3K2XA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
154
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 51
structure length 154
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3k2xA00
3B6NA 3ELCA 1JY8A 3FPIA 3F0EA 3IKFA 3GHZA 3P0ZA 4C82A 3K14A 3JVHA 3ERNA 3F6MA 1U3LA 3FBAA 3IEQA 4C8GA 3P10A 3K2XA 4C8IA 2PMPA 1KNKA 1T0AA 3F0FA 1VHAA 3IEWA 1W57A 1JN1A 5B8FA 3F0DA 1IV4A 1W55A 3EORA 1VH8A 3RE3A 1IV3A 4C8EA 3IKEA 1U3PA 1IV1A 1H47A 3T80A 2AMTA 1GX1A 1U43A 3ESJA 1YQNA 3MBMA 3QHDA 3F0GA 2UZHA 3Q8HA 2GZLA 1KNJA 4C81A 3KE1A 1U40A 1H48A 1IV2A
chains in the Genus database with same CATH superfamily
2OHWA 3I56F 2OTLF 1TUBA 2ZOVA 5JCOC 3IKFA 1YHQF 3WGNA 3NVIB 3FBAA 2I6DA 3KJKA 3F0FA 4X1KB 3UT5B 2LBTA 2AIFA 1JN1A 3CC4F 2I6RA 1M90H 3RYFB 1UI9A 4X20B 5EYPA 3MQWA 5HY0A 4U39A 4XCQA 5FNVA 4EI8A 5ITZB 2AMTA 3U0OA 3MBMA 2UZHA 1VQNF 5FLXM 4YJ2A 3CCUF 2RHJA 2PHNA 1XBIA 1PF5A 4C8IA 1VQLF 3HJWC 4O4LA 1W57A 3RYHA 1Z5WA 3F0DA 5JCOA 3VI6A 3VTIC 5IJ9B 4ZK7A 1YJ9F 4ERHA 2OTMA 1N8RH 1QD9A 5IJ0B 2HS3A 2VXYA 1FNKA 2Q1YA 3QUWA 1K9MH 3HWUA 1W5EA 4ZOLA 1W42A 4KWEA 1M1KH 2H8EA 2PMPA 5GONB 5J2TB 5LYJB 5GINC 2HP0A 3IEWA 4G88A 5CA0B 3VIUA 3I55F 3HKBA 1CLIA 1OAPA 3WPWA 1COMA 4BT7A 3QTYA 5JVDB 2Z1EA 3CPQA 4LCKA 3CCVF 3G71F 2OTJF 1GO0A 1VQ9F 4I4TB 5DCVA 3HAXD 2QA4F 4TUYB 1RQ2A 2DYYA 3KE1A 3WJQA 4O2AA 3CCQF 1JY8A 1X25A 3TD3A 4O4LB 3CCSF 3MDOA 5HWEA 3E22A 2H8CA 1RLUA 5HXUA 3FD6A 3CMEF 3R0PA 3NVKE 3E20B 5MN5A 5LXTB 3GYQA 1W55A 4X1KA 3UT5A 4C8EA 3LWQC 3LFOA 3D00A 1YGYA 1W581 3RYFA 5EAZA 3J81M 3QHDA 3M84A 3LYBA 1Q81H 2UYKA 3C9SA 4ZHWA 3K2XA 5J2UB 4B5CA 1X7OA 3PAFA 3DDNA 4NUTA 1CK2A 1DT9A 3RE3A 3IKEA 5IJ9A 2KGWA 3C8LA 3K0TA 4RHAA 4TV8B 2BTOA 5CA1A 2VGNA 4EB6A 3CPWF 1QVFF 5BMVA 3ZP7A 2AIZP 1Q8RA 3LDTA 3WGLA 4C8GA 1VQKF 3M4SA 3WGJA 1QAHA 2YXZA 1VQMF 2IG8A 5G4UC 2F9ZC 5GONA 5J2TA 5LYJA 4NQ3A 1DBFA 3CYPB 4O2BB 2HS4A 3S06A 4IHJB 5AVMA 5CA0A 3JAKB 1W59A 3N4ZA 5EIBD 3VYUC 2CWJA 4ZHYB 2BTQB 3JASA 3HKCB 5JVDA 4DXDA 5LOVA 5JQGB 3JARB 4I4TA 2K1SA 3CG6A 4C82A 4TUYA 3F6MA 5EIBC 2CVLA 3TD4A 3VO8A 1VQ7F 4X1IB 4BT3A 3NMUC 4B62A 5JH7B 3CXCF 4BVTA 1FSZA 3WPXA 3JALB 3S02A 5LXTA 3S0WA 5CA1B 4BW0B 4EB6B 1YI2F 1H47A 3C9UA 3O85A 3ZOPA 5BMVB 5HP8A 1W5FA 2VAWA 3V7QA 5KMGB 1VQOF 3BYQA 4X1YB 2Z01A 3ON1A 4IIJB 4B45A 3LWRC 3N4YA 4EI9A 1ODEA 4BT6A 4F6RA 2RB9A 2Z1FA 5J2UA 2EWCA 3MCAB 3NK7A 3G6EF 3E1YA 1VQ8F 1VQ4F 3JASB 3NK6A 3P4EA 1U3PA 2CZWA 4G4VA 1IV1A 1VQ6F 1NQ3A 4WBNB 5LOVB 4YJ3B 3V3TA 1KNJA 3WJPA 5GAPK 4TV8A 3ELCA 3KJJA 5IT9M 2IAFA 3JVHA 1TVKB 1K8AH 3DC2A 2UYNA 2HX0A 2KG4A 3LWOC 1VHAA 2HRUA 3N2GB 3V4DA 1ZWZA 3D54A 5LA6B 5GIPC 1Q82H 3SIVA 1VH8A 1IV3A 4BT5A 3HKDB 5LP6A 5MN6A 2GLZA 3N2KB 4BT2A 2H6LA 1W2BF 4O2BA 5HY2A 3ESJA 4IHJA 3CC2F 3MCQA 3JAKA 3Q8HA 5G4VC 3C9RA 3WGKA 1VQPF 1XHOA 1ONIA 2V9YA 3HKCA 2VAPA 3GHZA 3SIUA 3RYCB 5JQGA 4EI7A 3JARA 1PXWA 3K12A 4F6RB 1T0AA 2KTVA 3CCLF 1FNJA 3CC7F 3RYIB 5GANK 2RHOA 2KTUA 4O4JB 1KD1H 4X1IA 3JCMM 4TV9A 3VMFB 2HP3A 1X7PA 5JH7A 3OBYA 3OBWA 5C8YB 4U3JB 4ZI7A 3M1XA 4I50A 3JALA 4BY9D 5HXZA 1W5BA 3CMAF 1KQSF 2UYNB 1E7KA 1R1MA 3AGKA 4O4IB 1U3LA 3IEQA 1KNKA 1VK3A 1JFFA 5KMGA 1FFXB 4X1YA 1W41A 1RQ7A 4G4ZA 5EZYA 4IIJA 5B8FA 1IV4A 2BTUA 3C9TA 5LP6B 1XRGA 3EORA 4X3LA 4HNAB 3S0HA 1VQVA 1Q7YH 5A2QM 3ZO8A 2NMUA 4FFBA 3HKEA 3OW2F 4M8IA 4PWTA 3S03A 4E6EA 2QTPA 3B6NA 3ZP4A 4WBNA 3CCJF 4R40B 2MQEA 2FGYA 1GO1A 1SA0B 3FPIA 4YJ3A 3VYTC 3LWPC 4BVRA 2LBWA 3D01A 3JAWB 3JATB 5GIOC 1QVGF 1JJ2F 2CHTA 1TVKA 4I55B 2R751 1K73H 1KC8H 3VCZA 2DT4A 2HRYA 3TD5A 4TV9B 1NJIH 4X3MA 3S0YA 4B46A 3L7QA 1GZ0A 2ZF8A 3GTZA 3PLAC 3VOAA 3N2GA 4ZI7B 1H7MA 1RA4A 4I50B 5LA6A 4ZHQA 2W8BC 4BT4A 3I3FA 2HS0A 5EB0A 3FFMA 4BVSA 1YQNA 3CYQA 3HKDA 2GZLA 1SZQA 3N2KA 1U40A 1H48A 1IV2A 2CHSA 3OONA 2OZBA 5IYZA 2QEXF 2RHHA 3RA5A 1JFFB 3WGMA 3ERNA 4DRXB 2L26A 3LWVC 4NWOB 5EZYB 3CD6F 5LP6C 5MN4A 1W5AA 3WJRA 3RYCA 2ZVZA 2JNBA 2LBXA 3LMEA 1YITF 5FJ4C 2IQQA 2ZODA 3RYIA 2HVYD 4LNUB 1JD1A 4FFBB 3HKEB 4O4JA 5KX5A 1YJNF 2B33A 1OFUA 4O4HA 2GVIA 1CN7A 3WXMB 1U43A 1TUBB 3FD5A 3CCMF 3VOBA 4C81A 2LCAA 2VGMA 3J7AR 2VAMA 5EWRA 5C8YA 4U3JA 4TZZA 2Q1XA 3P0ZA 1IPAA 3P10A 4RQOA 4G4WA 1VQ5F 3V7EA 4O4IA 1SDSA 5EYPB 2P6YA 1Z5VA 3G4SF 2WALA 1W40A 1XV2A 5EB1B 1FFXA 5FNVB 4ZHQB 5HY1A 2ALEA 4G4YA 5CB4A 5EO3A 3RA6A 3IR9A 4HNAA 4YJ2B 3CCRF 5IYZB 2QI2A 1YJWF 1UFYA 3VYSC 4C4WC 1W3EX 3K14A 3RYHB 3I7TA 2ZAUA 4ZHVA 3J80M 2Z1TA 1SA0A 2FC3A 2UYJA 3CB2A 3JAWA 3JATA 5KX5B 4O4HB 3JAMM 3CCEF 4I55A 1S72F 2UYPA 2G9IA 2ZVYA 4X20A 2YYEA 1GX1A 1J7HA 3F0GA 3HTNA 2N48A 4ZOLB 2R6R1 5ITZA 2HQSC 2CW4A 3F0EA 2HP0B 4G4XA 5HP7A 3HKBB 4BVQA 3KIZA 1QU9A 4DRXA 3IMPA 3KHNA 5CB4B 1YIJF 1T0KB 2CSLA 1X52A 2BO1A 4O2AB 1Q86H 3T80A 4LNUA 5HY4A 1RLGA 2RHLA 3E22B 1NMUB 5IJ0A 2Z1UA
chains in the Genus database with same CATH topology
3B6NA 3ELCA 1JY8A 3FPIA 3F0EA 3IKFA 3GHZA 3P0ZA 4C82A 3K14A 3JVHA 3ERNA 3F6MA 1U3LA 3FBAA 3IEQA 4C8GA 3P10A 3K2XA 4C8IA 2PMPA 1KNKA 1T0AA 3F0FA 1VHAA 3IEWA 1W57A 1JN1A 5B8FA 3F0DA 1IV4A 1W55A 3EORA 1VH8A 3RE3A 1IV3A 4C8EA 3IKEA 1U3PA 1IV1A 1H47A 3T80A 2AMTA 1GX1A 1U43A 3ESJA 1YQNA 3MBMA 3QHDA 3F0GA 2UZHA 3Q8HA 2GZLA 1KNJA 4C81A 3KE1A 1U40A 1H48A 1IV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6N A;  3ELC A;  1JY8 A;  3FPI A;  3F0E A;  3IKF A;  3GHZ A;  3P0Z A;  4C82 A;  3K14 A;  3JVH A;  3ERN A;  3F6M A;  1U3L A;  3FBA A;  3IEQ A;  4C8G A;  3P10 A;  3K2X A;  4C8I A;  2PMP A;  1KNK A;  1T0A A;  3F0F A;  1VHA A;  3IEW A;  1W57 A;  1JN1 A;  5B8F A;  3F0D A;  1IV4 A;  1W55 A;  3EOR A;  1VH8 A;  3RE3 A;  1IV3 A;  4C8E A;  3IKE A;  1U3P A;  1IV1 A;  1H47 A;  3T80 A;  2AMT A;  1GX1 A;  1U43 A;  3ESJ A;  1YQN A;  3MBM A;  3QHD A;  3F0G A;  2UZH A;  3Q8H A;  2GZL A;  1KNJ A;  4C81 A;  3KE1 A;  1U40 A;  1H48 A;  1IV2 A; 
#chains in the Genus database with same CATH topology
 2OHW A;  3I56 F;  2OTL F;  1TUB A;  2ZOV A;  5JCO C;  3IKF A;  1YHQ F;  3WGN A;  3NVI B;  3FBA A;  2I6D A;  3KJK A;  3F0F A;  4X1K B;  3UT5 B;  2LBT A;  2AIF A;  1JN1 A;  3CC4 F;  2I6R A;  1M90 H;  3RYF B;  1UI9 A;  4X20 B;  5EYP A;  3MQW A;  5HY0 A;  4U39 A;  4XCQ A;  5FNV A;  4EI8 A;  5ITZ B;  2AMT A;  3U0O A;  3MBM A;  2UZH A;  1VQN F;  5FLX M;  4YJ2 A;  3CCU F;  2RHJ A;  2PHN A;  1XBI A;  1PF5 A;  4C8I A;  1VQL F;  3HJW C;  4O4L A;  1W57 A;  3RYH A;  1Z5W A;  3F0D A;  5JCO A;  3VI6 A;  3VTI C;  5IJ9 B;  4ZK7 A;  1YJ9 F;  4ERH A;  2OTM A;  1N8R H;  1QD9 A;  5IJ0 B;  2HS3 A;  2VXY A;  1FNK A;  2Q1Y A;  3QUW A;  1K9M H;  3HWU A;  1W5E A;  4ZOL A;  1W42 A;  4KWE A;  1M1K H;  2H8E A;  2PMP A;  5GON B;  5J2T B;  5LYJ B;  5GIN C;  2HP0 A;  3IEW A;  4G88 A;  5CA0 B;  3VIU A;  3I55 F;  3HKB A;  1CLI A;  1OAP A;  3WPW A;  1COM A;  4BT7 A;  3QTY A;  5JVD B;  2Z1E A;  3CPQ A;  4LCK A;  3CCV F;  3G71 F;  2OTJ F;  1GO0 A;  1VQ9 F;  4I4T B;  5DCV A;  3HAX D;  2QA4 F;  4TUY B;  1RQ2 A;  2DYY A;  3KE1 A;  3WJQ A;  4O2A A;  3CCQ F;  1JY8 A;  1X25 A;  3TD3 A;  4O4L B;  3CCS F;  3MDO A;  5HWE A;  3E22 A;  2H8C A;  1RLU A;  5HXU A;  3FD6 A;  3CME F;  3R0P A;  3NVK E;  3E20 B;  5MN5 A;  5LXT B;  3GYQ A;  1W55 A;  4X1K A;  3UT5 A;  4C8E A;  3LWQ C;  3LFO A;  3D00 A;  1YGY A;  1W58 1;  3RYF A;  5EAZ A;  3J81 M;  3QHD A;  3M84 A;  3LYB A;  1Q81 H;  2UYK A;  3C9S A;  4ZHW A;  3K2X A;  5J2U B;  4B5C A;  1X7O A;  3PAF A;  3DDN A;  4NUT A;  1CK2 A;  1DT9 A;  3RE3 A;  3IKE A;  5IJ9 A;  2KGW A;  3C8L A;  3K0T A;  4RHA A;  4TV8 B;  2BTO A;  5CA1 A;  2VGN A;  4EB6 A;  3CPW F;  1QVF F;  5BMV A;  3ZP7 A;  2AIZ P;  1Q8R A;  3LDT A;  3WGL A;  4C8G A;  1VQK F;  3M4S A;  3WGJ A;  1QAH A;  2YXZ A;  1VQM F;  2IG8 A;  5G4U C;  2F9Z C;  5GON A;  5J2T A;  5LYJ A;  4NQ3 A;  1DBF A;  3CYP B;  4O2B B;  2HS4 A;  3S06 A;  4IHJ B;  5AVM A;  5CA0 A;  3JAK B;  1W59 A;  3N4Z A;  5EIB D;  3VYU C;  2CWJ A;  4ZHY B;  2BTQ B;  3JAS A;  3HKC B;  5JVD A;  4DXD A;  5LOV A;  5JQG B;  3JAR B;  4I4T A;  2K1S A;  3CG6 A;  4C82 A;  4TUY A;  3F6M A;  5EIB C;  2CVL A;  3TD4 A;  3VO8 A;  1VQ7 F;  4X1I B;  4BT3 A;  3NMU C;  4B62 A;  5JH7 B;  3CXC F;  4BVT A;  1FSZ A;  3WPX A;  3JAL B;  3S02 A;  5LXT A;  3S0W A;  5CA1 B;  4BW0 B;  4EB6 B;  1YI2 F;  1H47 A;  3C9U A;  3O85 A;  3ZOP A;  5BMV B;  5HP8 A;  1W5F A;  2VAW A;  3V7Q A;  5KMG B;  1VQO F;  3BYQ A;  4X1Y B;  2Z01 A;  3ON1 A;  4IIJ B;  4B45 A;  3LWR C;  3N4Y A;  4EI9 A;  1ODE A;  4BT6 A;  4F6R A;  2RB9 A;  2Z1F A;  5J2U A;  2EWC A;  3MCA B;  3NK7 A;  3G6E F;  3E1Y A;  1VQ8 F;  1VQ4 F;  3JAS B;  3NK6 A;  3P4E A;  1U3P A;  2CZW A;  4G4V A;  1IV1 A;  1VQ6 F;  1NQ3 A;  4WBN B;  5LOV B;  4YJ3 B;  3V3T A;  1KNJ A;  3WJP A;  5GAP K;  4TV8 A;  3ELC A;  3KJJ A;  5IT9 M;  2IAF A;  3JVH A;  1TVK B;  1K8A H;  3DC2 A;  2UYN A;  2HX0 A;  2KG4 A;  3LWO C;  1VHA A;  2HRU A;  3N2G B;  3V4D A;  1ZWZ A;  3D54 A;  5LA6 B;  5GIP C;  1Q82 H;  3SIV A;  1VH8 A;  1IV3 A;  4BT5 A;  3HKD B;  5LP6 A;  5MN6 A;  2GLZ A;  3N2K B;  4BT2 A;  2H6L A;  1W2B F;  4O2B A;  5HY2 A;  3ESJ A;  4IHJ A;  3CC2 F;  3MCQ A;  3JAK A;  3Q8H A;  5G4V C;  3C9R A;  3WGK A;  1VQP F;  1XHO A;  1ONI A;  2V9Y A;  3HKC A;  2VAP A;  3GHZ A;  3SIU A;  3RYC B;  5JQG A;  4EI7 A;  3JAR A;  1PXW A;  3K12 A;  4F6R B;  1T0A A;  2KTV A;  3CCL F;  1FNJ A;  3CC7 F;  3RYI B;  5GAN K;  2RHO A;  2KTU A;  4O4J B;  1KD1 H;  4X1I A;  3JCM M;  4TV9 A;  3VMF B;  2HP3 A;  1X7P A;  5JH7 A;  3OBY A;  3OBW A;  5C8Y B;  4U3J B;  4ZI7 A;  3M1X A;  4I50 A;  3JAL A;  4BY9 D;  5HXZ A;  1W5B A;  3CMA F;  1KQS F;  2UYN B;  1E7K A;  1R1M A;  3AGK A;  4O4I B;  1U3L A;  3IEQ A;  1KNK A;  1VK3 A;  1JFF A;  5KMG A;  1FFX B;  4X1Y A;  1W41 A;  1RQ7 A;  4G4Z A;  5EZY A;  4IIJ A;  5B8F A;  1IV4 A;  2BTU A;  3C9T A;  5LP6 B;  1XRG A;  3EOR A;  4X3L A;  4HNA B;  3S0H A;  1VQV A;  1Q7Y H;  5A2Q M;  3ZO8 A;  2NMU A;  4FFB A;  3HKE A;  3OW2 F;  4M8I A;  4PWT A;  3S03 A;  4E6E A;  2QTP A;  3B6N A;  3ZP4 A;  4WBN A;  3CCJ F;  4R40 B;  2MQE A;  2FGY A;  1GO1 A;  1SA0 B;  3FPI A;  4YJ3 A;  3VYT C;  3LWP C;  4BVR A;  2LBW A;  3D01 A;  3JAW B;  3JAT B;  5GIO C;  1QVG F;  1JJ2 F;  2CHT A;  1TVK A;  4I55 B;  2R75 1;  1K73 H;  1KC8 H;  3VCZ A;  2DT4 A;  2HRY A;  3TD5 A;  4TV9 B;  1NJI H;  4X3M A;  3S0Y A;  4B46 A;  3L7Q A;  1GZ0 A;  2ZF8 A;  3GTZ A;  3PLA C;  3VOA A;  3N2G A;  4ZI7 B;  1H7M A;  1RA4 A;  4I50 B;  5LA6 A;  4ZHQ A;  2W8B C;  4BT4 A;  3I3F A;  2HS0 A;  5EB0 A;  3FFM A;  4BVS A;  1YQN A;  3CYQ A;  3HKD A;  2GZL A;  1SZQ A;  3N2K A;  1U40 A;  1H48 A;  1IV2 A;  2CHS A;  3OON A;  2OZB A;  5IYZ A;  2QEX F;  2RHH A;  3RA5 A;  1JFF B;  3WGM A;  3ERN A;  4DRX B;  2L26 A;  3LWV C;  4NWO B;  5EZY B;  3CD6 F;  5LP6 C;  5MN4 A;  1W5A A;  3WJR A;  3RYC A;  2ZVZ A;  2JNB A;  2LBX A;  3LME A;  1YIT F;  5FJ4 C;  2IQQ A;  2ZOD A;  3RYI A;  2HVY D;  4LNU B;  1JD1 A;  4FFB B;  3HKE B;  4O4J A;  5KX5 A;  1YJN F;  2B33 A;  1OFU A;  4O4H A;  2GVI A;  1CN7 A;  3WXM B;  1U43 A;  1TUB B;  3FD5 A;  3CCM F;  3VOB A;  4C81 A;  2LCA A;  2VGM A;  3J7A R;  2VAM A;  5EWR A;  5C8Y A;  4U3J A;  4TZZ A;  2Q1X A;  3P0Z A;  1IPA A;  3P10 A;  4RQO A;  4G4W A;  1VQ5 F;  3V7E A;  4O4I A;  1SDS A;  5EYP B;  2P6Y A;  1Z5V A;  3G4S F;  2WAL A;  1W40 A;  1XV2 A;  5EB1 B;  1FFX A;  5FNV B;  4ZHQ B;  5HY1 A;  2ALE A;  4G4Y A;  5CB4 A;  5EO3 A;  3RA6 A;  3IR9 A;  4HNA A;  4YJ2 B;  3CCR F;  5IYZ B;  2QI2 A;  1YJW F;  1UFY A;  3VYS C;  4C4W C;  1W3E X;  3K14 A;  3RYH B;  3I7T A;  2ZAU A;  4ZHV A;  3J80 M;  2Z1T A;  1SA0 A;  2FC3 A;  2UYJ A;  3CB2 A;  3JAW A;  3JAT A;  5KX5 B;  4O4H B;  3JAM M;  3CCE F;  4I55 A;  1S72 F;  2UYP A;  2G9I A;  2ZVY A;  4X20 A;  2YYE A;  1GX1 A;  1J7H A;  3F0G A;  3HTN A;  2N48 A;  4ZOL B;  2R6R 1;  5ITZ A;  2HQS C;  2CW4 A;  3F0E A;  2HP0 B;  4G4X A;  5HP7 A;  3HKB B;  4BVQ A;  3KIZ A;  1QU9 A;  4DRX A;  3IMP A;  3KHN A;  5CB4 B;  1YIJ F;  1T0K B;  2CSL A;  1X52 A;  2BO1 A;  4O2A B;  1Q86 H;  3T80 A;  4LNU A;  5HY4 A;  1RLG A;  2RHL A;  3E22 B;  1NMU B;  5IJ0 A;  2Z1U A; 
#chains in the Genus database with same CATH homology
 3B6N A;  3ELC A;  1JY8 A;  3FPI A;  3F0E A;  3IKF A;  3GHZ A;  3P0Z A;  4C82 A;  3K14 A;  3JVH A;  3ERN A;  3F6M A;  1U3L A;  3FBA A;  3IEQ A;  4C8G A;  3P10 A;  3K2X A;  4C8I A;  2PMP A;  1KNK A;  1T0A A;  3F0F A;  1VHA A;  3IEW A;  1W57 A;  1JN1 A;  5B8F A;  3F0D A;  1IV4 A;  1W55 A;  3EOR A;  1VH8 A;  3RE3 A;  1IV3 A;  4C8E A;  3IKE A;  1U3P A;  1IV1 A;  1H47 A;  3T80 A;  2AMT A;  1GX1 A;  1U43 A;  3ESJ A;  1YQN A;  3MBM A;  3QHD A;  3F0G A;  2UZH A;  3Q8H A;  2GZL A;  1KNJ A;  4C81 A;  3KE1 A;  1U40 A;  1H48 A;  1IV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...