3K2XA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
154
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 51
structure length 154
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3k2xA00
3F0FA 3IEQA 5B8FA 3EORA 3RE3A 3F0GA 1KNKA 2UZHA 1W57A 1U3PA 1U40A 3F0EA 3KE1A 4C8EA 1JY8A 4C82A 3F0DA 1IV4A 1IV3A 1YQNA 3Q8HA 3QHDA 3IKFA 4C8GA 3F6MA 1VHAA 2AMTA 1H47A 4C8IA 1GX1A 3JVHA 3MBMA 3B6NA 1U43A 3FPIA 3IKEA 3IEWA 3FBAA 1H48A 3ESJA 3ELCA 3K14A 3P10A 4C81A 1VH8A 3GHZA 1W55A 1KNJA 2GZLA 2PMPA 1IV1A 1U3LA 3ERNA 1JN1A 1T0AA 3T80A 1IV2A 3K2XA 3P0ZA
chains in the Genus database with same CATH superfamily
4E6EA 3I7TA 5HWEA 3HWUA 2ZF8A 1OFUA 2HS0A 2VAWA 5MN4A 3Q8HA 3WGLA 1E7KA 1JD1A 3MCQA 1VHAA 1PXWA 3VO8A 5BMVB 3DC2A 3FPIA 4B45A 4O2BA 4EI9A 4NWOB 3WJQA 2V9YA 3JAMM 3ESJA 5GINC 3DDNA 3P10A 2GZLA 3JARA 1YJ9F 1QD9A 1IV2A 1CLIA 4IIJB 3ON1A 1Z5VA 2CSLA 3IEQA 5LP6B 4TV9B 3LWRC 3JALA 2Z1EA 3ZP4A 4YJ2B 2Q1YA 5GIOC 1U40A 4ZHQB 5LOVA 3ZO8A 4U3JB 4X1KA 4TUYB 4X1YB 1W2BF 4X1IB 2BTOA 5FLXM 2GVIA 3E1YA 5DCVA 3IMPA 3CCSF 3CB2A 2Z1TA 3J81M 2Z01A 4O4LB 3FBAA 3VCZA 1YHQF 2KTVA 5ITZB 3WJRA 4LNUA 5JCOC 3LWQC 1VQ8F 4BVSA 5EO3A 2LBWA 4BVRA 2KGWA 5J2UB 5EWRA 3LFOA 1VQVA 3WJPA 3LWPC 3CC7F 3JATB 1IPAA 2YYEA 3CG6A 2QTPA 3S06A 5JH7B 1ODEA 5GONB 4X20B 1K9MH 1VQ7F 1W5AA 4EI7A 2OHWA 3JAWB 5LXTA 3M84A 3M1XA 3S0HA 2R6R1 3E20B 1YI2F 3VYUC 3NK7A 3EORA 2CZWA 2UZHA 1JFFA 3D00A 4ZOLA 3FD5A 2L26A 3CCMF 1VQLF 1FNKA 4O4HB 3HKEA 3HKDA 4I50B 4BW0B 5IYZB 2AMTA 5EB0A 3PAFA 5CA0A 4G4YA 2OTMA 4WBNA 3HJWC 5MN6A 5G4VC 1VQOF 2ZAUA 2PMPA 2LBTA 1YIJF 3QUWA 3VYSC 4O4IA 2UYPA 4ZK7A 4DRXB 1QVGF 5IT9M 3LDTA 3RE3A 3C9UA 2AIFA 5FNVB 4XCQA 3SIUA 5C8YA 1M90H 3WGKA 1W5BA 3D01A 2F9ZC 1W41A 3V4DA 3CCLF 2I6RA 5KX5A 2YXZA 3V7QA 5CA1B 2PHNA 1RQ2A 3CYPB 5EYPB 2RHHA 3K14A 2QEXF 1W42A 3E22A 5EZYB 5HY2A 4G4ZA 5LOVB 1TVKB 3L7QA 4TV8B 2IG8A 3I55F 5KX5B 4C8EA 3CC2F 4BT4A 3UT5A 4NQ3A 3C9TA 4IHJB 3RYFB 3QHDA 4IIJA 1DBFA 3MDOA 4YJ3A 4TZZA 5LP6C 4B46A 2OTLF 4I4TA 4O4JA 3MBMA 5JQGB 3R0PA 2H8CA 1H48A 2HRYA 4B5CA 3VI6A 1KNJA 2QI2A 1SA0B 4G4WA 3WGNA 1T0AA 5BMVA 3SIVA 1S72F 3FD6A 3IR9A 1QAHA 2VGMA 4ZI7B 4ZHVA 2HRUA 1SA0A 3HAXD 3KJJA 3MCAB 4O4JB 3CCVF 5LXTB 3CD6F 4LNUB 3RYCB 3CXCF 3S02A 3JVHA 3NK6A 1SDSA 5JQGA 4ERHA 2QA4F 4ZHQA 2CVLA 2UYJA 2R751 5IJ9B 4C4WC 1UI9A 1VH8A 5GONA 5HP8A 3G6EF 5LP6A 2Z1FA 4BT2A 2HQSC 2B33A 2RHLA 1W40A 3F0FA 5JH7A 4TUYA 4X1YA 2ZODA 3F0GA 5CA0B 3NVKE 3VOBA 1Q81H 1COMA 1FSZA 4I50A 1ONIA 3JASB 2UYNB 1VQPF 3WXMB 3ZOPA 1OAPA 2ALEA 3HTNA 3HKDB 3HKEB 1GX1A 5HY1A 3CYQA 4BY9D 3B6NA 3N2GB 2KG4A 1Q7YH 4BVTA 5LA6B 2W8BC 2UYNA 4DXDA 3N4ZA 3LYBA 2VAMA 2EWCA 1PF5A 5FNVA 3WGMA 3JASA 4DRXA 3JAWA 2KTUA 3OW2F 1GO0A 5JCOA 3V7EA 4TV9A 4C82A 3E22B 2CWJA 1YQNA 3N2KA 3JATA 5JVDA 1W5EA 3N2GA 1H47A 2ZVYA 2ZVZA 1DT9A 1RA4A 3S0WA 4TV8A 1NMUB 4ZOLB 4FFBB 3ZP7A 5MN5A 1X7PA 4ZI7A 1RLGA 4O4HA 3GHZA 3C9RA 1X52A 2VAPA 1FFXA 3AGKA 1H7MA 1UFYA 5EZYA 1JFFB 3RYIB 5HY0A 3G71F 5ITZA 3RA6A 5HP7A 2IQQA 4U39A 2BTQB 3KIZA 1CK2A 2CHTA 3BYQA 3NMUC 5CB4B 3TD3A 1FFXB 3F0DA 2WALA 3LMEA 4I4TB 3VYTC 4RQOA 5LYJA 3KJKA 5A2QM 2K1SA 3N4YA 1W3EX 3JAKA 3OBYA 1VQMF 4O4IB 3O85A 1M1KH 4EB6B 3LWVC 3RYFA 1GO1A 1IV1A 2LCAA 3P0ZA 4LCKA 3WPXA 1Z5WA 5J2TA 1J7HA 1JJ2F 4RHAA 1W57A 4EI8A 5LYJB 1TVKA 1NJIH 2RHOA 3RYHB 4C8GA 4O4LA 3U0OA 5GANK 5CA1A 4ZHWA 1U43A 2OZBA 1R1MA 1TUBB 5JVDB 4BT6A 3VOAA 4F6RB 3J7AR 3T80A 2H8EA 5J2UA 3K2XA 3TD4A 5GAPK 5B8FA 4R40B 1YJWF 5IJ0A 5KMGB 1VQNF 1FNJA 1XHOA 1KNKA 3F0EA 3M4SA 3CMAF 3CCEF 3P4EA 4U3JA 4O2AA 3RYHA 1KD1H 3OBWA 4YJ2A 5HXZA 3GTZA 5IJ0B 5KMGA 3IKEA 4BVQA 3J80M 5LA6A 3TD5A 3JAKB 2GLZA 4X3MA 2HP3A 2AIZP 2MQEA 3CCRF 4HNAA 4BT7A 1N8RH 1X7OA 3HKBA 5AVMA 3K12A 5IYZA 2BTUA 3VTIC 3JARB 1IV4A 2DT4A 2H6LA 3KHNA 3QTYA 4YJ3B 3CPQA 3RA5A 3CCUF 1W5FA 4ZHYB 1QU9A 3D54A 1NQ3A 4IHJA 2IAFA 4X3LA 1RQ7A 1RLUA 4BT3A 3ELCA 4G4XA 4X20A 4FFBA 2HP0A 2HX0A 1K8AH 3VIUA 3CCQF 1VQKF 1KQSF 3FFMA 3C9SA 1Q8RA 2NMUA 3WPWA 2G9IA 5EAZA 5HXUA 1T0KB 3HKCA 3HKBB 3KE1A 1YJNF 1YGYA 3CMEF 5EIBC 2P6YA 1IV3A 5CB4A 1QVFF 4O2AB 4X1IA 4C8IA 3I56F 1YITF 4I55B 5EIBD 3MQWA 4PWTA 2VXYA 2RB9A 3G4SF 2CW4A 4BT5A 3OONA 1W55A 1X25A 4X1KB 3CPWF 2I6DA 2OTJF 1XBIA 1U3LA 3C8LA 2Q1XA 5EB1B 1GZ0A 1VK3A 2FC3A 5C8YB 3N2KB 1JY8A 5HY4A 2FGYA 2BO1A 4G4VA 3IKFA 1SZQA 3I3FA 1W59A 4O2BB 1XV2A 3JALB 4NUTA 1Q82H 1CN7A 2N48A 4I55A 1VQ9F 3IEWA 3WGJA 4HNAB 4F6RA 2Z1UA 3VMFB 4C81A 1TUBA 1ZWZA 3CC4F 3ERNA 1JN1A 3RYIA 2RHJA 2VGNA 3S03A 3RYCA 1VQ4F 5EYPA 3NVIB 2ZOVA 2HP0B 2LBXA 2HS4A 4G88A 2HVYD 1U3PA 3GYQA 5G4UC 1W581 3JCMM 2CHSA 3F6MA 3HKCB 4WBNB 5J2TB 1VQ6F 2JNBA 1VQ5F 3UT5B 5FJ4C 4KWEA 3CCJF 1Q86H 1K73H 4EB6A 3LWOC 2DYYA 4M8IA 5IJ9A 3S0YA 5GIPC 1XRGA 4B62A 3V3TA 2HS3A 2UYKA 1KC8H 3PLAC 3K0TA
chains in the Genus database with same CATH topology
3F0FA 3IEQA 5B8FA 3EORA 3RE3A 3F0GA 1KNKA 2UZHA 1W57A 1U3PA 1U40A 3F0EA 3KE1A 4C8EA 1JY8A 4C82A 3F0DA 1IV4A 1IV3A 1YQNA 3Q8HA 3QHDA 3IKFA 4C8GA 3F6MA 1VHAA 2AMTA 1H47A 4C8IA 1GX1A 3JVHA 3MBMA 3B6NA 1U43A 3FPIA 3IKEA 3IEWA 3FBAA 1H48A 3ESJA 3ELCA 3K14A 3P10A 4C81A 1VH8A 3GHZA 1W55A 1KNJA 2GZLA 2PMPA 1IV1A 1U3LA 3ERNA 1JN1A 1T0AA 3T80A 1IV2A 3K2XA 3P0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0F A;  3IEQ A;  5B8F A;  3EOR A;  3RE3 A;  3F0G A;  1KNK A;  2UZH A;  1W57 A;  1U3P A;  1U40 A;  3F0E A;  3KE1 A;  4C8E A;  1JY8 A;  4C82 A;  3F0D A;  1IV4 A;  1IV3 A;  1YQN A;  3Q8H A;  3QHD A;  3IKF A;  4C8G A;  3F6M A;  1VHA A;  2AMT A;  1H47 A;  4C8I A;  1GX1 A;  3JVH A;  3MBM A;  3B6N A;  1U43 A;  3FPI A;  3IKE A;  3IEW A;  3FBA A;  1H48 A;  3ESJ A;  3ELC A;  3K14 A;  3P10 A;  4C81 A;  1VH8 A;  3GHZ A;  1W55 A;  1KNJ A;  2GZL A;  2PMP A;  1IV1 A;  1U3L A;  3ERN A;  1JN1 A;  1T0A A;  3T80 A;  1IV2 A;  3K2X A;  3P0Z A; 
#chains in the Genus database with same CATH topology
 4E6E A;  3I7T A;  5HWE A;  3HWU A;  2ZF8 A;  1OFU A;  2HS0 A;  2VAW A;  5MN4 A;  3Q8H A;  3WGL A;  1E7K A;  1JD1 A;  3MCQ A;  1VHA A;  1PXW A;  3VO8 A;  5BMV B;  3DC2 A;  3FPI A;  4B45 A;  4O2B A;  4EI9 A;  4NWO B;  3WJQ A;  2V9Y A;  3JAM M;  3ESJ A;  5GIN C;  3DDN A;  3P10 A;  2GZL A;  3JAR A;  1YJ9 F;  1QD9 A;  1IV2 A;  1CLI A;  4IIJ B;  3ON1 A;  1Z5V A;  2CSL A;  3IEQ A;  5LP6 B;  4TV9 B;  3LWR C;  3JAL A;  2Z1E A;  3ZP4 A;  4YJ2 B;  2Q1Y A;  5GIO C;  1U40 A;  4ZHQ B;  5LOV A;  3ZO8 A;  4U3J B;  4X1K A;  4TUY B;  4X1Y B;  1W2B F;  4X1I B;  2BTO A;  5FLX M;  2GVI A;  3E1Y A;  5DCV A;  3IMP A;  3CCS F;  3CB2 A;  2Z1T A;  3J81 M;  2Z01 A;  4O4L B;  3FBA A;  3VCZ A;  1YHQ F;  2KTV A;  5ITZ B;  3WJR A;  4LNU A;  5JCO C;  3LWQ C;  1VQ8 F;  4BVS A;  5EO3 A;  2LBW A;  4BVR A;  2KGW A;  5J2U B;  5EWR A;  3LFO A;  1VQV A;  3WJP A;  3LWP C;  3CC7 F;  3JAT B;  1IPA A;  2YYE A;  3CG6 A;  2QTP A;  3S06 A;  5JH7 B;  1ODE A;  5GON B;  4X20 B;  1K9M H;  1VQ7 F;  1W5A A;  4EI7 A;  2OHW A;  3JAW B;  5LXT A;  3M84 A;  3M1X A;  3S0H A;  2R6R 1;  3E20 B;  1YI2 F;  3VYU C;  3NK7 A;  3EOR A;  2CZW A;  2UZH A;  1JFF A;  3D00 A;  4ZOL A;  3FD5 A;  2L26 A;  3CCM F;  1VQL F;  1FNK A;  4O4H B;  3HKE A;  3HKD A;  4I50 B;  4BW0 B;  5IYZ B;  2AMT A;  5EB0 A;  3PAF A;  5CA0 A;  4G4Y A;  2OTM A;  4WBN A;  3HJW C;  5MN6 A;  5G4V C;  1VQO F;  2ZAU A;  2PMP A;  2LBT A;  1YIJ F;  3QUW A;  3VYS C;  4O4I A;  2UYP A;  4ZK7 A;  4DRX B;  1QVG F;  5IT9 M;  3LDT A;  3RE3 A;  3C9U A;  2AIF A;  5FNV B;  4XCQ A;  3SIU A;  5C8Y A;  1M90 H;  3WGK A;  1W5B A;  3D01 A;  2F9Z C;  1W41 A;  3V4D A;  3CCL F;  2I6R A;  5KX5 A;  2YXZ A;  3V7Q A;  5CA1 B;  2PHN A;  1RQ2 A;  3CYP B;  5EYP B;  2RHH A;  3K14 A;  2QEX F;  1W42 A;  3E22 A;  5EZY B;  5HY2 A;  4G4Z A;  5LOV B;  1TVK B;  3L7Q A;  4TV8 B;  2IG8 A;  3I55 F;  5KX5 B;  4C8E A;  3CC2 F;  4BT4 A;  3UT5 A;  4NQ3 A;  3C9T A;  4IHJ B;  3RYF B;  3QHD A;  4IIJ A;  1DBF A;  3MDO A;  4YJ3 A;  4TZZ A;  5LP6 C;  4B46 A;  2OTL F;  4I4T A;  4O4J A;  3MBM A;  5JQG B;  3R0P A;  2H8C A;  1H48 A;  2HRY A;  4B5C A;  3VI6 A;  1KNJ A;  2QI2 A;  1SA0 B;  4G4W A;  3WGN A;  1T0A A;  5BMV A;  3SIV A;  1S72 F;  3FD6 A;  3IR9 A;  1QAH A;  2VGM A;  4ZI7 B;  4ZHV A;  2HRU A;  1SA0 A;  3HAX D;  3KJJ A;  3MCA B;  4O4J B;  3CCV F;  5LXT B;  3CD6 F;  4LNU B;  3RYC B;  3CXC F;  3S02 A;  3JVH A;  3NK6 A;  1SDS A;  5JQG A;  4ERH A;  2QA4 F;  4ZHQ A;  2CVL A;  2UYJ A;  2R75 1;  5IJ9 B;  4C4W C;  1UI9 A;  1VH8 A;  5GON A;  5HP8 A;  3G6E F;  5LP6 A;  2Z1F A;  4BT2 A;  2HQS C;  2B33 A;  2RHL A;  1W40 A;  3F0F A;  5JH7 A;  4TUY A;  4X1Y A;  2ZOD A;  3F0G A;  5CA0 B;  3NVK E;  3VOB A;  1Q81 H;  1COM A;  1FSZ A;  4I50 A;  1ONI A;  3JAS B;  2UYN B;  1VQP F;  3WXM B;  3ZOP A;  1OAP A;  2ALE A;  3HTN A;  3HKD B;  3HKE B;  1GX1 A;  5HY1 A;  3CYQ A;  4BY9 D;  3B6N A;  3N2G B;  2KG4 A;  1Q7Y H;  4BVT A;  5LA6 B;  2W8B C;  2UYN A;  4DXD A;  3N4Z A;  3LYB A;  2VAM A;  2EWC A;  1PF5 A;  5FNV A;  3WGM A;  3JAS A;  4DRX A;  3JAW A;  2KTU A;  3OW2 F;  1GO0 A;  5JCO A;  3V7E A;  4TV9 A;  4C82 A;  3E22 B;  2CWJ A;  1YQN A;  3N2K A;  3JAT A;  5JVD A;  1W5E A;  3N2G A;  1H47 A;  2ZVY A;  2ZVZ A;  1DT9 A;  1RA4 A;  3S0W A;  4TV8 A;  1NMU B;  4ZOL B;  4FFB B;  3ZP7 A;  5MN5 A;  1X7P A;  4ZI7 A;  1RLG A;  4O4H A;  3GHZ A;  3C9R A;  1X52 A;  2VAP A;  1FFX A;  3AGK A;  1H7M A;  1UFY A;  5EZY A;  1JFF B;  3RYI B;  5HY0 A;  3G71 F;  5ITZ A;  3RA6 A;  5HP7 A;  2IQQ A;  4U39 A;  2BTQ B;  3KIZ A;  1CK2 A;  2CHT A;  3BYQ A;  3NMU C;  5CB4 B;  3TD3 A;  1FFX B;  3F0D A;  2WAL A;  3LME A;  4I4T B;  3VYT C;  4RQO A;  5LYJ A;  3KJK A;  5A2Q M;  2K1S A;  3N4Y A;  1W3E X;  3JAK A;  3OBY A;  1VQM F;  4O4I B;  3O85 A;  1M1K H;  4EB6 B;  3LWV C;  3RYF A;  1GO1 A;  1IV1 A;  2LCA A;  3P0Z A;  4LCK A;  3WPX A;  1Z5W A;  5J2T A;  1J7H A;  1JJ2 F;  4RHA A;  1W57 A;  4EI8 A;  5LYJ B;  1TVK A;  1NJI H;  2RHO A;  3RYH B;  4C8G A;  4O4L A;  3U0O A;  5GAN K;  5CA1 A;  4ZHW A;  1U43 A;  2OZB A;  1R1M A;  1TUB B;  5JVD B;  4BT6 A;  3VOA A;  4F6R B;  3J7A R;  3T80 A;  2H8E A;  5J2U A;  3K2X A;  3TD4 A;  5GAP K;  5B8F A;  4R40 B;  1YJW F;  5IJ0 A;  5KMG B;  1VQN F;  1FNJ A;  1XHO A;  1KNK A;  3F0E A;  3M4S A;  3CMA F;  3CCE F;  3P4E A;  4U3J A;  4O2A A;  3RYH A;  1KD1 H;  3OBW A;  4YJ2 A;  5HXZ A;  3GTZ A;  5IJ0 B;  5KMG A;  3IKE A;  4BVQ A;  3J80 M;  5LA6 A;  3TD5 A;  3JAK B;  2GLZ A;  4X3M A;  2HP3 A;  2AIZ P;  2MQE A;  3CCR F;  4HNA A;  4BT7 A;  1N8R H;  1X7O A;  3HKB A;  5AVM A;  3K12 A;  5IYZ A;  2BTU A;  3VTI C;  3JAR B;  1IV4 A;  2DT4 A;  2H6L A;  3KHN A;  3QTY A;  4YJ3 B;  3CPQ A;  3RA5 A;  3CCU F;  1W5F A;  4ZHY B;  1QU9 A;  3D54 A;  1NQ3 A;  4IHJ A;  2IAF A;  4X3L A;  1RQ7 A;  1RLU A;  4BT3 A;  3ELC A;  4G4X A;  4X20 A;  4FFB A;  2HP0 A;  2HX0 A;  1K8A H;  3VIU A;  3CCQ F;  1VQK F;  1KQS F;  3FFM A;  3C9S A;  1Q8R A;  2NMU A;  3WPW A;  2G9I A;  5EAZ A;  5HXU A;  1T0K B;  3HKC A;  3HKB B;  3KE1 A;  1YJN F;  1YGY A;  3CME F;  5EIB C;  2P6Y A;  1IV3 A;  5CB4 A;  1QVF F;  4O2A B;  4X1I A;  4C8I A;  3I56 F;  1YIT F;  4I55 B;  5EIB D;  3MQW A;  4PWT A;  2VXY A;  2RB9 A;  3G4S F;  2CW4 A;  4BT5 A;  3OON A;  1W55 A;  1X25 A;  4X1K B;  3CPW F;  2I6D A;  2OTJ F;  1XBI A;  1U3L A;  3C8L A;  2Q1X A;  5EB1 B;  1GZ0 A;  1VK3 A;  2FC3 A;  5C8Y B;  3N2K B;  1JY8 A;  5HY4 A;  2FGY A;  2BO1 A;  4G4V A;  3IKF A;  1SZQ A;  3I3F A;  1W59 A;  4O2B B;  1XV2 A;  3JAL B;  4NUT A;  1Q82 H;  1CN7 A;  2N48 A;  4I55 A;  1VQ9 F;  3IEW A;  3WGJ A;  4HNA B;  4F6R A;  2Z1U A;  3VMF B;  4C81 A;  1TUB A;  1ZWZ A;  3CC4 F;  3ERN A;  1JN1 A;  3RYI A;  2RHJ A;  2VGN A;  3S03 A;  3RYC A;  1VQ4 F;  5EYP A;  3NVI B;  2ZOV A;  2HP0 B;  2LBX A;  2HS4 A;  4G88 A;  2HVY D;  1U3P A;  3GYQ A;  5G4U C;  1W58 1;  3JCM M;  2CHS A;  3F6M A;  3HKC B;  4WBN B;  5J2T B;  1VQ6 F;  2JNB A;  1VQ5 F;  3UT5 B;  5FJ4 C;  4KWE A;  3CCJ F;  1Q86 H;  1K73 H;  4EB6 A;  3LWO C;  2DYY A;  4M8I A;  5IJ9 A;  3S0Y A;  5GIP C;  1XRG A;  4B62 A;  3V3T A;  2HS3 A;  2UYK A;  1KC8 H;  3PLA C;  3K0T A; 
#chains in the Genus database with same CATH homology
 3F0F A;  3IEQ A;  5B8F A;  3EOR A;  3RE3 A;  3F0G A;  1KNK A;  2UZH A;  1W57 A;  1U3P A;  1U40 A;  3F0E A;  3KE1 A;  4C8E A;  1JY8 A;  4C82 A;  3F0D A;  1IV4 A;  1IV3 A;  1YQN A;  3Q8H A;  3QHD A;  3IKF A;  4C8G A;  3F6M A;  1VHA A;  2AMT A;  1H47 A;  4C8I A;  1GX1 A;  3JVH A;  3MBM A;  3B6N A;  1U43 A;  3FPI A;  3IKE A;  3IEW A;  3FBA A;  1H48 A;  3ESJ A;  3ELC A;  3K14 A;  3P10 A;  4C81 A;  1VH8 A;  3GHZ A;  1W55 A;  1KNJ A;  2GZL A;  2PMP A;  1IV1 A;  1U3L A;  3ERN A;  1JN1 A;  1T0A A;  3T80 A;  1IV2 A;  3K2X A;  3P0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...