4BW0B

The molecular recognition of kink turn structure by the l7ae class of proteins
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna/rna binding protein
molecule keywords HMKT-7
publication title The Molecular Recognition of Kink-Turn Structure by the L7Ae Class of Proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4bw0B00
5A2QM 3CC2F 4BY9D 3CXCF 1GO1A 1S72F 3E20B 1NJIH 3CG6A 2BO1A 1H7MA 1X7OA 4TZZA 1RLGA 1W3EX 1CN7A 3WXMB 3CCEF 1KC8H 5EO3A 1GO0A 1W41A 3RA5A 2LBXA 3NVIB 5G4VC 3V7QA 2FC3A 2WALA 3NVKE 3CC4F 3I55F 1W42A 2LBWA 1QVGF 1VQNF 3SIVA 4X3MA 1M1KH 3V7EA 2KTVA 4BW0B 2OZBA 3CCUF 1Q86H 1K8AH 1RA4A 1YJ9F 3LWPC 1YITF 1VQOF 1YJNF 4X3LA 3CD6F 5FJ4C 3CMEF 3VMFB 3PAFA 3OBWA 3HAXD 3CCLF 1VQMF 3AGKA 3CCMF 2OTJF 3FFMA 1K73H 3LFOA 1M90H 1ZWZA 3OW2F 5FLXM 3CCSF 3LWQC 1DT9A 3LWOC 5GIOC 1IPAA 3N4ZA 1N8RH 1VQKF 1PXWA 2HVYD 2ALEA 3CCJF 4NUTA 1W2BF 3CPQA 1VQ6F 3E1YA 1X7PA 1VQLF 2QEXF 1JJ2F 1GZ0A 1VQ7F 3OBYA 1E7KA 3G4SF 3O85A 1YI2F 3HJWC 3SIUA 3CCQF 1Q82H 3MCAB 3G6EF 3CPWF 1QVFF 1VQ4F 1YJWF 1Q7YH 3J7AR 2I6DA 3CCRF 3ON1A 1VQ9F 1VQPF 5GIPC 2QI2A 3CCVF 1NMUB 1Q81H 5EWRA 1K9MH 3GYQA 4LCKA 3CC7F 2KTUA 3G71F 5GANK 3J80M 3IR9A 2OHWA 1CK2A 3NK7A 3JCMM 3CMAF 1KD1H 1XBIA 2OTLF 2AIFA 4C4WC 1YHQF 1X52A 5IT9M 1KQSF 1VQ5F 1VQ8F 5DCVA 3VI6A 2JNBA 5G4UC 3PLAC 3LWRC 3RA6A 1W40A 2KG4A 3N4YA 3I56F 2QA4F 2CZWA 1SDSA 5GAPK 3NK6A 3J81M 1T0KB 5GINC 2VGMA 2VGNA 3LWVC 3NMUC 1YIJF 3JAMM
chains in the Genus database with same CATH superfamily
2QTPA 4X1KA 2PHNA 5J2UB 4BY9D 3MQWA 3CXCF 4O2AB 2Z1FA 3E20B 1VK3A 2BTQB 2YYEA 4U3JB 1TUBB 2BO1A 1H7MA 1RLGA 1W5EA 1Z5VA 1CN7A 2UYPA 1JY8A 2FGYA 5EB1B 5EO3A 1W41A 3VIUA 2LBXA 3VCZA 1SA0A 3DDNA 3NVKE 5EB0A 3JARB 4BT7A 3IKEA 1YQNA 5EZYB 1M1KH 2KTVA 1W5AA 4O4IB 3CB2A 3S0HA 1YITF 4ZHVA 3KIZA 5JVDB 2B33A 4ZHWA 2IG8A 5JH7B 3OBWA 3HAXD 4C82A 5LXTB 3CCMF 3D01A 2DYYA 2ZOVA 1K73H 3LFOA 1M90H 2OTJF 4ZK7A 5KMGA 3CCSF 5EYPA 1DT9A 3LWOC 3K0TA 2CWJA 3HTNA 2I6RA 2UZHA 2UYNA 1RQ7A 5LA6B 2VXYA 3MDOA 3HKCA 3ZOPA 4BT6A 2H8EA 5EIBC 3ELCA 3CCJF 1W2BF 3L7QA 5J2UA 3UT5B 4O2AA 2HP3A 4G4VA 1GX1A 1X7PA 5JQGB 2KGWA 1VQLF 1JJ2F 3B6NA 2RHLA 1XRGA 1TUBA 3G4SF 1U3LA 4WBNB 3GTZA 1YI2F 3SIUA 2RHHA 3MCAB 5LYJB 3CPWF 3ERNA 4TV8B 1RLUA 1Q7YH 2I6DA 3IMPA 3CCRF 3M4SA 1VQPF 3VO8A 1Q81H 3TD5A 4FFBB 1K9MH 1ODEA 1U3PA 5EZYA 4O4IA 4X20B 5LOVB 4ZHQB 1IV4A 3P0ZA 3NK7A 3JVHA 3CMAF 1XBIA 2AMTA 1Q8RA 5JVDA 4NWOB 2AIFA 2LCAA 1YHQF 3CYQA 5JH7A 3HKDB 3Q8HA 5DCVA 4O2BB 3VI6A 1SA0B 1SZQA 3WGLA 3N4YA 1RQ2A 3S06A 3I56F 2GLZA 5HXZA 3J81M 5HWEA 1T0KB 4TV9B 1TVKA 5GINC 2VGMA 2CHTA 4G4ZA 5LA6A 1FSZA 2Q1YA 3F6MA 3VOBA 4PWTA 1NJIH 3WGKA 2OTMA 2Z1TA 1X7OA 4TZZA 5CA0B 3JASB 1FNKA 1W3EX 3UT5A 5JQGA 3S0WA 2PMPA 3FD5A 1GO0A 3F0DA 3NVIB 4WBNA 3N2GB 2WALA 3CYPB 3I55F 1QVGF 2UYNB 5MN6A 4X3MA 3TD4A 4TV8A 1QAHA 3CCUF 1K8AH 1RA4A 1IV2A 1YJ9F 3EORA 3GHZA 3IKFA 5HY2A 4X20A 3CD6F 3VMFB 3P4EA 4ZHQA 5LOVA 3S03A 5IYZB 1FFXB 1VQMF 3AGKA 3WJPA 5MN5A 4B5CA 1IV1A 3OW2F 3JALB 3VYUC 5FLXM 3HKDA 3DC2A 4O2BA 4X1IA 4C81A 3WPWA 1CLIA 1XV2A 3BYQA 5BMVB 3RYIA 5GIOC 1N8RH 1VQKF 4TV9A 2HVYD 5C8YB 3ESJA 4NUTA 4BVSA 2DT4A 3V4DA 4BVRA 4O4JA 4IHJB 4BT5A 1GZ0A 4F6RB 2ZVZA 3WGJA 3OBYA 4ZI7A 3K2XA 5CA0A 3JASA 3HJWC 2VAWA 2NMUA 1VQ4F 1YJWF 1T0AA 2AIZP 3D54A 1TVKB 3KJJA 3N2GA 1U43A 5GIPC 3HKEA 2R6R1 2H8CA 4LCKA 4B62A 1U40A 3G71F 1PF5A 3IEQA 3RYFA 3VYSC 3RYCA 4B46A 1CK2A 3JCMM 2OTLF 4IIJB 5EIBD 2V9YA 4B45A 4BT4A 5IYZA 1KQSF 1FFXA 2HX0A 4ERHA 2HS3A 4YJ3B 3M1XA 4I50A 3JALA 5LP6B 1W57A 3WGNA 2CZWA 4HNAB 3NK6A 5BMVA 3FD6A 3KJKA 2P6YA 3JAMM 2Z1UA 5A2QM 3CC2F 3S02A 5FNVA 4EI8A 5HY4A 5C8YA 1H47A 3CG6A 2W8BC 5GONA 4EB6B 1W5FA 4IHJA 4BVTA 3FPIA 1KNKA 2HS4A 2LBTA 3WXMB 1KC8H 4O4HB 4F6RA 4LNUA 4KWEA 1H48A 4X1IB 3V7QA 2FC3A 4RQOA 3RYIB 3CC4F 2IQQA 3V3TA 3E22B 2LBWA 3SIVA 3V7EA 5IJ9B 2OZBA 1Q86H 2EWCA 3LWPC 4C8EA 1VQOF 5LP6C 4O4JB 2ZF8A 5FJ4C 5KX5B 3K12A 3CMEF 1OFUA 3S0YA 3C9RA 3JAWA 5J2TB 4ZI7B 3ZO8A 3CCLF 1ONIA 3FFMA 4IIJA 1UI9A 3IEWA 3QTYA 3ZP7A 1COMA 1ZWZA 5CB4A 1KNJA 1DBFA 4I4TA 3LWQC 1IV3A 4U39A 5ITZB 2R751 3HKEB 4YJ3A 3R0PA 1IPAA 3MCQA 5LP6A 3FBAA 4I55B 3HKBB 4HNAA 2VAPA 2K1SA 2ALEA 4YJ2B 4ZOLB 3RYFB 3RYCB 4DRXB 1VQ6F 5AVMA 5MN4A 1UFYA 4O4LB 1JN1A 3U0OA 3C9SA 3C9UA 1VQ7F 4EB6A 3TD3A 3VOAA 3CCQF 4G4WA 1Q82H 4I50B 2MQEA 4O4HA 3WJRA 4EI9A 1QVFF 1QD9A 2VAMA 3F0EA 3F0FA 5HY1A 3LYBA 3ON1A 3CCVF 3E22A 1QU9A 3JAKA 1JD1A 4RHAA 5FNVB 5IJ9A 3MBMA 5GANK 5B8FA 3WPXA 2Z01A 3LDTA 3P10A 1JFFA 5GONB 1KD1H 4C4WC 5KX5A 1X52A 1XHOA 4C8IA 4LNUB 1VQ5F 5J2TA 1Z5WA 5HP8A 1FNJA 2G9IA 3RE3A 5G4UC 3PLAC 4EI7A 1W40A 1YGYA 2GVIA 3M84A 4DXDA 2QA4F 5ITZA 2VGNA 3LWVC 3NMUC 1YIJF 2ZVYA 4I55A 5HY0A 3HKBA 5EAZA 3HWUA 1GO1A 1W5BA 1S72F 2HP0A 4YJ2A 3JAWB 4ZOLA 3N2KB 2CSLA 4DRXA 2HRUA 5CB4B 4O4LA 3CCEF 3RA5A 1R1MA 4I4TB 4X1YB 5CA1A 3WGMA 5JCOC 5G4VC 4TUYB 2N48A 4C8GA 4M8IA 1W581 3KHNA 1W42A 1VQNF 3T80A 4BW0B 4BT3A 2GZLA 5IJ0A 2Z1EA 4XCQA 1YJNF 3I7TA 4X3LA 3PAFA 2H6LA 2ZODA 4U3JA 5JCOA 2IAFA 1NQ3A 4R40B 2YXZA 2CVLA 3LMEA 2RHJA 3RYHB 2Q1XA 3JATB 2HS0A 3JARA 3JAKB 1X25A 3N4ZA 4X1KB 3C9TA 4E6EA 4G4YA 1PXWA 2RB9A 2ZAUA 3CPQA 3OONA 1JFFB 4G88A 3E1YA 3C8LA 1OAPA 2QEXF 3WJQA 2L26A 3N2KA 1E7KA 2UYJA 5LXTA 3O85A 3VYTC 2BTOA 3VTIC 3G6EF 2HRYA 2UYKA 4X1YA 4BVQA 3J7AR 3D00A 4TUYA 1VQ9F 2QI2A 1NMUB 5EWRA 3K14A 3GYQA 4BT2A 2HQSC 2CHSA 3CC7F 2KTUA 3J80M 1J7HA 2HP0B 3IR9A 2OHWA 5HP7A 1W55A 1VQVA 1VH8A 2BTUA 5KMGB 5IT9M 5HXUA 1VQ8F 4G4XA 1VHAA 5CA1B 5EYPB 2RHOA 2JNBA 3QHDA 3LWRC 3RA6A 4NQ3A 3ZP4A 2CW4A 4ZHYB 5LYJA 2F9ZC 2KG4A 1W59A 3I3FA 1SDSA 3F0GA 3HKCB 5GAPK 3QUWA 3RYHA 5IJ0B 3JATA 3KE1A 4FFBA
chains in the Genus database with same CATH topology
5A2QM 5HY0A 3CC2F 4BY9D 3CXCF 1GO1A 4EI8A 3E20B 5HY4A 1S72F 1NJIH 3CG6A 2BO1A 1H7MA 1X7OA 4TZZA 1RLGA 1W3EX 4BVTA 1CN7A 3WXMB 3CCEF 2FGYA 1KC8H 5EO3A 1GO0A 1W41A 3RA5A 2LBXA 3NVIB 5G4VC 3V7QA 2FC3A 2WALA 3NVKE 3CC4F 3I55F 3V3TA 1W42A 2LBWA 1QVGF 1VQNF 3SIVA 4X3MA 1M1KH 3V7EA 2KTVA 4BW0B 2OZBA 3CCUF 1Q86H 1K8AH 1RA4A 1YJ9F 3LWPC 1YITF 1VQOF 4XCQA 5HY2A 1YJNF 4X3LA 3CD6F 5FJ4C 3CMEF 3VMFB 3PAFA 3OBWA 3HAXD 3CCLF 1VQMF 3AGKA 3CCMF 2OTJF 3FFMA 1K73H 3LFOA 1M90H 1ZWZA 3OW2F 5FLXM 3CCSF 3LWQC 1DT9A 3LWOC 5GIOC 1IPAA 3N4ZA 1N8RH 1VQKF 1PXWA 2HVYD 2ALEA 4BVSA 4NUTA 3CCJF 1W2BF 3CPQA 1VQ6F 4BVRA 3E1YA 1X7PA 1VQLF 2QEXF 1JJ2F 1GZ0A 1VQ7F 3OBYA 1E7KA 3G4SF 3O85A 1YI2F 3HJWC 3SIUA 3CCQF 1Q82H 3MCAB 3G6EF 3CPWF 4EI9A 1QVFF 1VQ4F 4BVQA 5HY1A 1YJWF 1Q7YH 3J7AR 3D00A 2I6DA 3CCRF 3ON1A 1VQ9F 1VQPF 2QI2A 5GIPC 3CCVF 1NMUB 1Q81H 5EWRA 1K9MH 3GYQA 4LCKA 3CC7F 2KTUA 3G71F 5GANK 3J80M 3IR9A 2OHWA 1CK2A 3NK7A 3JCMM 3CMAF 1KD1H 1XBIA 2OTLF 2AIFA 4C4WC 1YHQF 1X52A 5IT9M 5HXUA 1KQSF 1VQ5F 1VQ8F 5DCVA 3VI6A 2JNBA 5G4UC 3PLAC 3LWRC 3RA6A 4NQ3A 4EI7A 1W40A 2F9ZC 2KG4A 3N4YA 3I56F 2QA4F 2CZWA 2GLZA 5HXZA 3NK6A 3J81M 5HWEA 5GAPK 1SDSA 1T0KB 5GINC 2VGMA 2VGNA 3LWVC 3NMUC 1YIJF 3JAMM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q M;  3CC2 F;  4BY9 D;  3CXC F;  1GO1 A;  1S72 F;  3E20 B;  1NJI H;  3CG6 A;  2BO1 A;  1H7M A;  1X7O A;  4TZZ A;  1RLG A;  1W3E X;  1CN7 A;  3WXM B;  3CCE F;  1KC8 H;  5EO3 A;  1GO0 A;  1W41 A;  3RA5 A;  2LBX A;  3NVI B;  5G4V C;  3V7Q A;  2FC3 A;  2WAL A;  3NVK E;  3CC4 F;  3I55 F;  1W42 A;  2LBW A;  1QVG F;  1VQN F;  3SIV A;  4X3M A;  1M1K H;  3V7E A;  2KTV A;  4BW0 B;  2OZB A;  3CCU F;  1Q86 H;  1K8A H;  1RA4 A;  1YJ9 F;  3LWP C;  1YIT F;  1VQO F;  1YJN F;  4X3L A;  3CD6 F;  5FJ4 C;  3CME F;  3VMF B;  3PAF A;  3OBW A;  3HAX D;  3CCL F;  1VQM F;  3AGK A;  3CCM F;  2OTJ F;  3FFM A;  1K73 H;  3LFO A;  1M90 H;  1ZWZ A;  3OW2 F;  5FLX M;  3CCS F;  3LWQ C;  1DT9 A;  3LWO C;  5GIO C;  1IPA A;  3N4Z A;  1N8R H;  1VQK F;  1PXW A;  2HVY D;  2ALE A;  3CCJ F;  4NUT A;  1W2B F;  3CPQ A;  1VQ6 F;  3E1Y A;  1X7P A;  1VQL F;  2QEX F;  1JJ2 F;  1GZ0 A;  1VQ7 F;  3OBY A;  1E7K A;  3G4S F;  3O85 A;  1YI2 F;  3HJW C;  3SIU A;  3CCQ F;  1Q82 H;  3MCA B;  3G6E F;  3CPW F;  1QVF F;  1VQ4 F;  1YJW F;  1Q7Y H;  3J7A R;  2I6D A;  3CCR F;  3ON1 A;  1VQ9 F;  1VQP F;  5GIP C;  2QI2 A;  3CCV F;  1NMU B;  1Q81 H;  5EWR A;  1K9M H;  3GYQ A;  4LCK A;  3CC7 F;  2KTU A;  3G71 F;  5GAN K;  3J80 M;  3IR9 A;  2OHW A;  1CK2 A;  3NK7 A;  3JCM M;  3CMA F;  1KD1 H;  1XBI A;  2OTL F;  2AIF A;  4C4W C;  1YHQ F;  1X52 A;  5IT9 M;  1KQS F;  1VQ5 F;  1VQ8 F;  5DCV A;  3VI6 A;  2JNB A;  5G4U C;  3PLA C;  3LWR C;  3RA6 A;  1W40 A;  2KG4 A;  3N4Y A;  3I56 F;  2QA4 F;  2CZW A;  1SDS A;  5GAP K;  3NK6 A;  3J81 M;  1T0K B;  5GIN C;  2VGM A;  2VGN A;  3LWV C;  3NMU C;  1YIJ F;  3JAM M; 
#chains in the Genus database with same CATH topology
 2QTP A;  4X1K A;  2PHN A;  5J2U B;  4BY9 D;  3MQW A;  3CXC F;  4O2A B;  2Z1F A;  3E20 B;  1VK3 A;  2BTQ B;  2YYE A;  4U3J B;  1TUB B;  2BO1 A;  1H7M A;  1RLG A;  1W5E A;  1Z5V A;  1CN7 A;  2UYP A;  1JY8 A;  2FGY A;  5EB1 B;  5EO3 A;  1W41 A;  3VIU A;  2LBX A;  3VCZ A;  1SA0 A;  3DDN A;  3NVK E;  5EB0 A;  3JAR B;  4BT7 A;  3IKE A;  1YQN A;  5EZY B;  1M1K H;  2KTV A;  1W5A A;  4O4I B;  3CB2 A;  3S0H A;  1YIT F;  4ZHV A;  3KIZ A;  5JVD B;  2B33 A;  4ZHW A;  2IG8 A;  5JH7 B;  3OBW A;  3HAX D;  4C82 A;  5LXT B;  3CCM F;  3D01 A;  2DYY A;  2ZOV A;  1K73 H;  3LFO A;  1M90 H;  2OTJ F;  4ZK7 A;  5KMG A;  3CCS F;  5EYP A;  1DT9 A;  3LWO C;  3K0T A;  2CWJ A;  3HTN A;  2I6R A;  2UZH A;  2UYN A;  1RQ7 A;  5LA6 B;  2VXY A;  3MDO A;  3HKC A;  3ZOP A;  4BT6 A;  2H8E A;  5EIB C;  3ELC A;  3CCJ F;  1W2B F;  3L7Q A;  5J2U A;  3UT5 B;  4O2A A;  2HP3 A;  4G4V A;  1GX1 A;  1X7P A;  5JQG B;  2KGW A;  1VQL F;  1JJ2 F;  3B6N A;  2RHL A;  1XRG A;  1TUB A;  3G4S F;  1U3L A;  4WBN B;  3GTZ A;  1YI2 F;  3SIU A;  2RHH A;  3MCA B;  5LYJ B;  3CPW F;  3ERN A;  4TV8 B;  1RLU A;  1Q7Y H;  2I6D A;  3IMP A;  3CCR F;  3M4S A;  1VQP F;  3VO8 A;  1Q81 H;  3TD5 A;  4FFB B;  1K9M H;  1ODE A;  1U3P A;  5EZY A;  4O4I A;  4X20 B;  5LOV B;  4ZHQ B;  1IV4 A;  3P0Z A;  3NK7 A;  3JVH A;  3CMA F;  1XBI A;  2AMT A;  1Q8R A;  5JVD A;  4NWO B;  2AIF A;  2LCA A;  1YHQ F;  3CYQ A;  5JH7 A;  3HKD B;  3Q8H A;  5DCV A;  4O2B B;  3VI6 A;  1SA0 B;  1SZQ A;  3WGL A;  3N4Y A;  1RQ2 A;  3S06 A;  3I56 F;  2GLZ A;  5HXZ A;  3J81 M;  5HWE A;  1T0K B;  4TV9 B;  1TVK A;  5GIN C;  2VGM A;  2CHT A;  4G4Z A;  5LA6 A;  1FSZ A;  2Q1Y A;  3F6M A;  3VOB A;  4PWT A;  1NJI H;  3WGK A;  2OTM A;  2Z1T A;  1X7O A;  4TZZ A;  5CA0 B;  3JAS B;  1FNK A;  1W3E X;  3UT5 A;  5JQG A;  3S0W A;  2PMP A;  3FD5 A;  1GO0 A;  3F0D A;  3NVI B;  4WBN A;  3N2G B;  2WAL A;  3CYP B;  3I55 F;  1QVG F;  2UYN B;  5MN6 A;  4X3M A;  3TD4 A;  4TV8 A;  1QAH A;  3CCU F;  1K8A H;  1RA4 A;  1IV2 A;  1YJ9 F;  3EOR A;  3GHZ A;  3IKF A;  5HY2 A;  4X20 A;  3CD6 F;  3VMF B;  3P4E A;  4ZHQ A;  5LOV A;  3S03 A;  5IYZ B;  1FFX B;  1VQM F;  3AGK A;  3WJP A;  5MN5 A;  4B5C A;  1IV1 A;  3OW2 F;  3JAL B;  3VYU C;  5FLX M;  3HKD A;  3DC2 A;  4O2B A;  4X1I A;  4C81 A;  3WPW A;  1CLI A;  1XV2 A;  3BYQ A;  5BMV B;  3RYI A;  5GIO C;  1N8R H;  1VQK F;  4TV9 A;  2HVY D;  5C8Y B;  3ESJ A;  4NUT A;  4BVS A;  2DT4 A;  3V4D A;  4BVR A;  4O4J A;  4IHJ B;  4BT5 A;  1GZ0 A;  4F6R B;  2ZVZ A;  3WGJ A;  3OBY A;  4ZI7 A;  3K2X A;  5CA0 A;  3JAS A;  3HJW C;  2VAW A;  2NMU A;  1VQ4 F;  1YJW F;  1T0A A;  2AIZ P;  3D54 A;  1TVK B;  3KJJ A;  3N2G A;  1U43 A;  5GIP C;  3HKE A;  2R6R 1;  2H8C A;  4LCK A;  4B62 A;  1U40 A;  3G71 F;  1PF5 A;  3IEQ A;  3RYF A;  3VYS C;  3RYC A;  4B46 A;  1CK2 A;  3JCM M;  2OTL F;  4IIJ B;  5EIB D;  2V9Y A;  4B45 A;  4BT4 A;  5IYZ A;  1KQS F;  1FFX A;  2HX0 A;  4ERH A;  2HS3 A;  4YJ3 B;  3M1X A;  4I50 A;  3JAL A;  5LP6 B;  1W57 A;  3WGN A;  2CZW A;  4HNA B;  3NK6 A;  5BMV A;  3FD6 A;  3KJK A;  2P6Y A;  3JAM M;  2Z1U A;  5A2Q M;  3CC2 F;  3S02 A;  5FNV A;  4EI8 A;  5HY4 A;  5C8Y A;  1H47 A;  3CG6 A;  2W8B C;  5GON A;  4EB6 B;  1W5F A;  4IHJ A;  4BVT A;  3FPI A;  1KNK A;  2HS4 A;  2LBT A;  3WXM B;  1KC8 H;  4O4H B;  4F6R A;  4LNU A;  4KWE A;  1H48 A;  4X1I B;  3V7Q A;  2FC3 A;  4RQO A;  3RYI B;  3CC4 F;  2IQQ A;  3V3T A;  3E22 B;  2LBW A;  3SIV A;  3V7E A;  5IJ9 B;  2OZB A;  1Q86 H;  2EWC A;  3LWP C;  4C8E A;  1VQO F;  5LP6 C;  4O4J B;  2ZF8 A;  5FJ4 C;  5KX5 B;  3K12 A;  3CME F;  1OFU A;  3S0Y A;  3C9R A;  3JAW A;  5J2T B;  4ZI7 B;  3ZO8 A;  3CCL F;  1ONI A;  3FFM A;  4IIJ A;  1UI9 A;  3IEW A;  3QTY A;  3ZP7 A;  1COM A;  1ZWZ A;  5CB4 A;  1KNJ A;  1DBF A;  4I4T A;  3LWQ C;  1IV3 A;  4U39 A;  5ITZ B;  2R75 1;  3HKE B;  4YJ3 A;  3R0P A;  1IPA A;  3MCQ A;  5LP6 A;  3FBA A;  4I55 B;  3HKB B;  4HNA A;  2VAP A;  2K1S A;  2ALE A;  4YJ2 B;  4ZOL B;  3RYF B;  3RYC B;  4DRX B;  1VQ6 F;  5AVM A;  5MN4 A;  1UFY A;  4O4L B;  1JN1 A;  3U0O A;  3C9S A;  3C9U A;  1VQ7 F;  4EB6 A;  3TD3 A;  3VOA A;  3CCQ F;  4G4W A;  1Q82 H;  4I50 B;  2MQE A;  4O4H A;  3WJR A;  4EI9 A;  1QVF F;  1QD9 A;  2VAM A;  3F0E A;  3F0F A;  5HY1 A;  3LYB A;  3ON1 A;  3CCV F;  3E22 A;  1QU9 A;  3JAK A;  1JD1 A;  4RHA A;  5FNV B;  5IJ9 A;  3MBM A;  5GAN K;  5B8F A;  3WPX A;  2Z01 A;  3LDT A;  3P10 A;  1JFF A;  5GON B;  1KD1 H;  4C4W C;  5KX5 A;  1X52 A;  1XHO A;  4C8I A;  4LNU B;  1VQ5 F;  5J2T A;  1Z5W A;  5HP8 A;  1FNJ A;  2G9I A;  3RE3 A;  5G4U C;  3PLA C;  4EI7 A;  1W40 A;  1YGY A;  2GVI A;  3M84 A;  4DXD A;  2QA4 F;  5ITZ A;  2VGN A;  3LWV C;  3NMU C;  1YIJ F;  2ZVY A;  4I55 A;  5HY0 A;  3HKB A;  5EAZ A;  3HWU A;  1GO1 A;  1W5B A;  1S72 F;  2HP0 A;  4YJ2 A;  3JAW B;  4ZOL A;  3N2K B;  2CSL A;  4DRX A;  2HRU A;  5CB4 B;  4O4L A;  3CCE F;  3RA5 A;  1R1M A;  4I4T B;  4X1Y B;  5CA1 A;  3WGM A;  5JCO C;  5G4V C;  4TUY B;  2N48 A;  4C8G A;  4M8I A;  1W58 1;  3KHN A;  1W42 A;  1VQN F;  3T80 A;  4BW0 B;  4BT3 A;  2GZL A;  5IJ0 A;  2Z1E A;  4XCQ A;  1YJN F;  3I7T A;  4X3L A;  3PAF A;  2H6L A;  2ZOD A;  4U3J A;  5JCO A;  2IAF A;  1NQ3 A;  4R40 B;  2YXZ A;  2CVL A;  3LME A;  2RHJ A;  3RYH B;  2Q1X A;  3JAT B;  2HS0 A;  3JAR A;  3JAK B;  1X25 A;  3N4Z A;  4X1K B;  3C9T A;  4E6E A;  4G4Y A;  1PXW A;  2RB9 A;  2ZAU A;  3CPQ A;  3OON A;  1JFF B;  4G88 A;  3E1Y A;  3C8L A;  1OAP A;  2QEX F;  3WJQ A;  2L26 A;  3N2K A;  1E7K A;  2UYJ A;  5LXT A;  3O85 A;  3VYT C;  2BTO A;  3VTI C;  3G6E F;  2HRY A;  2UYK A;  4X1Y A;  4BVQ A;  3J7A R;  3D00 A;  4TUY A;  1VQ9 F;  2QI2 A;  1NMU B;  5EWR A;  3K14 A;  3GYQ A;  4BT2 A;  2HQS C;  2CHS A;  3CC7 F;  2KTU A;  3J80 M;  1J7H A;  2HP0 B;  3IR9 A;  2OHW A;  5HP7 A;  1W55 A;  1VQV A;  1VH8 A;  2BTU A;  5KMG B;  5IT9 M;  5HXU A;  1VQ8 F;  4G4X A;  1VHA A;  5CA1 B;  5EYP B;  2RHO A;  2JNB A;  3QHD A;  3LWR C;  3RA6 A;  4NQ3 A;  3ZP4 A;  2CW4 A;  4ZHY B;  5LYJ A;  2F9Z C;  2KG4 A;  1W59 A;  3I3F A;  1SDS A;  3F0G A;  3HKC B;  5GAP K;  3QUW A;  3RYH A;  5IJ0 B;  3JAT A;  3KE1 A;  4FFB A; 
#chains in the Genus database with same CATH homology
 5A2Q M;  5HY0 A;  3CC2 F;  4BY9 D;  3CXC F;  1GO1 A;  4EI8 A;  3E20 B;  5HY4 A;  1S72 F;  1NJI H;  3CG6 A;  2BO1 A;  1H7M A;  1X7O A;  4TZZ A;  1RLG A;  1W3E X;  4BVT A;  1CN7 A;  3WXM B;  3CCE F;  2FGY A;  1KC8 H;  5EO3 A;  1GO0 A;  1W41 A;  3RA5 A;  2LBX A;  3NVI B;  5G4V C;  3V7Q A;  2FC3 A;  2WAL A;  3NVK E;  3CC4 F;  3I55 F;  3V3T A;  1W42 A;  2LBW A;  1QVG F;  1VQN F;  3SIV A;  4X3M A;  1M1K H;  3V7E A;  2KTV A;  4BW0 B;  2OZB A;  3CCU F;  1Q86 H;  1K8A H;  1RA4 A;  1YJ9 F;  3LWP C;  1YIT F;  1VQO F;  4XCQ A;  5HY2 A;  1YJN F;  4X3L A;  3CD6 F;  5FJ4 C;  3CME F;  3VMF B;  3PAF A;  3OBW A;  3HAX D;  3CCL F;  1VQM F;  3AGK A;  3CCM F;  2OTJ F;  3FFM A;  1K73 H;  3LFO A;  1M90 H;  1ZWZ A;  3OW2 F;  5FLX M;  3CCS F;  3LWQ C;  1DT9 A;  3LWO C;  5GIO C;  1IPA A;  3N4Z A;  1N8R H;  1VQK F;  1PXW A;  2HVY D;  2ALE A;  4BVS A;  4NUT A;  3CCJ F;  1W2B F;  3CPQ A;  1VQ6 F;  4BVR A;  3E1Y A;  1X7P A;  1VQL F;  2QEX F;  1JJ2 F;  1GZ0 A;  1VQ7 F;  3OBY A;  1E7K A;  3G4S F;  3O85 A;  1YI2 F;  3HJW C;  3SIU A;  3CCQ F;  1Q82 H;  3MCA B;  3G6E F;  3CPW F;  4EI9 A;  1QVF F;  1VQ4 F;  4BVQ A;  5HY1 A;  1YJW F;  1Q7Y H;  3J7A R;  3D00 A;  2I6D A;  3CCR F;  3ON1 A;  1VQ9 F;  1VQP F;  2QI2 A;  5GIP C;  3CCV F;  1NMU B;  1Q81 H;  5EWR A;  1K9M H;  3GYQ A;  4LCK A;  3CC7 F;  2KTU A;  3G71 F;  5GAN K;  3J80 M;  3IR9 A;  2OHW A;  1CK2 A;  3NK7 A;  3JCM M;  3CMA F;  1KD1 H;  1XBI A;  2OTL F;  2AIF A;  4C4W C;  1YHQ F;  1X52 A;  5IT9 M;  5HXU A;  1KQS F;  1VQ5 F;  1VQ8 F;  5DCV A;  3VI6 A;  2JNB A;  5G4U C;  3PLA C;  3LWR C;  3RA6 A;  4NQ3 A;  4EI7 A;  1W40 A;  2F9Z C;  2KG4 A;  3N4Y A;  3I56 F;  2QA4 F;  2CZW A;  2GLZ A;  5HXZ A;  3NK6 A;  3J81 M;  5HWE A;  5GAP K;  1SDS A;  1T0K B;  5GIN C;  2VGM A;  2VGN A;  3LWV C;  3NMU C;  1YIJ F;  3JAM M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...