3K2XA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
154
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 51
structure length 154
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3k2xA00
3B6NA 1T0AA 1GX1A 1VH8A 2PMPA 1VHAA 1IV2A 3JVHA 3P10A 1U43A 4C8GA 3EORA 2AMTA 3QHDA 3MBMA 5B8FA 3FBAA 1JN1A 3RE3A 3F6MA 4C82A 4C81A 1U3LA 3K2XA 1H48A 3F0EA 3F0FA 1KNJA 1H47A 1IV4A 3ESJA 3F0GA 2GZLA 1U40A 3GHZA 1W55A 3Q8HA 1JY8A 1KNKA 1W57A 3IEQA 3ELCA 3F0DA 3FPIA 2UZHA 3ERNA 3P0ZA 4C8EA 3K14A 3KE1A 3T80A 4C8IA 3IKFA 1U3PA 1YQNA 3IEWA 1IV3A 3IKEA 1IV1A
chains in the Genus database with same CATH superfamily
4ZK7A 1VHAA 4X1KB 5AVMA 5JVDB 3C9RA 3LMEA 1W59A 1VQ5F 4I50B 1QVGF 2ZAUA 4ZI7A 4U3JA 3TD5A 4DRXA 1K9MH 1VQ4F 1VQKF 3N4ZA 1E7KA 3JATA 3OW2F 1X7PA 1KQSF 5LXTB 3S0HA 3M1XA 3WPWA 2Z01A 4HNAB 1VQ8F 3V7QA 5IJ0A 4C8IA 1VQOF 4FFBB 4O4LB 3P10A 3LWPC 4O4IB 3JALA 1JFFA 5HWEA 3HKBA 3JAWA 5CB4A 1NQ3A 1U40A 1QD9A 3N4YA 3RYIB 5EZYB 5JCOC 4F6RB 3I55F 1PXWA 1GO0A 1ODEA 4TV8A 2EWCA 3S0WA 1Z5VA 5FJ4C 2UYJA 4IIJB 4X1YA 3FD6A 1VQPF 2YYEA 5CA1A 1IV3A 3HKDA 1FNJA 1YI2F 5JH7A 2Q1XA 1VQ7F 4BT7A 1M90H 2RHLA 3CCVF 2MQEA 3V4DA 2QA4F 3TD3A 5JQGB 3CCSF 2BTOA 3E1YA 1Q82H 3WPXA 4O2BB 2HS0A 2H6LA 3LDTA 3WGMA 3RYCB 3J7AR 3VOAA 1W5AA 3N2GA 4NQ3A 5KMGA 4EI8A 1T0KB 3QUWA 2UYKA 3RYCA 2HP0A 4X1YB 3J81M 3CCEF 4X3MA 3T80A 5LA6B 5DCVA 1RQ2A 5G4VC 3HKEB 2R6R1 4LNUB 3JCMM 5JQGA 1K73H 2H8CA 5GINC 2BTUA 4G4XA 2HS4A 3QHDA 4I55B 2DT4A 3RYHA 5KX5B 2BTQB 3MCAB 1H48A 1IV4A 2AIFA 1VQVA 4LNUA 3VIUA 4I4TB 1W41A 3MCQA 3TD4A 4C8EA 4TZZA 4F6RA 5GONB 5JCOA 3LYBA 3RYFB 5J2TB 3J80M 2OTLF 5J2UA 2UYNA 3U0OA 2LBWA 3CMEF 3UT5B 5A2QM 4IHJA 3IMPA 3NMUC 4B45A 1ZWZA 4B62A 3Q8HA 1Q7YH 4O4JA 5LXTA 2KG4A 3HTNA 1QAHA 4BT4A 4G88A 2GVIA 2HQSC 5IYZB 2ZOVA 1Z5WA 4O4HB 3WGLA 2UYPA 2QEXF 5LYJB 4BY9D 1QVFF 1PF5A 5HY4A 4ZOLB 5LOVB 1JD1A 1W3EX 2AMTA 3CPQA 1DT9A 2WALA 5JH7B 3F0FA 3RYIA 2PHNA 2KTVA 4O4LA 5MN6A 4BT2A 3ZO8A 4U3JB 2B33A 3WXMB 1Q86H 2CHTA 1W42A 3JARA 5BMVB 4TV8B 3SIUA 4B46A 1CLIA 3FD5A 3PAFA 5EYPB 5C8YB 1JFFB 4G4WA 1M1KH 2OHWA 3S06A 3HKCB 3HKDB 3M84A 5GANK 3D01A 4C4WC 1S72F 4C82A 3CC7F 5LP6B 1W581 1GZ0A 3WGKA 3F0EA 1NMUB 1XRGA 1W2BF 1VQ6F 1X25A 2ALEA 4ERHA 5HY0A 3K12A 1XV2A 3KJJA 1W5EA 2HRYA 5ITZB 4G4ZA 5BMVA 3V7EA 2V9YA 1RLUA 4PWTA 4EI7A 3IKEA 3CCUF 3M4SA 3GTZA 1T0AA 2PMPA 5LP6A 3LWRC 3CCJF 2CVLA 1TUBA 3OBWA 1ONIA 3FFMA 3C8LA 4C81A 3JASA 3N2KA 1XBIA 5EB0A 4YJ3B 2VAWA 3O85A 3MDOA 3WGJA 2DYYA 2P6YA 1H7MA 3VYUC 4X1IB 3S0YA 1KC8H 4EB6A 5IJ9A 3P0ZA 2Z1FA 2G9IA 3K14A 5CA0A 4WBNB 4G4VA 2VAPA 4X1KA 3B6NA 3LFOA 2CW4A 1IV2A 2CSLA 3CPWF 5MN5A 1TUBB 5EYPA 3NK6A 2IQQA 1SA0B 1CN7A 2R751 1FFXA 1H47A 4IHJB 5EAZA 1YHQF 5J2TA 2IAFA 1FNKA 1Q81H 3KJKA 1FSZA 2UZHA 4TUYA 1YJNF 4O4JB 2HVYD 2LBXA 3KHNA 3VCZA 2Z1TA 2VAMA 4B5CA 3WJRA 3LWQC 2F9ZC 3CYQA 3PLAC 3RA6A 4NWOB 3ZP4A 2JNBA 4ZHYB 5LYJA 1RA4A 1XHOA 3OBYA 3WJQA 4EB6B 1VQMF 1TVKA 2HX0A 3OONA 3RE3A 3K2XA 4R40B 4RQOA 2RHOA 3C9TA 4LCKA 3I3FA 5EIBD 3G71F 3ZP7A 2ZVZA 3VYTC 3K0TA 1YJ9F 5HY2A 1UFYA 2HRUA 3IEQA 1N8RH 3E22A 4BVRA 2KTUA 3C9SA 1W5FA 2K1SA 2NMUA 1VQLF 2AIZP 5HP8A 2ZODA 1YJWF 2OTJF 1IV1A 2UYNB 4X20B 5HXUA 1VH8A 3LWOC 1DBFA 1U43A 4BT3A 5C8YA 3R0PA 1GO1A 4ZHQA 4E6EA 1VK3A 4ZHVA 1R1MA 1OFUA 5GIPC 4M8IA 3JARB 4DXDA 1RQ7A 5MN4A 3WJPA 2QTPA 3VMFB 4X20A 2QI2A 3CB2A 3JAMM 2N48A 3F0DA 2I6DA 3N2GB 1RLGA 5EIBC 3RYHB 5KX5A 1X52A 3IKFA 3IEWA 2CZWA 4ZOLA 5HY1A 1Q8RA 3NK7A 1GX1A 3HKEA 1QU9A 2VGNA 1CK2A 2CWJA 5HXZA 4O4HA 3I7TA 1U3LA 3AGKA 1KNJA 5EWRA 2BO1A 3F0GA 3GHZA 3VO8A 5KMGB 2RHJA 1W55A 1JY8A 1YIJF 4XCQA 3GYQA 3NVIB 3RA5A 3ELCA 4I4TA 5LOVA 4BVTA 3CCMF 4BT5A 3HWUA 4NUTA 5EZYA 5FNVA 1U3PA 5LP6C 4ZHQB 1K8AH 3JAWB 3HKBB 5J2UB 3D54A 2W8BC 1IPAA 3VI6A 3JALB 5IT9M 5B8FA 3D00A 1JN1A 4BT6A 2FC3A 2RB9A 3CC4F 5GIOC 3CC2F 3CG6A 5LA6A 1NJIH 2OZBA 1KNKA 2Z1EA 4U39A 4TUYB 3UT5A 3ERNA 5GAPK 3DC2A 3VOBA 1SDSA 3KE1A 3RYFA 4O2AB 4O2BA 4I55A 2VGMA 2OTMA 3DDNA 5FNVB 5GONA 2RHHA 4X1IA 2ZF8A 4C8GA 3S03A 2HS3A 3E22B 3CCRF 3EORA 3IR9A 3MBMA 5JVDA 2CHSA 1W5BA 1YGYA 3FBAA 5IJ0B 3S02A 3NVKE 3JASB 4BW0B 2HP0B 3CXCF 2Z1UA 3CD6F 3JATB 4ZHWA 2LBTA 2Q1YA 1X7OA 1OAPA 3ON1A 3FPIA 3G4SF 2HP3A 4HNAA 3JAKB 1W40A 1SA0A 3HJWC 3HAXD 2H8EA 2KGWA 3G6EF 3BYQA 3CMAF 2VXYA 2YXZA 3JVHA 1VQNF 3KIZA 4ZI7B 3CCLF 2LCAA 3I56F 4WBNA 5CA0B 4IIJA 5G4UC 2FGYA 2GZLA 1VQ9F 3E20B 2IG8A 1W57A 3MQWA 5FLXM 1J7HA 1YITF 2L26A 3JAKA 3P4EA 4BVSA 1TVKB 3V3TA 5IJ9B 5CA1B 1YQNA 4YJ2B 4I50A 1FFXB 3ESJA 4FFBA 3CYPB 3QTYA 4EI9A 2I6RA 4TV9A 3HKCA 1COMA 4BVQA 3N2KB 3F6MA 3VTIC 5ITZA 3SIVA 2ZVYA 5HP7A 1JJ2F 4TV9B 4G4YA 5CB4B 4KWEA 3CCQF 4YJ3A 5EB1B 3LWVC 4DRXB 3VYSC 4YJ2A 1KD1H 4O4IA 3C9UA 4O2AA 5IYZA 3L7QA 3WGNA 3ZOPA 1UI9A 4RHAA 4X3LA 2GLZA 5EO3A 1SZQA
chains in the Genus database with same CATH topology
3B6NA 1T0AA 1GX1A 1VH8A 2PMPA 1VHAA 1IV2A 3JVHA 3P10A 1U43A 4C8GA 3EORA 2AMTA 3QHDA 3MBMA 5B8FA 3FBAA 1JN1A 3RE3A 3F6MA 4C82A 4C81A 1U3LA 3K2XA 1H48A 3F0EA 3F0FA 1KNJA 1H47A 1IV4A 3ESJA 3F0GA 2GZLA 1U40A 3GHZA 1W55A 3Q8HA 1JY8A 1KNKA 1W57A 3IEQA 3ELCA 3F0DA 3FPIA 2UZHA 3ERNA 3P0ZA 4C8EA 3K14A 3KE1A 3T80A 4C8IA 3IKFA 1U3PA 1YQNA 3IEWA 1IV3A 3IKEA 1IV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6N A;  1T0A A;  1GX1 A;  1VH8 A;  2PMP A;  1VHA A;  1IV2 A;  3JVH A;  3P10 A;  1U43 A;  4C8G A;  3EOR A;  2AMT A;  3QHD A;  3MBM A;  5B8F A;  3FBA A;  1JN1 A;  3RE3 A;  3F6M A;  4C82 A;  4C81 A;  1U3L A;  3K2X A;  1H48 A;  3F0E A;  3F0F A;  1KNJ A;  1H47 A;  1IV4 A;  3ESJ A;  3F0G A;  2GZL A;  1U40 A;  3GHZ A;  1W55 A;  3Q8H A;  1JY8 A;  1KNK A;  1W57 A;  3IEQ A;  3ELC A;  3F0D A;  3FPI A;  2UZH A;  3ERN A;  3P0Z A;  4C8E A;  3K14 A;  3KE1 A;  3T80 A;  4C8I A;  3IKF A;  1U3P A;  1YQN A;  3IEW A;  1IV3 A;  3IKE A;  1IV1 A; 
#chains in the Genus database with same CATH topology
 4ZK7 A;  1VHA A;  4X1K B;  5AVM A;  5JVD B;  3C9R A;  3LME A;  1W59 A;  1VQ5 F;  4I50 B;  1QVG F;  2ZAU A;  4ZI7 A;  4U3J A;  3TD5 A;  4DRX A;  1K9M H;  1VQ4 F;  1VQK F;  3N4Z A;  1E7K A;  3JAT A;  3OW2 F;  1X7P A;  1KQS F;  5LXT B;  3S0H A;  3M1X A;  3WPW A;  2Z01 A;  4HNA B;  1VQ8 F;  3V7Q A;  5IJ0 A;  4C8I A;  1VQO F;  4FFB B;  4O4L B;  3P10 A;  3LWP C;  4O4I B;  3JAL A;  1JFF A;  5HWE A;  3HKB A;  3JAW A;  5CB4 A;  1NQ3 A;  1U40 A;  1QD9 A;  3N4Y A;  3RYI B;  5EZY B;  5JCO C;  4F6R B;  3I55 F;  1PXW A;  1GO0 A;  1ODE A;  4TV8 A;  2EWC A;  3S0W A;  1Z5V A;  5FJ4 C;  2UYJ A;  4IIJ B;  4X1Y A;  3FD6 A;  1VQP F;  2YYE A;  5CA1 A;  1IV3 A;  3HKD A;  1FNJ A;  1YI2 F;  5JH7 A;  2Q1X A;  1VQ7 F;  4BT7 A;  1M90 H;  2RHL A;  3CCV F;  2MQE A;  3V4D A;  2QA4 F;  3TD3 A;  5JQG B;  3CCS F;  2BTO A;  3E1Y A;  1Q82 H;  3WPX A;  4O2B B;  2HS0 A;  2H6L A;  3LDT A;  3WGM A;  3RYC B;  3J7A R;  3VOA A;  1W5A A;  3N2G A;  4NQ3 A;  5KMG A;  4EI8 A;  1T0K B;  3QUW A;  2UYK A;  3RYC A;  2HP0 A;  4X1Y B;  3J81 M;  3CCE F;  4X3M A;  3T80 A;  5LA6 B;  5DCV A;  1RQ2 A;  5G4V C;  3HKE B;  2R6R 1;  4LNU B;  3JCM M;  5JQG A;  1K73 H;  2H8C A;  5GIN C;  2BTU A;  4G4X A;  2HS4 A;  3QHD A;  4I55 B;  2DT4 A;  3RYH A;  5KX5 B;  2BTQ B;  3MCA B;  1H48 A;  1IV4 A;  2AIF A;  1VQV A;  4LNU A;  3VIU A;  4I4T B;  1W41 A;  3MCQ A;  3TD4 A;  4C8E A;  4TZZ A;  4F6R A;  5GON B;  5JCO A;  3LYB A;  3RYF B;  5J2T B;  3J80 M;  2OTL F;  5J2U A;  2UYN A;  3U0O A;  2LBW A;  3CME F;  3UT5 B;  5A2Q M;  4IHJ A;  3IMP A;  3NMU C;  4B45 A;  1ZWZ A;  4B62 A;  3Q8H A;  1Q7Y H;  4O4J A;  5LXT A;  2KG4 A;  3HTN A;  1QAH A;  4BT4 A;  4G88 A;  2GVI A;  2HQS C;  5IYZ B;  2ZOV A;  1Z5W A;  4O4H B;  3WGL A;  2UYP A;  2QEX F;  5LYJ B;  4BY9 D;  1QVF F;  1PF5 A;  5HY4 A;  4ZOL B;  5LOV B;  1JD1 A;  1W3E X;  2AMT A;  3CPQ A;  1DT9 A;  2WAL A;  5JH7 B;  3F0F A;  3RYI A;  2PHN A;  2KTV A;  4O4L A;  5MN6 A;  4BT2 A;  3ZO8 A;  4U3J B;  2B33 A;  3WXM B;  1Q86 H;  2CHT A;  1W42 A;  3JAR A;  5BMV B;  4TV8 B;  3SIU A;  4B46 A;  1CLI A;  3FD5 A;  3PAF A;  5EYP B;  5C8Y B;  1JFF B;  4G4W A;  1M1K H;  2OHW A;  3S06 A;  3HKC B;  3HKD B;  3M84 A;  5GAN K;  3D01 A;  4C4W C;  1S72 F;  4C82 A;  3CC7 F;  5LP6 B;  1W58 1;  1GZ0 A;  3WGK A;  3F0E A;  1NMU B;  1XRG A;  1W2B F;  1VQ6 F;  1X25 A;  2ALE A;  4ERH A;  5HY0 A;  3K12 A;  1XV2 A;  3KJJ A;  1W5E A;  2HRY A;  5ITZ B;  4G4Z A;  5BMV A;  3V7E A;  2V9Y A;  1RLU A;  4PWT A;  4EI7 A;  3IKE A;  3CCU F;  3M4S A;  3GTZ A;  1T0A A;  2PMP A;  5LP6 A;  3LWR C;  3CCJ F;  2CVL A;  1TUB A;  3OBW A;  1ONI A;  3FFM A;  3C8L A;  4C81 A;  3JAS A;  3N2K A;  1XBI A;  5EB0 A;  4YJ3 B;  2VAW A;  3O85 A;  3MDO A;  3WGJ A;  2DYY A;  2P6Y A;  1H7M A;  3VYU C;  4X1I B;  3S0Y A;  1KC8 H;  4EB6 A;  5IJ9 A;  3P0Z A;  2Z1F A;  2G9I A;  3K14 A;  5CA0 A;  4WBN B;  4G4V A;  2VAP A;  4X1K A;  3B6N A;  3LFO A;  2CW4 A;  1IV2 A;  2CSL A;  3CPW F;  5MN5 A;  1TUB B;  5EYP A;  3NK6 A;  2IQQ A;  1SA0 B;  1CN7 A;  2R75 1;  1FFX A;  1H47 A;  4IHJ B;  5EAZ A;  1YHQ F;  5J2T A;  2IAF A;  1FNK A;  1Q81 H;  3KJK A;  1FSZ A;  2UZH A;  4TUY A;  1YJN F;  4O4J B;  2HVY D;  2LBX A;  3KHN A;  3VCZ A;  2Z1T A;  2VAM A;  4B5C A;  3WJR A;  3LWQ C;  2F9Z C;  3CYQ A;  3PLA C;  3RA6 A;  4NWO B;  3ZP4 A;  2JNB A;  4ZHY B;  5LYJ A;  1RA4 A;  1XHO A;  3OBY A;  3WJQ A;  4EB6 B;  1VQM F;  1TVK A;  2HX0 A;  3OON A;  3RE3 A;  3K2X A;  4R40 B;  4RQO A;  2RHO A;  3C9T A;  4LCK A;  3I3F A;  5EIB D;  3G71 F;  3ZP7 A;  2ZVZ A;  3VYT C;  3K0T A;  1YJ9 F;  5HY2 A;  1UFY A;  2HRU A;  3IEQ A;  1N8R H;  3E22 A;  4BVR A;  2KTU A;  3C9S A;  1W5F A;  2K1S A;  2NMU A;  1VQL F;  2AIZ P;  5HP8 A;  2ZOD A;  1YJW F;  2OTJ F;  1IV1 A;  2UYN B;  4X20 B;  5HXU A;  1VH8 A;  3LWO C;  1DBF A;  1U43 A;  4BT3 A;  5C8Y A;  3R0P A;  1GO1 A;  4ZHQ A;  4E6E A;  1VK3 A;  4ZHV A;  1R1M A;  1OFU A;  5GIP C;  4M8I A;  3JAR B;  4DXD A;  1RQ7 A;  5MN4 A;  3WJP A;  2QTP A;  3VMF B;  4X20 A;  2QI2 A;  3CB2 A;  3JAM M;  2N48 A;  3F0D A;  2I6D A;  3N2G B;  1RLG A;  5EIB C;  3RYH B;  5KX5 A;  1X52 A;  3IKF A;  3IEW A;  2CZW A;  4ZOL A;  5HY1 A;  1Q8R A;  3NK7 A;  1GX1 A;  3HKE A;  1QU9 A;  2VGN A;  1CK2 A;  2CWJ A;  5HXZ A;  4O4H A;  3I7T A;  1U3L A;  3AGK A;  1KNJ A;  5EWR A;  2BO1 A;  3F0G A;  3GHZ A;  3VO8 A;  5KMG B;  2RHJ A;  1W55 A;  1JY8 A;  1YIJ F;  4XCQ A;  3GYQ A;  3NVI B;  3RA5 A;  3ELC A;  4I4T A;  5LOV A;  4BVT A;  3CCM F;  4BT5 A;  3HWU A;  4NUT A;  5EZY A;  5FNV A;  1U3P A;  5LP6 C;  4ZHQ B;  1K8A H;  3JAW B;  3HKB B;  5J2U B;  3D54 A;  2W8B C;  1IPA A;  3VI6 A;  3JAL B;  5IT9 M;  5B8F A;  3D00 A;  1JN1 A;  4BT6 A;  2FC3 A;  2RB9 A;  3CC4 F;  5GIO C;  3CC2 F;  3CG6 A;  5LA6 A;  1NJI H;  2OZB A;  1KNK A;  2Z1E A;  4U39 A;  4TUY B;  3UT5 A;  3ERN A;  5GAP K;  3DC2 A;  3VOB A;  1SDS A;  3KE1 A;  3RYF A;  4O2A B;  4O2B A;  4I55 A;  2VGM A;  2OTM A;  3DDN A;  5FNV B;  5GON A;  2RHH A;  4X1I A;  2ZF8 A;  4C8G A;  3S03 A;  2HS3 A;  3E22 B;  3CCR F;  3EOR A;  3IR9 A;  3MBM A;  5JVD A;  2CHS A;  1W5B A;  1YGY A;  3FBA A;  5IJ0 B;  3S02 A;  3NVK E;  3JAS B;  4BW0 B;  2HP0 B;  3CXC F;  2Z1U A;  3CD6 F;  3JAT B;  4ZHW A;  2LBT A;  2Q1Y A;  1X7O A;  1OAP A;  3ON1 A;  3FPI A;  3G4S F;  2HP3 A;  4HNA A;  3JAK B;  1W40 A;  1SA0 A;  3HJW C;  3HAX D;  2H8E A;  2KGW A;  3G6E F;  3BYQ A;  3CMA F;  2VXY A;  2YXZ A;  3JVH A;  1VQN F;  3KIZ A;  4ZI7 B;  3CCL F;  2LCA A;  3I56 F;  4WBN A;  5CA0 B;  4IIJ A;  5G4U C;  2FGY A;  2GZL A;  1VQ9 F;  3E20 B;  2IG8 A;  1W57 A;  3MQW A;  5FLX M;  1J7H A;  1YIT F;  2L26 A;  3JAK A;  3P4E A;  4BVS A;  1TVK B;  3V3T A;  5IJ9 B;  5CA1 B;  1YQN A;  4YJ2 B;  4I50 A;  1FFX B;  3ESJ A;  4FFB A;  3CYP B;  3QTY A;  4EI9 A;  2I6R A;  4TV9 A;  3HKC A;  1COM A;  4BVQ A;  3N2K B;  3F6M A;  3VTI C;  5ITZ A;  3SIV A;  2ZVY A;  5HP7 A;  1JJ2 F;  4TV9 B;  4G4Y A;  5CB4 B;  4KWE A;  3CCQ F;  4YJ3 A;  5EB1 B;  3LWV C;  4DRX B;  3VYS C;  4YJ2 A;  1KD1 H;  4O4I A;  3C9U A;  4O2A A;  5IYZ A;  3L7Q A;  3WGN A;  3ZOP A;  1UI9 A;  4RHA A;  4X3L A;  2GLZ A;  5EO3 A;  1SZQ A; 
#chains in the Genus database with same CATH homology
 3B6N A;  1T0A A;  1GX1 A;  1VH8 A;  2PMP A;  1VHA A;  1IV2 A;  3JVH A;  3P10 A;  1U43 A;  4C8G A;  3EOR A;  2AMT A;  3QHD A;  3MBM A;  5B8F A;  3FBA A;  1JN1 A;  3RE3 A;  3F6M A;  4C82 A;  4C81 A;  1U3L A;  3K2X A;  1H48 A;  3F0E A;  3F0F A;  1KNJ A;  1H47 A;  1IV4 A;  3ESJ A;  3F0G A;  2GZL A;  1U40 A;  3GHZ A;  1W55 A;  3Q8H A;  1JY8 A;  1KNK A;  1W57 A;  3IEQ A;  3ELC A;  3F0D A;  3FPI A;  2UZH A;  3ERN A;  3P0Z A;  4C8E A;  3K14 A;  3KE1 A;  3T80 A;  4C8I A;  3IKF A;  1U3P A;  1YQN A;  3IEW A;  1IV3 A;  3IKE A;  1IV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...