4BW0B

The molecular recognition of kink turn structure by the l7ae class of proteins
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
b'SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMKT-7
publication title The Molecular Recognition of Kink-Turn Structure by the L7Ae Class of Proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna/rna binding protein
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4bw0B00
1ZWZA 3CCSF 2AIFA 1VQNF 1IPAA 4C4WC 3CCMF 5G4VC 2VGNA 1YJNF 5DCVA 1W41A 3LFOA 3CCRF 2OZBA 5GIPC 3CPQA 3FFMA 3J7AR 3CCUF 1M90H 1YIJF 2HVYD 4TZZA 4X3MA 1X7PA 3G4SF 3G71F 2JNBA 3E20B 5GANK 2I6DA 3NVKE 3CPWF 4LCKA 1VQOF 4NUTA 3NVIB 3V7QA 1W2BF 2LBWA 5GIOC 1H7MA 1E7KA 3ON1A 3CC2F 2LBXA 1Q7YH 2QI2A 3JCMM 1VQ6F 3CCJF 1VQ7F 1QVGF 5FLXM 1Q81H 1CK2A 1XBIA 1JJ2F 1Q86H 3OW2F 3CCLF 1VQKF 1X7OA 3MCAB 1K73H 1GO0A 3CG6A 3OBYA 1W40A 1NMUB 1YITF 4BW0B 3CXCF 2QEXF 1YJWF 5EWRA 1Q82H 3CC7F 5GINC 1KQSF 5G4UC 2KTVA 3AGKA 2VGMA 1SDSA 3HAXD 3HJWC 3V7EA 3N4ZA 2QA4F 2CZWA 1N8RH 1VQ5F 3NK7A 2OTLF 1VQ9F 3PAFA 2ALEA 3CCVF 3OBWA 3J81M 4BY9D 3NK6A 3G6EF 3CMAF 3CMEF 5IT9M 1RA4A 1YHQF 3CD6F 3I56F 1DT9A 2KG4A 3CCQF 4X3LA 3VMFB 3SIVA 3NMUC 2BO1A 1M1KH 1VQMF 1VQ8F 3IR9A 3O85A 1VQLF 3GYQA 3E1YA 1YI2F 2FC3A 1X52A 3LWQC 1QVFF 3I55F 3J80M 1GZ0A 3JAMM 3RA6A 3PLAC 2OHWA 3RA5A 1VQPF 5GAPK 2KTUA 1W42A 1YJ9F 1PXWA 3LWOC 5EO3A 3SIUA 1T0KB 3N4YA 3VI6A 1W3EX 1VQ4F 3WXMB 3LWVC 1KD1H 5FJ4C 1CN7A 1K9MH 1RLGA 2WALA 1K8AH 2OTJF 5A2QM 1NJIH 1KC8H 3LWRC 3CCEF 1S72F 3CC4F 1GO1A 3LWPC
chains in the Genus database with same CATH superfamily
4ZI7A 2AIFA 3RYIA 3S0HA 5G4VC 2CWJA 3KIZA 3V3TA 1SA0A 5DCVA 3WGKA 3S02A 1X7PA 5GANK 4M8IA 1W5AA 4ZHVA 5JH7B 4ZHQA 5LP6C 1Z5WA 3V4DA 4NWOB 5HY0A 4BVTA 1E7KA 3I7TA 3ON1A 4YJ3A 1Q7YH 2Z1EA 4X20A 1QAHA 4C8IA 1XBIA 1JJ2F 1J7HA 3OW2F 1H47A 4I55B 3D01A 2FGYA 1X7OA 5LXTB 1XRGA 3M1XA 4EI9A 3LMEA 5IYZB 2HP0B 3CG6A 2RB9A 1W40A 1YITF 4BW0B 2ZVYA 3CC7F 1JFFB 4X1IA 2UYKA 2VAWA 1W581 2GZLA 2UYPA 3VCZA 5GONB 3JAWA 3FD5A 4X1KB 2UYJA 5C8YB 4EI8A 3NK7A 4ZI7B 3RYIB 5J2TA 2Z01A 1U3LA 3G6EF 1SA0B 4C81A 1RA4A 3CD6F 2ZODA 3I56F 4F6RA 4IIJA 4G4WA 5EIBC 3SIVA 3JVHA 3BYQA 3NMUC 3ZOPA 5EYPA 4ZHQB 1M1KH 3P0ZA 2R751 2RHLA 3D54A 1VQLF 3E1YA 3GYQA 1YI2F 2G9IA 3I55F 4YJ3B 3CYQA 3RA6A 2BTOA 4XCQA 3MDOA 4X20B 2KTUA 3GHZA 3VOAA 3WJPA 3VO8A 3I3FA 3WGLA 5JVDA 4KWEA 1T0KB 3N4YA 1W3EX 2AIZP 1TVKA 5EAZA 1VQ4F 1KD1H 1CN7A 2EWCA 2GLZA 2WALA 5IJ9A 4O4JA 1NJIH 1Q8RA 3LWPC 3OONA 4X1IB 2RHJA 3CCSF 1VQNF 1UI9A 5FNVA 1FNKA 4B45A 5MN4A 1YJNF 3F0GA 3LFOA 3JAWB 3P10A 3GTZA 3J7AR 3CCUF 1YIJF 4TZZA 3G71F 2UZHA 3M84A 2JNBA 3IEQA 1OFUA 5J2TB 2CSLA 4O4LA 4LCKA 1VQOF 3MBMA 5LYJA 4BT7A 3NVIB 1W2BF 4F6RB 4WBNA 4IIJB 1VQVA 1VQ7F 2LBTA 5EYPB 5FLXM 2PMPA 4ZHWA 2CW4A 3WJQA 1TUBA 4G88A 3HKDA 1RLUA 4B5CA 5JCOC 5MN6A 3MCAB 1K73H 4B62A 1NQ3A 3HWUA 3IKEA 3WJRA 3RYFA 2ZOVA 3QUWA 4G4VA 3ZO8A 5JVDB 5EWRA 3VYTC 3B6NA 2KGWA 1TVKB 2KTVA 3ERNA 2DT4A 4YJ2A 3MCQA 4HNAA 3HAXD 3V7EA 3N4ZA 5IJ9B 3RYCA 1KNKA 1VH8A 4O4JB 3UT5A 1VQ5F 1FNJA 2HP3A 1U40A 3PAFA 2ALEA 3C9RA 3JALA 5FNVB 3J81M 2CHSA 4TUYA 4G4ZA 5IT9M 4O2BA 4IHJA 2OTMA 3JATA 4I4TA 3IMPA 4DXDA 1IV2A 5EB1B 5EIBD 5LA6A 2BO1A 4O4LB 1W55A 1UFYA 1FSZA 1VQ8F 5LYJB 3IR9A 2QTPA 3O85A 4FFBA 1FFXA 5IJ0A 4U3JA 2ZAUA 3LWQC 2MQEA 4WBNB 3HKCA 1GZ0A 3M4SA 2IQQA 5GAPK 1W42A 2NMUA 2HRYA 2CVLA 1XV2A 5KMGA 1TUBB 3HKDB 4BT6A 2ZF8A 3WXMB 3RYFB 4O4HA 1YQNA 1K9MH 1RLGA 2Z1UA 3F0FA 2OTJF 1K8AH 1VHAA 5A2QM 3QHDA 3C9SA 1KC8H 2V9YA 2Z1FA 3JASA 4U39A 1CK2A 2RHHA 3WPWA 1IPAA 1SZQA 4C4WC 4YJ2B 3ELCA 3VIUA 2OZBA 4HNAB 2UYNA 3CPQA 3RYCB 4ZK7A 4B46A 4X3MA 3G4SF 3UT5B 5J2UA 1H48A 3D00A 2I6DA 1ONIA 1OAPA 3JALB 3WGNA 3VTIC 1IV4A 3R0PA 4TUYB 5EZYA 3VYUC 4I50A 4NUTA 4O2BB 4IHJB 3U0OA 3V7QA 2LBWA 3JATB 5GIOC 4I4TB 3N2KA 4DRXA 3FBAA 1KNJA 2QI2A 5BMVA 3IKFA 5LA6B 5LOVA 1VQ6F 3CB2A 1QVGF 1Q81H 2I6RA 5HXUA 1FFXB 4FFBB 5IJ0B 2GVIA 1Q86H 4U3JB 3VOBA 3CCLF 1DBFA 2Q1XA 1VQKF 1W57A 3P4EA 3HKCB 4BT3A 1PF5A 2RHOA 1GO0A 3FPIA 2HQSC 3OBYA 1NMUB 4TV9A 5KMGB 4BT4A 3CXCF 1YJWF 1Q82H 4BT2A 2HS4A 5G4UC 1Z5VA 1QU9A 4O4HB 2VGMA 1SDSA 3HJWC 3F6MA 4LNUA 2CHTA 3KJKA 4NQ3A 5HWEA 1N8RH 3FD6A 3C9TA 1W5BA 3JASB 4RQOA 2OTLF 3CCVF 3OBWA 3MQWA 3NK6A 1YGYA 5HP8A 3N2GA 2BTQB 3CMEF 2UYNB 2F9ZC 5EB0A 1DT9A 5ITZA 4RHAA 5HY2A 2KG4A 5J2UB 4BT5A 1JY8A 4X3LA 3DDNA 3K2XA 2B33A 4C82A 4O2AA 5EZYB 1VQMF 3DC2A 4I50B 5LP6A 2FC3A 1X52A 3F0DA 3L7QA 3N2KB 3T80A 4DRXB 3J80M 5BMVB 5LOVB 3JAMM 2OHWA 3RA5A 3WGMA 1VQPF 2PHNA 3K12A 1RQ2A 1PXWA 5JQGA 3SIUA 5EO3A 3C8LA 3KJJA 3TD4A 3K0TA 4G4YA 1U3PA 2N48A 3ZP7A 1IV3A 4O4IA 5KX5A 1IV1A 4TV9B 3CC4F 1S72F 3RE3A 1GO1A 4ERHA 2HX0A 1ZWZA 4BVSA 4EB6A 3CCMF 3TD5A 4BVQA 4G4XA 2VGNA 3KHNA 4ZOLA 1W41A 3CCRF 5GIPC 3HKBA 3FFMA 1M90H 4LNUB 2HVYD 3QTYA 4PWTA 5CA0A 3HTNA 1U43A 3E20B 3JARA 3NVKE 4R40B 3CPWF 3S03A 4BVRA 3N2GB 3WGJA 4C8GA 3E22A 1H7MA 5ITZB 1VK3A 3S0YA 3Q8HA 2LBXA 4X1YA 3CC2F 3JCMM 3IEWA 3CCJF 2H8CA 3CYPB 4O2AB 3RYHA 1GX1A 5LP6B 1ODEA 2DYYA 3HKEA 3EORA 5CA1A 4TV8A 3JAKA 1W5EA 3WPXA 5B8FA 2ZVZA 5CB4A 1CLIA 2R6R1 5JQGB 3ZP4A 3C9UA 3S06A 2QEXF 5GINC 1KQSF 2YXZA 1RQ7A 2HRUA 3AGKA 2L26A 2HS0A 2BTUA 2H6LA 3KE1A 4O4IB 5KX5B 2QA4F 1COMA 2CZWA 2LCAA 1JD1A 1VQ9F 4EB6B 5HP7A 4BY9D 5HY1A 5JH7A 4ZOLB 2P6YA 3CMAF 1W5FA 2W8BC 1YHQF 3HKBB 1JN1A 2AMTA 5CA0B 3CCQF 1XHOA 3JARB 3VYSC 3VMFB 2HS3A 3LDTA 5HXZA 5AVMA 2YYEA 3F0EA 3E22B 1X25A 4I55A 3ESJA 1QVFF 1QD9A 4X1YB 2H8EA 5LXTA 4EI7A 3TD3A 3S0WA 3PLAC 1R1MA 3RYHB 2IG8A 2K1SA 2HP0A 3K14A 5IYZA 2Q1YA 1YJ9F 2VAPA 3LWOC 1W59A 3HKEB 4E6EA 5CA1B 4TV8B 4ZHYB 3JAKB 1JFFA 5JCOA 3LYBA 5HY4A 3VI6A 2IAFA 3LWVC 5FJ4C 5MN5A 5CB4B 5GONA 2Z1TA 1T0AA 4X1KA 4C8EA 2VXYA 5C8YA 3LWRC 3CCEF 2VAMA
chains in the Genus database with same CATH topology
1ZWZA 3CCSF 2AIFA 4BVSA 1IPAA 1VQNF 4C4WC 3CCMF 5G4VC 4BVQA 2VGNA 3V3TA 1YJNF 5DCVA 1W41A 3LFOA 3CCRF 2OZBA 5GIPC 3CPQA 3FFMA 3J7AR 3CCUF 1M90H 1YIJF 2HVYD 4TZZA 4X3MA 1X7PA 3G4SF 3G71F 2JNBA 3E20B 5GANK 3D00A 2I6DA 3NVKE 3CPWF 4BVRA 1VQOF 4LCKA 4NUTA 3NVIB 3V7QA 5HY0A 2LBWA 1W2BF 5GIOC 4BVTA 1H7MA 1E7KA 3ON1A 3CC2F 2LBXA 1Q7YH 2QI2A 3JCMM 1VQ6F 3CCJF 1VQ7F 1QVGF 5FLXM 1Q81H 5HXUA 1CK2A 1XBIA 1JJ2F 1Q86H 3OW2F 2FGYA 3CCLF 1VQKF 1X7OA 3MCAB 1K73H 4EI9A 1GO0A 3CG6A 3OBYA 1W40A 1NMUB 1YITF 4BW0B 3CXCF 2QEXF 1YJWF 5EWRA 1Q82H 3CC7F 5GINC 1KQSF 5G4UC 2KTVA 3AGKA 2VGMA 1SDSA 3HAXD 3HJWC 3V7EA 3N4ZA 2QA4F 4NQ3A 4EI8A 5HWEA 2CZWA 1N8RH 1VQ5F 3NK7A 2OTLF 1VQ9F 3PAFA 2ALEA 3CCVF 3OBWA 3J81M 4BY9D 3NK6A 3G6EF 5HY1A 3CMAF 3CMEF 5IT9M 1RA4A 1YHQF 3CD6F 2F9ZC 3I56F 1DT9A 5HY2A 2KG4A 3CCQF 4X3LA 3VMFB 3SIVA 3NMUC 2BO1A 1M1KH 1VQMF 1VQ8F 3IR9A 3O85A 5HXZA 1VQLF 3GYQA 3E1YA 1YI2F 2FC3A 1X52A 3LWQC 1QVFF 3I55F 3J80M 4EI7A 1GZ0A 3JAMM 3RA6A 3PLAC 2OHWA 3RA5A 1VQPF 4XCQA 5GAPK 2KTUA 1W42A 1YJ9F 1PXWA 3LWOC 5EO3A 3SIUA 1T0KB 3N4YA 3VI6A 1W3EX 5HY4A 1VQ4F 3WXMB 3LWVC 1KD1H 5FJ4C 1CN7A 1K9MH 1RLGA 2GLZA 2WALA 1K8AH 2OTJF 5A2QM 1NJIH 1KC8H 3LWRC 3CCEF 1S72F 3CC4F 1GO1A 3LWPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWZ A;  3CCS F;  2AIF A;  1VQN F;  1IPA A;  4C4W C;  3CCM F;  5G4V C;  2VGN A;  1YJN F;  5DCV A;  1W41 A;  3LFO A;  3CCR F;  2OZB A;  5GIP C;  3CPQ A;  3FFM A;  3J7A R;  3CCU F;  1M90 H;  1YIJ F;  2HVY D;  4TZZ A;  4X3M A;  1X7P A;  3G4S F;  3G71 F;  2JNB A;  3E20 B;  5GAN K;  2I6D A;  3NVK E;  3CPW F;  4LCK A;  1VQO F;  4NUT A;  3NVI B;  3V7Q A;  1W2B F;  2LBW A;  5GIO C;  1H7M A;  1E7K A;  3ON1 A;  3CC2 F;  2LBX A;  1Q7Y H;  2QI2 A;  3JCM M;  1VQ6 F;  3CCJ F;  1VQ7 F;  1QVG F;  5FLX M;  1Q81 H;  1CK2 A;  1XBI A;  1JJ2 F;  1Q86 H;  3OW2 F;  3CCL F;  1VQK F;  1X7O A;  3MCA B;  1K73 H;  1GO0 A;  3CG6 A;  3OBY A;  1W40 A;  1NMU B;  1YIT F;  4BW0 B;  3CXC F;  2QEX F;  1YJW F;  5EWR A;  1Q82 H;  3CC7 F;  5GIN C;  1KQS F;  5G4U C;  2KTV A;  3AGK A;  2VGM A;  1SDS A;  3HAX D;  3HJW C;  3V7E A;  3N4Z A;  2QA4 F;  2CZW A;  1N8R H;  1VQ5 F;  3NK7 A;  2OTL F;  1VQ9 F;  3PAF A;  2ALE A;  3CCV F;  3OBW A;  3J81 M;  4BY9 D;  3NK6 A;  3G6E F;  3CMA F;  3CME F;  5IT9 M;  1RA4 A;  1YHQ F;  3CD6 F;  3I56 F;  1DT9 A;  2KG4 A;  3CCQ F;  4X3L A;  3VMF B;  3SIV A;  3NMU C;  2BO1 A;  1M1K H;  1VQM F;  1VQ8 F;  3IR9 A;  3O85 A;  1VQL F;  3GYQ A;  3E1Y A;  1YI2 F;  2FC3 A;  1X52 A;  3LWQ C;  1QVF F;  3I55 F;  3J80 M;  1GZ0 A;  3JAM M;  3RA6 A;  3PLA C;  2OHW A;  3RA5 A;  1VQP F;  5GAP K;  2KTU A;  1W42 A;  1YJ9 F;  1PXW A;  3LWO C;  5EO3 A;  3SIU A;  1T0K B;  3N4Y A;  3VI6 A;  1W3E X;  1VQ4 F;  3WXM B;  3LWV C;  1KD1 H;  5FJ4 C;  1CN7 A;  1K9M H;  1RLG A;  2WAL A;  1K8A H;  2OTJ F;  5A2Q M;  1NJI H;  1KC8 H;  3LWR C;  3CCE F;  1S72 F;  3CC4 F;  1GO1 A;  3LWP C; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  2AIF A;  3RYI A;  3S0H A;  5G4V C;  2CWJ A;  3KIZ A;  3V3T A;  1SA0 A;  5DCV A;  3WGK A;  3S02 A;  1X7P A;  5GAN K;  4M8I A;  1W5A A;  4ZHV A;  5JH7 B;  4ZHQ A;  5LP6 C;  1Z5W A;  3V4D A;  4NWO B;  5HY0 A;  4BVT A;  1E7K A;  3I7T A;  3ON1 A;  4YJ3 A;  1Q7Y H;  2Z1E A;  4X20 A;  1QAH A;  4C8I A;  1XBI A;  1JJ2 F;  1J7H A;  3OW2 F;  1H47 A;  4I55 B;  3D01 A;  2FGY A;  1X7O A;  5LXT B;  1XRG A;  3M1X A;  4EI9 A;  3LME A;  5IYZ B;  2HP0 B;  3CG6 A;  2RB9 A;  1W40 A;  1YIT F;  4BW0 B;  2ZVY A;  3CC7 F;  1JFF B;  4X1I A;  2UYK A;  2VAW A;  1W58 1;  2GZL A;  2UYP A;  3VCZ A;  5GON B;  3JAW A;  3FD5 A;  4X1K B;  2UYJ A;  5C8Y B;  4EI8 A;  3NK7 A;  4ZI7 B;  3RYI B;  5J2T A;  2Z01 A;  1U3L A;  3G6E F;  1SA0 B;  4C81 A;  1RA4 A;  3CD6 F;  2ZOD A;  3I56 F;  4F6R A;  4IIJ A;  4G4W A;  5EIB C;  3SIV A;  3JVH A;  3BYQ A;  3NMU C;  3ZOP A;  5EYP A;  4ZHQ B;  1M1K H;  3P0Z A;  2R75 1;  2RHL A;  3D54 A;  1VQL F;  3E1Y A;  3GYQ A;  1YI2 F;  2G9I A;  3I55 F;  4YJ3 B;  3CYQ A;  3RA6 A;  2BTO A;  4XCQ A;  3MDO A;  4X20 B;  2KTU A;  3GHZ A;  3VOA A;  3WJP A;  3VO8 A;  3I3F A;  3WGL A;  5JVD A;  4KWE A;  1T0K B;  3N4Y A;  1W3E X;  2AIZ P;  1TVK A;  5EAZ A;  1VQ4 F;  1KD1 H;  1CN7 A;  2EWC A;  2GLZ A;  2WAL A;  5IJ9 A;  4O4J A;  1NJI H;  1Q8R A;  3LWP C;  3OON A;  4X1I B;  2RHJ A;  3CCS F;  1VQN F;  1UI9 A;  5FNV A;  1FNK A;  4B45 A;  5MN4 A;  1YJN F;  3F0G A;  3LFO A;  3JAW B;  3P10 A;  3GTZ A;  3J7A R;  3CCU F;  1YIJ F;  4TZZ A;  3G71 F;  2UZH A;  3M84 A;  2JNB A;  3IEQ A;  1OFU A;  5J2T B;  2CSL A;  4O4L A;  4LCK A;  1VQO F;  3MBM A;  5LYJ A;  4BT7 A;  3NVI B;  1W2B F;  4F6R B;  4WBN A;  4IIJ B;  1VQV A;  1VQ7 F;  2LBT A;  5EYP B;  5FLX M;  2PMP A;  4ZHW A;  2CW4 A;  3WJQ A;  1TUB A;  4G88 A;  3HKD A;  1RLU A;  4B5C A;  5JCO C;  5MN6 A;  3MCA B;  1K73 H;  4B62 A;  1NQ3 A;  3HWU A;  3IKE A;  3WJR A;  3RYF A;  2ZOV A;  3QUW A;  4G4V A;  3ZO8 A;  5JVD B;  5EWR A;  3VYT C;  3B6N A;  2KGW A;  1TVK B;  2KTV A;  3ERN A;  2DT4 A;  4YJ2 A;  3MCQ A;  4HNA A;  3HAX D;  3V7E A;  3N4Z A;  5IJ9 B;  3RYC A;  1KNK A;  1VH8 A;  4O4J B;  3UT5 A;  1VQ5 F;  1FNJ A;  2HP3 A;  1U40 A;  3PAF A;  2ALE A;  3C9R A;  3JAL A;  5FNV B;  3J81 M;  2CHS A;  4TUY A;  4G4Z A;  5IT9 M;  4O2B A;  4IHJ A;  2OTM A;  3JAT A;  4I4T A;  3IMP A;  4DXD A;  1IV2 A;  5EB1 B;  5EIB D;  5LA6 A;  2BO1 A;  4O4L B;  1W55 A;  1UFY A;  1FSZ A;  1VQ8 F;  5LYJ B;  3IR9 A;  2QTP A;  3O85 A;  4FFB A;  1FFX A;  5IJ0 A;  4U3J A;  2ZAU A;  3LWQ C;  2MQE A;  4WBN B;  3HKC A;  1GZ0 A;  3M4S A;  2IQQ A;  5GAP K;  1W42 A;  2NMU A;  2HRY A;  2CVL A;  1XV2 A;  5KMG A;  1TUB B;  3HKD B;  4BT6 A;  2ZF8 A;  3WXM B;  3RYF B;  4O4H A;  1YQN A;  1K9M H;  1RLG A;  2Z1U A;  3F0F A;  2OTJ F;  1K8A H;  1VHA A;  5A2Q M;  3QHD A;  3C9S A;  1KC8 H;  2V9Y A;  2Z1F A;  3JAS A;  4U39 A;  1CK2 A;  2RHH A;  3WPW A;  1IPA A;  1SZQ A;  4C4W C;  4YJ2 B;  3ELC A;  3VIU A;  2OZB A;  4HNA B;  2UYN A;  3CPQ A;  3RYC B;  4ZK7 A;  4B46 A;  4X3M A;  3G4S F;  3UT5 B;  5J2U A;  1H48 A;  3D00 A;  2I6D A;  1ONI A;  1OAP A;  3JAL B;  3WGN A;  3VTI C;  1IV4 A;  3R0P A;  4TUY B;  5EZY A;  3VYU C;  4I50 A;  4NUT A;  4O2B B;  4IHJ B;  3U0O A;  3V7Q A;  2LBW A;  3JAT B;  5GIO C;  4I4T B;  3N2K A;  4DRX A;  3FBA A;  1KNJ A;  2QI2 A;  5BMV A;  3IKF A;  5LA6 B;  5LOV A;  1VQ6 F;  3CB2 A;  1QVG F;  1Q81 H;  2I6R A;  5HXU A;  1FFX B;  4FFB B;  5IJ0 B;  2GVI A;  1Q86 H;  4U3J B;  3VOB A;  3CCL F;  1DBF A;  2Q1X A;  1VQK F;  1W57 A;  3P4E A;  3HKC B;  4BT3 A;  1PF5 A;  2RHO A;  1GO0 A;  3FPI A;  2HQS C;  3OBY A;  1NMU B;  4TV9 A;  5KMG B;  4BT4 A;  3CXC F;  1YJW F;  1Q82 H;  4BT2 A;  2HS4 A;  5G4U C;  1Z5V A;  1QU9 A;  4O4H B;  2VGM A;  1SDS A;  3HJW C;  3F6M A;  4LNU A;  2CHT A;  3KJK A;  4NQ3 A;  5HWE A;  1N8R H;  3FD6 A;  3C9T A;  1W5B A;  3JAS B;  4RQO A;  2OTL F;  3CCV F;  3OBW A;  3MQW A;  3NK6 A;  1YGY A;  5HP8 A;  3N2G A;  2BTQ B;  3CME F;  2UYN B;  2F9Z C;  5EB0 A;  1DT9 A;  5ITZ A;  4RHA A;  5HY2 A;  2KG4 A;  5J2U B;  4BT5 A;  1JY8 A;  4X3L A;  3DDN A;  3K2X A;  2B33 A;  4C82 A;  4O2A A;  5EZY B;  1VQM F;  3DC2 A;  4I50 B;  5LP6 A;  2FC3 A;  1X52 A;  3F0D A;  3L7Q A;  3N2K B;  3T80 A;  4DRX B;  3J80 M;  5BMV B;  5LOV B;  3JAM M;  2OHW A;  3RA5 A;  3WGM A;  1VQP F;  2PHN A;  3K12 A;  1RQ2 A;  1PXW A;  5JQG A;  3SIU A;  5EO3 A;  3C8L A;  3KJJ A;  3TD4 A;  3K0T A;  4G4Y A;  1U3P A;  2N48 A;  3ZP7 A;  1IV3 A;  4O4I A;  5KX5 A;  1IV1 A;  4TV9 B;  3CC4 F;  1S72 F;  3RE3 A;  1GO1 A;  4ERH A;  2HX0 A;  1ZWZ A;  4BVS A;  4EB6 A;  3CCM F;  3TD5 A;  4BVQ A;  4G4X A;  2VGN A;  3KHN A;  4ZOL A;  1W41 A;  3CCR F;  5GIP C;  3HKB A;  3FFM A;  1M90 H;  4LNU B;  2HVY D;  3QTY A;  4PWT A;  5CA0 A;  3HTN A;  1U43 A;  3E20 B;  3JAR A;  3NVK E;  4R40 B;  3CPW F;  3S03 A;  4BVR A;  3N2G B;  3WGJ A;  4C8G A;  3E22 A;  1H7M A;  5ITZ B;  1VK3 A;  3S0Y A;  3Q8H A;  2LBX A;  4X1Y A;  3CC2 F;  3JCM M;  3IEW A;  3CCJ F;  2H8C A;  3CYP B;  4O2A B;  3RYH A;  1GX1 A;  5LP6 B;  1ODE A;  2DYY A;  3HKE A;  3EOR A;  5CA1 A;  4TV8 A;  3JAK A;  1W5E A;  3WPX A;  5B8F A;  2ZVZ A;  5CB4 A;  1CLI A;  2R6R 1;  5JQG B;  3ZP4 A;  3C9U A;  3S06 A;  2QEX F;  5GIN C;  1KQS F;  2YXZ A;  1RQ7 A;  2HRU A;  3AGK A;  2L26 A;  2HS0 A;  2BTU A;  2H6L A;  3KE1 A;  4O4I B;  5KX5 B;  2QA4 F;  1COM A;  2CZW A;  2LCA A;  1JD1 A;  1VQ9 F;  4EB6 B;  5HP7 A;  4BY9 D;  5HY1 A;  5JH7 A;  4ZOL B;  2P6Y A;  3CMA F;  1W5F A;  2W8B C;  1YHQ F;  3HKB B;  1JN1 A;  2AMT A;  5CA0 B;  3CCQ F;  1XHO A;  3JAR B;  3VYS C;  3VMF B;  2HS3 A;  3LDT A;  5HXZ A;  5AVM A;  2YYE A;  3F0E A;  3E22 B;  1X25 A;  4I55 A;  3ESJ A;  1QVF F;  1QD9 A;  4X1Y B;  2H8E A;  5LXT A;  4EI7 A;  3TD3 A;  3S0W A;  3PLA C;  1R1M A;  3RYH B;  2IG8 A;  2K1S A;  2HP0 A;  3K14 A;  5IYZ A;  2Q1Y A;  1YJ9 F;  2VAP A;  3LWO C;  1W59 A;  3HKE B;  4E6E A;  5CA1 B;  4TV8 B;  4ZHY B;  3JAK B;  1JFF A;  5JCO A;  3LYB A;  5HY4 A;  3VI6 A;  2IAF A;  3LWV C;  5FJ4 C;  5MN5 A;  5CB4 B;  5GON A;  2Z1T A;  1T0A A;  4X1K A;  4C8E A;  2VXY A;  5C8Y A;  3LWR C;  3CCE F;  2VAM A; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  3CCS F;  2AIF A;  4BVS A;  1IPA A;  1VQN F;  4C4W C;  3CCM F;  5G4V C;  4BVQ A;  2VGN A;  3V3T A;  1YJN F;  5DCV A;  1W41 A;  3LFO A;  3CCR F;  2OZB A;  5GIP C;  3CPQ A;  3FFM A;  3J7A R;  3CCU F;  1M90 H;  1YIJ F;  2HVY D;  4TZZ A;  4X3M A;  1X7P A;  3G4S F;  3G71 F;  2JNB A;  3E20 B;  5GAN K;  3D00 A;  2I6D A;  3NVK E;  3CPW F;  4BVR A;  1VQO F;  4LCK A;  4NUT A;  3NVI B;  3V7Q A;  5HY0 A;  2LBW A;  1W2B F;  5GIO C;  4BVT A;  1H7M A;  1E7K A;  3ON1 A;  3CC2 F;  2LBX A;  1Q7Y H;  2QI2 A;  3JCM M;  1VQ6 F;  3CCJ F;  1VQ7 F;  1QVG F;  5FLX M;  1Q81 H;  5HXU A;  1CK2 A;  1XBI A;  1JJ2 F;  1Q86 H;  3OW2 F;  2FGY A;  3CCL F;  1VQK F;  1X7O A;  3MCA B;  1K73 H;  4EI9 A;  1GO0 A;  3CG6 A;  3OBY A;  1W40 A;  1NMU B;  1YIT F;  4BW0 B;  3CXC F;  2QEX F;  1YJW F;  5EWR A;  1Q82 H;  3CC7 F;  5GIN C;  1KQS F;  5G4U C;  2KTV A;  3AGK A;  2VGM A;  1SDS A;  3HAX D;  3HJW C;  3V7E A;  3N4Z A;  2QA4 F;  4NQ3 A;  4EI8 A;  5HWE A;  2CZW A;  1N8R H;  1VQ5 F;  3NK7 A;  2OTL F;  1VQ9 F;  3PAF A;  2ALE A;  3CCV F;  3OBW A;  3J81 M;  4BY9 D;  3NK6 A;  3G6E F;  5HY1 A;  3CMA F;  3CME F;  5IT9 M;  1RA4 A;  1YHQ F;  3CD6 F;  2F9Z C;  3I56 F;  1DT9 A;  5HY2 A;  2KG4 A;  3CCQ F;  4X3L A;  3VMF B;  3SIV A;  3NMU C;  2BO1 A;  1M1K H;  1VQM F;  1VQ8 F;  3IR9 A;  3O85 A;  5HXZ A;  1VQL F;  3GYQ A;  3E1Y A;  1YI2 F;  2FC3 A;  1X52 A;  3LWQ C;  1QVF F;  3I55 F;  3J80 M;  4EI7 A;  1GZ0 A;  3JAM M;  3RA6 A;  3PLA C;  2OHW A;  3RA5 A;  1VQP F;  4XCQ A;  5GAP K;  2KTU A;  1W42 A;  1YJ9 F;  1PXW A;  3LWO C;  5EO3 A;  3SIU A;  1T0K B;  3N4Y A;  3VI6 A;  1W3E X;  5HY4 A;  1VQ4 F;  3WXM B;  3LWV C;  1KD1 H;  5FJ4 C;  1CN7 A;  1K9M H;  1RLG A;  2GLZ A;  2WAL A;  1K8A H;  2OTJ F;  5A2Q M;  1NJI H;  1KC8 H;  3LWR C;  3CCE F;  1S72 F;  3CC4 F;  1GO1 A;  3LWP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...