4BW0B

The molecular recognition of kink turn structure by the l7ae class of proteins
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Recognition of Kink-Turn Structure by the L7Ae Class of Proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna/rna binding protein
molecule keywords HMKT-7
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4bw0B00
2QEXF 1DT9A 3IR9A 3LWOC 3CCVF 1H7MA 1K73H 1CK2A 1W41A 3CPQA 3VI6A 3ON1A 3JAMM 1KD1H 3CMEF 1YIJF 1YHQF 1VQNF 2KTUA 3J80M 3E20B 4X3MA 3RA5A 3WXMB 3JCMM 1Q82H 1VQKF 1SDSA 2OTJF 1VQPF 5GINC 1YITF 5IT9M 3V7QA 1QVFF 3NK6A 1KQSF 2VGMA 3J7AR 3J81M 3CMAF 1E7KA 3CCSF 2CZWA 2BO1A 3N4YA 3CC4F 2LBWA 1X52A 5DCVA 1VQ5F 1VQ6F 4C4WC 1CN7A 3CG6A 5A2QM 4NUTA 1GZ0A 3I55F 3PLAC 3CXCF 1NJIH 3OBWA 3CPWF 2KG4A 2LBXA 3LWQC 3CCJF 3CC7F 3SIVA 2OTLF 1VQ4F 5G4VC 3I56F 3CCQF 3CCUF 5EO3A 1X7OA 2OHWA 3HJWC 2HVYD 1X7PA 5G4UC 3OW2F 2KTVA 1T0KB 3AGKA 5FLXM 3PAFA 1GO1A 1W40A 1W2BF 3HAXD 4X3LA 1W3EX 3FFMA 5FJ4C 1VQ7F 3E1YA 5GAPK 1KC8H 1K9MH 1Q81H 1VQ8F 1RLGA 1VQ9F 3G6EF 3CD6F 1XBIA 3N4ZA 2QI2A 2ALEA 4TZZA 2I6DA 3CCLF 2OZBA 1Q86H 3VMFB 2AIFA 1VQOF 1QVGF 3NMUC 3CCEF 1YJWF 1JJ2F 1M1KH 1M90H 3O85A 1RA4A 3NK7A 1S72F 3CC2F 1W42A 3RA6A 3LWRC 2VGNA 1Q7YH 2FC3A 1NMUB 1ZWZA 3LFOA 1IPAA 3G4SF 3CCMF 1GO0A 3LWPC 2QA4F 4LCKA 2WALA 3GYQA 3V7EA 5GANK 1YJNF 3MCAB 3SIUA 5EWRA 1YJ9F 1VQMF 3NVIB 5GIPC 3G71F 4BW0B 3NVKE 3CCRF 1N8RH 2JNBA 1K8AH 1VQLF 5GIOC 1YI2F 1PXWA 3OBYA 4BY9D 3LWVC
chains in the Genus database with same CATH superfamily
3MCQA 1FSZA 2KGWA 3HTNA 4FFBA 3LWOC 3CYPB 1K73H 3CPQA 2VXYA 3VOAA 3JAMM 2H8EA 3D54A 3JALA 3WGJA 3C9TA 5HY1A 5EYPA 3CYQA 3JAKB 4X3MA 1VQKF 2VAMA 5EB0A 2Z1TA 1VQPF 5GINC 1YITF 2L26A 3NK6A 1KQSF 3LMEA 3CMAF 1Z5WA 5FNVA 4EI8A 2CZWA 3CC4F 3JATA 3VIUA 1JN1A 4BT4A 1TVKA 5DCVA 4PWTA 5EIBD 5JH7A 2UYPA 5LP6A 3VO8A 1QU9A 3ERNA 3P10A 4B62A 1GZ0A 3I55F 1Z5VA 3HKDA 3M84A 1QAHA 5GONB 3TD5A 3CPWF 3HKEB 4X1IA 5EIBC 5MN5A 4ZHVA 3SIVA 2QTPA 1FFXA 1OFUA 3IMPA 1VQ4F 3Q8HA 4WBNA 4C8IA 5EO3A 4O4LA 3VYUC 3C9UA 4E6EA 3HJWC 2YXZA 4IHJB 4LNUB 1X7PA 3I7TA 4F6RA 1W59A 4YJ3B 3S03A 4IIJA 5BMVA 1FNJA 1W3EX 1VQ7F 1W581 2CWJA 4ZOLA 5KMGA 3B6NA 1R1MA 3JASB 4BVSA 3CD6F 1Q81H 1RLGA 2GZLA 3JAWA 2G9IA 2I6DA 3CCLF 1VK3A 2VAPA 1IV2A 1Q86H 5ITZB 3WPWA 2V9YA 3EORA 2Z1FA 1ONIA 2Z01A 1JJ2F 3RYFB 4EB6A 3IKFA 4X20B 1NQ3A 3V4DA 3VOBA 2YYEA 3CC2F 1W42A 3RA6A 4BT2A 2VGNA 2HP3A 4ZI7A 5IJ0A 1NMUB 2HQSC 5JQGB 4I4TB 3HKCA 5LXTB 3G4SF 2HP0B 5C8YA 3GYQA 3UT5A 4ZHQA 2QA4F 3E22B 4G4VA 4C8EA 5JVDB 5EZYB 1UI9A 3C9RA 2BTQB 5EWRA 1JFFA 3T80A 5J2TA 3WPXA 4O4IA 1RQ2A 1VHAA 3NVIB 3G71F 4BW0B 3N2GA 3CCRF 3QTYA 4TV8B 2CSLA 5IYZA 3I3FA 3M1XA 4O2AB 5EAZA 1SA0A 2QEXF 1DT9A 2P6YA 3IR9A 1H7MA 1W41A 1YQNA 3ON1A 4O2AA 1YHQF 5IYZB 1VQNF 2KTUA 3J80M 3GHZA 3E20B 3RA5A 3MQWA 1KNJA 4O4IB 5IT9M 2HRYA 2LBTA 1QVFF 1W5FA 4C82A 3S0WA 3CCSF 2BO1A 3RYCA 3F0DA 3N4YA 1U40A 4XCQA 3E22A 5LOVA 4ERHA 2HS3A 2MQEA 1CN7A 5J2UA 5LP6C 4B5CA 3C8LA 1IV1A 5IJ9B 1NJIH 3TD4A 2H6LA 3F0EA 4O4JB 4TUYA 3CC7F 5ITZA 3CCUF 1ODEA 1SA0B 2PMPA 2CVLA 2BTUA 3JASA 1SZQA 3P0ZA 3WJQA 2AMTA 4R40B 3MDOA 4RQOA 1KNKA 2UYJA 3PAFA 5J2TB 1JFFB 1W40A 4IIJB 3VYSC 2DT4A 1W2BF 5EZYA 3FD6A 5EB1B 5HY0A 5GAPK 1K9MH 4O4JA 1VQ9F 1XBIA 5LXTA 4I4TA 5AVMA 3FBAA 1FFXB 2I6RA 2W8BC 1UFYA 4BVTA 1CLIA 4M8IA 4ZHYB 5J2UB 3JVHA 4B45A 1YJWF 2BTOA 1M90H 3O85A 1QD9A 5GONA 2ZF8A 3F0GA 1T0AA 3D01A 1J7HA 3HKDB 3K12A 3VCZA 2Z1UA 3KIZA 4BVQA 4G4WA 2ZAUA 2ZOVA 2B33A 3ZP7A 3KHNA 2Q1YA 3SIUA 3KJJA 2OTMA 2Z1EA 1YJ9F 2DYYA 5HP8A 4F6RB 5GIPC 1K8AH 4TUYB 2EWCA 1YI2F 2CHSA 3OBYA 3JALB 3LWVC 5IJ9A 2LCAA 3ZO8A 1CK2A 2RHOA 3DC2A 3IEQA 3VI6A 1W57A 3CB2A 3P4EA 3CMEF 3HKEA 4X1IB 3K0TA 2GLZA 5JVDA 3WXMB 1Q82H 3GTZA 5LOVB 4YJ2A 3UT5B 1SDSA 3C9SA 3RYCB 2K1SA 5LP6B 3HKCB 2HX0A 1W55A 2VGMA 3J7AR 5JH7B 4U3JB 4ZI7B 1TVKB 1X52A 2RHJA 3VTIC 4HNAB 1VQ6F 5FNVB 5A2QM 1IV4A 4NUTA 4ZHWA 4G4ZA 1RQ7A 1U3PA 2F9ZC 3OBWA 5EYPB 5MN6A 3JARB 3LYBA 1VQVA 4TV8A 4ZOLB 2R6R1 3N2GB 2OTLF 2CHTA 5G4VC 3I56F 3CCQF 3N2KA 1H47A 4LNUA 4IHJA 3OW2F 4TV9A 2KTVA 4ZHQB 5HXZA 2IQQA 2HP0A 5C8YB 4O4LB 1GO1A 2FGYA 3HAXD 5HY2A 5B8FA 3S0YA 4X3LA 5JQGA 5IJ0B 1JD1A 1KC8H 1VQ8F 1Q8RA 4X20A 4DXDA 2ZVZA 3N4ZA 4EB6B 2ZODA 2OZBA 3RYFA 4G4YA 1QVGF 3V3TA 3D00A 1OAPA 1COMA 3CCEF 5CA1B 3WJPA 4BT6A 3S0HA 3F6MA 1RA4A 3JAWB 3NK7A 2PHNA 5KMGB 3JATB 3LWRC 2UZHA 5KX5B 2H8CA 5HWEA 1ZWZA 5BMVB 3LFOA 5LA6A 3F0FA 2HS4A 3LWPC 4YJ3A 4LCKA 2WALA 2Q1XA 5GANK 2RHLA 1YJNF 3ESJA 3MCAB 5JCOA 1FNKA 2NMUA 4C8GA 1VH8A 2UYNB 3WGMA 1VQMF 2N48A 4WBNB 2HS0A 3NVKE 1N8RH 4EI9A 1IV3A 2R751 1RLUA 5GIOC 1PXWA 3RE3A 4I50B 4O2BA 3R0PA 4BY9D 3IEWA 2RB9A 1TUBA 3CCVF 4DRXB 3BYQA 1KD1H 4I50A 4O2BB 1YIJF 4NQ3A 5HXUA 3FD5A 3JCMM 5HP7A 5CB4A 2OTJF 3S02A 4X1YA 1PF5A 3V7QA 1DBFA 3MBMA 4BT3A 3J81M 1E7KA 1U43A 2LBWA 4G4XA 3JAKA 1VQ5F 5LA6B 4C4WC 3L7QA 3CG6A 5HY4A 5JCOC 3WJRA 4U39A 5CB4B 1W5AA 3PLAC 4FFBB 3QUWA 3CXCF 4ZK7A 1H48A 2KG4A 5LYJA 2LBXA 2RHHA 1GX1A 2IG8A 3S06A 3LWQC 3CCJF 3KE1A 3RYHA 3WGLA 4DRXA 4G88A 4RHAA 4X1KB 2GVIA 1X7OA 1YGYA 2OHWA 3RYIA 3U0OA 3HKBB 2HVYD 4KWEA 4I55A 2HRUA 5G4UC 3HKBA 3VYTC 1T0KB 3AGKA 2UYKA 5FLXM 5CA0B 2IAFA 2VAWA 2UYNA 4X1KA 3FFMA 5FJ4C 4NWOB 4TV9B 3E1YA 3RYHB 4O4HA 3N2KB 1XV2A 3G6EF 4BVRA 2QI2A 2ALEA 4TZZA 2CW4A 3K2XA 3VMFB 2AIFA 1VQOF 5KX5A 3NMUC 1JY8A 3DDNA 3KJKA 1XHOA 3IKEA 2ZVYA 3JARA 1X25A 1M1KH 5CA1A 1S72F 4O4HB 1XRGA 1U3LA 1Q7YH 2FC3A 3FPIA 3HWUA 1IPAA 4HNAA 3LDTA 3QHDA 4X1YB 4BT7A 3ZOPA 3CCMF 5CA0A 3ELCA 4C81A 1GO0A 3TD3A 3V7EA 4I55B 4U3JA 3RYIB 3WGKA 1W5BA 3OONA 4YJ2B 1TUBB 4EI7A 5MN4A 2AIZP 2JNBA 1VQLF 3K14A 3WGNA 5LYJB 1W5EA 3ZP4A 3M4SA 4BT5A 4B46A
chains in the Genus database with same CATH topology
2QEXF 1DT9A 3IR9A 3LWOC 3CCVF 1H7MA 1K73H 1CK2A 1W41A 3CPQA 3VI6A 3ON1A 3JAMM 1KD1H 3CMEF 3CD6F 1YIJF 4NQ3A 1YHQF 5HY1A 1VQNF 2KTUA 2GLZA 5HXUA 3J80M 3E20B 4X3MA 3RA5A 3WXMB 3JCMM 1Q82H 1VQKF 1SDSA 2OTJF 1VQPF 5GINC 1YITF 5IT9M 3V7QA 1QVFF 3NK6A 1KQSF 2VGMA 3J7AR 3J81M 3CMAF 4EI8A 1E7KA 3CCSF 2CZWA 2BO1A 3N4YA 3CC4F 4XCQA 2LBWA 1X52A 5DCVA 1VQ5F 1VQ6F 4C4WC 1CN7A 3CG6A 5HY4A 5A2QM 4NUTA 1GZ0A 3I55F 3PLAC 3CXCF 2F9ZC 1NJIH 3OBWA 3CPWF 2KG4A 2LBXA 3LWQC 3CCJF 3CC7F 3SIVA 2OTLF 1VQ4F 5G4VC 3I56F 3CCQF 3CCUF 5EO3A 1X7OA 2OHWA 3HJWC 2HVYD 1X7PA 5G4UC 3OW2F 5HXZA 2KTVA 1T0KB 3AGKA 5FLXM 3PAFA 1GO1A 2FGYA 1W40A 1W2BF 3HAXD 5HY2A 4X3LA 1W3EX 3FFMA 5FJ4C 1VQ7F 3E1YA 4BVSA 5HY0A 5GAPK 1KC8H 1Q81H 1K9MH 1VQ8F 1VQ9F 3G6EF 1RLGA 1XBIA 4BVRA 3N4ZA 2QI2A 2ALEA 4TZZA 2I6DA 3CCLF 2OZBA 1Q86H 3VMFB 2AIFA 1VQOF 1QVGF 3V3TA 4BVTA 3NMUC 3D00A 3CCEF 1YJWF 1JJ2F 1M1KH 1M90H 3O85A 1RA4A 3NK7A 1S72F 3CC2F 1W42A 3RA6A 3LWRC 2VGNA 1Q7YH 2FC3A 1NMUB 5HWEA 1ZWZA 3LFOA 1IPAA 4BVQA 3G4SF 3CCMF 1GO0A 3LWPC 2QA4F 4LCKA 2WALA 3GYQA 3V7EA 5GANK 1YJNF 3MCAB 3SIUA 5EWRA 1YJ9F 1VQMF 3NVIB 5GIPC 3G71F 4BW0B 4EI7A 3NVKE 3CCRF 1N8RH 2JNBA 4EI9A 1K8AH 1VQLF 5GIOC 1YI2F 1PXWA 3OBYA 4BY9D 3LWVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX F;  1DT9 A;  3IR9 A;  3LWO C;  3CCV F;  1H7M A;  1K73 H;  1CK2 A;  1W41 A;  3CPQ A;  3VI6 A;  3ON1 A;  3JAM M;  1KD1 H;  3CME F;  1YIJ F;  1YHQ F;  1VQN F;  2KTU A;  3J80 M;  3E20 B;  4X3M A;  3RA5 A;  3WXM B;  3JCM M;  1Q82 H;  1VQK F;  1SDS A;  2OTJ F;  1VQP F;  5GIN C;  1YIT F;  5IT9 M;  3V7Q A;  1QVF F;  3NK6 A;  1KQS F;  2VGM A;  3J7A R;  3J81 M;  3CMA F;  1E7K A;  3CCS F;  2CZW A;  2BO1 A;  3N4Y A;  3CC4 F;  2LBW A;  1X52 A;  5DCV A;  1VQ5 F;  1VQ6 F;  4C4W C;  1CN7 A;  3CG6 A;  5A2Q M;  4NUT A;  1GZ0 A;  3I55 F;  3PLA C;  3CXC F;  1NJI H;  3OBW A;  3CPW F;  2KG4 A;  2LBX A;  3LWQ C;  3CCJ F;  3CC7 F;  3SIV A;  2OTL F;  1VQ4 F;  5G4V C;  3I56 F;  3CCQ F;  3CCU F;  5EO3 A;  1X7O A;  2OHW A;  3HJW C;  2HVY D;  1X7P A;  5G4U C;  3OW2 F;  2KTV A;  1T0K B;  3AGK A;  5FLX M;  3PAF A;  1GO1 A;  1W40 A;  1W2B F;  3HAX D;  4X3L A;  1W3E X;  3FFM A;  5FJ4 C;  1VQ7 F;  3E1Y A;  5GAP K;  1KC8 H;  1K9M H;  1Q81 H;  1VQ8 F;  1RLG A;  1VQ9 F;  3G6E F;  3CD6 F;  1XBI A;  3N4Z A;  2QI2 A;  2ALE A;  4TZZ A;  2I6D A;  3CCL F;  2OZB A;  1Q86 H;  3VMF B;  2AIF A;  1VQO F;  1QVG F;  3NMU C;  3CCE F;  1YJW F;  1JJ2 F;  1M1K H;  1M90 H;  3O85 A;  1RA4 A;  3NK7 A;  1S72 F;  3CC2 F;  1W42 A;  3RA6 A;  3LWR C;  2VGN A;  1Q7Y H;  2FC3 A;  1NMU B;  1ZWZ A;  3LFO A;  1IPA A;  3G4S F;  3CCM F;  1GO0 A;  3LWP C;  2QA4 F;  4LCK A;  2WAL A;  3GYQ A;  3V7E A;  5GAN K;  1YJN F;  3MCA B;  3SIU A;  5EWR A;  1YJ9 F;  1VQM F;  3NVI B;  5GIP C;  3G71 F;  4BW0 B;  3NVK E;  3CCR F;  1N8R H;  2JNB A;  1K8A H;  1VQL F;  5GIO C;  1YI2 F;  1PXW A;  3OBY A;  4BY9 D;  3LWV C; 
#chains in the Genus database with same CATH topology
 3MCQ A;  1FSZ A;  2KGW A;  3HTN A;  4FFB A;  3LWO C;  3CYP B;  1K73 H;  3CPQ A;  2VXY A;  3VOA A;  3JAM M;  2H8E A;  3D54 A;  3JAL A;  3WGJ A;  3C9T A;  5HY1 A;  5EYP A;  3CYQ A;  3JAK B;  4X3M A;  1VQK F;  2VAM A;  5EB0 A;  2Z1T A;  1VQP F;  5GIN C;  1YIT F;  2L26 A;  3NK6 A;  1KQS F;  3LME A;  3CMA F;  1Z5W A;  5FNV A;  4EI8 A;  2CZW A;  3CC4 F;  3JAT A;  3VIU A;  1JN1 A;  4BT4 A;  1TVK A;  5DCV A;  4PWT A;  5EIB D;  5JH7 A;  2UYP A;  5LP6 A;  3VO8 A;  1QU9 A;  3ERN A;  3P10 A;  4B62 A;  1GZ0 A;  3I55 F;  1Z5V A;  3HKD A;  3M84 A;  1QAH A;  5GON B;  3TD5 A;  3CPW F;  3HKE B;  4X1I A;  5EIB C;  5MN5 A;  4ZHV A;  3SIV A;  2QTP A;  1FFX A;  1OFU A;  3IMP A;  1VQ4 F;  3Q8H A;  4WBN A;  4C8I A;  5EO3 A;  4O4L A;  3VYU C;  3C9U A;  4E6E A;  3HJW C;  2YXZ A;  4IHJ B;  4LNU B;  1X7P A;  3I7T A;  4F6R A;  1W59 A;  4YJ3 B;  3S03 A;  4IIJ A;  5BMV A;  1FNJ A;  1W3E X;  1VQ7 F;  1W58 1;  2CWJ A;  4ZOL A;  5KMG A;  3B6N A;  1R1M A;  3JAS B;  4BVS A;  3CD6 F;  1Q81 H;  1RLG A;  2GZL A;  3JAW A;  2G9I A;  2I6D A;  3CCL F;  1VK3 A;  2VAP A;  1IV2 A;  1Q86 H;  5ITZ B;  3WPW A;  2V9Y A;  3EOR A;  2Z1F A;  1ONI A;  2Z01 A;  1JJ2 F;  3RYF B;  4EB6 A;  3IKF A;  4X20 B;  1NQ3 A;  3V4D A;  3VOB A;  2YYE A;  3CC2 F;  1W42 A;  3RA6 A;  4BT2 A;  2VGN A;  2HP3 A;  4ZI7 A;  5IJ0 A;  1NMU B;  2HQS C;  5JQG B;  4I4T B;  3HKC A;  5LXT B;  3G4S F;  2HP0 B;  5C8Y A;  3GYQ A;  3UT5 A;  4ZHQ A;  2QA4 F;  3E22 B;  4G4V A;  4C8E A;  5JVD B;  5EZY B;  1UI9 A;  3C9R A;  2BTQ B;  5EWR A;  1JFF A;  3T80 A;  5J2T A;  3WPX A;  4O4I A;  1RQ2 A;  1VHA A;  3NVI B;  3G71 F;  4BW0 B;  3N2G A;  3CCR F;  3QTY A;  4TV8 B;  2CSL A;  5IYZ A;  3I3F A;  3M1X A;  4O2A B;  5EAZ A;  1SA0 A;  2QEX F;  1DT9 A;  2P6Y A;  3IR9 A;  1H7M A;  1W41 A;  1YQN A;  3ON1 A;  4O2A A;  1YHQ F;  5IYZ B;  1VQN F;  2KTU A;  3J80 M;  3GHZ A;  3E20 B;  3RA5 A;  3MQW A;  1KNJ A;  4O4I B;  5IT9 M;  2HRY A;  2LBT A;  1QVF F;  1W5F A;  4C82 A;  3S0W A;  3CCS F;  2BO1 A;  3RYC A;  3F0D A;  3N4Y A;  1U40 A;  4XCQ A;  3E22 A;  5LOV A;  4ERH A;  2HS3 A;  2MQE A;  1CN7 A;  5J2U A;  5LP6 C;  4B5C A;  3C8L A;  1IV1 A;  5IJ9 B;  1NJI H;  3TD4 A;  2H6L A;  3F0E A;  4O4J B;  4TUY A;  3CC7 F;  5ITZ A;  3CCU F;  1ODE A;  1SA0 B;  2PMP A;  2CVL A;  2BTU A;  3JAS A;  1SZQ A;  3P0Z A;  3WJQ A;  2AMT A;  4R40 B;  3MDO A;  4RQO A;  1KNK A;  2UYJ A;  3PAF A;  5J2T B;  1JFF B;  1W40 A;  4IIJ B;  3VYS C;  2DT4 A;  1W2B F;  5EZY A;  3FD6 A;  5EB1 B;  5HY0 A;  5GAP K;  1K9M H;  4O4J A;  1VQ9 F;  1XBI A;  5LXT A;  4I4T A;  5AVM A;  3FBA A;  1FFX B;  2I6R A;  2W8B C;  1UFY A;  4BVT A;  1CLI A;  4M8I A;  4ZHY B;  5J2U B;  3JVH A;  4B45 A;  1YJW F;  2BTO A;  1M90 H;  3O85 A;  1QD9 A;  5GON A;  2ZF8 A;  3F0G A;  1T0A A;  3D01 A;  1J7H A;  3HKD B;  3K12 A;  3VCZ A;  2Z1U A;  3KIZ A;  4BVQ A;  4G4W A;  2ZAU A;  2ZOV A;  2B33 A;  3ZP7 A;  3KHN A;  2Q1Y A;  3SIU A;  3KJJ A;  2OTM A;  2Z1E A;  1YJ9 F;  2DYY A;  5HP8 A;  4F6R B;  5GIP C;  1K8A H;  4TUY B;  2EWC A;  1YI2 F;  2CHS A;  3OBY A;  3JAL B;  3LWV C;  5IJ9 A;  2LCA A;  3ZO8 A;  1CK2 A;  2RHO A;  3DC2 A;  3IEQ A;  3VI6 A;  1W57 A;  3CB2 A;  3P4E A;  3CME F;  3HKE A;  4X1I B;  3K0T A;  2GLZ A;  5JVD A;  3WXM B;  1Q82 H;  3GTZ A;  5LOV B;  4YJ2 A;  3UT5 B;  1SDS A;  3C9S A;  3RYC B;  2K1S A;  5LP6 B;  3HKC B;  2HX0 A;  1W55 A;  2VGM A;  3J7A R;  5JH7 B;  4U3J B;  4ZI7 B;  1TVK B;  1X52 A;  2RHJ A;  3VTI C;  4HNA B;  1VQ6 F;  5FNV B;  5A2Q M;  1IV4 A;  4NUT A;  4ZHW A;  4G4Z A;  1RQ7 A;  1U3P A;  2F9Z C;  3OBW A;  5EYP B;  5MN6 A;  3JAR B;  3LYB A;  1VQV A;  4TV8 A;  4ZOL B;  2R6R 1;  3N2G B;  2OTL F;  2CHT A;  5G4V C;  3I56 F;  3CCQ F;  3N2K A;  1H47 A;  4LNU A;  4IHJ A;  3OW2 F;  4TV9 A;  2KTV A;  4ZHQ B;  5HXZ A;  2IQQ A;  2HP0 A;  5C8Y B;  4O4L B;  1GO1 A;  2FGY A;  3HAX D;  5HY2 A;  5B8F A;  3S0Y A;  4X3L A;  5JQG A;  5IJ0 B;  1JD1 A;  1KC8 H;  1VQ8 F;  1Q8R A;  4X20 A;  4DXD A;  2ZVZ A;  3N4Z A;  4EB6 B;  2ZOD A;  2OZB A;  3RYF A;  4G4Y A;  1QVG F;  3V3T A;  3D00 A;  1OAP A;  1COM A;  3CCE F;  5CA1 B;  3WJP A;  4BT6 A;  3S0H A;  3F6M A;  1RA4 A;  3JAW B;  3NK7 A;  2PHN A;  5KMG B;  3JAT B;  3LWR C;  2UZH A;  5KX5 B;  2H8C A;  5HWE A;  1ZWZ A;  5BMV B;  3LFO A;  5LA6 A;  3F0F A;  2HS4 A;  3LWP C;  4YJ3 A;  4LCK A;  2WAL A;  2Q1X A;  5GAN K;  2RHL A;  1YJN F;  3ESJ A;  3MCA B;  5JCO A;  1FNK A;  2NMU A;  4C8G A;  1VH8 A;  2UYN B;  3WGM A;  1VQM F;  2N48 A;  4WBN B;  2HS0 A;  3NVK E;  1N8R H;  4EI9 A;  1IV3 A;  2R75 1;  1RLU A;  5GIO C;  1PXW A;  3RE3 A;  4I50 B;  4O2B A;  3R0P A;  4BY9 D;  3IEW A;  2RB9 A;  1TUB A;  3CCV F;  4DRX B;  3BYQ A;  1KD1 H;  4I50 A;  4O2B B;  1YIJ F;  4NQ3 A;  5HXU A;  3FD5 A;  3JCM M;  5HP7 A;  5CB4 A;  2OTJ F;  3S02 A;  4X1Y A;  1PF5 A;  3V7Q A;  1DBF A;  3MBM A;  4BT3 A;  3J81 M;  1E7K A;  1U43 A;  2LBW A;  4G4X A;  3JAK A;  1VQ5 F;  5LA6 B;  4C4W C;  3L7Q A;  3CG6 A;  5HY4 A;  5JCO C;  3WJR A;  4U39 A;  5CB4 B;  1W5A A;  3PLA C;  4FFB B;  3QUW A;  3CXC F;  4ZK7 A;  1H48 A;  2KG4 A;  5LYJ A;  2LBX A;  2RHH A;  1GX1 A;  2IG8 A;  3S06 A;  3LWQ C;  3CCJ F;  3KE1 A;  3RYH A;  3WGL A;  4DRX A;  4G88 A;  4RHA A;  4X1K B;  2GVI A;  1X7O A;  1YGY A;  2OHW A;  3RYI A;  3U0O A;  3HKB B;  2HVY D;  4KWE A;  4I55 A;  2HRU A;  5G4U C;  3HKB A;  3VYT C;  1T0K B;  3AGK A;  2UYK A;  5FLX M;  5CA0 B;  2IAF A;  2VAW A;  2UYN A;  4X1K A;  3FFM A;  5FJ4 C;  4NWO B;  4TV9 B;  3E1Y A;  3RYH B;  4O4H A;  3N2K B;  1XV2 A;  3G6E F;  4BVR A;  2QI2 A;  2ALE A;  4TZZ A;  2CW4 A;  3K2X A;  3VMF B;  2AIF A;  1VQO F;  5KX5 A;  3NMU C;  1JY8 A;  3DDN A;  3KJK A;  1XHO A;  3IKE A;  2ZVY A;  3JAR A;  1X25 A;  1M1K H;  5CA1 A;  1S72 F;  4O4H B;  1XRG A;  1U3L A;  1Q7Y H;  2FC3 A;  3FPI A;  3HWU A;  1IPA A;  4HNA A;  3LDT A;  3QHD A;  4X1Y B;  4BT7 A;  3ZOP A;  3CCM F;  5CA0 A;  3ELC A;  4C81 A;  1GO0 A;  3TD3 A;  3V7E A;  4I55 B;  4U3J A;  3RYI B;  3WGK A;  1W5B A;  3OON A;  4YJ2 B;  1TUB B;  4EI7 A;  5MN4 A;  2AIZ P;  2JNB A;  1VQL F;  3K14 A;  3WGN A;  5LYJ B;  1W5E A;  3ZP4 A;  3M4S A;  4BT5 A;  4B46 A; 
#chains in the Genus database with same CATH homology
 2QEX F;  1DT9 A;  3IR9 A;  3LWO C;  3CCV F;  1H7M A;  1K73 H;  1CK2 A;  1W41 A;  3CPQ A;  3VI6 A;  3ON1 A;  3JAM M;  1KD1 H;  3CME F;  3CD6 F;  1YIJ F;  4NQ3 A;  1YHQ F;  5HY1 A;  1VQN F;  2KTU A;  2GLZ A;  5HXU A;  3J80 M;  3E20 B;  4X3M A;  3RA5 A;  3WXM B;  3JCM M;  1Q82 H;  1VQK F;  1SDS A;  2OTJ F;  1VQP F;  5GIN C;  1YIT F;  5IT9 M;  3V7Q A;  1QVF F;  3NK6 A;  1KQS F;  2VGM A;  3J7A R;  3J81 M;  3CMA F;  4EI8 A;  1E7K A;  3CCS F;  2CZW A;  2BO1 A;  3N4Y A;  3CC4 F;  4XCQ A;  2LBW A;  1X52 A;  5DCV A;  1VQ5 F;  1VQ6 F;  4C4W C;  1CN7 A;  3CG6 A;  5HY4 A;  5A2Q M;  4NUT A;  1GZ0 A;  3I55 F;  3PLA C;  3CXC F;  2F9Z C;  1NJI H;  3OBW A;  3CPW F;  2KG4 A;  2LBX A;  3LWQ C;  3CCJ F;  3CC7 F;  3SIV A;  2OTL F;  1VQ4 F;  5G4V C;  3I56 F;  3CCQ F;  3CCU F;  5EO3 A;  1X7O A;  2OHW A;  3HJW C;  2HVY D;  1X7P A;  5G4U C;  3OW2 F;  5HXZ A;  2KTV A;  1T0K B;  3AGK A;  5FLX M;  3PAF A;  1GO1 A;  2FGY A;  1W40 A;  1W2B F;  3HAX D;  5HY2 A;  4X3L A;  1W3E X;  3FFM A;  5FJ4 C;  1VQ7 F;  3E1Y A;  4BVS A;  5HY0 A;  5GAP K;  1KC8 H;  1Q81 H;  1K9M H;  1VQ8 F;  1VQ9 F;  3G6E F;  1RLG A;  1XBI A;  4BVR A;  3N4Z A;  2QI2 A;  2ALE A;  4TZZ A;  2I6D A;  3CCL F;  2OZB A;  1Q86 H;  3VMF B;  2AIF A;  1VQO F;  1QVG F;  3V3T A;  4BVT A;  3NMU C;  3D00 A;  3CCE F;  1YJW F;  1JJ2 F;  1M1K H;  1M90 H;  3O85 A;  1RA4 A;  3NK7 A;  1S72 F;  3CC2 F;  1W42 A;  3RA6 A;  3LWR C;  2VGN A;  1Q7Y H;  2FC3 A;  1NMU B;  5HWE A;  1ZWZ A;  3LFO A;  1IPA A;  4BVQ A;  3G4S F;  3CCM F;  1GO0 A;  3LWP C;  2QA4 F;  4LCK A;  2WAL A;  3GYQ A;  3V7E A;  5GAN K;  1YJN F;  3MCA B;  3SIU A;  5EWR A;  1YJ9 F;  1VQM F;  3NVI B;  5GIP C;  3G71 F;  4BW0 B;  4EI7 A;  3NVK E;  3CCR F;  1N8R H;  2JNB A;  4EI9 A;  1K8A H;  1VQL F;  5GIO C;  1YI2 F;  1PXW A;  3OBY A;  4BY9 D;  3LWV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...