4BW0B

The molecular recognition of kink turn structure by the l7ae class of proteins
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMKT-7
publication title The Molecular Recognition of Kink-Turn Structure by the L7Ae Class of Proteins.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna/rna binding protein
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4bw0B00
3VI6A 4C4WC 5G4UC 3CCQF 3CCSF 1Q82H 1VQNF 3LWPC 1KD1H 5A2QM 1VQOF 5EO3A 3CMAF 1VQKF 1Q81H 1PXWA 3SIVA 2VGMA 2AIFA 5G4VC 3I55F 3CC2F 1NJIH 1VQ5F 3GYQA 1W2BF 3OBWA 5GANK 3G4SF 1S72F 2HVYD 2QA4F 1IPAA 3CXCF 3OW2F 4X3MA 3PAFA 3CCJF 5GINC 3RA5A 3O85A 3IR9A 1Q7YH 1VQ4F 1DT9A 3JAMM 3CD6F 4LCKA 5DCVA 1KC8H 2LBXA 3NK6A 1E7KA 2OTLF 3SIUA 1M90H 2OZBA 1YIJF 1VQ7F 3J7AR 1VQMF 3FFMA 4X3LA 3HAXD 2KG4A 1N8RH 3MCAB 3V7QA 3NVIB 3LFOA 1RA4A 1VQ8F 3CPQA 1W41A 4BW0B 3NMUC 2FC3A 3V7EA 3WXMB 3CCUF 1YHQF 2I6DA 1GZ0A 1X52A 1SDSA 1VQPF 2JNBA 1K8AH 3HJWC 1W42A 5FJ4C 1GO1A 2QEXF 3J80M 2WALA 1KQSF 3LWQC 2OTJF 3ON1A 1CK2A 1X7PA 5GIOC 3RA6A 3G71F 1NMUB 1JJ2F 3G6EF 1VQ6F 1W40A 3E20B 1YJWF 2QI2A 3CMEF 3CG6A 3N4ZA 1K73H 1Q86H 5FLXM 1CN7A 1GO0A 1YJ9F 3N4YA 5GIPC 3CCLF 3CCVF 1VQ9F 5IT9M 3I56F 3NK7A 3J81M 5EWRA 1ZWZA 3CCRF 3VMFB 4TZZA 3AGKA 1W3EX 4BY9D 2KTUA 3LWVC 1RLGA 1K9MH 2OHWA 1H7MA 1QVGF 1M1KH 2BO1A 1YI2F 2LBWA 2CZWA 2KTVA 1YITF 1YJNF 3PLAC 3E1YA 5GAPK 2VGNA 1X7OA 3CPWF 3NVKE 3CCEF 3CCMF 3LWOC 3OBYA 3JCMM 1QVFF 2ALEA 1VQLF 3LWRC 1T0KB 3CC4F 3CC7F 1XBIA 4NUTA
chains in the Genus database with same CATH superfamily
2IAFA 4C4WC 3CCQF 1VQNF 3F0GA 4O4JB 4C8EA 5IYZA 3F0EA 2Q1XA 3LMEA 2I6RA 2VXYA 4ZOLA 4B5CA 1KD1H 5EO3A 3UT5A 4G4VA 4X20A 4ZOLB 4X20B 5LXTA 1PXWA 2B33A 4G4WA 2BTUA 1IV2A 4I50A 4U3JA 2CVLA 1PF5A 5GANK 3VTIC 3KHNA 5EB1B 1VH8A 1W581 1TVKB 1FFXB 1W5AA 3WJQA 5C8YA 3FBAA 5C8YB 1DT9A 3N2KB 2PMPA 4X1KB 2VAPA 3VCZA 1KC8H 1H47A 3P10A 2HS0A 5JCOA 1J7HA 1VQ7F 3S0HA 2HX0A 2HS3A 4O4IB 1GX1A 3M84A 3JALB 5LP6A 3NVIB 1NQ3A 3NMUC 4IIJA 3JARA 5JH7A 3CCUF 5EYPA 1YHQF 5JH7B 1SDSA 1X52A 5EYPB 1VQPF 1K8AH 3HJWC 1Q8RA 1W5EA 3F6MA 3HWUA 3ZOPA 5BMVA 2HS4A 4O4LB 4TUYB 4X1YB 3GTZA 3KIZA 3HKDB 1TUBA 3OONA 3LDTA 3JAWB 1TUBB 1NMUB 2HRUA 1JN1A 1W40A 1IV1A 2RHHA 1YJWF 1KNKA 4O4HB 2HP3A 3CG6A 1K73H 1Q86H 5LOVB 4HNAB 4X1IA 2L26A 4G4XA 2UYKA 3CCLF 1VQ9F 1RQ7A 3D00A 2LBTA 3HKEB 1QU9A 2GVIA 4BY9D 3HTNA 3S03A 2BTOA 4BVQA 1VQVA 5IJ0B 4NQ3A 2VAWA 1YI2F 2CZWA 1YJNF 3E1YA 2AIZP 5HP8A 2P6YA 5HXZA 5KMGA 4R40B 3ESJA 3ZP4A 1JD1A 5KMGB 3CCMF 1QVFF 2GLZA 2ALEA 3WGMA 5MN4A 4BT4A 3CC4F 3Q8HA 1Z5WA 5G4UC 1JFFA 3WPWA 2ZF8A 3LWPC 4ZI7A 4EB6A 2YYEA 4TV9B 4XCQA 5EAZA 3CMAF 3VO8A 5MN6A 1FSZA 2IQQA 3RYFB 4BVTA 5G4VC 4BT3A 3RYCA 1JY8A 5J2UA 2VAMA 1DBFA 3GYQA 1VQ5F 1W55A 1YQNA 3JATA 4O2BA 5GONA 3M1XA 2QA4F 5GONB 3ERNA 3R0PA 4DRXB 3PAFA 5GINC 5EIBD 2BTQB 5EIBC 5CA1A 3QTYA 1Q7YH 5CA1B 3FPIA 2DYYA 4ZHQA 2QTPA 1VQ4F 4BT5A 4ZHQB 5LYJB 3DDNA 5JQGA 4LCKA 5JQGB 1W5FA 4B46A 2LCAA 2LBXA 3NK6A 3HKCB 5JCOC 2HP0B 3FD5A 1M90H 1RQ2A 3D54A 3S0YA 3HAXD 2KG4A 1N8RH 3MCAB 5LP6C 4EI7A 4B45A 3LFOA 1RA4A 1TVKA 3CPQA 3V7EA 1FFXA 1QD9A 1VK3A 3U0OA 1XV2A 1RLUA 4I4TB 3WGNA 4F6RA 1GO1A 3LYBA 3J80M 2WALA 4F6RB 5CB4A 3N2KA 2IG8A 4X1KA 5CB4B 3K0TA 4NWOB 2HRYA 1VQ6F 3IKFA 3E20B 3MBMA 4O4IA 4WBNA 3JALA 4ZK7A 2Q1YA 4WBNB 3RYHB 1CN7A 2RHOA 3WGLA 3KE1A 3N4YA 1KNJA 3E22A 4KWEA 5AVMA 2CW4A 2UYPA 3E22B 5FNVB 2W8BC 4I55A 3J81M 4DXDA 4I55B 1UFYA 3VMFB 3AGKA 4O4LA 4TUYA 4X1YA 2KTUA 3N2GA 3HKDA 3BYQA 5HWEA 2ZVZA 2Z1EA 3N2GB 4EI9A 1RLGA 4BT7A 3C9SA 1H7MA 1QVGF 3ZP7A 3JAWA 2BO1A 3QUWA 2CHTA 2KTVA 4O4HA 3CPWF 3NVKE 5LOVA 4HNAA 3JCMM 4RHAA 1VQLF 3B6NA 3LWRC 3S06A 1XBIA 4C8IA 4NUTA 3VI6A 1T0AA 3CYPB 1Q82H 2FGYA 3IEQA 3HKEA 5A2QM 2YXZA 1VQKF 5IJ0A 1W57A 1U3PA 3I55F 1NJIH 4ZHWA 2CSLA 5J2TA 1W2BF 5IJ9A 1QAHA 5J2TB 1S72F 1ONIA 5IJ9B 2R751 3WJRA 2F9ZC 2HQSC 3CYQA 3CXCF 3S02A 4X3MA 4BT2A 5HY1A 3OW2F 5LA6A 3RA5A 3O85A 2H8EA 3JASB 4C8GA 3IR9A 5LA6B 4TV9A 1OAPA 3JAMM 3VYSC 2EWCA 1SZQA 3RYFA 1CLIA 4IHJA 5DCVA 3K14A 4E6EA 4IHJB 3RYIB 1E7KA 3SIUA 3P4EA 2ZODA 4BVRA 5EB0A 5B8FA 4U39A 3P0ZA 3V3TA 3M4SA 4C82A 4DRXA 4ZHVA 1VQ8F 3MDOA 2FC3A 3VOBA 4O2AA 4YJ3A 1GZ0A 3RE3A 4O2AB 2JNBA 4YJ3B 3EORA 5FJ4C 3F0FA 5ITZB 5LYJA 3MCQA 3ON1A 3KJKA 1Z5VA 1R1MA 3K12A 1X7PA 2UYNB 3HKCA 1XRGA 2HP0A 3FD6A 1ODEA 2QI2A 1VHAA 3ELCA 3CMEF 3N4ZA 3DC2A 5FLXM 1GO0A 5MN5A 1YJ9F 1SA0B 3K2XA 4RQOA 5IT9M 3I56F 2ZVYA 5EZYA 2RHJA 2DT4A 3IMPA 4I4TA 5IYZB 5EWRA 5HY4A 3CCRF 5EZYB 1XHOA 3UT5B 3LWVC 3C8LA 1K9MH 2OHWA 5LXTB 5HY2A 1M1KH 2R6R1 2LBWA 3VYUC 3PLAC 4G4YA 4I50B 4U3JB 2VGNA 1X7OA 3RYHA 3CCEF 3GHZA 3OBYA 2K1SA 1T0KB 2Z01A 3CC7F 2H8CA 4G88A 5KX5A 2AMTA 1H48A 5KX5B 4M8IA 5FNVA 3T80A 3CCSF 2ZOVA 3C9RA 3WPXA 4ZHYB 1VQOF 3F0DA 3TD3A 2MQEA 1Q81H 3SIVA 2VGMA 5HP7A 2AIFA 3CC2F 4BT6A 3OBWA 2CHSA 4PWTA 3G4SF 2N48A 2HVYD 3I7TA 3V4DA 5HY0A 5LP6B 1IPAA 1FNKA 1U43A 4IIJB 3JARB 4ERHA 3C9UA 3CCJF 5HXUA 3ZO8A 1YGYA 5BMVB 5CA0A 3CD6F 1U40A 2UYJA 3IEWA 5CA0B 3WGJA 3VOAA 1IV4A 4LNUA 2OTLF 4LNUB 2OZBA 3D01A 1YIJF 3J7AR 1VQMF 3FFMA 2Z1UA 4X3LA 2V9YA 3CB2A 3TD5A 3V7QA 2CWJA 4B62A 4X1IB 1W59A 3HKBA 2RB9A 1W41A 4BW0B 1FNJA 3WXMB 3HKBB 3S0WA 3JASA 2I6DA 4BVSA 4TV8A 1W42A 3VYTC 2QEXF 4EI8A 4TV8B 1KQSF 3LWQC 2G9IA 2OTJF 4C81A 1CK2A 5GIOC 3RA6A 3RYIA 3G71F 2OTMA 3IKEA 1JJ2F 3G6EF 2ZAUA 3JAKA 4FFBA 3QHDA 3JAKB 1X25A 4FFBB 5GIPC 2PHNA 4G4ZA 3CCVF 1U3LA 4O4JA 2KGWA 1COMA 3NK7A 1UI9A 1JFFB 1W5BA 2Z1FA 3WGKA 1ZWZA 4ZI7B 3TD4A 4EB6B 4TZZA 3VIUA 1W3EX 5ITZA 1OFUA 2Z1TA 5JVDA 3KJJA 2UZHA 2UYNA 4YJ2A 5JVDB 2RHLA 4YJ2B 3I3FA 3MQWA 2GZLA 3RYCB 1IV3A 1YITF 3JVHA 3WJPA 5GAPK 5J2UB 3JATB 4O2BB 3LWOC 3L7QA 2NMUA 1SA0A 2H6LA 3C9TA
chains in the Genus database with same CATH topology
3VI6A 4C4WC 5G4UC 3CCQF 3CCSF 1Q82H 1VQNF 2FGYA 3LWPC 1KD1H 5A2QM 4XCQA 1VQOF 5EO3A 3CMAF 1VQKF 1Q81H 1PXWA 3SIVA 2VGMA 2AIFA 4BVTA 5G4VC 3I55F 3CC2F 1NJIH 1VQ5F 3GYQA 1W2BF 3OBWA 5GANK 3G4SF 1S72F 2HVYD 2QA4F 5HY0A 1IPAA 2F9ZC 3CXCF 3OW2F 4X3MA 5HY1A 3PAFA 3CCJF 3RA5A 3O85A 5GINC 5HXUA 3IR9A 1Q7YH 1VQ4F 1DT9A 3JAMM 3CD6F 4LCKA 5DCVA 1KC8H 2LBXA 3NK6A 1E7KA 2OTLF 3SIUA 1M90H 2OZBA 1YIJF 1VQ7F 3J7AR 1VQMF 3FFMA 4X3LA 4BVRA 3HAXD 2KG4A 1N8RH 3MCAB 4EI7A 3V3TA 3V7QA 3NVIB 3LFOA 1RA4A 1VQ8F 3CPQA 1W41A 4BW0B 3NMUC 2FC3A 3V7EA 3WXMB 3CCUF 1YHQF 2I6DA 1GZ0A 1X52A 1SDSA 1VQPF 2JNBA 1K8AH 4BVSA 3HJWC 1W42A 5FJ4C 1GO1A 2QEXF 4EI8A 3J80M 2WALA 1KQSF 3LWQC 2OTJF 3ON1A 1CK2A 1X7PA 5GIOC 3RA6A 3G71F 1NMUB 1JJ2F 3G6EF 1VQ6F 1W40A 3E20B 1YJWF 2QI2A 3CMEF 3CG6A 3N4ZA 1K73H 1Q86H 5FLXM 1CN7A 1GO0A 1YJ9F 3N4YA 5GIPC 3CCLF 3CCVF 1VQ9F 5IT9M 3I56F 3NK7A 3D00A 3J81M 5EWRA 1ZWZA 5HY4A 3CCRF 3VMFB 4TZZA 3AGKA 1W3EX 4BY9D 2KTUA 3LWVC 5HWEA 4BVQA 4EI9A 1RLGA 1K9MH 2OHWA 1H7MA 5HY2A 1QVGF 1M1KH 2BO1A 4NQ3A 1YI2F 2LBWA 2CZWA 2KTVA 1YITF 1YJNF 3PLAC 3E1YA 5GAPK 2VGNA 1X7OA 3CPWF 3NVKE 5HXZA 3CCEF 3CCMF 3LWOC 3OBYA 3JCMM 1QVFF 2GLZA 2ALEA 1VQLF 3LWRC 1T0KB 3CC4F 3CC7F 1XBIA 4NUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI6 A;  4C4W C;  5G4U C;  3CCQ F;  3CCS F;  1Q82 H;  1VQN F;  3LWP C;  1KD1 H;  5A2Q M;  1VQO F;  5EO3 A;  3CMA F;  1VQK F;  1Q81 H;  1PXW A;  3SIV A;  2VGM A;  2AIF A;  5G4V C;  3I55 F;  3CC2 F;  1NJI H;  1VQ5 F;  3GYQ A;  1W2B F;  3OBW A;  5GAN K;  3G4S F;  1S72 F;  2HVY D;  2QA4 F;  1IPA A;  3CXC F;  3OW2 F;  4X3M A;  3PAF A;  3CCJ F;  5GIN C;  3RA5 A;  3O85 A;  3IR9 A;  1Q7Y H;  1VQ4 F;  1DT9 A;  3JAM M;  3CD6 F;  4LCK A;  5DCV A;  1KC8 H;  2LBX A;  3NK6 A;  1E7K A;  2OTL F;  3SIU A;  1M90 H;  2OZB A;  1YIJ F;  1VQ7 F;  3J7A R;  1VQM F;  3FFM A;  4X3L A;  3HAX D;  2KG4 A;  1N8R H;  3MCA B;  3V7Q A;  3NVI B;  3LFO A;  1RA4 A;  1VQ8 F;  3CPQ A;  1W41 A;  4BW0 B;  3NMU C;  2FC3 A;  3V7E A;  3WXM B;  3CCU F;  1YHQ F;  2I6D A;  1GZ0 A;  1X52 A;  1SDS A;  1VQP F;  2JNB A;  1K8A H;  3HJW C;  1W42 A;  5FJ4 C;  1GO1 A;  2QEX F;  3J80 M;  2WAL A;  1KQS F;  3LWQ C;  2OTJ F;  3ON1 A;  1CK2 A;  1X7P A;  5GIO C;  3RA6 A;  3G71 F;  1NMU B;  1JJ2 F;  3G6E F;  1VQ6 F;  1W40 A;  3E20 B;  1YJW F;  2QI2 A;  3CME F;  3CG6 A;  3N4Z A;  1K73 H;  1Q86 H;  5FLX M;  1CN7 A;  1GO0 A;  1YJ9 F;  3N4Y A;  5GIP C;  3CCL F;  3CCV F;  1VQ9 F;  5IT9 M;  3I56 F;  3NK7 A;  3J81 M;  5EWR A;  1ZWZ A;  3CCR F;  3VMF B;  4TZZ A;  3AGK A;  1W3E X;  4BY9 D;  2KTU A;  3LWV C;  1RLG A;  1K9M H;  2OHW A;  1H7M A;  1QVG F;  1M1K H;  2BO1 A;  1YI2 F;  2LBW A;  2CZW A;  2KTV A;  1YIT F;  1YJN F;  3PLA C;  3E1Y A;  5GAP K;  2VGN A;  1X7O A;  3CPW F;  3NVK E;  3CCE F;  3CCM F;  3LWO C;  3OBY A;  3JCM M;  1QVF F;  2ALE A;  1VQL F;  3LWR C;  1T0K B;  3CC4 F;  3CC7 F;  1XBI A;  4NUT A; 
#chains in the Genus database with same CATH topology
 2IAF A;  4C4W C;  3CCQ F;  1VQN F;  3F0G A;  4O4J B;  4C8E A;  5IYZ A;  3F0E A;  2Q1X A;  3LME A;  2I6R A;  2VXY A;  4ZOL A;  4B5C A;  1KD1 H;  5EO3 A;  3UT5 A;  4G4V A;  4X20 A;  4ZOL B;  4X20 B;  5LXT A;  1PXW A;  2B33 A;  4G4W A;  2BTU A;  1IV2 A;  4I50 A;  4U3J A;  2CVL A;  1PF5 A;  5GAN K;  3VTI C;  3KHN A;  5EB1 B;  1VH8 A;  1W58 1;  1TVK B;  1FFX B;  1W5A A;  3WJQ A;  5C8Y A;  3FBA A;  5C8Y B;  1DT9 A;  3N2K B;  2PMP A;  4X1K B;  2VAP A;  3VCZ A;  1KC8 H;  1H47 A;  3P10 A;  2HS0 A;  5JCO A;  1J7H A;  1VQ7 F;  3S0H A;  2HX0 A;  2HS3 A;  4O4I B;  1GX1 A;  3M84 A;  3JAL B;  5LP6 A;  3NVI B;  1NQ3 A;  3NMU C;  4IIJ A;  3JAR A;  5JH7 A;  3CCU F;  5EYP A;  1YHQ F;  5JH7 B;  1SDS A;  1X52 A;  5EYP B;  1VQP F;  1K8A H;  3HJW C;  1Q8R A;  1W5E A;  3F6M A;  3HWU A;  3ZOP A;  5BMV A;  2HS4 A;  4O4L B;  4TUY B;  4X1Y B;  3GTZ A;  3KIZ A;  3HKD B;  1TUB A;  3OON A;  3LDT A;  3JAW B;  1TUB B;  1NMU B;  2HRU A;  1JN1 A;  1W40 A;  1IV1 A;  2RHH A;  1YJW F;  1KNK A;  4O4H B;  2HP3 A;  3CG6 A;  1K73 H;  1Q86 H;  5LOV B;  4HNA B;  4X1I A;  2L26 A;  4G4X A;  2UYK A;  3CCL F;  1VQ9 F;  1RQ7 A;  3D00 A;  2LBT A;  3HKE B;  1QU9 A;  2GVI A;  4BY9 D;  3HTN A;  3S03 A;  2BTO A;  4BVQ A;  1VQV A;  5IJ0 B;  4NQ3 A;  2VAW A;  1YI2 F;  2CZW A;  1YJN F;  3E1Y A;  2AIZ P;  5HP8 A;  2P6Y A;  5HXZ A;  5KMG A;  4R40 B;  3ESJ A;  3ZP4 A;  1JD1 A;  5KMG B;  3CCM F;  1QVF F;  2GLZ A;  2ALE A;  3WGM A;  5MN4 A;  4BT4 A;  3CC4 F;  3Q8H A;  1Z5W A;  5G4U C;  1JFF A;  3WPW A;  2ZF8 A;  3LWP C;  4ZI7 A;  4EB6 A;  2YYE A;  4TV9 B;  4XCQ A;  5EAZ A;  3CMA F;  3VO8 A;  5MN6 A;  1FSZ A;  2IQQ A;  3RYF B;  4BVT A;  5G4V C;  4BT3 A;  3RYC A;  1JY8 A;  5J2U A;  2VAM A;  1DBF A;  3GYQ A;  1VQ5 F;  1W55 A;  1YQN A;  3JAT A;  4O2B A;  5GON A;  3M1X A;  2QA4 F;  5GON B;  3ERN A;  3R0P A;  4DRX B;  3PAF A;  5GIN C;  5EIB D;  2BTQ B;  5EIB C;  5CA1 A;  3QTY A;  1Q7Y H;  5CA1 B;  3FPI A;  2DYY A;  4ZHQ A;  2QTP A;  1VQ4 F;  4BT5 A;  4ZHQ B;  5LYJ B;  3DDN A;  5JQG A;  4LCK A;  5JQG B;  1W5F A;  4B46 A;  2LCA A;  2LBX A;  3NK6 A;  3HKC B;  5JCO C;  2HP0 B;  3FD5 A;  1M90 H;  1RQ2 A;  3D54 A;  3S0Y A;  3HAX D;  2KG4 A;  1N8R H;  3MCA B;  5LP6 C;  4EI7 A;  4B45 A;  3LFO A;  1RA4 A;  1TVK A;  3CPQ A;  3V7E A;  1FFX A;  1QD9 A;  1VK3 A;  3U0O A;  1XV2 A;  1RLU A;  4I4T B;  3WGN A;  4F6R A;  1GO1 A;  3LYB A;  3J80 M;  2WAL A;  4F6R B;  5CB4 A;  3N2K A;  2IG8 A;  4X1K A;  5CB4 B;  3K0T A;  4NWO B;  2HRY A;  1VQ6 F;  3IKF A;  3E20 B;  3MBM A;  4O4I A;  4WBN A;  3JAL A;  4ZK7 A;  2Q1Y A;  4WBN B;  3RYH B;  1CN7 A;  2RHO A;  3WGL A;  3KE1 A;  3N4Y A;  1KNJ A;  3E22 A;  4KWE A;  5AVM A;  2CW4 A;  2UYP A;  3E22 B;  5FNV B;  2W8B C;  4I55 A;  3J81 M;  4DXD A;  4I55 B;  1UFY A;  3VMF B;  3AGK A;  4O4L A;  4TUY A;  4X1Y A;  2KTU A;  3N2G A;  3HKD A;  3BYQ A;  5HWE A;  2ZVZ A;  2Z1E A;  3N2G B;  4EI9 A;  1RLG A;  4BT7 A;  3C9S A;  1H7M A;  1QVG F;  3ZP7 A;  3JAW A;  2BO1 A;  3QUW A;  2CHT A;  2KTV A;  4O4H A;  3CPW F;  3NVK E;  5LOV A;  4HNA A;  3JCM M;  4RHA A;  1VQL F;  3B6N A;  3LWR C;  3S06 A;  1XBI A;  4C8I A;  4NUT A;  3VI6 A;  1T0A A;  3CYP B;  1Q82 H;  2FGY A;  3IEQ A;  3HKE A;  5A2Q M;  2YXZ A;  1VQK F;  5IJ0 A;  1W57 A;  1U3P A;  3I55 F;  1NJI H;  4ZHW A;  2CSL A;  5J2T A;  1W2B F;  5IJ9 A;  1QAH A;  5J2T B;  1S72 F;  1ONI A;  5IJ9 B;  2R75 1;  3WJR A;  2F9Z C;  2HQS C;  3CYQ A;  3CXC F;  3S02 A;  4X3M A;  4BT2 A;  5HY1 A;  3OW2 F;  5LA6 A;  3RA5 A;  3O85 A;  2H8E A;  3JAS B;  4C8G A;  3IR9 A;  5LA6 B;  4TV9 A;  1OAP A;  3JAM M;  3VYS C;  2EWC A;  1SZQ A;  3RYF A;  1CLI A;  4IHJ A;  5DCV A;  3K14 A;  4E6E A;  4IHJ B;  3RYI B;  1E7K A;  3SIU A;  3P4E A;  2ZOD A;  4BVR A;  5EB0 A;  5B8F A;  4U39 A;  3P0Z A;  3V3T A;  3M4S A;  4C82 A;  4DRX A;  4ZHV A;  1VQ8 F;  3MDO A;  2FC3 A;  3VOB A;  4O2A A;  4YJ3 A;  1GZ0 A;  3RE3 A;  4O2A B;  2JNB A;  4YJ3 B;  3EOR A;  5FJ4 C;  3F0F A;  5ITZ B;  5LYJ A;  3MCQ A;  3ON1 A;  3KJK A;  1Z5V A;  1R1M A;  3K12 A;  1X7P A;  2UYN B;  3HKC A;  1XRG A;  2HP0 A;  3FD6 A;  1ODE A;  2QI2 A;  1VHA A;  3ELC A;  3CME F;  3N4Z A;  3DC2 A;  5FLX M;  1GO0 A;  5MN5 A;  1YJ9 F;  1SA0 B;  3K2X A;  4RQO A;  5IT9 M;  3I56 F;  2ZVY A;  5EZY A;  2RHJ A;  2DT4 A;  3IMP A;  4I4T A;  5IYZ B;  5EWR A;  5HY4 A;  3CCR F;  5EZY B;  1XHO A;  3UT5 B;  3LWV C;  3C8L A;  1K9M H;  2OHW A;  5LXT B;  5HY2 A;  1M1K H;  2R6R 1;  2LBW A;  3VYU C;  3PLA C;  4G4Y A;  4I50 B;  4U3J B;  2VGN A;  1X7O A;  3RYH A;  3CCE F;  3GHZ A;  3OBY A;  2K1S A;  1T0K B;  2Z01 A;  3CC7 F;  2H8C A;  4G88 A;  5KX5 A;  2AMT A;  1H48 A;  5KX5 B;  4M8I A;  5FNV A;  3T80 A;  3CCS F;  2ZOV A;  3C9R A;  3WPX A;  4ZHY B;  1VQO F;  3F0D A;  3TD3 A;  2MQE A;  1Q81 H;  3SIV A;  2VGM A;  5HP7 A;  2AIF A;  3CC2 F;  4BT6 A;  3OBW A;  2CHS A;  4PWT A;  3G4S F;  2N48 A;  2HVY D;  3I7T A;  3V4D A;  5HY0 A;  5LP6 B;  1IPA A;  1FNK A;  1U43 A;  4IIJ B;  3JAR B;  4ERH A;  3C9U A;  3CCJ F;  5HXU A;  3ZO8 A;  1YGY A;  5BMV B;  5CA0 A;  3CD6 F;  1U40 A;  2UYJ A;  3IEW A;  5CA0 B;  3WGJ A;  3VOA A;  1IV4 A;  4LNU A;  2OTL F;  4LNU B;  2OZB A;  3D01 A;  1YIJ F;  3J7A R;  1VQM F;  3FFM A;  2Z1U A;  4X3L A;  2V9Y A;  3CB2 A;  3TD5 A;  3V7Q A;  2CWJ A;  4B62 A;  4X1I B;  1W59 A;  3HKB A;  2RB9 A;  1W41 A;  4BW0 B;  1FNJ A;  3WXM B;  3HKB B;  3S0W A;  3JAS A;  2I6D A;  4BVS A;  4TV8 A;  1W42 A;  3VYT C;  2QEX F;  4EI8 A;  4TV8 B;  1KQS F;  3LWQ C;  2G9I A;  2OTJ F;  4C81 A;  1CK2 A;  5GIO C;  3RA6 A;  3RYI A;  3G71 F;  2OTM A;  3IKE A;  1JJ2 F;  3G6E F;  2ZAU A;  3JAK A;  4FFB A;  3QHD A;  3JAK B;  1X25 A;  4FFB B;  5GIP C;  2PHN A;  4G4Z A;  3CCV F;  1U3L A;  4O4J A;  2KGW A;  1COM A;  3NK7 A;  1UI9 A;  1JFF B;  1W5B A;  2Z1F A;  3WGK A;  1ZWZ A;  4ZI7 B;  3TD4 A;  4EB6 B;  4TZZ A;  3VIU A;  1W3E X;  5ITZ A;  1OFU A;  2Z1T A;  5JVD A;  3KJJ A;  2UZH A;  2UYN A;  4YJ2 A;  5JVD B;  2RHL A;  4YJ2 B;  3I3F A;  3MQW A;  2GZL A;  3RYC B;  1IV3 A;  1YIT F;  3JVH A;  3WJP A;  5GAP K;  5J2U B;  3JAT B;  4O2B B;  3LWO C;  3L7Q A;  2NMU A;  1SA0 A;  2H6L A;  3C9T A; 
#chains in the Genus database with same CATH homology
 3VI6 A;  4C4W C;  5G4U C;  3CCQ F;  3CCS F;  1Q82 H;  1VQN F;  2FGY A;  3LWP C;  1KD1 H;  5A2Q M;  4XCQ A;  1VQO F;  5EO3 A;  3CMA F;  1VQK F;  1Q81 H;  1PXW A;  3SIV A;  2VGM A;  2AIF A;  4BVT A;  5G4V C;  3I55 F;  3CC2 F;  1NJI H;  1VQ5 F;  3GYQ A;  1W2B F;  3OBW A;  5GAN K;  3G4S F;  1S72 F;  2HVY D;  2QA4 F;  5HY0 A;  1IPA A;  2F9Z C;  3CXC F;  3OW2 F;  4X3M A;  5HY1 A;  3PAF A;  3CCJ F;  3RA5 A;  3O85 A;  5GIN C;  5HXU A;  3IR9 A;  1Q7Y H;  1VQ4 F;  1DT9 A;  3JAM M;  3CD6 F;  4LCK A;  5DCV A;  1KC8 H;  2LBX A;  3NK6 A;  1E7K A;  2OTL F;  3SIU A;  1M90 H;  2OZB A;  1YIJ F;  1VQ7 F;  3J7A R;  1VQM F;  3FFM A;  4X3L A;  4BVR A;  3HAX D;  2KG4 A;  1N8R H;  3MCA B;  4EI7 A;  3V3T A;  3V7Q A;  3NVI B;  3LFO A;  1RA4 A;  1VQ8 F;  3CPQ A;  1W41 A;  4BW0 B;  3NMU C;  2FC3 A;  3V7E A;  3WXM B;  3CCU F;  1YHQ F;  2I6D A;  1GZ0 A;  1X52 A;  1SDS A;  1VQP F;  2JNB A;  1K8A H;  4BVS A;  3HJW C;  1W42 A;  5FJ4 C;  1GO1 A;  2QEX F;  4EI8 A;  3J80 M;  2WAL A;  1KQS F;  3LWQ C;  2OTJ F;  3ON1 A;  1CK2 A;  1X7P A;  5GIO C;  3RA6 A;  3G71 F;  1NMU B;  1JJ2 F;  3G6E F;  1VQ6 F;  1W40 A;  3E20 B;  1YJW F;  2QI2 A;  3CME F;  3CG6 A;  3N4Z A;  1K73 H;  1Q86 H;  5FLX M;  1CN7 A;  1GO0 A;  1YJ9 F;  3N4Y A;  5GIP C;  3CCL F;  3CCV F;  1VQ9 F;  5IT9 M;  3I56 F;  3NK7 A;  3D00 A;  3J81 M;  5EWR A;  1ZWZ A;  5HY4 A;  3CCR F;  3VMF B;  4TZZ A;  3AGK A;  1W3E X;  4BY9 D;  2KTU A;  3LWV C;  5HWE A;  4BVQ A;  4EI9 A;  1RLG A;  1K9M H;  2OHW A;  1H7M A;  5HY2 A;  1QVG F;  1M1K H;  2BO1 A;  4NQ3 A;  1YI2 F;  2LBW A;  2CZW A;  2KTV A;  1YIT F;  1YJN F;  3PLA C;  3E1Y A;  5GAP K;  2VGN A;  1X7O A;  3CPW F;  3NVK E;  5HXZ A;  3CCE F;  3CCM F;  3LWO C;  3OBY A;  3JCM M;  1QVF F;  2GLZ A;  2ALE A;  1VQL F;  3LWR C;  1T0K B;  3CC4 F;  3CC7 F;  1XBI A;  4NUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...