3CPWF

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cpwF00
1YITF 3CXCF 3CD6F 1K8AH 1YJ9F 3J81M 2LBWA 3CPQA 1QVGF 2QI2A 3O85A 2AIFA 1KQSF 3J7AR 3FFMA 3NK7A 1X7OA 3G4SF 3V7EA 1SDSA 1T0KB 1CN7A 3IR9A 4NUTA 5GINC 3CMEF 3CC2F 1VQLF 5DCVA 2JNBA 1NMUB 1RA4A 3CC4F 1YJWF 1QVFF 5GIPC 1YI2F 2I6DA 3JCMM 3MCAB 3LWPC 1W41A 1YIJF 1VQKF 3HJWC 3N4ZA 5GANK 1YHQF 3CCLF 3CCMF 1IPAA 1VQ7F 3SIVA 2HVYD 5EWRA 1JJ2F 1E7KA 1K73H 1DT9A 5GAPK 2WALA 3VI6A 3E20B 3VMFB 1N8RH 1PXWA 1VQ6F 5EO3A 4BW0B 3SIUA 3NK6A 1ZWZA 3LWOC 1NJIH 3CCUF 1XBIA 3LWRC 2ALEA 3CPWF 3N4YA 4C4WC 2KTVA 3V7QA 1X52A 2OTLF 2KG4A 3OW2F 4BY9D 5G4VC 3GYQA 5A2QM 2CZWA 3I55F 1GZ0A 3I56F 3LWQC 2KTUA 3AGKA 1M90H 1H7MA 3CG6A 1Q82H 1VQNF 1Q81H 1KD1H 5FJ4C 1VQ9F 1VQ8F 3G71F 2QEXF 2LBXA 2QA4F 1Q86H 3J80M 3CC7F 3NVKE 1RLGA 1KC8H 5G4UC 1VQPF 1W42A 4LCKA 2OHWA 3G6EF 3CCSF 5IT9M 1GO0A 3OBYA 3CMAF 1S72F 1W2BF 5GIOC 4X3LA 1K9MH 1W3EX 3CCRF 3RA5A 1VQ5F 1VQ4F 2FC3A 3HAXD 3LFOA 3LWVC 1W40A 1YJNF 2OZBA 4TZZA 1Q7YH 2VGNA 2VGMA 3NVIB 2OTJF 2BO1A 4X3MA 3ON1A 1X7PA 3CCQF 3E1YA 3RA6A 3CCVF 1CK2A 3PLAC 3NMUC 3CCEF 1VQMF 1GO1A 3OBWA 1VQOF 3PAFA 5FLXM 3JAMM 3WXMB 3CCJF 1M1KH
chains in the Genus database with same CATH superfamily
4DXDA 3QHDA 2G9IA 3CXCF 3VO8A 1K8AH 3VTIC 2YYEA 5LOVA 3HKEB 3CPQA 4B5CA 4BT7A 2UYKA 3OONA 4I4TB 3O85A 5EYPB 3K14A 3NK7A 3P4EA 3G4SF 2RHHA 1SDSA 1T0KB 2Z1UA 4LNUB 4NUTA 5GINC 3CMEF 3WJPA 5DCVA 3JALA 2PMPA 5CA1B 1JN1A 3K0TA 3S03A 1YI2F 1IV4A 4ZHQA 3WGMA 4X1KA 3CCLF 1IPAA 5EAZA 3CYPB 2HVYD 4O4JB 4C81A 3C9TA 2I6RA 3VI6A 4X1YA 3N2GB 4C8IA 3VMFB 5JQGB 5J2UA 2Q1YA 4G4XA 1PXWA 4BVSA 3SIUA 5LOVB 2P6YA 3NK6A 3WJQA 2V9YA 3U0OA 1X25A 3C8LA 3V7QA 4G88A 3I3FA 3F0EA 5EB1B 2CWJA 3GYQA 4X1IA 3VOAA 3JALB 2ZAUA 1XHOA 5GONA 5HXUA 3IKFA 1M90H 2IQQA 5HY4A 4F6RA 3B6NA 2Z1EA 5J2TA 1Q82H 3MBMA 4BVRA 4FFBA 1COMA 2HS4A 3F0DA 4ZHQB 1FNKA 2ZOVA 1R1MA 4IHJA 4X1KB 1W55A 1VQ8F 5HY2A 2QA4F 1Q86H 4O4HB 3VCZA 4G4YA 1RLUA 4X1YB 5LA6A 4PWTA 1W5BA 5J2UB 3KHNA 2RHJA 3RA5A 5AVMA 1YQNA 2GLZA 3HKBA 4X20A 3LFOA 5LP6A 1W40A 3RYFB 3JAKA 2VGNA 1W59A 2H8CA 3KE1A 3E22B 5IJ9A 4EB6A 2BO1A 3ON1A 1X7PA 5LYJA 3CCQF 3ESJA 1JFFA 1U3LA 2ZVYA 4X1IB 4R40B 1QAHA 2HRYA 3IMPA 5GONB 4I4TA 3PAFA 5MN6A 3S06A 5J2TB 5HP8A 1M1KH 3S0HA 3GHZA 2BTUA 4FFBB 5HP7A 1IV3A 4IHJB 1W5EA 1YITF 3QTYA 1YJ9F 4IIJA 3J81M 1CLIA 2QI2A 3JASB 1KQSF 1JY8A 1H48A 3T80A 4EI9A 1CN7A 2EWCA 3S0YA 2JNBA 1NMUB 3HKBB 4X20B 3JATB 5LP6B 3D54A 3CC4F 3UT5A 1YJWF 2UYPA 5GIPC 4TV9B 2I6DA 3MQWA 3LWPC 1OFUA 1YIJF 1VQKF 5LYJB 5JQGA 1JFFB 4O4IA 3CCMF 1VQ7F 3WGLA 2LBTA 3HWUA 1DBFA 5EWRA 3RE3A 2WALA 3ZO8A 1N8RH 1VQ6F 5EO3A 2VXYA 4IIJB 4TV8A 4RHAA 4BT2A 4B45A 1H47A 5HY0A 1ZWZA 1XRGA 2AMTA 1SZQA 1T0AA 4EI8A 1VH8A 4O4LA 5JCOA 3F0GA 3KJJA 3TD3A 2OTLF 2KG4A 4BY9D 1VK3A 2K1SA 3UT5B 4B62A 3I55F 1U40A 1GZ0A 5EB0A 3WGKA 4U39A 2OTMA 4O2BA 4O4HA 4YJ2B 1FNJA 1OAPA 1GX1A 4C8EA 3RYCA 1VQ9F 2LBXA 3C9UA 4O4IB 1VQVA 5HXZA 2F9ZC 1RLGA 1VHAA 3RYFA 1W42A 2UYNA 2ZODA 3CCSF 2DT4A 4X3LA 3WJRA 1K9MH 3E22A 3HTNA 1VQ4F 2FC3A 1Z5VA 4TV8B 4U3JB 1SA0B 1YJNF 3FD6A 4ZHWA 4O4LB 2BTQB 3ZP4A 4G4WA 4ZOLA 3FBAA 4X3MA 3MDOA 3FPIA 3IEWA 1QD9A 1U43A 5EZYA 5IYZB 2UZHA 2Z1FA 4O2BB 1W5FA 3JASA 5IJ0A 3JAMM 1W5AA 2PHNA 3WXMB 1UFYA 3RYCB 3WGNA 3JATA 3HKDB 2UYNB 1QU9A 1TUBA 3TD5A 4TV9A 3KJKA 3IR9A 3R0PA 1VQLF 3CC2F 1KNJA 5CA0A 4HNAA 4NWOB 2B33A 2CHTA 5CB4A 3JCMM 2L26A 3L7QA 3QUWA 4I55B 4ZOLB 3HJWC 3ZP7A 5GANK 1YHQF 2IAFA 3LYBA 1YGYA 5EZYB 3VIUA 3SIVA 1IV1A 3IKEA 3M1XA 3WGJA 5KX5B 1JJ2F 1E7KA 1RQ2A 1DT9A 4ZI7B 5IJ0B 5GAPK 3P0ZA 4RQOA 1FFXB 2KGWA 4ZHVA 2W8BC 2CVLA 1KNKA 2RB9A 2RHOA 3LWOC 1NJIH 2HS3A 3IEQA 3C9RA 1TUBB 2Z1TA 3MCQA 2ALEA 3DDNA 4YJ2A 3CPWF 4WBNA 3HKCA 5LP6C 5MN5A 3CB2A 3N2KB 5A2QM 2N48A 4HNAB 5CA0B 2CZWA 3D01A 5ITZA 3LWQC 1U3PA 3C9SA 4I50A 5CB4B 3AGKA 2HP3A 1H7MA 3V4DA 3CG6A 3LDTA 4YJ3A 1Q81H 2H6LA 2VAWA 1KD1H 5FJ4C 4C82A 5B8FA 2QEXF 1TVKB 3J80M 3S02A 1KC8H 1VQPF 4NQ3A 4U3JA 3VOBA 1SA0A 2ZF8A 3JVHA 5IT9M 5FNVB 3OBYA 3CMAF 1S72F 1W2BF 3LMEA 1W3EX 3WPWA 1XV2A 2HX0A 3V3TA 3HAXD 5BMVA 4G4ZA 3EORA 5IYZA 2HRUA 1Q7YH 4B46A 2DYYA 3NVIB 2OTJF 4WBNB 3HKCB 1PF5A 3E1YA 3D00A 3CCVF 1CK2A 3I7TA 4TUYB 3PLAC 3JARA 3CCEF 3NMUC 2NMUA 3HKDA 5LXTA 5ITZB 4I50B 3RYHA 4YJ3B 1JD1A 4BT5A 5C8YA 4BT6A 2HS0A 2CW4A 5HY1A 3CD6F 2LBWA 1Z5WA 1UI9A 4ZK7A 1QVGF 3J7AR 2AIFA 3FFMA 2VAMA 2BTOA 1X7OA 3V7EA 3DC2A 2Z01A 1ONIA 4I55A 3RYIA 1RA4A 3F6MA 5BMVB 1QVFF 4XCQA 5KMGA 1NQ3A 5JCOC 4O2AA 5KX5A 4EI7A 3MCAB 4ZI7A 1W41A 2IG8A 5HWEA 1FFXA 3K12A 3N4ZA 5JH7A 3F0FA 3FD5A 3JARB 5JVDA 2VAPA 5LXTB 5MN4A 2ZVZA 1K73H 3RYHB 2R751 5C8YB 3E20B 1W57A 4BW0B 3M84A 3N2KA 4ERHA 3M4SA 3S0WA 1Q8RA 2CSLA 3P10A 3CCUF 1XBIA 3ZOPA 4DRXA 3LWRC 5EIBD 3N4YA 4C4WC 2KTVA 2MQEA 1X52A 3RYIB 2HP0A 2FGYA 3OW2F 5G4VC 2LCAA 4G4VA 1TVKA 5KMGB 3CYQA 2GVIA 2HQSC 4O2AB 4ZHYB 3VYTC 3I56F 2RHLA 2KTUA 3ELCA 3GTZA 3JAWA 1VQNF 5FNVA 4BVQA 5JH7B 2H8EA 3G71F 3CC7F 3NVKE 3HKEA 2R6R1 2AIZP 5JVDB 5G4UC 3VYSC 2Q1XA 3Q8HA 5EYPA 4LCKA 2OHWA 2QTPA 3G6EF 4F6RB 4BT3A 1GO0A 3BYQA 5GIOC 4BVTA 2UYJA 4LNUA 3CCRF 1VQ5F 3VYUC 3LWVC 3KIZA 4TUYA 2OZBA 2CHSA 2GZLA 5CA1A 4TZZA 4KWEA 5LA6B 2VGMA 3K2XA 4DRXB 4C8GA 1J7HA 1FSZA 2HP0B 3RA6A 1ODEA 5IJ9B 1RQ7A 4BT4A 2YXZA 4M8IA 3ERNA 3JAKB 4O4JA 1VQMF 1GO1A 3OBWA 4E6EA 1VQOF 5EIBC 3TD4A 1IV2A 3WPXA 5FLXM 3JAWB 4EB6B 3CCJF 1W581 3N2GA
chains in the Genus database with same CATH topology
1YITF 5HY1A 3CXCF 3CD6F 1K8AH 1YJ9F 3J81M 2LBWA 3CPQA 1QVGF 2QI2A 3O85A 2AIFA 1KQSF 3J7AR 3FFMA 3NK7A 4EI9A 1X7OA 3G4SF 3V7EA 1SDSA 1T0KB 1CN7A 3IR9A 4NUTA 5GINC 3CMEF 3CC2F 1VQLF 5DCVA 2JNBA 1NMUB 1RA4A 3CC4F 1YJWF 1QVFF 4XCQA 5GIPC 1YI2F 2I6DA 3JCMM 4EI7A 3MCAB 3LWPC 1W41A 1YIJF 1VQKF 3HJWC 5HWEA 3N4ZA 5GANK 1YHQF 3CCLF 3CCMF 1IPAA 1VQ7F 3SIVA 2HVYD 5EWRA 1JJ2F 1E7KA 1K73H 1DT9A 5GAPK 2WALA 3VI6A 3E20B 3VMFB 1N8RH 1PXWA 1VQ6F 5EO3A 4BVSA 4BW0B 3SIUA 5HY0A 3NK6A 1ZWZA 3LWOC 1NJIH 3CCUF 4EI8A 1XBIA 3LWRC 2ALEA 3CPWF 3N4YA 4C4WC 2KTVA 3V7QA 1X52A 2OTLF 2KG4A 2FGYA 3OW2F 5G4VC 4BY9D 3GYQA 5A2QM 2CZWA 3I55F 1GZ0A 3I56F 3LWQC 5HXUA 2KTUA 3AGKA 1M90H 1H7MA 5HY4A 3CG6A 1Q82H 1VQNF 4BVQA 4BVRA 1Q81H 1KD1H 5FJ4C 1VQ9F 1VQ8F 3G71F 2QEXF 2LBXA 5HY2A 2QA4F 3J80M 1Q86H 3CC7F 5HXZA 3NVKE 2F9ZC 1RLGA 1KC8H 5G4UC 1VQPF 1W42A 4NQ3A 4LCKA 2OHWA 3G6EF 3CCSF 5IT9M 1GO0A 3OBYA 3CMAF 1S72F 1W2BF 5GIOC 4X3LA 1K9MH 1W3EX 4BVTA 3CCRF 3RA5A 1VQ5F 1VQ4F 3V3TA 2FC3A 2GLZA 3HAXD 3LFOA 3LWVC 1W40A 1YJNF 2OZBA 4TZZA 1Q7YH 2VGNA 2VGMA 3NVIB 2OTJF 2BO1A 4X3MA 3ON1A 1X7PA 3CCQF 3E1YA 3D00A 3RA6A 3CCVF 1CK2A 3PLAC 3NMUC 3CCEF 1VQMF 1GO1A 3OBWA 1VQOF 3PAFA 5FLXM 3JAMM 3WXMB 3CCJF 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT F;  3CXC F;  3CD6 F;  1K8A H;  1YJ9 F;  3J81 M;  2LBW A;  3CPQ A;  1QVG F;  2QI2 A;  3O85 A;  2AIF A;  1KQS F;  3J7A R;  3FFM A;  3NK7 A;  1X7O A;  3G4S F;  3V7E A;  1SDS A;  1T0K B;  1CN7 A;  3IR9 A;  4NUT A;  5GIN C;  3CME F;  3CC2 F;  1VQL F;  5DCV A;  2JNB A;  1NMU B;  1RA4 A;  3CC4 F;  1YJW F;  1QVF F;  5GIP C;  1YI2 F;  2I6D A;  3JCM M;  3MCA B;  3LWP C;  1W41 A;  1YIJ F;  1VQK F;  3HJW C;  3N4Z A;  5GAN K;  1YHQ F;  3CCL F;  3CCM F;  1IPA A;  1VQ7 F;  3SIV A;  2HVY D;  5EWR A;  1JJ2 F;  1E7K A;  1K73 H;  1DT9 A;  5GAP K;  2WAL A;  3VI6 A;  3E20 B;  3VMF B;  1N8R H;  1PXW A;  1VQ6 F;  5EO3 A;  4BW0 B;  3SIU A;  3NK6 A;  1ZWZ A;  3LWO C;  1NJI H;  3CCU F;  1XBI A;  3LWR C;  2ALE A;  3CPW F;  3N4Y A;  4C4W C;  2KTV A;  3V7Q A;  1X52 A;  2OTL F;  2KG4 A;  3OW2 F;  4BY9 D;  5G4V C;  3GYQ A;  5A2Q M;  2CZW A;  3I55 F;  1GZ0 A;  3I56 F;  3LWQ C;  2KTU A;  3AGK A;  1M90 H;  1H7M A;  3CG6 A;  1Q82 H;  1VQN F;  1Q81 H;  1KD1 H;  5FJ4 C;  1VQ9 F;  1VQ8 F;  3G71 F;  2QEX F;  2LBX A;  2QA4 F;  1Q86 H;  3J80 M;  3CC7 F;  3NVK E;  1RLG A;  1KC8 H;  5G4U C;  1VQP F;  1W42 A;  4LCK A;  2OHW A;  3G6E F;  3CCS F;  5IT9 M;  1GO0 A;  3OBY A;  3CMA F;  1S72 F;  1W2B F;  5GIO C;  4X3L A;  1K9M H;  1W3E X;  3CCR F;  3RA5 A;  1VQ5 F;  1VQ4 F;  2FC3 A;  3HAX D;  3LFO A;  3LWV C;  1W40 A;  1YJN F;  2OZB A;  4TZZ A;  1Q7Y H;  2VGN A;  2VGM A;  3NVI B;  2OTJ F;  2BO1 A;  4X3M A;  3ON1 A;  1X7P A;  3CCQ F;  3E1Y A;  3RA6 A;  3CCV F;  1CK2 A;  3PLA C;  3NMU C;  3CCE F;  1VQM F;  1GO1 A;  3OBW A;  1VQO F;  3PAF A;  5FLX M;  3JAM M;  3WXM B;  3CCJ F;  1M1K H; 
#chains in the Genus database with same CATH topology
 4DXD A;  3QHD A;  2G9I A;  3CXC F;  3VO8 A;  1K8A H;  3VTI C;  2YYE A;  5LOV A;  3HKE B;  3CPQ A;  4B5C A;  4BT7 A;  2UYK A;  3OON A;  4I4T B;  3O85 A;  5EYP B;  3K14 A;  3NK7 A;  3P4E A;  3G4S F;  2RHH A;  1SDS A;  1T0K B;  2Z1U A;  4LNU B;  4NUT A;  5GIN C;  3CME F;  3WJP A;  5DCV A;  3JAL A;  2PMP A;  5CA1 B;  1JN1 A;  3K0T A;  3S03 A;  1YI2 F;  1IV4 A;  4ZHQ A;  3WGM A;  4X1K A;  3CCL F;  1IPA A;  5EAZ A;  3CYP B;  2HVY D;  4O4J B;  4C81 A;  3C9T A;  2I6R A;  3VI6 A;  4X1Y A;  3N2G B;  4C8I A;  3VMF B;  5JQG B;  5J2U A;  2Q1Y A;  4G4X A;  1PXW A;  4BVS A;  3SIU A;  5LOV B;  2P6Y A;  3NK6 A;  3WJQ A;  2V9Y A;  3U0O A;  1X25 A;  3C8L A;  3V7Q A;  4G88 A;  3I3F A;  3F0E A;  5EB1 B;  2CWJ A;  3GYQ A;  4X1I A;  3VOA A;  3JAL B;  2ZAU A;  1XHO A;  5GON A;  5HXU A;  3IKF A;  1M90 H;  2IQQ A;  5HY4 A;  4F6R A;  3B6N A;  2Z1E A;  5J2T A;  1Q82 H;  3MBM A;  4BVR A;  4FFB A;  1COM A;  2HS4 A;  3F0D A;  4ZHQ B;  1FNK A;  2ZOV A;  1R1M A;  4IHJ A;  4X1K B;  1W55 A;  1VQ8 F;  5HY2 A;  2QA4 F;  1Q86 H;  4O4H B;  3VCZ A;  4G4Y A;  1RLU A;  4X1Y B;  5LA6 A;  4PWT A;  1W5B A;  5J2U B;  3KHN A;  2RHJ A;  3RA5 A;  5AVM A;  1YQN A;  2GLZ A;  3HKB A;  4X20 A;  3LFO A;  5LP6 A;  1W40 A;  3RYF B;  3JAK A;  2VGN A;  1W59 A;  2H8C A;  3KE1 A;  3E22 B;  5IJ9 A;  4EB6 A;  2BO1 A;  3ON1 A;  1X7P A;  5LYJ A;  3CCQ F;  3ESJ A;  1JFF A;  1U3L A;  2ZVY A;  4X1I B;  4R40 B;  1QAH A;  2HRY A;  3IMP A;  5GON B;  4I4T A;  3PAF A;  5MN6 A;  3S06 A;  5J2T B;  5HP8 A;  1M1K H;  3S0H A;  3GHZ A;  2BTU A;  4FFB B;  5HP7 A;  1IV3 A;  4IHJ B;  1W5E A;  1YIT F;  3QTY A;  1YJ9 F;  4IIJ A;  3J81 M;  1CLI A;  2QI2 A;  3JAS B;  1KQS F;  1JY8 A;  1H48 A;  3T80 A;  4EI9 A;  1CN7 A;  2EWC A;  3S0Y A;  2JNB A;  1NMU B;  3HKB B;  4X20 B;  3JAT B;  5LP6 B;  3D54 A;  3CC4 F;  3UT5 A;  1YJW F;  2UYP A;  5GIP C;  4TV9 B;  2I6D A;  3MQW A;  3LWP C;  1OFU A;  1YIJ F;  1VQK F;  5LYJ B;  5JQG A;  1JFF B;  4O4I A;  3CCM F;  1VQ7 F;  3WGL A;  2LBT A;  3HWU A;  1DBF A;  5EWR A;  3RE3 A;  2WAL A;  3ZO8 A;  1N8R H;  1VQ6 F;  5EO3 A;  2VXY A;  4IIJ B;  4TV8 A;  4RHA A;  4BT2 A;  4B45 A;  1H47 A;  5HY0 A;  1ZWZ A;  1XRG A;  2AMT A;  1SZQ A;  1T0A A;  4EI8 A;  1VH8 A;  4O4L A;  5JCO A;  3F0G A;  3KJJ A;  3TD3 A;  2OTL F;  2KG4 A;  4BY9 D;  1VK3 A;  2K1S A;  3UT5 B;  4B62 A;  3I55 F;  1U40 A;  1GZ0 A;  5EB0 A;  3WGK A;  4U39 A;  2OTM A;  4O2B A;  4O4H A;  4YJ2 B;  1FNJ A;  1OAP A;  1GX1 A;  4C8E A;  3RYC A;  1VQ9 F;  2LBX A;  3C9U A;  4O4I B;  1VQV A;  5HXZ A;  2F9Z C;  1RLG A;  1VHA A;  3RYF A;  1W42 A;  2UYN A;  2ZOD A;  3CCS F;  2DT4 A;  4X3L A;  3WJR A;  1K9M H;  3E22 A;  3HTN A;  1VQ4 F;  2FC3 A;  1Z5V A;  4TV8 B;  4U3J B;  1SA0 B;  1YJN F;  3FD6 A;  4ZHW A;  4O4L B;  2BTQ B;  3ZP4 A;  4G4W A;  4ZOL A;  3FBA A;  4X3M A;  3MDO A;  3FPI A;  3IEW A;  1QD9 A;  1U43 A;  5EZY A;  5IYZ B;  2UZH A;  2Z1F A;  4O2B B;  1W5F A;  3JAS A;  5IJ0 A;  3JAM M;  1W5A A;  2PHN A;  3WXM B;  1UFY A;  3RYC B;  3WGN A;  3JAT A;  3HKD B;  2UYN B;  1QU9 A;  1TUB A;  3TD5 A;  4TV9 A;  3KJK A;  3IR9 A;  3R0P A;  1VQL F;  3CC2 F;  1KNJ A;  5CA0 A;  4HNA A;  4NWO B;  2B33 A;  2CHT A;  5CB4 A;  3JCM M;  2L26 A;  3L7Q A;  3QUW A;  4I55 B;  4ZOL B;  3HJW C;  3ZP7 A;  5GAN K;  1YHQ F;  2IAF A;  3LYB A;  1YGY A;  5EZY B;  3VIU A;  3SIV A;  1IV1 A;  3IKE A;  3M1X A;  3WGJ A;  5KX5 B;  1JJ2 F;  1E7K A;  1RQ2 A;  1DT9 A;  4ZI7 B;  5IJ0 B;  5GAP K;  3P0Z A;  4RQO A;  1FFX B;  2KGW A;  4ZHV A;  2W8B C;  2CVL A;  1KNK A;  2RB9 A;  2RHO A;  3LWO C;  1NJI H;  2HS3 A;  3IEQ A;  3C9R A;  1TUB B;  2Z1T A;  3MCQ A;  2ALE A;  3DDN A;  4YJ2 A;  3CPW F;  4WBN A;  3HKC A;  5LP6 C;  5MN5 A;  3CB2 A;  3N2K B;  5A2Q M;  2N48 A;  4HNA B;  5CA0 B;  2CZW A;  3D01 A;  5ITZ A;  3LWQ C;  1U3P A;  3C9S A;  4I50 A;  5CB4 B;  3AGK A;  2HP3 A;  1H7M A;  3V4D A;  3CG6 A;  3LDT A;  4YJ3 A;  1Q81 H;  2H6L A;  2VAW A;  1KD1 H;  5FJ4 C;  4C82 A;  5B8F A;  2QEX F;  1TVK B;  3J80 M;  3S02 A;  1KC8 H;  1VQP F;  4NQ3 A;  4U3J A;  3VOB A;  1SA0 A;  2ZF8 A;  3JVH A;  5IT9 M;  5FNV B;  3OBY A;  3CMA F;  1S72 F;  1W2B F;  3LME A;  1W3E X;  3WPW A;  1XV2 A;  2HX0 A;  3V3T A;  3HAX D;  5BMV A;  4G4Z A;  3EOR A;  5IYZ A;  2HRU A;  1Q7Y H;  4B46 A;  2DYY A;  3NVI B;  2OTJ F;  4WBN B;  3HKC B;  1PF5 A;  3E1Y A;  3D00 A;  3CCV F;  1CK2 A;  3I7T A;  4TUY B;  3PLA C;  3JAR A;  3CCE F;  3NMU C;  2NMU A;  3HKD A;  5LXT A;  5ITZ B;  4I50 B;  3RYH A;  4YJ3 B;  1JD1 A;  4BT5 A;  5C8Y A;  4BT6 A;  2HS0 A;  2CW4 A;  5HY1 A;  3CD6 F;  2LBW A;  1Z5W A;  1UI9 A;  4ZK7 A;  1QVG F;  3J7A R;  2AIF A;  3FFM A;  2VAM A;  2BTO A;  1X7O A;  3V7E A;  3DC2 A;  2Z01 A;  1ONI A;  4I55 A;  3RYI A;  1RA4 A;  3F6M A;  5BMV B;  1QVF F;  4XCQ A;  5KMG A;  1NQ3 A;  5JCO C;  4O2A A;  5KX5 A;  4EI7 A;  3MCA B;  4ZI7 A;  1W41 A;  2IG8 A;  5HWE A;  1FFX A;  3K12 A;  3N4Z A;  5JH7 A;  3F0F A;  3FD5 A;  3JAR B;  5JVD A;  2VAP A;  5LXT B;  5MN4 A;  2ZVZ A;  1K73 H;  3RYH B;  2R75 1;  5C8Y B;  3E20 B;  1W57 A;  4BW0 B;  3M84 A;  3N2K A;  4ERH A;  3M4S A;  3S0W A;  1Q8R A;  2CSL A;  3P10 A;  3CCU F;  1XBI A;  3ZOP A;  4DRX A;  3LWR C;  5EIB D;  3N4Y A;  4C4W C;  2KTV A;  2MQE A;  1X52 A;  3RYI B;  2HP0 A;  2FGY A;  3OW2 F;  5G4V C;  2LCA A;  4G4V A;  1TVK A;  5KMG B;  3CYQ A;  2GVI A;  2HQS C;  4O2A B;  4ZHY B;  3VYT C;  3I56 F;  2RHL A;  2KTU A;  3ELC A;  3GTZ A;  3JAW A;  1VQN F;  5FNV A;  4BVQ A;  5JH7 B;  2H8E A;  3G71 F;  3CC7 F;  3NVK E;  3HKE A;  2R6R 1;  2AIZ P;  5JVD B;  5G4U C;  3VYS C;  2Q1X A;  3Q8H A;  5EYP A;  4LCK A;  2OHW A;  2QTP A;  3G6E F;  4F6R B;  4BT3 A;  1GO0 A;  3BYQ A;  5GIO C;  4BVT A;  2UYJ A;  4LNU A;  3CCR F;  1VQ5 F;  3VYU C;  3LWV C;  3KIZ A;  4TUY A;  2OZB A;  2CHS A;  2GZL A;  5CA1 A;  4TZZ A;  4KWE A;  5LA6 B;  2VGM A;  3K2X A;  4DRX B;  4C8G A;  1J7H A;  1FSZ A;  2HP0 B;  3RA6 A;  1ODE A;  5IJ9 B;  1RQ7 A;  4BT4 A;  2YXZ A;  4M8I A;  3ERN A;  3JAK B;  4O4J A;  1VQM F;  1GO1 A;  3OBW A;  4E6E A;  1VQO F;  5EIB C;  3TD4 A;  1IV2 A;  3WPX A;  5FLX M;  3JAW B;  4EB6 B;  3CCJ F;  1W58 1;  3N2G A; 
#chains in the Genus database with same CATH homology
 1YIT F;  5HY1 A;  3CXC F;  3CD6 F;  1K8A H;  1YJ9 F;  3J81 M;  2LBW A;  3CPQ A;  1QVG F;  2QI2 A;  3O85 A;  2AIF A;  1KQS F;  3J7A R;  3FFM A;  3NK7 A;  4EI9 A;  1X7O A;  3G4S F;  3V7E A;  1SDS A;  1T0K B;  1CN7 A;  3IR9 A;  4NUT A;  5GIN C;  3CME F;  3CC2 F;  1VQL F;  5DCV A;  2JNB A;  1NMU B;  1RA4 A;  3CC4 F;  1YJW F;  1QVF F;  4XCQ A;  5GIP C;  1YI2 F;  2I6D A;  3JCM M;  4EI7 A;  3MCA B;  3LWP C;  1W41 A;  1YIJ F;  1VQK F;  3HJW C;  5HWE A;  3N4Z A;  5GAN K;  1YHQ F;  3CCL F;  3CCM F;  1IPA A;  1VQ7 F;  3SIV A;  2HVY D;  5EWR A;  1JJ2 F;  1E7K A;  1K73 H;  1DT9 A;  5GAP K;  2WAL A;  3VI6 A;  3E20 B;  3VMF B;  1N8R H;  1PXW A;  1VQ6 F;  5EO3 A;  4BVS A;  4BW0 B;  3SIU A;  5HY0 A;  3NK6 A;  1ZWZ A;  3LWO C;  1NJI H;  3CCU F;  4EI8 A;  1XBI A;  3LWR C;  2ALE A;  3CPW F;  3N4Y A;  4C4W C;  2KTV A;  3V7Q A;  1X52 A;  2OTL F;  2KG4 A;  2FGY A;  3OW2 F;  5G4V C;  4BY9 D;  3GYQ A;  5A2Q M;  2CZW A;  3I55 F;  1GZ0 A;  3I56 F;  3LWQ C;  5HXU A;  2KTU A;  3AGK A;  1M90 H;  1H7M A;  5HY4 A;  3CG6 A;  1Q82 H;  1VQN F;  4BVQ A;  4BVR A;  1Q81 H;  1KD1 H;  5FJ4 C;  1VQ9 F;  1VQ8 F;  3G71 F;  2QEX F;  2LBX A;  5HY2 A;  2QA4 F;  3J80 M;  1Q86 H;  3CC7 F;  5HXZ A;  3NVK E;  2F9Z C;  1RLG A;  1KC8 H;  5G4U C;  1VQP F;  1W42 A;  4NQ3 A;  4LCK A;  2OHW A;  3G6E F;  3CCS F;  5IT9 M;  1GO0 A;  3OBY A;  3CMA F;  1S72 F;  1W2B F;  5GIO C;  4X3L A;  1K9M H;  1W3E X;  4BVT A;  3CCR F;  3RA5 A;  1VQ5 F;  1VQ4 F;  3V3T A;  2FC3 A;  2GLZ A;  3HAX D;  3LFO A;  3LWV C;  1W40 A;  1YJN F;  2OZB A;  4TZZ A;  1Q7Y H;  2VGN A;  2VGM A;  3NVI B;  2OTJ F;  2BO1 A;  4X3M A;  3ON1 A;  1X7P A;  3CCQ F;  3E1Y A;  3D00 A;  3RA6 A;  3CCV F;  1CK2 A;  3PLA C;  3NMU C;  3CCE F;  1VQM F;  1GO1 A;  3OBW A;  1VQO F;  3PAF A;  5FLX M;  3JAM M;  3WXM B;  3CCJ F;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...