1U43A

Ispf with 4-diphosphocytidyl-2c-methyl-d-erythritol 2-phosphate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase Involved in Mevalonate Independent Biosynthesis of Isoprenoids
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1u43A00
1GX1A 3JVHA 3F0DA 3IEWA 1U3PA 1IV4A 1W55A 3F0FA 3Q8HA 4C8GA 1JY8A 1IV1A 3T80A 1U40A 2UZHA 4C81A 1U43A 1H47A 3B6NA 3GHZA 1W57A 3MBMA 1VHAA 3P0ZA 1KNJA 1VH8A 3F6MA 1IV2A 3K14A 4C8EA 3K2XA 3KE1A 2GZLA 3QHDA 3P10A 3F0EA 4C8IA 3FBAA 2PMPA 4C82A 1JN1A 1IV3A 3FPIA 3ESJA 3F0GA 5B8FA 3ELCA 1KNKA 3IKEA 1YQNA 3EORA 1H48A 3IEQA 3IKFA 2AMTA 3RE3A 1U3LA 3ERNA 1T0AA
chains in the Genus database with same CATH superfamily
3RYFA 3SIUA 4C4WC 3JAWA 2OZBA 4ZHWA 3JAMM 4I55A 5HY0A 2MQEA 1YI2F 4ZI7B 1YJWF 3GHZA 1XRGA 3VMFB 1J7HA 2NMUA 1KNJA 2IG8A 5LP6B 3CG6A 1VQKF 2KG4A 4ZHQA 5EYPA 2HS3A 1W42A 4X1KB 1RQ7A 4RQOA 2UYNB 2QA4F 1X25A 3CB2A 1YJNF 1TVKA 4ZK7A 1W41A 1FFXA 4TV8B 3CC2F 3I56F 2WALA 4X1YB 4G4VA 2ZVYA 3T80A 4EI8A 1UFYA 3VIUA 2HP0A 2CVLA 2RHOA 4FFBA 1T0KB 4B45A 2VAWA 5MN6A 3LWOC 2VXYA 1VQ8F 1VQ4F 3OBYA 3WPXA 1YQNA 3GTZA 4EB6A 4TV9B 4G4WA 1COMA 1N8RH 5KMGB 3HJWC 3ZP7A 5CA1A 2LBWA 2CHTA 4NUTA 3S03A 2UZHA 2Z1TA 2CHSA 3TD4A 3G71F 3CYPB 5LA6B 5BMVB 3JASA 3I3FA 3VYUC 2HQSC 3QTYA 2P6YA 3KE1A 2IAFA 3LWVC 4X1IA 5EB1B 2PMPA 1TUBB 4ZHVA 3JARB 2HRYA 3CCVF 2DT4A 3L7QA 3LDTA 4X20A 3JAKB 1IPAA 2FGYA 1W5BA 4YJ2A 1Q81H 1VQNF 3DDNA 5CA0A 2HX0A 5HXZA 3RA5A 1W3EX 4F6RA 2Q1YA 2LBXA 3VI6A 1JFFA 3D00A 3HKBA 2GZLA 4HNAA 5HY4A 4O2BA 3VYSC 3LMEA 3JATB 3C8LA 1QD9A 1VQMF 3P4EA 1KNKA 3QUWA 3FFMA 2YXZA 3I7TA 1DBFA 1FNKA 5EZYB 5JH7B 4X3LA 2H8CA 2HRUA 1SDSA 3K12A 2CZWA 3JVHA 2ZOVA 3E20B 2KTVA 4X3MA 5J2UA 5EO3A 1YGYA 4TUYA 3M1XA 3WJRA 1U43A 5LYJB 3RA6A 4R40B 5JQGA 3MBMA 3RYHB 3TD5A 1X7OA 5ITZA 3MQWA 1JJ2F 3K2XA 3O85A 2Z01A 3CCQF 4C8IA 4U3JB 1M90H 5EAZA 1ODEA 3ESJA 4YJ3A 3NVIB 2QTPA 3EORA 5IJ0B 5IYZA 2YYEA 1Q8RA 3IKFA 5JVDA 2DYYA 3JALA 3N2KA 2I6RA 4I50B 1JD1A 4RHAA 3CCMF 3LFOA 1OAPA 3Q8HA 3OBWA 4IIJB 1JY8A 4KWEA 1IV1A 5EIBD 3CXCF 3G4SF 1ONIA 1FSZA 3CCSF 4WBNB 2AIZP 2ZF8A 4BT5A 4BT6A 3F6MA 3OW2F 4DRXA 1NMUB 3RYCB 3QHDA 1PXWA 3CCLF 3S06A 3UT5A 3CC7F 3RYFB 3JAWB 1SA0A 2QI2A 2UYKA 3S02A 5GANK 4I55B 5LP6A 1UI9A 1KD1H 2HS4A 3J80M 4E6EA 1H48A 2H8EA 4X1KA 5MN4A 4B5CA 2I6DA 5LP6C 5EYPB 4C81A 4BT4A 3NK7A 4I4TA 5LXTA 3M84A 4BY9D 3CCEF 3V7EA 2G9IA 1TVKB 4BT7A 3ZOPA 5A2QM 3C9UA 2BTUA 5IJ9A 1FFXB 5C8YA 3LWPC 1RLGA 5HWEA 5CB4B 3CCJF 4LCKA 3I55F 4ERHA 3RYIA 4O2AB 1VQ9F 3RE3A 2HP0B 5G4VC 3VOAA 1X7PA 4FFBB 1FNJA 1RQ2A 2W8BC 3IEWA 3VYTC 4C8GA 3JCMM 1QVFF 1QAHA 3WGMA 4NWOB 1H47A 5HXUA 4ZOLA 3CMAF 1DT9A 1SZQA 2LCAA 2K1SA 4EB6B 3E22B 1JN1A 3CMEF 5BMVA 2KTUA 3WJPA 5HP8A 3ON1A 3JASB 2IQQA 3JARA 4O4HB 2RHHA 3MCQA 3F0DA 4BT3A 1QVGF 3F0FA 3D01A 2HP3A 1KQSF 4LNUA 3M4SA 5KX5A 4G88A 1VQPF 1VQ7F 3SIVA 2RB9A 3VCZA 1K9MH 1IV2A 4IHJB 3LWQC 4X20B 1M1KH 5EB0A 4O4JA 3HKCA 4YJ2B 3HKEA 2RHLA 3C9SA 5FNVA 1E7KA 3N4YA 2BTOA 5HY1A 3NMUC 4F6RB 4O4IB 4BVQA 2V9YA 2AMTA 2F9ZC 3WXMB 1JFFB 1T0AA 3HKBB 3N2GA 2VGMA 3IMPA 1CLIA 1YIJF 3B6NA 3E1YA 3P0ZA 4BVRA 3AGKA 3WGNA 1XBIA 1R1MA 5LOVA 3PLAC 4NQ3A 2HS0A 3HKDA 4EI7A 5B8FA 2ZVZA 3WPWA 5J2UB 4BT2A 1VQ5F 1XHOA 5J2TA 2VGNA 4TUYB 1W5EA 3PAFA 5JQGB 4O4LA 3LYBA 5FLXM 3ERNA 5ITZB 1XV2A 2HVYD 2GLZA 4B46A 3DC2A 2R751 3HWUA 2PHNA 2Z1UA 2VAPA 5FJ4C 2VAMA 2KGWA 3KJKA 3N4ZA 5IYZB 2ALEA 5GONB 3FBAA 5JVDB 3N2KB 3WGLA 1YITF 1W2BF 1VQVA 5EIBC 3V4DA 4ZI7A 4WBNA 2CWJA 1Z5VA 3IEQA 1YJ9F 3WGKA 4DRXB 2FC3A 3S0HA 1VK3A 3WJQA 1IV4A 5AVMA 3ZO8A 3J7AR 3C9TA 3MCAB 1H7MA 2UYNA 1U40A 3CPQA 3UT5B 4ZHQB 1SA0B 1W57A 3KJJA 3K14A 4C8EA 2GVIA 4TV8A 2Q1XA 4X1YA 4B62A 3HTNA 5GIOC 5IT9M 1Q86H 4BW0B 1RLUA 4I4TB 5LXTB 1W5AA 5JCOA 3MDOA 2JNBA 3K0TA 1U3PA 1NJIH 4M8IA 5CB4A 2ZAUA 5IJ9B 4O2AA 2UYPA 5C8YB 2OHWA 2EWCA 3TD3A 5JCOC 2AIFA 3OONA 4TV9A 5KMGA 1VH8A 3GYQA 1W581 3RYIB 3F0EA 3J81M 2R6R1 5CA1B 5EWRA 5LA6A 2OTJF 4DXDA 3IKEA 2B33A 3CC4F 2Z1EA 3VOBA 3D54A 4ZOLB 3E22A 3IR9A 3LWRC 1TUBA 1GX1A 2H6LA 2BO1A 5MN5A 3S0WA 3CCUF 4X1IB 2UYJA 1Z5WA 4G4ZA 3WGJA 1GO0A 3JAKA 4O4HA 4BVTA 4BVSA 4TZZA 3FPIA 3V3TA 4IHJA 1ZWZA 5CA0B 4LNUB 5KX5B 2CSLA 3NVKE 2BTQB 4XCQA 3JATA 2N48A 3C9RA 3CD6F 5GIPC 4HNAB 4G4XA 4O4JB 3KHNA 1GZ0A 3HKCB 4O2BB 4O4IA 3HKEB 5EZYA 3V7QA 5JH7A 5HP7A 1S72F 1VHAA 1K73H 5FNVB 3KIZA 1X52A 1VQ6F 3VO8A 5LYJA 1Q7YH 3N2GB 1CK2A 5HY2A 3ELCA 3RYHA 5G4UC 3VTIC 3FD5A 4EI9A 2CW4A 5GINC 5DCVA 3U0OA 3FD6A 2OTMA 4U3JA 4ZHYB 3CPWF 1W55A 2Z1FA 3BYQA 5GAPK 5LOVB 2ZODA 1W59A 3S0YA 1QU9A 1GO1A 3CCRF 1KC8H 3HKDB 5IJ0A 1W5FA 2LBTA 5J2TB 3CYQA 1K8AH 4YJ3B 1VQLF 2RHJA 3R0PA 4I50A 1RA4A 3P10A 4G4YA 4O4LB 2L26A 4IIJA 4C82A 1PF5A 1IV3A 1W40A 3JALB 3ZP4A 3F0GA 1OFUA 2QEXF 4PWTA 1CN7A 3RYCA 3NK6A 4U39A 5GONA 1VQOF 3G6EF 1YHQF 1Q82H 2OTLF 1NQ3A 3HAXD 1U3LA
chains in the Genus database with same CATH topology
1GX1A 3JVHA 3F0DA 3IEWA 1U3PA 1IV4A 1W55A 3F0FA 3Q8HA 4C8GA 1JY8A 1IV1A 3T80A 1U40A 2UZHA 4C81A 1U43A 1H47A 3B6NA 3GHZA 1W57A 3MBMA 1VHAA 3P0ZA 1KNJA 1VH8A 3F6MA 1IV2A 3K14A 4C8EA 3K2XA 3KE1A 2GZLA 3QHDA 3P10A 3F0EA 4C8IA 3FBAA 2PMPA 4C82A 1JN1A 1IV3A 3FPIA 3ESJA 3F0GA 5B8FA 3ELCA 1KNKA 3IKEA 1YQNA 3EORA 1H48A 3IEQA 3IKFA 2AMTA 3RE3A 1U3LA 3ERNA 1T0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX1 A;  3JVH A;  3F0D A;  3IEW A;  1U3P A;  1IV4 A;  1W55 A;  3F0F A;  3Q8H A;  4C8G A;  1JY8 A;  1IV1 A;  3T80 A;  1U40 A;  2UZH A;  4C81 A;  1U43 A;  1H47 A;  3B6N A;  3GHZ A;  1W57 A;  3MBM A;  1VHA A;  3P0Z A;  1KNJ A;  1VH8 A;  3F6M A;  1IV2 A;  3K14 A;  4C8E A;  3K2X A;  3KE1 A;  2GZL A;  3QHD A;  3P10 A;  3F0E A;  4C8I A;  3FBA A;  2PMP A;  4C82 A;  1JN1 A;  1IV3 A;  3FPI A;  3ESJ A;  3F0G A;  5B8F A;  3ELC A;  1KNK A;  3IKE A;  1YQN A;  3EOR A;  1H48 A;  3IEQ A;  3IKF A;  2AMT A;  3RE3 A;  1U3L A;  3ERN A;  1T0A A; 
#chains in the Genus database with same CATH topology
 3RYF A;  3SIU A;  4C4W C;  3JAW A;  2OZB A;  4ZHW A;  3JAM M;  4I55 A;  5HY0 A;  2MQE A;  1YI2 F;  4ZI7 B;  1YJW F;  3GHZ A;  1XRG A;  3VMF B;  1J7H A;  2NMU A;  1KNJ A;  2IG8 A;  5LP6 B;  3CG6 A;  1VQK F;  2KG4 A;  4ZHQ A;  5EYP A;  2HS3 A;  1W42 A;  4X1K B;  1RQ7 A;  4RQO A;  2UYN B;  2QA4 F;  1X25 A;  3CB2 A;  1YJN F;  1TVK A;  4ZK7 A;  1W41 A;  1FFX A;  4TV8 B;  3CC2 F;  3I56 F;  2WAL A;  4X1Y B;  4G4V A;  2ZVY A;  3T80 A;  4EI8 A;  1UFY A;  3VIU A;  2HP0 A;  2CVL A;  2RHO A;  4FFB A;  1T0K B;  4B45 A;  2VAW A;  5MN6 A;  3LWO C;  2VXY A;  1VQ8 F;  1VQ4 F;  3OBY A;  3WPX A;  1YQN A;  3GTZ A;  4EB6 A;  4TV9 B;  4G4W A;  1COM A;  1N8R H;  5KMG B;  3HJW C;  3ZP7 A;  5CA1 A;  2LBW A;  2CHT A;  4NUT A;  3S03 A;  2UZH A;  2Z1T A;  2CHS A;  3TD4 A;  3G71 F;  3CYP B;  5LA6 B;  5BMV B;  3JAS A;  3I3F A;  3VYU C;  2HQS C;  3QTY A;  2P6Y A;  3KE1 A;  2IAF A;  3LWV C;  4X1I A;  5EB1 B;  2PMP A;  1TUB B;  4ZHV A;  3JAR B;  2HRY A;  3CCV F;  2DT4 A;  3L7Q A;  3LDT A;  4X20 A;  3JAK B;  1IPA A;  2FGY A;  1W5B A;  4YJ2 A;  1Q81 H;  1VQN F;  3DDN A;  5CA0 A;  2HX0 A;  5HXZ A;  3RA5 A;  1W3E X;  4F6R A;  2Q1Y A;  2LBX A;  3VI6 A;  1JFF A;  3D00 A;  3HKB A;  2GZL A;  4HNA A;  5HY4 A;  4O2B A;  3VYS C;  3LME A;  3JAT B;  3C8L A;  1QD9 A;  1VQM F;  3P4E A;  1KNK A;  3QUW A;  3FFM A;  2YXZ A;  3I7T A;  1DBF A;  1FNK A;  5EZY B;  5JH7 B;  4X3L A;  2H8C A;  2HRU A;  1SDS A;  3K12 A;  2CZW A;  3JVH A;  2ZOV A;  3E20 B;  2KTV A;  4X3M A;  5J2U A;  5EO3 A;  1YGY A;  4TUY A;  3M1X A;  3WJR A;  1U43 A;  5LYJ B;  3RA6 A;  4R40 B;  5JQG A;  3MBM A;  3RYH B;  3TD5 A;  1X7O A;  5ITZ A;  3MQW A;  1JJ2 F;  3K2X A;  3O85 A;  2Z01 A;  3CCQ F;  4C8I A;  4U3J B;  1M90 H;  5EAZ A;  1ODE A;  3ESJ A;  4YJ3 A;  3NVI B;  2QTP A;  3EOR A;  5IJ0 B;  5IYZ A;  2YYE A;  1Q8R A;  3IKF A;  5JVD A;  2DYY A;  3JAL A;  3N2K A;  2I6R A;  4I50 B;  1JD1 A;  4RHA A;  3CCM F;  3LFO A;  1OAP A;  3Q8H A;  3OBW A;  4IIJ B;  1JY8 A;  4KWE A;  1IV1 A;  5EIB D;  3CXC F;  3G4S F;  1ONI A;  1FSZ A;  3CCS F;  4WBN B;  2AIZ P;  2ZF8 A;  4BT5 A;  4BT6 A;  3F6M A;  3OW2 F;  4DRX A;  1NMU B;  3RYC B;  3QHD A;  1PXW A;  3CCL F;  3S06 A;  3UT5 A;  3CC7 F;  3RYF B;  3JAW B;  1SA0 A;  2QI2 A;  2UYK A;  3S02 A;  5GAN K;  4I55 B;  5LP6 A;  1UI9 A;  1KD1 H;  2HS4 A;  3J80 M;  4E6E A;  1H48 A;  2H8E A;  4X1K A;  5MN4 A;  4B5C A;  2I6D A;  5LP6 C;  5EYP B;  4C81 A;  4BT4 A;  3NK7 A;  4I4T A;  5LXT A;  3M84 A;  4BY9 D;  3CCE F;  3V7E A;  2G9I A;  1TVK B;  4BT7 A;  3ZOP A;  5A2Q M;  3C9U A;  2BTU A;  5IJ9 A;  1FFX B;  5C8Y A;  3LWP C;  1RLG A;  5HWE A;  5CB4 B;  3CCJ F;  4LCK A;  3I55 F;  4ERH A;  3RYI A;  4O2A B;  1VQ9 F;  3RE3 A;  2HP0 B;  5G4V C;  3VOA A;  1X7P A;  4FFB B;  1FNJ A;  1RQ2 A;  2W8B C;  3IEW A;  3VYT C;  4C8G A;  3JCM M;  1QVF F;  1QAH A;  3WGM A;  4NWO B;  1H47 A;  5HXU A;  4ZOL A;  3CMA F;  1DT9 A;  1SZQ A;  2LCA A;  2K1S A;  4EB6 B;  3E22 B;  1JN1 A;  3CME F;  5BMV A;  2KTU A;  3WJP A;  5HP8 A;  3ON1 A;  3JAS B;  2IQQ A;  3JAR A;  4O4H B;  2RHH A;  3MCQ A;  3F0D A;  4BT3 A;  1QVG F;  3F0F A;  3D01 A;  2HP3 A;  1KQS F;  4LNU A;  3M4S A;  5KX5 A;  4G88 A;  1VQP F;  1VQ7 F;  3SIV A;  2RB9 A;  3VCZ A;  1K9M H;  1IV2 A;  4IHJ B;  3LWQ C;  4X20 B;  1M1K H;  5EB0 A;  4O4J A;  3HKC A;  4YJ2 B;  3HKE A;  2RHL A;  3C9S A;  5FNV A;  1E7K A;  3N4Y A;  2BTO A;  5HY1 A;  3NMU C;  4F6R B;  4O4I B;  4BVQ A;  2V9Y A;  2AMT A;  2F9Z C;  3WXM B;  1JFF B;  1T0A A;  3HKB B;  3N2G A;  2VGM A;  3IMP A;  1CLI A;  1YIJ F;  3B6N A;  3E1Y A;  3P0Z A;  4BVR A;  3AGK A;  3WGN A;  1XBI A;  1R1M A;  5LOV A;  3PLA C;  4NQ3 A;  2HS0 A;  3HKD A;  4EI7 A;  5B8F A;  2ZVZ A;  3WPW A;  5J2U B;  4BT2 A;  1VQ5 F;  1XHO A;  5J2T A;  2VGN A;  4TUY B;  1W5E A;  3PAF A;  5JQG B;  4O4L A;  3LYB A;  5FLX M;  3ERN A;  5ITZ B;  1XV2 A;  2HVY D;  2GLZ A;  4B46 A;  3DC2 A;  2R75 1;  3HWU A;  2PHN A;  2Z1U A;  2VAP A;  5FJ4 C;  2VAM A;  2KGW A;  3KJK A;  3N4Z A;  5IYZ B;  2ALE A;  5GON B;  3FBA A;  5JVD B;  3N2K B;  3WGL A;  1YIT F;  1W2B F;  1VQV A;  5EIB C;  3V4D A;  4ZI7 A;  4WBN A;  2CWJ A;  1Z5V A;  3IEQ A;  1YJ9 F;  3WGK A;  4DRX B;  2FC3 A;  3S0H A;  1VK3 A;  3WJQ A;  1IV4 A;  5AVM A;  3ZO8 A;  3J7A R;  3C9T A;  3MCA B;  1H7M A;  2UYN A;  1U40 A;  3CPQ A;  3UT5 B;  4ZHQ B;  1SA0 B;  1W57 A;  3KJJ A;  3K14 A;  4C8E A;  2GVI A;  4TV8 A;  2Q1X A;  4X1Y A;  4B62 A;  3HTN A;  5GIO C;  5IT9 M;  1Q86 H;  4BW0 B;  1RLU A;  4I4T B;  5LXT B;  1W5A A;  5JCO A;  3MDO A;  2JNB A;  3K0T A;  1U3P A;  1NJI H;  4M8I A;  5CB4 A;  2ZAU A;  5IJ9 B;  4O2A A;  2UYP A;  5C8Y B;  2OHW A;  2EWC A;  3TD3 A;  5JCO C;  2AIF A;  3OON A;  4TV9 A;  5KMG A;  1VH8 A;  3GYQ A;  1W58 1;  3RYI B;  3F0E A;  3J81 M;  2R6R 1;  5CA1 B;  5EWR A;  5LA6 A;  2OTJ F;  4DXD A;  3IKE A;  2B33 A;  3CC4 F;  2Z1E A;  3VOB A;  3D54 A;  4ZOL B;  3E22 A;  3IR9 A;  3LWR C;  1TUB A;  1GX1 A;  2H6L A;  2BO1 A;  5MN5 A;  3S0W A;  3CCU F;  4X1I B;  2UYJ A;  1Z5W A;  4G4Z A;  3WGJ A;  1GO0 A;  3JAK A;  4O4H A;  4BVT A;  4BVS A;  4TZZ A;  3FPI A;  3V3T A;  4IHJ A;  1ZWZ A;  5CA0 B;  4LNU B;  5KX5 B;  2CSL A;  3NVK E;  2BTQ B;  4XCQ A;  3JAT A;  2N48 A;  3C9R A;  3CD6 F;  5GIP C;  4HNA B;  4G4X A;  4O4J B;  3KHN A;  1GZ0 A;  3HKC B;  4O2B B;  4O4I A;  3HKE B;  5EZY A;  3V7Q A;  5JH7 A;  5HP7 A;  1S72 F;  1VHA A;  1K73 H;  5FNV B;  3KIZ A;  1X52 A;  1VQ6 F;  3VO8 A;  5LYJ A;  1Q7Y H;  3N2G B;  1CK2 A;  5HY2 A;  3ELC A;  3RYH A;  5G4U C;  3VTI C;  3FD5 A;  4EI9 A;  2CW4 A;  5GIN C;  5DCV A;  3U0O A;  3FD6 A;  2OTM A;  4U3J A;  4ZHY B;  3CPW F;  1W55 A;  2Z1F A;  3BYQ A;  5GAP K;  5LOV B;  2ZOD A;  1W59 A;  3S0Y A;  1QU9 A;  1GO1 A;  3CCR F;  1KC8 H;  3HKD B;  5IJ0 A;  1W5F A;  2LBT A;  5J2T B;  3CYQ A;  1K8A H;  4YJ3 B;  1VQL F;  2RHJ A;  3R0P A;  4I50 A;  1RA4 A;  3P10 A;  4G4Y A;  4O4L B;  2L26 A;  4IIJ A;  4C82 A;  1PF5 A;  1IV3 A;  1W40 A;  3JAL B;  3ZP4 A;  3F0G A;  1OFU A;  2QEX F;  4PWT A;  1CN7 A;  3RYC A;  3NK6 A;  4U39 A;  5GON A;  1VQO F;  3G6E F;  1YHQ F;  1Q82 H;  2OTL F;  1NQ3 A;  3HAX D;  1U3L A; 
#chains in the Genus database with same CATH homology
 1GX1 A;  3JVH A;  3F0D A;  3IEW A;  1U3P A;  1IV4 A;  1W55 A;  3F0F A;  3Q8H A;  4C8G A;  1JY8 A;  1IV1 A;  3T80 A;  1U40 A;  2UZH A;  4C81 A;  1U43 A;  1H47 A;  3B6N A;  3GHZ A;  1W57 A;  3MBM A;  1VHA A;  3P0Z A;  1KNJ A;  1VH8 A;  3F6M A;  1IV2 A;  3K14 A;  4C8E A;  3K2X A;  3KE1 A;  2GZL A;  3QHD A;  3P10 A;  3F0E A;  4C8I A;  3FBA A;  2PMP A;  4C82 A;  1JN1 A;  1IV3 A;  3FPI A;  3ESJ A;  3F0G A;  5B8F A;  3ELC A;  1KNK A;  3IKE A;  1YQN A;  3EOR A;  1H48 A;  3IEQ A;  3IKF A;  2AMT A;  3RE3 A;  1U3L A;  3ERN A;  1T0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...