MA 3CMAF 4HNAB 3RYIA 2H8CA 4R40B 1K9MH 5GANK 3E22A 5GONA 4O2AB 1XBIA 5GINC 3LWOC 4ZOLA 2YXZA 5HP8A 4B62A 5LYJB 2IQQA 1W57A 4DRXA 4YJ2A 2FC3A 4FFBB 3GHZA 3J81M 5HWEA 3SIUA 4B46A 1VQOF 1JFFA 2Q1YA 2UYNB 3N2GB 1XRGA 3MQWA 1DT9A 2ZAUA 2PHNA 2QI2A 5KMGB 1W5EA 1GO0A 3CC4F 2V9YA 3LFOA 1NJIH 4I4TA 4U39A 1W40A 3CCRF 2VAMA 3V7QA 3G4SF 2KTUA 3RYCA 4BW0B 2AMTA 2ZVZA 1Z5WA 1VQPF 3V7EA 3VOBA 5LXTA 5KX5A 1X7OA 1GZ0A 1FNJA 3HKEA 2UYKA 3UT5A 3DDNA 4EI9A 3CPWF 2UYPA 1KQSF 4X1YA 2HP0A 5JQGA 3JCMM 3PAFA 3TD5A 3CCJF 1U43A 1JJ2F 1COMA 3VI6A 3JALB 4EI8A 4C81A 3JAKB 2LBWA 3NMUC 5LA6A 1W55A 1W41A 5HXUA 3M1XA 5ITZB 4IIJB 3ON1A 3HKBA 3CCUF 3OONA 5G4VC 5B8FA 2ZVYA 3WPWA 5HY2A 3RYHA 4ZHVA 4TV9A 3IEWA
chains in the Genus database with same CATH topology
2OTJF 2LBXA 4NQ3A 3CCEF 3E1YA 3N4ZA 1SDSA 4C4WC 1Q86H 2JNBA 2WALA 4XCQA 1VQMF 1YI2F 3J7AR 1YJWF 3V3TA 4X3LA 1K73H 1VQ7F 2CZWA 3NK7A 1YJNF 1PXWA 1KD1H 2BO1A 3WXMB 3RA6A 1QVGF 1H7MA 3CMAF 1RLGA 1Q7YH 3CC2F 2I6DA 4BVSA 1W2BF 1K9MH 1T0KB 1S72F 5GANK 2OHWA 3G6EF 5FJ4C 2OTLF 5HXZA 3LWPC 1YITF 1VQ9F 3CCMF 1NMUB 2KTVA 3GYQA 1N8RH 1XBIA 4BVRA 5GINC 1YJ9F 3FFMA 3LWOC 1K8AH 5GIOC 4NUTA 3MCAB 1VQ6F 5DCVA 2FC3A 3I56F 1E7KA 3OBWA 3HJWC 3J81M 3SIUA 5HWEA 3I55F 1VQOF 2VGMA 3RA5A 1X7PA 1DT9A 3CCLF 4X3MA 1VQ4F 3O85A 2QI2A 3CCVF 1X52A 1GO0A 3LWRC 3CC4F 3LFOA 1NJIH 5FLXM 1IPAA 1CK2A 1KC8H 1W40A 3CCRF 1YIJF 1M90H 3NK6A 1M1KH 3E20B 1VQ8F 3J80M 3V7QA 3G4SF 1Q81H 1W3EX 2KTUA 1VQKF 5G4UC 4BW0B 1W42A 3LWVC 5EO3A 3N4YA 1QVFF 1VQPF 5GIPC 3V7EA 2AIFA 2QEXF 1VQLF 3AGKA 3CXCF 3G71F 3NVIB 3CD6F 3JAMM 1X7OA 1GZ0A 3PLAC 2FGYA 1CN7A 3CCSF 3CG6A 3D00A 4EI9A 3CPWF 2KG4A 3OW2F 3OBYA 1KQSF 4BVTA 3HAXD 5IT9M 3JCMM 5A2QM 2GLZA 1ZWZA 3IR9A 3PAFA 3CMEF 4BY9D 5EWRA 3CCJF 2HVYD 4LCKA 1JJ2F 3VI6A 5HY1A 4EI8A 1GO1A 1Q82H 2LBWA 3NMUC 3CC7F 1W41A 5HXUA 5HY4A 3SIVA 3CPQA 3ON1A 2VGNA 1VQNF 4TZZA 1VQ5F 3CCUF 1YHQF 2OZBA 5G4VC 3VMFB 1RA4A 4EI7A 5HY2A 2QA4F 2ALEA 3NVKE 5HY0A 3CCQF 2F9ZC 4BVQA 5GAPK 3LWQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ F;  2LBX A;  3CCE F;  3E1Y A;  3N4Z A;  1SDS A;  4C4W C;  1Q86 H;  2JNB A;  2WAL A;  1VQM F;  1YI2 F;  3J7A R;  1YJW F;  4X3L A;  1K73 H;  1VQ7 F;  2CZW A;  3NK7 A;  1YJN F;  1PXW A;  1KD1 H;  2BO1 A;  3WXM B;  3RA6 A;  1QVG F;  1H7M A;  3CMA F;  1RLG A;  1Q7Y H;  3CC2 F;  2I6D A;  1W2B F;  1K9M H;  1T0K B;  1S72 F;  5GAN K;  2OHW A;  3G6E F;  5FJ4 C;  2OTL F;  3LWP C;  1YIT F;  1VQ9 F;  3CCM F;  1NMU B;  2KTV A;  3GYQ A;  1N8R H;  1XBI A;  5GIN C;  1YJ9 F;  3FFM A;  3LWO C;  1K8A H;  5GIO C;  4NUT A;  3MCA B;  1VQ6 F;  5DCV A;  2FC3 A;  3I56 F;  1E7K A;  3OBW A;  3HJW C;  3J81 M;  3SIU A;  3I55 F;  1VQO F;  2VGM A;  3RA5 A;  1X7P A;  1DT9 A;  3CCL F;  4X3M A;  1VQ4 F;  3O85 A;  2QI2 A;  3CCV F;  1X52 A;  1GO0 A;  3LWR C;  3CC4 F;  3LFO A;  1NJI H;  5FLX M;  1IPA A;  1CK2 A;  1KC8 H;  1W40 A;  3CCR F;  1YIJ F;  1M90 H;  3NK6 A;  1M1K H;  3E20 B;  1VQ8 F;  3J80 M;  3V7Q A;  3G4S F;  1Q81 H;  1W3E X;  2KTU A;  1VQK F;  5G4U C;  4BW0 B;  1W42 A;  3LWV C;  5EO3 A;  3N4Y A;  1QVF F;  1VQP F;  5GIP C;  3V7E A;  2AIF A;  2QEX F;  1VQL F;  3AGK A;  3CXC F;  3G71 F;  3NVI B;  3CD6 F;  3JAM M;  1X7O A;  1GZ0 A;  3PLA C;  1CN7 A;  3CCS F;  3CG6 A;  3CPW F;  2KG4 A;  3OW2 F;  3OBY A;  1KQS F;  3HAX D;  5IT9 M;  3JCM M;  5A2Q M;  1ZWZ A;  3IR9 A;  3PAF A;  3CME F;  4BY9 D;  5EWR A;  3CCJ F;  2HVY D;  4LCK A;  1JJ2 F;  3VI6 A;  1GO1 A;  1Q82 H;  2LBW A;  3NMU C;  3CC7 F;  1W41 A;  3SIV A;  3CPQ A;  3ON1 A;  2VGN A;  1VQN F;  4TZZ A;  1VQ5 F;  3CCU F;  1YHQ F;  2OZB A;  5G4V C;  3VMF B;  1RA4 A;  2QA4 F;  2ALE A;  3NVK E;  3CCQ F;  5GAP K;  3LWQ C; 
#chains in the Genus database with same CATH topology
 1T0A A;  3JAR B;  5JH7 A;  3S0H A;  5CA1 B;  1TVK B;  3N4Z A;  4EB6 A;  2HS3 A;  4G4V A;  3EOR A;  2CWJ A;  4WBN A;  3M84 A;  5CA0 A;  2L26 A;  3JAS A;  4X20 B;  1FNK A;  1VQM F;  1PF5 A;  2QTP A;  3N2K B;  2OTM A;  3KJJ A;  1K73 H;  5BMV A;  1QAH A;  2GZL A;  4O4I B;  4F6R A;  1RLG A;  1Q7Y H;  4I50 A;  4HNA A;  3MBM A;  3ZP7 A;  4I55 A;  3LWP C;  1YIT F;  1VQ9 F;  3CCM F;  1NMU B;  3GYQ A;  4TUY B;  2Q1X A;  3HKC B;  3ESJ A;  1YJ9 F;  1U3L A;  5GIO C;  1JD1 A;  3F0G A;  3D54 A;  2K1S A;  3RYF A;  2HS0 A;  3I56 F;  4BT5 A;  3OBW A;  5LYJ A;  3VYU C;  4BT6 A;  1GX1 A;  5LP6 B;  1XHO A;  3F0F A;  3S0W A;  3M4S A;  1VQ4 F;  3WJQ A;  2UYN A;  1X52 A;  2HS4 A;  3K12 A;  1CLI A;  1QU9 A;  5EYP A;  4X1I B;  3Q8H A;  4O2B A;  3ELC A;  3TD4 A;  5FLX M;  1IPA A;  2H6L A;  3KHN A;  4G4Y A;  5FNV B;  4ZHQ B;  3BYQ A;  5J2U A;  4KWE A;  3VOA A;  1Q81 H;  3R0P A;  1VQK F;  5G4U C;  1TUB B;  1W42 A;  3JAT A;  3ZP4 A;  5HP7 A;  4U3J A;  5EO3 A;  1U3P A;  3VO8 A;  2VAW A;  5LOV B;  1YGY A;  3G71 F;  3CD6 F;  4RQO A;  2FGY A;  5IYZ B;  3OW2 F;  3OBY A;  4BVT A;  3GTZ A;  5IT9 M;  2R6R 1;  3KE1 A;  2Z01 A;  5HY1 A;  1FFX B;  5C8Y B;  5IJ0 B;  3C9R A;  5HY4 A;  3CPQ A;  2UYJ A;  1VQN F;  3FBA A;  3F6M A;  3RYI B;  2NMU A;  4B5C A;  2OZB A;  5ITZ A;  3HKD A;  3VMF B;  4EI7 A;  3E22 B;  1ONI A;  5EAZ A;  3WGJ A;  5HY0 A;  3CCQ F;  5GON B;  1W58 1;  5GAP K;  3P4E A;  3KIZ A;  1SA0 A;  2LBX A;  4NQ3 A;  4BT7 A;  1W5F A;  3CCE F;  3E1Y A;  3LYB A;  4ZOL B;  4X1K A;  5EIB D;  4O4H A;  1RQ2 A;  4YJ2 B;  3D01 A;  5CB4 A;  1YI2 F;  4O4J A;  3F0E A;  1JFF B;  5IJ9 A;  3S02 A;  4ERH A;  3NK7 A;  3DC2 A;  5JVD A;  4O4L A;  5AVM A;  4LNU B;  4BT2 A;  4I4T B;  2BTU A;  4O4I A;  2RHO A;  3FPI A;  1FSZ A;  2ZOV A;  5FJ4 C;  2OTL F;  5EZY A;  3V4D A;  2Z1U A;  3RYC B;  2KTV A;  1W59 A;  1IV1 A;  2BTQ B;  4BVR A;  1J7H A;  4E6E A;  3FFM A;  2LBT A;  3FD5 A;  5DCV A;  2LCA A;  3T80 A;  2HRY A;  3HKE B;  1IV3 A;  3UT5 B;  4ZI7 A;  1E7K A;  3HJW C;  3B6N A;  1R1M A;  1ODE A;  2N48 A;  3I55 F;  3RA5 A;  5JQG B;  1X7P A;  3CCL F;  3O85 A;  3CCV F;  2AIZ P;  5LP6 A;  3LWR C;  5LA6 B;  4G4W A;  4DXD A;  2BTO A;  2EWC A;  1M1K H;  2VAP A;  3HKB B;  1VQ8 F;  1U40 A;  3J80 M;  1KNK A;  1H48 A;  4O2A A;  3RYH B;  3MDO A;  3WGN A;  1QVF F;  3N4Y A;  3LDT A;  5GIP C;  5MN5 A;  2AIF A;  4TV9 B;  3NVI B;  1VQL F;  3AGK A;  1TUB A;  3QHD A;  3CXC F;  3JAM M;  5JH7 B;  5MN6 A;  2ZF8 A;  4FFB A;  4ZHY B;  4EB6 B;  3PLA C;  1W5B A;  1VK3 A;  2KG4 A;  4WBN B;  3VYT C;  5CA0 B;  2IAF A;  1DBF A;  3TD3 A;  3JAS B;  2HX0 A;  1KNJ A;  3N2G A;  4BT4 A;  3ERN A;  2VXY A;  5MN4 A;  2RB9 A;  1Z5V A;  2I6R A;  3JAW B;  5EWR A;  3CME F;  2HVY D;  4LCK A;  4PWT A;  5KMG A;  1H47 A;  1GO1 A;  2RHL A;  1Q82 H;  4YJ3 B;  1SZQ A;  4BT3 A;  4C8G A;  4F6R B;  3LME A;  3P10 A;  1FFX A;  1VQ5 F;  2KGW A;  5JCO A;  1RA4 A;  2QA4 F;  2ALE A;  1XV2 A;  4C8I A;  3S0Y A;  1X25 A;  4I55 B;  5LP6 C;  3LWQ C;  3S03 A;  2Z1F A;  1RQ7 A;  4IHJ B;  4B45 A;  2OTJ F;  1OAP A;  4TV8 B;  4G4Z A;  1IV4 A;  4RHA A;  5J2T B;  1SDS A;  3VYS C;  1RLU A;  1VH8 A;  3S06 A;  3IKF A;  3RYF B;  3KJK A;  3V3T A;  4X3L A;  3WJP A;  2Z1T A;  3JAL A;  2DT4 A;  3JAK A;  3WXM B;  2CSL A;  3CYQ A;  4IIJ A;  3CC2 F;  2I6D A;  5EYP B;  4BVS A;  3C9S A;  4M8I A;  2IG8 A;  1W2B F;  4O2B B;  1T0K B;  3WGK A;  1S72 F;  2PMP A;  3HWU A;  2OHW A;  3K2X A;  4LNU A;  3G6E F;  3HTN A;  5HXZ A;  3I3F A;  5J2U B;  3C8L A;  3WJR A;  4ZK7 A;  1N8R H;  3JAT B;  3JAR A;  3I7T A;  4U3J B;  4DRX B;  5CA1 A;  1TVK A;  1K8A H;  3C9T A;  3C9U A;  1Q8R A;  4NUT A;  3VIU A;  2RHH A;  3MCA B;  1VQ6 F;  5EB0 A;  3QUW A;  2YYE A;  5JCO C;  4X20 A;  2MQE A;  4NWO B;  3CYP B;  3N2K A;  3RE3 A;  2VGM A;  1UI9 A;  4X3M A;  3IKE A;  3K14 A;  1IV2 A;  3JVH A;  4G88 A;  2DYY A;  4C82 A;  1CK2 A;  1W5A A;  1KC8 H;  1YIJ F;  1M90 H;  3NK6 A;  3E20 B;  1W3E X;  3U0O A;  3HKD B;  4TUY A;  2G9I A;  1QD9 A;  2HP3 A;  5KX5 B;  3HKC A;  5LXT B;  2CVL A;  3LWV C;  3MCQ A;  3QTY A;  3F0D A;  2QEX F;  3IEQ A;  1SA0 B;  2ZOD A;  4X1Y B;  3ZO8 A;  4X1K B;  1CN7 A;  2HP0 B;  5EB1 B;  3IMP A;  3CCS F;  1YQN A;  3CG6 A;  1NQ3 A;  3D00 A;  4O4H B;  2CW4 A;  3HAX D;  5EIB C;  2GLZ A;  1ZWZ A;  3IR9 A;  3VTI C;  5A2Q M;  5CB4 B;  4BY9 D;  4O4J B;  3VCZ A;  5IJ9 B;  3P0Z A;  5JVD B;  2HQS C;  3JAW A;  4O4L B;  4X1I A;  3L7Q A;  3CC7 F;  3SIV A;  2UZH A;  2W8B C;  2H8E A;  2VGN A;  5FNV A;  4ZHW A;  4ZHQ A;  4TZZ A;  2CHS A;  4YJ3 A;  1YHQ F;  2RHJ A;  1OFU A;  2R75 1;  3ZOP A;  2Z1E A;  3NVK E;  5EZY B;  1JN1 A;  2F9Z C;  4BVQ A;  3WGL A;  5LOV A;  1VHA A;  4G4X A;  3WPX A;  3WGM A;  2B33 A;  3CB2 A;  5IYZ A;  4C4W C;  4IHJ A;  2P6Y A;  1Q86 H;  3FD6 A;  4TV8 A;  1UFY A;  2GVI A;  4C8E A;  5J2T A;  4ZI7 B;  1JY8 A;  2JNB A;  2WAL A;  4XCQ A;  3J7A R;  5BMV B;  3K0T A;  1YJW F;  2HRU A;  1VQ7 F;  2CZW A;  1YJN F;  2CHT A;  1PXW A;  1KD1 H;  2BO1 A;  5C8Y A;  4I50 B;  5IJ0 A;  1VQV A;  3RA6 A;  1QVG F;  1H7M A;  3CMA F;  4HNA B;  3RYI A;  2H8C A;  4R40 B;  1K9M H;  5GAN K;  3E22 A;  5GON A;  4O2A B;  1XBI A;  5GIN C;  3LWO C;  4ZOL A;  2YXZ A;  5HP8 A;  4B62 A;  5LYJ B;  2IQQ A;  1W57 A;  4DRX A;  4YJ2 A;  2FC3 A;  4FFB B;  3GHZ A;  3J81 M;  5HWE A;  3SIU A;  4B46 A;  1VQO F;  1JFF A;  2Q1Y A;  2UYN B;  3N2G B;  1XRG A;  3MQW A;  1DT9 A;  2ZAU A;  2PHN A;  2QI2 A;  5KMG B;  1W5E A;  1GO0 A;  3CC4 F;  2V9Y A;  3LFO A;  1NJI H;  4I4T A;  4U39 A;  1W40 A;  3CCR F;  2VAM A;  3V7Q A;  3G4S F;  2KTU A;  3RYC A;  4BW0 B;  2AMT A;  2ZVZ A;  1Z5W A;  1VQP F;  3V7E A;  3VOB A;  5LXT A;  5KX5 A;  1X7O A;  1GZ0 A;  1FNJ A;  3HKE A;  2UYK A;  3UT5 A;  3DDN A;  4EI9 A;  3CPW F;  2UYP A;  1KQS F;  4X1Y A;  2HP0 A;  5JQG A;  3JCM M;  3PAF A;  3TD5 A;  3CCJ F;  1U43 A;  1JJ2 F;  1COM A;  3VI6 A;  3JAL B;  4EI8 A;  4C81 A;  3JAK B;  2LBW A;  3NMU C;  5LA6 A;  1W55 A;  1W41 A;  5HXU A;  3M1X A;  5ITZ B;  4IIJ B;  3ON1 A;  3HKB A;  3CCU F;  3OON A;  5G4V C;  5B8F A;  2ZVY A;  3WPW A;  5HY2 A;  3RYH A;  4ZHV A;  4TV9 A;  3IEW A; 
#chains in the Genus database with same CATH homology
 2OTJ F;  2LBX A;  4NQ3 A;  3CCE F;  3E1Y A;  3N4Z A;  1SDS A;  4C4W C;  1Q86 H;  2JNB A;  2WAL A;  4XCQ A;  1VQM F;  1YI2 F;  3J7A R;  1YJW F;  3V3T A;  4X3L A;  1K73 H;  1VQ7 F;  2CZW A;  3NK7 A;  1YJN F;  1PXW A;  1KD1 H;  2BO1 A;  3WXM B;  3RA6 A;  1QVG F;  1H7M A;  3CMA F;  1RLG A;  1Q7Y H;  3CC2 F;  2I6D A;  4BVS A;  1W2B F;  1K9M H;  1T0K B;  1S72 F;  5GAN K;  2OHW A;  3G6E F;  5FJ4 C;  2OTL F;  5HXZ A;  3LWP C;  1YIT F;  1VQ9 F;  3CCM F;  1NMU B;  2KTV A;  3GYQ A;  1N8R H;  1XBI A;  4BVR A;  5GIN C;  1YJ9 F;  3FFM A;  3LWO C;  1K8A H;  5GIO C;  4NUT A;  3MCA B;  1VQ6 F;  5DCV A;  2FC3 A;  3I56 F;  1E7K A;  3OBW A;  3HJW C;  3J81 M;  3SIU A;  5HWE A;  3I55 F;  1VQO F;  2VGM A;  3RA5 A;  1X7P A;  1DT9 A;  3CCL F;  4X3M A;  1VQ4 F;  3O85 A;  2QI2 A;  3CCV F;  1X52 A;  1GO0 A;  3LWR C;  3CC4 F;  3LFO A;  1NJI H;  5FLX M;  1IPA A;  1CK2 A;  1KC8 H;  1W40 A;  3CCR F;  1YIJ F;  1M90 H;  3NK6 A;  1M1K H;  3E20 B;  1VQ8 F;  3J80 M;  3V7Q A;  3G4S F;  1Q81 H;  1W3E X;  2KTU A;  1VQK F;  5G4U C;  4BW0 B;  1W42 A;  3LWV C;  5EO3 A;  3N4Y A;  1QVF F;  1VQP F;  5GIP C;  3V7E A;  2AIF A;  2QEX F;  1VQL F;  3AGK A;  3CXC F;  3G71 F;  3NVI B;  3CD6 F;  3JAM M;  1X7O A;  1GZ0 A;  3PLA C;  2FGY A;  1CN7 A;  3CCS F;  3CG6 A;  3D00 A;  4EI9 A;  3CPW F;  2KG4 A;  3OW2 F;  3OBY A;  1KQS F;  4BVT A;  3HAX D;  5IT9 M;  3JCM M;  5A2Q M;  2GLZ A;  1ZWZ A;  3IR9 A;  3PAF A;  3CME F;  4BY9 D;  5EWR A;  3CCJ F;  2HVY D;  4LCK A;  1JJ2 F;  3VI6 A;  5HY1 A;  4EI8 A;  1GO1 A;  1Q82 H;  2LBW A;  3NMU C;  3CC7 F;  1W41 A;  5HXU A;  5HY4 A;  3SIV A;  3CPQ A;  3ON1 A;  2VGN A;  1VQN F;  4TZZ A;  1VQ5 F;  3CCU F;  1YHQ F;  2OZB A;  5G4V C;  3VMF B;  1RA4 A;  4EI7 A;  5HY2 A;  2QA4 F;  2ALE A;  3NVK E;  5HY0 A;  3CCQ F;  2F9Z C;  4BVQ A;  5GAP K;  3LWQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...