4DRXB

Gtp-tubulin in complex with a darpin
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
431
structure length
424
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title A designed ankyrin repeat protein selected to bind to tubulin caps the microtubule plus end.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
total genus 164
structure length 424
sequence length 431
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4drxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4drxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4drxB01
3RYIA 4I50A 4EB6A 4E6EA 5KMGB 4O4LA 4O2AB 4X1IA 4YJ3A 4F6RB 4EI8A 5JVDB 1Z5VA 3JARA 4IHJB 5J2TB 4O4IA 5IYZB 4TUYB 5BMVB 3HKCA 5LA6A 3RYIB 4I50B 4EB6B 5JQGA 1JFFA 4O4LB 4YJ3B 4X1IB 3RYHB 1FSZA 1W59A 1TUBB 3JARB 4O4IB 5FNVA 3UT5A 3HKCB 3HKDA 4I55B 3N2KA 3VOBA 5ITZA 4F6RA 5JQGB 1JFFB 5IJ9A 3RYCA 5JCOA 3RYFA 5IYZA 3WGKA 3N2GA 5FNVB 3JATA 5EIBD 3UT5B 4ZI7B 2GVIA 5MN6A 2XKBA 2BTQA 4IIJA 1RQ2A 1RQ7A 3HKDB 3N2KB 4HNAA 5ITZB 4M8IA 2BTOA 3RYHA 1TUBA 5IJ9B 1W581 5EYPA 1W5AA 5JCOC 3RYCB 2RHOA 3RYFB 2VXYA 4DXDA 3N2GB 3JALA 3JASA 4ZOLB 3JATB 4I55A 3ZBQA 2BTQB 4IIJB 4O2BA 4HNAB 3VOAA 3JAKA 5CA1A 3WGLA 5EYPB 4LNUA 3M8KA 5CB4A 4ZI7A 3JALB 3JASB 1OFUA 2RHJA 5C8YB 4O2BB 5LOVB 4U39A 3JAKB 2R751 5CA1B 2VAMA 2XKAA 4XCQA 4LNUB 4ZOLA 5CB4B 3ZIDA 5IJ0A 4TV9A 3WGMA 4X1YA 4TV8A 2R6R1 4FFBA 1W5EA 2VAPA 3E22A 5LP6A 4B45A 1FFXA 2RHLA 4B46A 4WBNA 3R4VA 5C8YA 1TVKA 5J2UA 4I4TA 3V3TA 5IJ0B 5LOVA 4TV9B 2VAWA 4X1YB 5MN5A 4X20A 4TV8B 4X1KA 2RHHA 5EIBC 1SA0A 3C8LA 5GONA 2Q1XA 4FFBB 3M89A 3E22B 5LP6C 5LP6B 1W5BA 1FFXB 4WBNB 4EI9A 1TVKB 5J2UB 4I4TB 4ZHQA 4O4HA 4YJ2B 4X20B 4O4JA 4X1KB 5EZYA 5CA0A 3VPAA 1SA0B 5GONB 3VO8A 3HKEA 3JAWA 5JH7A 3RB8A 1Z5WA 3ZBPA 4ZHQB 5KX5A 4O4HB 5LYJA 4O4JB 3WGJA 5EZYB 5CA0B 5LXTA 3HKBA 4DRXA 3HKEB 3JAWB 5JH7B 5MN4A 4YJ2A 4U3JA 4KWEA 5KX5B 5KMGA 5LA6B 5LYJB 4O2AA 5M7EA 5JVDA 3VO9A 5LXTB 4IHJA 5J2TA 3WGNA 1W5FA 3HKBB 4DRXB 4TUYA 5BMVA 4EI7A 1RLUA 3CB2A 4U3JB 2Q1YA
chains in the Genus database with same CATH superfamily
3E3MA 3AG2C 1EBFA 1EB9A 5H4GA 1YR9A 4LYEA 4UHBA 2EZOA 4C30A 1UBFA 3P9ZA 4WT7A 3O7WA 1K8QA 5HP4A 1WXDA 3A7DA 4DG5A 3GVCA 5C4IA 4DK0A 1FQOA 2IYQA 4V0NA 5LQJA 4RWZA 4G6ZA 1WUTA 4LHVA 1LS6A 3VR4D 3ZRVA 1GV0A 2QTOA 1CR6A 3WKBA 2YKGA 3MSCA 2HP8A 1XBTA 4XQGA 4F1KA 4F3TA 1KO1A 1KE1A 3CYQA 3Q7QA 5H2FZ 3O4IA 2DFPA 5HJ5A 4FM2A 3LQ4A 3OSUA 2I54A 5IBCA 1UIMA 1L5FA 1VPVA 1XCOA 4Z99A 1KBHA 2QVZX 3HM9A 5KUTA 3UW1A 3ZV4A 3VNRA 2VZ0A 1AKWA 3ZG6A 1H0HA 3DEIA 1EI9A 3H6KA 3ETLA 3CHYA 3NMUC 3R9XB 4JI5O 2X3UA 1J5EO 2UYCA 1IVNA 3AWIA 2CFOA 4JVOA 2G25A 4WF9V 3U26A 1GM8A 5K01A 1H2FA 4ZVKA 1C1XA 3S3TA 4WFJA 3WLAA 2DSTA 1VMKA 4RHUA 4RK6A 4F9EA 3NTVA 3OJEA 1Q74A 3UAGA 1WA5A 4GECA 1SC6A 4DLZA 5CJPA 3WB1A 4NL4H 5LBTA 2IUSA 1X8KA 4HN4B 3FTNA 4B3GA 3KKQA 1R0WA 3TW0A 5LKRA 4MLPA 1Q95A 1W87A 3AETB 3L7MA 1CERA 2FLKA 2VCHA 2IUTA 2P6OA 3HN7A 3FYTA 3G8BA 2RGDA 1TIKA 1V16A 4AMYA 3GN2A 1SH7A 2XR1A 1ZWZA 2UVQA 3TSOA 1AQIA 2I4TA 1JY8A 5E9WA 3UA4A 3QU7A 4E4TA 5JMOA 1WCXA 3VC3A 2W48A 4NU5A 1P45A 1QNFA 3TTVA 3KDPA 1C9NA 4YPVA 1PLLA 5KKAA 4HVAA 5TS2A 2OCXA 2KSQA 2Y6UA 1JG6A 5AJTA 1IQPA 5KC9A 3QNWA 2P5OA 2Z3YA 2X15A 4U02A 5LBQA 4QE7A 1A4UA 2Q07A 4BX3A 4HGQA 1QO0A 1YB2A 2GUWA 1EGMB 2HLNA 2Q3FA 3H1JH 3NDRA 5G0WA 1X15A 2KX7A 3B6MA 1Z62A 2EOAA 3P97A 4Z9FA 4IDAA 1HT2E 3JQGB 1UXOA 3WOHA 4RKYA 3X1WA 5AK0A 3I3FA 3U80A 2XUQA 4KLNA 4LRTB 4GZ5A 3OUFA 3SYCA 3NHAA 1SXJC 2Q1XA 1I6LA 4ZAYA 1S9HA 3CLSC 4PX5A 2A5YB 3VRHA 1E2QA 4N5LA 1P60A 3DFFA 2JAOA 4UHCA 3VR5A 2ECKA 1JHXA 2O3UA 3R41A 4JF3A 3DULA 1T6YA 2DR2A 1LDYA 3GLIA 1P2UA 4BP8A 3N2IA 5GVSA 4EJMA 1OKKD 3L1VA 1E89A 3AFHA 1PR3A 1TT5B 3C5WP 3B8MA 4LF7B 4DIEA 2QA5A 4MVCA 2OK8A 4ZXFA 1OSNA 4HRVA 3L46A 3E86A 4CM1A 1N5JA 3VVCA 5IU6A 1IE3A 1LK5A 2QT9A 5G4UC 2QIPA 2CHEA 2C4KA 1TD1A 1P8JA 3UQ8A 2H3HA 3ZV6A 4YP6A 1YVWA 4B7AA 4OFBA 4ND1A 1BCSA 4ZCPA 4XFJA 3MQFA 4M38A 1K89A 2EYQA 2AN4A 1IZ3A 3R5FA 5ADUS 2CBGA 2CE7A 3EFFK 3HL0A 1EX1A 3CGGA 1I5XA 1X52A 4UHDA 2R8YA 4TRRA 2N1BA 3T2MA 4HN9A 3GARA 3FCAA 1TM4E 3WYAA 2BY4A 2R11A 1W1WA 4W9RA 3UCSC 3VZSA 5IH7A 4QE3A 2RI1A 1NN0A 1FJHA 2DT5A 2VK4A 1F2TB 2P9QA 1T26A 2P4EA 2GM9A 3Q6IA 1PGJA 4HR7A 5CHYA 4BLTA 5L3QB 1L7VC 2P2GA 2FG6C 4UCWA 4ND6A 2J7PA 1YT5A 5F4ZA 4PVCA 2HS0A 2VRNA 3ADBA 3WPWA 5HIAA 2GSMB 2NNUA 1AF4A 2Y2VA 3KB8A 3KPUA 3OPYB 1AKYA 2H5JA 4S1NA 2Q3JA 5KA6A 3E83A 4DR2O 3DE2X 2QM4A 4JYAB 5I9MA 5LIRA 4O8ZA 4U7HA 4OHBA 5LNK6 1ODTC 4MVJG 1RBYA 1H2NA 2W93A 1ORHA 2HDNB 3S3WA 3D7KA 4FXPA 4FMDB 1FXWA 2JAHA 4XE5A 3LOUA 1R4ZA 4GX2A 3CFYA 1VJGA 1IZYA 4DA8A 3EGDB 3F90A 1YC5A 3MW8A 1XR3A 3EJ6A 13PKA 1NW4A 3ER8A 2JHGA 2XB8A 3HN2A 3FHOA 4TSFD 3KQMA 3UC5A 4QIHA 4F3KA 4B8WA 1I24A 2P2DA 3G67A 2VTKA 2CKMA 1S3IA 3U31A 4Z2YA 5MHTA 3QZUA 2VOEA 3KEQA 2E4YA 1B8VA 1KERA 2OBBA 2JS7A 3DEYX 4IVQA 3DZ8A 1M34E 4FUQA 1YXMA 3THWA 4NWOB 2WVAA 4XIJA 4RS4A 4FGJA 4RJLA 3C3PA 3EZYA 4HGZA 2Q2QA 4MQFA 3GB7C 1NBMA 3IOEA 1KMMA 1HLFA 2P3QA 4C0HA 4MIKA 2XOKA 1R0YA 5A4JA 3CBGA 2LJ2A 3KQHA 3F47A 2HSEA 1NV8A 1E2IA 2BCEA 1RJGA 3T9CA 4KE6A 2JGMA 1M76A 3SF0A 4JYYA 1C1HA 1NJGA 1GFSA 1VQLV 3WLEA 3OFNG 1GYRA 4RTPA 4ZVRA 4I55B 3WBJA 5EMJA 1EA7A 3AVXA 1NW6A 4A2WA 4B3TO 1UAGA 3PR3A 5DNWA 3S2SA 3T6KA 3KR2A 4RMJA 3GNSA 2X8WA 4RFSA 3F8TA 1SF9A 4TPKA 4PR3A 2HU8A 1NVDA 3GLHB 3ABQB 4PX9A 5CFQA 1XHFA 3AP2A 4FU0A 4J4TA 3PDIB 2I33A 2GUGA 3D01A 3MBIA 3I2FA 4OGLA 2OGWA 1NA5A 1GITA 1ZX1A 2JCGA 4IOLA 1WWKA 4YYZA 4BFWA 4II7A 2HU2A 4LC1A 4U6NA 3T8YA 3ESQA 3LVBA 3BHMA 3KOZA 3W2GA 4RKRA 2QY6A 3EQZA 1PJSA 4W1PA 4JBYA 2C9BA 1YRBA 3P5SA 1R73A 5JD3A 3N7TA 2GM3A 2DP4E 1EFUA 2AOVA 3QEOA 2UAGA 1KPIA 1V6CA 3OO1A 1CUZA 2QROA 2WF7A 1UL1X 4KK4A 1Z2CA 3K3PA 1YUNA 1RRCA 5F1YA 2V9PA 4M6WB 1ADJA 4MMYB 4QBIA 4MUGA 5CBFA 3FGZA 4ZVSA 3HU3A 3PXGA 1KHHA 3Q9NA 4QBGB 1ORWA 4FGSA 1VIBA 1DQPA 2Y1GA 1MZEA 4XDHA 2UYOA 1XJ0A 4KFMA 3L6EA 4NXNB 2DLNA 1NQTA 4X1YA 1OT3A 3O4RA 3H3FA 4P6VF 5A5EA 1E1RA 4LX8A 3I0MA 1KAGA 1EFAA 1USKA 3QPAA 4QGFA 3TBFA 4DKJA 4JD5A 1TTQB 3E1YA 1IUNA 2QD2A 2UVPA 5FNZA 4LHZA 4EIWA 2JLWA 3KU4A 4KTVE 3L0YA 1ENPA 5DSZA 4E2ZA 3VO9A 1TA0A 4A2CA 4R2IA 1JXOA 4V0RA 1F7VA 4W6ZA 1JG3A 1S2MA 1C0EA 2FSHA 4UNIA 4RZXA 5BNFA 1C3OA 2VQ6A 2HBZA 4RO0A 1JKJA 4KP4A 4CXMA 2HO4A 4GR9A 3T1YB 2RGRA 4US1R 5KOJA 3EPHA 3UGQA 5B58T 3K0FA 5EJGA 4BBPA 4XDYA 3I55F 5EB1B 2YN4A 2VDVE 3HNPA 4DMGA 3TGPA 3SYPA 1K7XB 1EM8A 3CR3C 1SHLA 3NCTA 3U4QA 2HP0B 2ZB8A 4WXHA 1UF9A 4FWBA 4CMJA 3R7WB 4DQKA 2ZJ5A 2X0LA 3P9CA 2J3HA 4HB0A 1JW9B 1KD1H 4DA4A 4NVPA 3KE8A 2ACVA 3TCKA 3WL7A 3QF4B 3AEYA 3VH1A 3SS9X 3UAXA 1FDUA 4YDQA 3PJEA 3OTOO 4GICA 3SI7A 3T1CA 3SR2C 3ZNNA 2NXEA 3A58B 3NBAA 5K05A 2C7GA 4N40A 2WNIA 1P5JA 3MSXA 3VU3A 3VBCA 3EMDA 3MQWA 1LU9A 3ISVA 2O8BA 1ZKDA 2WIFA 4GAEA 1DDIA 3VQVA 4AJHA 4Q3CA 3PUXA 3ZDRA 3FNGA 3V1TC 2QL5A 1HEIA 1QTRA 1HDCA 2II6A 4UVDA 5C8DA 1QFXA 2XPCA 4M9QA 3LHIA 1U28C 2ZWMA 3OQ1A 4FC6A 1P84F 5KYUB 3M82A 4DLTA 4DNOA 3JSXA 3PTZA 5HIJA 1TE2A 2MSDB 2FR8C 1WXGA 3BJRA 1R88A 3IPLA 1B0PA 3V33A 4FWTA 5IAOA 5AVWA 3H2JA 5IW8A 2M98A 4IFTA 4LW8A 2JHCA 4TS9A 1F7YA 2DPGA 4U6QA 5KNBA 2VR1A 2P0EA 2ZYUX 4C2TA 3UJ7A 1BU5A 3KXDA 1NNI1 1GEEA 2F1KA 3ZGYA 2J0UA 1XLUA 3HBFA 3IVXA 4YRRA 3AVOA 1E3EA 4F4FA 3ZE2B 3AK2A 4DW1A 3ND5A 1ZMTA 3W4JA 2C0QA 2QGNA 4GX5A 4LZNA 1EVYA 3BIJA 3LBAA 3U7QB 5K6AC 4QJIA 1TZBA 3N8KA 1PCXA 3G2MA 1E9VA 2EWMA 4RE5A 5KU1A 3BA8A 3RM3A 5D6NA 4GL2A 1YS2X 4IFBA 1LI5A 2JJ2D 2R8BA 3IL2A 1R8SA 3ORFA 4BCDA 1ZEMA 2C31A 3IPRA 1V3UA 1NRWA 4EYKA 3UAOA 2YTZA 1JBKA 1OH8A 3CMEF 3H5RA 4K1LA 3EXEB 2Y1WA 3RLFA 3SOZA 4H27A 4R01A 4CR7A 5IJWA 4Q03A 3BIXA 1DINA 3OVMA 1N1MA 2B4YA 4DLNA 4I3GA 4Q24A 3UWDA 3ONNA 1H2HA 5JI2E 1YBVA 4N5DA 4PLFA 3F6PA 3TIIA 1V9SA 4IVRA 2WA1A 2H2DA 1YA4A 1OLOA 3C3EA 3M7MX 2BZ1A 4YP1A 2HPZA 2E85A 4CDGA 3NONA 1XLTA 4MVQA 4LOAA 4TLDA 3ANYB 3A2NA 3QVNA 1FFGA 1P5RA 3UH0A 1IM8A 1FYJA 1WUJS 1VIYA 2GCEA 2PUHA 3SJAC 2YVAA 2XE6A 2GFIA 2PK3A 3E70C 4PDRA 4BVQA 4HCJA 4UU1A 5A9SA 1NBHA 4QUDA 4CFZA 4IQFA 2H6EA 3KFLA 1C3LA 1WP9A 5GJWC 3V7FA 2A06H 3T7TA 3H1PA 2M32A 2AZ0A 3ACDA 1S89A 4EW2A 2V3VA 2IGBA 1Q77A 2IELA 4X41A 4RM2A 3IP3A 4BWYA 5FLXM 4LXHA 1Z17A 1BGYH 1R9NA 2VQEO 5BP7A 3OBBA 5EBLC 1R1DA 3CP1A 4IH9A 1DU4A 5ALJA 5A0VA 4EJ2A 3S7TA 2UUAO 1WCIB 1EDEA 3AILA 1E8MA 1KU9A 1Y1KE 5DX0A 1OYWA 1Q17A 5AHWA 4RTOA 3JD3A 4KQCA 4FZJA 3SZUA 4BKOA 5JW6A 1CYDA 3ZDDA 2V4ZA 2IEBA 2AHYA 2O23A 2QP4A 3BB3A 3ILSA 2OECA 4DLPA 3E0QA 4B6RA 3IEPA 4PLWA 2QS9A 1FLDA 5FXMA 4OAPA 1KMCA 2XKJE 2V4MA 3LZCA 4D9EA 1CR2A 5ESDA 1UZUA 4B31A 3WIDA 1VFNA 4YMLA 2CGNA 2X13A 5REQB 3ZDQA 2X0IA 1AKRA 1T24A 2XGJA 1CUCA 1XVUA 2I34A 3WNDA 1VARA 4BFSA 3KB1A 4OQXA 1CEYA 3BOSA 2ZSUA 3P9NA 5F2KA 3N07A 2PZKA 3C5VA 1L5MA 2PT9A 3VYTB 1AVMA 2PGIA 1T5BA 1HX7A 4JWTA 1IM2A 4ID3A 1WJGA 1UMDA 4HFJA 1AUOA 4LSGA 2D62A 2VUIB 2AMTA 5JTTA 1LFDB 1YRAA 2IQIA 4ARVA 1YZTA 5HS6A 3VOAA 4RM3A 3CNOA 2OXRA 4D56A 2Y05A 3DDZX 1QVFU 1PT7A 2Z8ZA 4QEKA 1X74A 4B46A 3CVJA 1UJ6A 5AXBA 1E20A 4K0KB 4YMUA 5DASA 4YN3A 3GD5A 1L9KA 2B1GA 2X14A 4A6EA 1M8JA 2FMKA 2WIBA 1XMJA 2IUUA 3HKEB 1R0SA 1OH7A 5KTTA 3AY0A 2FB5A 2QYHA 2ZXEA 3PCXA 1U8FO 3IOYA 1H2BA 1NBOA 4XR4A 3KEGA 1R6KA 2JIRA 3PFKA 1OHHA 3FWYA 5KBYA 1K5PA 5DEOA 1PUJA 2IH3C 2AHZA 2QL7A 4QDUA 2ZR9A 2PMBA 3WRXA 5G4VC 1Y9JA 4OM8A 4RGBA 3WMGA 3KLBA 1BRTA 2OBLA 4TXHA 4YRGA 2O2HA 4A5UB 1UK8A 3O4VA 4IHQA 5B1SA 4B17A 1DAMA 2O2EA 3N4ZA 2XEDA 3EFEA 1RQNA 2R25B 3LC1O 4X1OA 5ES4B 3SIWA 5KCZA 2H18A 4JBNA 4G24A 5K8JB 3A6HA 2O1EA 4EABA 2Z2XA 4MDFA 5A4FS 1NZJA 4HATA 1CZKA 3Q9LA 4FMCF 1BJRE 4Q15A 4WL0A 1SIWA 1O94C 4YXFA 1XD8A 3R9XA 1EESA 4ZJUA 4N65A 4KE8A 3L4BC 4QTZA 1P5FA 4RSRA 1JHVA 4R2XA 1FTWA 1HG0A 4D9CA 4N0EA 3UMMA 2XTZA 2FFAA 1NR7A 3GJRA 4CFYA 1T2AA 5F2VO 1GZSA 3LV8A 3RU9A 3ABLC 2EKPA 2R7LA 1RS0A 1XL0A 5B3JC 3OE5A 1I36A 1K9SA 3PRYA 4PYOA 2EKDA 2PA3A 3WJAA 2X4LA 2NYUA 3RVZA 4CH3A 2I6DA 6REQB 2HWKA 2E4VA 3HGQA 1X9GA 3U0ZA 1EWRA 1BD3A 1UINA 3QVKA 3VR2D 4E0BA 2A67A 2GNAA 2D5CA 2FW6A 3AETA 3I3OA 4PPQA 3STUA 5JFOA 1XTZA 3IGAC 1QRRA 1PT6A 1G1XB 4F04A 4RTRA 4D45A 3PWKA 1E4OA 1M0SA 2JG3A 2JGDB 4AMBA 3TNLA 2VRCD 1U2RA 2AG0A 3M81A 3N6VA 1L4YA 4LBVA 3LRXA 1GTZA 1EFHA 1J2JA 4HEQA 1NHGA 2HV8A 2FZCA 4LN1A 3TLAA 3PF9A 1M1KH 1JA9A 1ENVA 1KBZA 3ROPA 1NIPA 3HB5X 3ZU5A 5AKEA 3KX2A 4C4SA 5AKHA 4Y2SA 1JLKA 1CZRA 4CQMB 3D36A 1HQKA 1NRJB 4W9NA 5THXA 3ZDXB 4MTCA 4U7JA 5HFLA 1E3JA 2KMLA 4W1SA 3RFFA 4HADA 4KWIA 1XYGA 3F0EA 3K8OE 3I62A 4ZQGA 3GXOA 5U4QA 2YNMD 5AM3A 3JQGA 1IUPA 4S1PA 4F85A 3MJHA 3R3VA 1Y4UA 5A4AA 3H8VA 1FS4A 3S81A 1B23P 4Q3LA 5KOYA 1VMDA 5LP6C 1CFZA 3LBYA 3AHJA 4D26A 4IVPA 2ZDQA 3T7KA 1G4HA 1TT5A 1SU6A 3PFHA 5BT8A 2Y93A 4EAAA 4GXNA 1GPYA 1UZLA 3EIQA 3L07A 2XNDA 3BHNA 1DEAA 4CT0A 3MLEA 4LYFA 2C7RA 1GZHB 3H6GA 2XTMA 1QGDA 2BFBB 3VO2A 1E3TA 2OHFA 1HURA 5J4VA 2IX3A 1CC1S 5A9TA 2PKCA 3AVYA 3ABMB 3WNZA 4RENA 1W96A 3LCUA 4FM9A 4CM8B 4LZWA 4YJDA 3AGQA 4WAUA 2VBCA 1MMFB 3KKEA 1G20B 3OU7A 4OUKX 1NVVR 3UKDA 4UUOA 5ESXA 3I2GA 4UVBA 3EASA 1NHWA 5T6MA 4MYCA 2YWEA 1X13A 2V7QG 3UQZA 3IH5A 2CL7X 4DCOA 4MB0A 4HLUA 3T7EA 3EEQA 3D54A 1K06A 1QCEA 4RTQA 4J7CA 3A0RB 5AHOA 4RMIA 3E7PA 3VCZA 1NN3A 3H9UA 1RQRA 2ERXA 4Y7CA 2IWHA 1DCKA 3NHPA 1F2TA 2J4FA 4MW5A 2ANCA 3U1BA 3H9BA 4ITVA 3OMWA 1GPAA 1CQWA 5KDDA 9LDTA 2V96A 4D0RA 4A91A 1U1IA 1THMA 3ZTYA 5JNSA 5L3QA 1EX7A 2WAYA 3TOZA 4XEHA 3VU9B 1P74A 1RRFA 3ZWYA 4Q9DA 4X8HA 4LY9A 1PZFA 1YZKA 3QJ5A 3QMMA 4BMXA 1P4SA 1P2VA 5I8WA 2G3YA 3ET4A 3OPYA 2WMDA 4YP9A 2YOGA 4TTVA 7ABPA 1CIPA 3I28A 4EKDA 3P4XA 4NATA 3A6ZA 2F4VO 4WDQA 4OI4A 2XNJA 4ZMSA 1FXKC 2FWNA 1XRGA 4OLFA 5T67A 2XQIA 4G8CA 4I7EA 3V4SA 4XDZA 4ZGWA 3FDIA 3W4IA 3E35A 4GNRA 4MW4A 3CWBH 1T1GA 5NLLA 2AJ8A 1D2DA 1GLNA 2B34A 3EAFA 1WL8A 1XNJA 1FFAA 2PV7A 4EUEA 2HS4A 3J7TA 2Y9MB 2PCJA 4LGCA 2QN2A 2EBHX 3EGDA 3MHPA 4G9GA 4ISBA 1D4AA 1SY7A 2V6GA 2ZAMA 2WA2A 1G0NA 3LGSA 3DBLB 2VPPA 2QSJA 4ABMA 2CWWA 1MD9A 1VSUA 3JQAB 3C3DA 3I3SR 4ZDKA 3GJTA 1RFYA 2EDCA 2XLBA 3H1IH 4BRSA 4HNVA 1CUIA 1GD1O 1ZA1A 3UAZA 4PR0A 3COJA 1SEVA 4A8TA 2GAAA 4P80A 4H31A 3T1HO 1NXVA 1CB7A 1GKFA 2DEUA 5TS3A 2HYIC 1OA0A 2Z2IA 3GJZA 5D87A 2L2QA 1OZFA 3RRYA 1NXTA 5DSTA 4NFHA 2R9IA 4XTCS 1YOVB 5IWAO 4WXRA 1T6ZA 4UXJA 3IALA 1VL5A 5C5CA 4DJJA 2NNLD 4G5XA 4W63A 3LX5A 2ZVPX 2C3YA 4HB4A 1OXSC 2EJTA 4QVIA 3OHPA 3JQ9C 3BMCB 1VQ6V 2J30A 3A4VA 1GG2A 4LHXA 3UB3A 1GPBA 1UJCA 1XN4A 5J5CA 1CEQA 3U44B 1BEZA 3NNNA 1K8RA 3GAMA 1YZLA 2QPAA 1AZTA 1YI2V 4CI0B 1L4MA 3VUEA 3PEEA 4HGRA 4RZUA 3AR2A 4ZVOA 3F8WA 3TMKA 4OPMA 4KYTA 2GLXA 1I3LA 1C0PA 2Q4BA 3BJIC 2RH8A 3ZVNA 1W5AA 3Q8HA 5FO1A 2D3OW 1RE1A 1RADA 3GLHA 3UN1A 5GADl 4DBZA 1IJFA 1FX0B 4M9SA 3PDIA 1KEZA 4NQRA 4NHOA 1YIDA 1KYIA 1U5AA 4DUZB 2B1JA 3LHSA 4LDPA 2CH7B 3I42A 3PNYA 4I9GA 4YC7A 1TA4A 2LP4Y 5HM8A 4LXQA 4LY6A 1XTQA 5CBPB 3U3XA 3V1LA 1TECE 1JSCA 1E7SA 3C14C 2BHRA 2J9ZB 4DLRA 1ZRNA 3T3EA 4RE6A 1NSTA 5AOCA 4YQFA 1UC4B 3O3NB 2H63A 2F3UA 5JZBA 4P3PA 4MI1A 3E2PA 3N2LA 2O8NA 3SM3A 2H7YA 1I3OA 4JA2A 1E77A 3ZQUA 1YJBA 3PR2B 2HWWA 1H93A 2Z9DA 4D46A 3S1AA 3RTBA 4FS8A 3O9VA 2ZRCA 3WGKA 1BJKA 2QWRB 4K9DA 2QMHA 3QPCA 3BCHA 4Z8YA 2R5WA 2EFYA 3G79A 3OCJA 5CYOA 1LNZA 4JBWA 2J67A 5C7YA 3BMQB 4QAJA 4HYOA 1KOJA 1CEEA 4UB6Z 1BKDR 5EIBC 1SXIA 2P41A 1JE0A 1Y6QA 1QRUA 2O8BB 4KITB 3CF4G 1OCRC 4RLQA 1P73A 1KJ9A 3VQXA 1I7SB 4B8ZA 2PG3A 5AK6A 2GB4A 5DCYA 4RVUA 3GFGA 2KJQA 1D7OA 3AFOA 4FFOA 3ZK9A 4KQWA 4BO3A 1EWKA 4Z54A 1AQYA 3DGFC 3IQGX 3HPRA 3LUAA 3RVPA 1W94A 5J4KA 2AKAB 2AKEA 3DS8A 3WAGA 3HZRA 4CIAA 2HVYD 5FEMA 4NNOA 2ZSAA 3GFVA 2OBYA 2HP0A 3R7WA 5EYPB 1QIEA 3JASB 4X5OA 1FYDA 3ETQA 3QX7A 4FMCB 2CB9A 4TVKA 4FOOA 3QF4A 5FOUA 2HQSC 2BM1A 3B1FA 1ZI6A 2ZEJA 3O73A 3BKXA 2CKDA 3ACCA 1JPJA 1J7KA 3ENQA 1RAGA 2AEEA 3ZWQA 3RS3A 3VMMA 1YMVA 4RFVA 2IIPA 3KTAB 3EZ6A 5B37A 1MJGA 2GN6A 3FKQA 1S6YA 4FR0A 3R3SA 1NIJA 1S8AA 1XFAA 4II2A 1UEJA 3B9BA 4GPBA 3I5YA 4HDOB 5A7GA 1J8DA 3NANA 1F4MA 4YHHB 2K6GA 2PLRA 1BD4A 1UZNA 4OX9B 2KLBA 1J20A 4RXUA 3PRKE 1KDOA 1MNAA 4X92A 5EEGA 4B3SB 1LPPA 2I99A 1OFUA 3E9RA 1FYVA 2UZ3A 3W2TA 1ZBDA 2H51A 3HBAA 1GDDA 1FMJA 3QYPA 2PR7A 2BOBC 4B48A 3KSUA 1N3YA 1FNSA 1X42A 3IQEA 3U9LA 5I48A 4LDRA 4YMVA 3VDNB 1MO3A 2FYTA 4ZEVA 2E75B 2B8EA 1I32A 1DUVG 1DBRA 2WJGA 1PV2A 5EJ9A 3ENZA 1QYRA 2R7NA 3HUTA 1EA5A 3KVOA 3PC7A 2W7TA 2I6UA 4Z9BA 4GPAA 4AZVA 3RYTC 4P81A 1FUKA 2X7RB 4WFEA 4FC7A 4QPPA 1GXSA 1UUFA 5CHEA 1Z5UA 3HDGA 1GTL1 1D6NA 2ZRGA 4AG6A 3RLIA 4JASB 3HE3A 3RVNA 1KWGA 4QE9A 3EWAA 1CEXA 1UDCA 5LBUA 4M8IA 1VBFA 3EG9B 3CINA 5IZCC 2R2GA 1XC7A 5L8VA 3CSUA 4CG0A 3Q7TA 3FSJX 4TZKA 2PUAA 5A9SB 3TZHA 4PFKA 4JEHA 3QLVC 1U90A 5LKAA 3U4GA 5DGDA 1VYVA 2CTWA 2IE8A 3EXEA 5LFAA 2WLSA 1JDNA 3M89A 2WYVA 4QPNA 1YHNA 3K0CC 4LHWA 5IC5A 4UM9D 3OT4A 2JRIA 4LF5O 4PTLA 3GX1A 1TW3A 4QQ8A 4QYIB 3T80A 4BNVA 4TMZA 4MUYA 6ABPA 3DMYA 5EEHA 4WFFA 2PXXA 3EMKA 2JZNA 4CIDA 2R8XA 3HUFA 2JIPA 4JXJA 1NOIA 2HEIA 1Y6FA 4E6EA 3Q8XB 4NCHA 3O3CA 4LF4O 4ADSG 3PYLA 4OKNA 3QG5A 4MWSA 4N54A 1MB0A 1D2GA 1ZCBA 3TX6A 5JROA 1ZLZA 3QY0A 4GE0A 4M0PA 2YICA 3ABKC 3JWGA 2P1ZA 1T1SA 3VPFA 1ZVJA 4RL4A 1DOHA 1C0KA 3W5IA 1EDOA 4I9NA 2VN8A 1MO4A 3WIOA 2JRLA 2C03A 4PLCA 1GGEA 1SBQA 2WYIA 2B94A 2GXQA 2INGX 5JC8A 4DSUA 5KUMA 3V2GA 5T5QA 2QYTA 4PHGA 2D59A 3ZS9A 4RY9A 2HQBA 5JWPA 1ZIYA 4G37A 1UBKS 3OZ7A 1W1IA 4EHHA 2F55A 4S24A 2UYYA 3VHRA 5J4LA 3C2QA 3FNEA 5DE3A 4NZZA 2CN1A 2B9VA 3VSBA 1KXJA 3QI7A 1Q1AA 3SAJA 4B6FA 2M6LA 1HYQA 1F0PA 1AXRA 1WCIA 3A1CA 2CVFA 4NXMO 3O8OB 4AKHA 2J0SA 2NUPB 3D81A 3KT3A 4YJKA 3W5AA 4K6GA 2PI4A 3CBQA 2UKDA 3TZCA 3N53A 5KC8A 2OFPA 5L3FA 2CLLB 3SBDA 4DCUA 2ZRBA 3EZXA 3MCUA 2HLPA 3TTXA 4F6LA 1QV9A 4ILKA 2E89A 2MINB 5DHFA 1ISRA 3NPAA 3SFVA 2PXAA 3E82A 2HPAA 4BNTA 4K26A 4QUJA 1F60A 3M6WA 3PX2A 2O4UX 1NJ8A 1B8NA 3ZP7A 1DG3A 4F12A 5REQA 2ZD9A 1P75A 1EK1A 3PN1A 3K5PA 4Z3DA 4KACA 3NOOA 3G89A 1P7GA 5CYGA 2J3QA 3M4JA 3S1SA 2CXRA 4MKIA 1LW7A 4LF6O 2FK7A 1MQSA 1JDTA 3WVNA 3I9V1 3G2LA 4GR5A 1QQBA 3WTBA 3I1JA 3PNOA 5CVCA 1OGIA 2FFJA 2DG2A 2ZTVA 2OQRA 1G42A 4G28B 4UD2A 4A3SA 1AHNA 4ER7A 3DV2A 3NTQA 1X3SA 3G88A 2AHOA 2Z2JA 4MV1A 1CXZB 3L7QA 3EE6A 1RSOB 3OKCA 1SKYB 4LDQA 1LBEA 2HMUA 4CMCA 3UAWA 1E1KA 3ORYA 4OF4A 4LJ4A 5K7SA 3A6PC 1JIKA 3D3IA 3DKVA 3AK4A 1H9BA 4HEA6 3CZ5A 1IG0A 4AX8A 4RH0A 5CFLA 1EE1A 2ZRHA 3K6KA 5I9LA 2EFEB 3IP6A 2H8CA 2R5NA 3ZQKA 1BXZA 2QOEA 2HHHO 2BHTA 3HKEA 1NW5A 3DLHA 4URFA 3JVEA 5CBKA 5DK4A 4MKXA 1WR8A 5LL6Y 1PZNA 4QFDA 3VKFA 1N5DA 4LGYA 2V74B 5B7NA 1SM4A 5AVTA 1Z5VA 3T4ZA 4RVCA 3OJWA 1AE1A 4Y1FA 2EEZA 3KZNA 3PA8A 3G17A 3C1AA 3DFMA 4Z1VA 5FBHA 1MEJA 3I9OA 3O4FA 3UUFA 4KL8S 1J39A 1Y9ZA 3FOBA 1IXMA 3AF4A 2YJTD 3I83A 3EK2A 2B6HA 4TWRA 5C80A 3LHDA 4J0KA 2IQQA 1ACMA 3FVWA 1ND5A 2VH5R 1RAAA 4ZKEA 3K12A 2Z4TA 5CYPA 1UBNA 2Q4EA 4JQYA 4WLVA 3FUVA 2QV0A 4US2R 5BWBA 1V3QE 2MIIA 3U40A 3HBNA 1WDMA 4BNMA 2QMQA 1KNXA 4ARBA 4G65A 1AKEA 1KARA 4HQFA 1T10A 3CKYA 4V2IA 3DFKA 2VP6A 4IIYA 4G89A 1RJ9A 3E9YA 4EY6A 4JEMA 3CNHA 2FZKA 3F67A 2LIPA 3BTSA 1DARA 3K2QA 3JQBA 2XWPA 2BM0A 3CXCU 4TMFA 4QARA 7MHTA 3KKZA 3EVTA 3I32A 3UV7A 2WA4A 1PAUA 3BXPA 5DT9A 5TGTA 4HZUB 2NU8B 6REQA 2C92A 4QTYA 3MG9A 1U8UA 2EIMB 5HILA 2PSSA 4AROA 4YT2A 2AEJA 2GPSA 2HA7A 3GPCA 1POXA 2QA4F 3IC5A 2CXXA 1VE6A 3SZMA 2JGDA 2ZFUA 1U3CA 3GGPA 4QHSA 1ZIDA 1F3LA 3NCHA 1WVMA 3ZD6A 3FWHA 1T8UA 1MT0A 1Z8DA 3OT7A 2D2FA 4JJIA 4B6EA 1KKDA 2W22A 2O7VA 4BCCA 3OF2A 2CTQA 1WTCA 3ETCA 1WA8B 1IOVA 4GZLA 5JXIA 3VYSC 1IAQA 1UP6A 3X2EA 5EC8A 4HQ6A 4RLHA 4W4LA 5EE9A 1R12A 4EI7A 2A9HA 4OL0A 4CQMA 4NESA 4RPJA 4OHMA 1M83A 3L43A 3UK0A 1EXDA 2WTBA 3WSVA 3L6BA 1P3DA 1MC5A 3QUWA 1LX7A 4BZWA 4R1SA 4IXTA 1I0IA 2VDRB 1EZJA 4HH4A 3CUUA 5LUBA 2W83A 4AUNA 1ZK4A 2GTSA 5LCXA 4FFLA 3ETGA 4P9OA 4PTZA 4UCVA 2XUGA 4BJHB 4W82A 5KJ6A 3COSA 3D6HA 4AY5A 1BMDA 2VRBA 2D54A 3WWPA 5H82A 2CHQA 4LJKA 2KTVA 1AK1A 2I8CA 1WUYA 1L6RA 1E98A 1GPWB 4UARA 3ONEA 2QL9A 3HUDA 2CHFA 3AJRA 1G9XA 2B0JA 4W1QA 1BWPA 1BS1A 3A1WA 2JJ1A 4Q20A 2P8SA 1G1MA 1O9BA 1SA0B 5BMOA 2WJPA 2NO5A 4D42A 4D02A 2OP1A 2G5TA 2MSCB 5DHAA 5A3RA 2CUZA 3I09A 1E6WA 1Q3HA 1HQYE 3IJPA 4TL6A 4F1WA 2BFBA 3CE2A 3QA9A 3W9UA 2X2EA 2Y0DA 4EFKA 4LDNA 3VNQA 4DEVA 3MT7A 3R24A 4OYRA 3I4FA 3C16C 3RS4A 2F17A 2DXIA 4JOBA 5K3FA 1FNBA 4CM8A 1K4KA 4M9UA 1G20A 3SVTA 3GJ8A 1CULC 3AJ8A 2WM2A 1Q7EA 1YASA 2VQ3A 3QVJA 3ERCA 2IW3A 2YZMA 3KQLA 2EIJB 1Y4AE 1TYAE 3WMRA 2IU6A 1BS3A 1ZJ4A 1S3SA 1WAZA 1Q50A 4XH9B 4G8DA 1P9RA 3TG2A 3A0RA 3MGCA 3MYYA 5DOVA 1FSFA 1A2OA 1DPFA 5D51S 2DH6A 2JGEA 4KHPB 1W6RA 4CKWB 1X87A 4XVQA 1D2CA 4M1MA 4IGKA 5D84A 2L26A 4EG5A 1DK1A 3JQEA 2E4AA 1XHXA 2BLLA 3ZGNA 5LLDA 3PT5A 3AZQA 4J0EA 4AO6A 2D0OB 1YF3A 4ZO8A 2VJLA 2PS3A 1IVYA 3VU9A 4GKJO 1XWWA 4JT4A 5JG7A 5C5IA 1RCTE 1SD5A 2ONYA 2YXEA 1USGA 2I3BA 3G71V 4DWJA 1KJWA 4DQ0A 1RKBA 1Y6XA 4DRYA 2ZRLA 4YAGA 4RULA 3CPHA 3AFMA 1QIIA 3KR0A 3DEHA 1KWKA 4DMLA 4XDLA 2PZBA 2H00A 1JHQA 4JV5O 1EVJA 5BV1A 2MMCA 3NWEA 3C9UA 1JJ2F 4YLYA 3ZV3A 3HZOA 1BVYF 2HKOA 1XRRA 1VQ9F 3D2BA 3VH3A 1IN1A 4O2RA 1VKZA 5J63A 4F5YA 5LHGA 2UYPA 1Y8RB 1T4GA 3KZXA 1FS0G 3DW3X 2E21A 4ZRNA 5EWJB 2RONA 3M0EA 3GLTA 2Z30A 1DJMA 3UHJA 4R0VA 4E09A 3OZSA 3DBLA 2IPMA 3TRFA 4OLAA 5FPSA 3JQAA 4KR2A 1FTSA 4GR4A 4L9AA 2JASA 3PE4A 4IJWA 2X5OA 1SXHA 1JNYA 4DPMA 4BU0A 3WJ7A 1BDBA 4AP6A 2ZJAA 5E9QA 3O21A 2ZIXB 5ALGA 1MH9A 4EW3A 5I7WA 5LGTA 1OCZC 5JSQA 4JUDX 1YOVA 5FO0A 1CF2O 2BEWB 2IYAA 3PNKA 4OV6B 1JTFA 3NWBA 4ZQEA 1QG2A 5JWOA 1ABEA 4JR0A 1OC4A 4KK3A 5J4HA 3BMCA 3UBMA 4W5WA 1CETA 2QRKA 2DUUA 1C8LA 1NT4A 1J5EB 3WHPA 2GZDA 1ZP6A 4JP3A 5HM6A 4TQ9A 3U44A 4HGOA 4C43A 2PIAA 1E9DA 3S1AB 4JQSA 1X8LA 2XNHA 2BRUA 4QREA 4QYSA 4NK5A 2DHQA 1VQMF 2LV8A 3SWWA 5DXFA 1GN6A 1DKLA 4AIIA 1EP2B 1I08A 3VUFA 1RBQA 3PUZA 4BLRA 1VHLA 5L7WA 2OZVA 4G67A 1FX0A 3PXCX 2BZ0A 5CPBA 1C8KA 2V7BA 4IUCS 1YVRA 1FYXA 5D5QA 3U7IA 2QLNA 2CH7A 1PXWA 4N0DA 3CE6A 2FTKA 2GN8A 3P2JA 1U2DA 2MSKA 3EQ9A 3Q10A 5CBPA 4KQJA 1K4MA 3X2QC 4FYMA 2JAUA 3STYA 2PMKA 5L3EA 3LPCA 3G5MA 2O3SA 2YFQA 2ZDIA 3X0DA 2XD9A 3C6ZA 3OP4A 4X1KB 5CLHA 5DHUA 4PHHA 1V5FA 1X77A 3PXBA 4N49A 1RZ3A 2V9CA 4JN6B 4C6TB 1QU3A 1ILEA 3FOZA 3KQYA 4NE7A 4EO9A 4XQ0A 3TRDA 3LAWA 1VG8A 5FPYA 1SUPA 1TAHA 1ONOA 2OAQ1 1LDNA 3WKAA 3L84A 3TSYA 4DSAA 2G5CA 1XZBA 4I9HA 5COBA 1GZ5A 3LPNA 4IDPA 3CCQV 4CL8A 2VK8A 3T1QA 4BO1A 3WIUA 3CRCA 3JVIA 4JLUA 4JJ8A 1WZNA 2IH2A 1FPMA 4E1AA 1KIAA 3ESAA 3K6JA 1UKBA 1DUSA 3L7IA 3ZMSA 2X5XA 2QUZA 4NVRA 2EJUA 1WRBA 4NZPA 3GPDG 1I5EA 4MUAA 3BMQA 3DZDA 1QAQA 2X0EA 4JGIA 2PVPA 1G19A 2G1PA 3TEMA 1IOWA 3AI3A 4ZOCA 1QG0A 4F6EA 2GETA 4ZC1A 4AN1A 3UUEA 1Y6ZA 1E1NA 1R5JA 3CZQA 1P5ZB 1SU7A 3O2SB 2XW6A 3FNQA 2PLWA 1V5GA 1QQ7A 3G1TA 4DJDC 2JGIA 4CT4B 3OIVA 2IZ7A 5I6DA 5LQDA 1U8AA 2CY0A 4TRJA 1G59A 2J46A 2A9KA 4JFRA 3RBVA 3I4CA 3LO8A 2ZJBA 3RV3A 4Y8VA 1PHRA 2PFKA 5K45A 4MCAA 1ML3A 5EYPA 4KX5A 1EFRG 1Q12A 1CF9A 3JASA 1XLTC 3IDOA 2B4RO 1NFRA 1ODIA 4GWKA 3BWDD 2XMBA 2JFWA 3K9LA 4ZANA 4Q4JB 5BRAA 1PG2A 2QX8A 4Z49A 4ZOLA 1EXMA 4KQIA 1WB6A 1KNQA 2YQ5A 2XWJI 3MILA 5KTPA 3KTAA 2OYQA 1P17A 4QTXA 5IDWA 3DM9B 1GXSB 2IC5A 4MVJA 4LDJA 5B1YA 4UHKA 4WDRA 1S3GA 1U40A 1CY8A 3FZQA 5AIBA 4G1UC 4XM0A 4BX0A 4BAUA 1K92A 1QQ5A 3U4DA 2JLXA 3I01A 3OOJA 3C5EA 2YMQA 1PJRA 3IA7A 4IYRA 2CVPA 1ZD1A 1OILA 1ZVMA 3MBMA 3W7VA 3B51X 2XMGA 1MN6A 2LBTA 2P4UA 4P2GA 2IYPA 4BIIA 2XYPA 4E2FA 3ENWA 4MP6A 4DR2B 2ZUCA 5B1AC 1ZM2A 3CONA 3LI2A 3KJFA 3ZZ0A 3EIHA 3CH7A 1P81A 1KOLA 5TJ9A 1Z29A 1HTTA 1VLVA 2L69A 1T5TA 1NXWA 2NW6A 4LHEA 4KCGA 3MAGA 5K0EA 2ZRMA 4M89A 4BRUA 4N6GA 1RDFA 3H13A 2YW2A 4RHCA 1XUQA 1XXHB 3AJDA 3FVVA 2BD0A 1ZGJA 2CFIA 3SQOA 3DE4X 2C8JA 3S7ZA 3ZS8A 3I5UA 2WTNA 5KNCA 3ADKA 1F6WA 5BSVA 1PJQA 4JASA 4WD3A 3LSSA 4LRYA 3CCRV 2XI4A 4I9QA 1NY5A 4OHYA 2Z1DA 1GO1A 3EG9A 4RF3A 4YUAA 3OFNA 2V4UA 5D3KA 3DMGA 1PR0A 3V2IA 1KQNA 2Q6AA 4AD8A 3NVMB 5FNVF 3P19A 3UICA 1JMKC 1WV0A 2XXBA 4UVIA 4NP6A 3WO0A 1NVVQ 5ILOA 3PNBA 4G0UA 1K0FA 5BYBA 3N75A 5ALXA 3REGA 3DAYA 1B8UA 4QYIA 2Y9PB 3INTA 2CJPA 2OXFA 2RNBA 2ZSIA 1XILA 1LTKA 3OAAD 3JY6A 4Y2HA 3IT1A 4GX1A 2XTAA 4MRMB 1GT6A 1PQUA 2I3AA 4EYQA 1Z7YA 1QUEA 1P19A 2QRZA 4IX1A 4B3TB 2VHXA 4HYYA 1T1IA 4GI5A 3QOYA 1TYEB 4DBLE 2OBNA 1H42A 1Z4IA 1PL6A 3WRXC 3B85A 4YNBA 4PM4A 1AK2A 4QECA 4IRXA 1KKCA 2TMDA 1GUFA 3O4HA 2EX1A 5EUMA 4AUEA 1T5IA 2R87A 1KD1W 4CL0A 1X1CA 2HSZA 2P6PA 3WGOA 4DQXA 7ADHA 1MB3A 4MPJA 4UFNA 2PVCA 1C7IA 5HG0A 4YAIA 4Z3OA 1R4NA 3P0FA 3ON5A 2QW0X 2IF0A 3EVKA 4DNXA 4HY3A 4N0MA 1FNCA 5I8PA 2Q6KA 3CTPA 3QYAA 5DWVA 1IDOA 5HPYB 4WK4B 3WU2Z 3N2NA 2O05A 4C01A 3ANSA 4G56A 2VF7A 2YWJA 5AW8A 3N3BC 3WK8A 5L45A 4FGZA 3AR6A 1X39A 4OX9Y 1YA8A 5G02A 3TG8A 1E5XA 4ZCIA 2IH1C 2W6ID 4CKBB 2RKBA 3GRRA 3C7KA 3O8OA 5FOVA 2NUPA 3DSQA 1V8BA 2PGGA 4WFGA 4HMQA 1AKQA 2NX2A 2NO4A 1HTWA 4MMZB 1Z45A 3L1JA 1JDJA 2OHHA 1Z15A 3E3LA 1R5BA 4CW7A 4KGDA 2MINA 4TTTS 3KOUA 4BQIA 3Q8LA 1Y5IA 1GPUA 2Y67A 5G4KB 1ZAKA 1ZD9A 3ORQA 3L9XA 4KMSA 1VF7A 4MPPA 3O65A 1Y4MA 3A6LA 2AE2A 2AOTB 1G5RA 2FP4A 3OHSX 4RSHA 1LDEA 4F4JA 2ADQB 3KPJA 1YBAA 4FLMA 5I9TA 3RRMA 1Q1BA 1AA9A 5E0OA 5DT2A 2VZLA 5AVQA 4DZZA 4JSYA 4F3RA 5JS1A 4QELA 4YCSA 4M2LA 4UBNA 4AJIA 5KTRA 3AR7A 1H1DA 2VPIA 2VWPA 4LFBB 2WLNA 4FBGA 5F7XA 1GQSA 2C2MA 2WFMA 4OQLA 1UDWA 5HW0A 2A57A 3OX2A 4TSKA 3CPSA 3GA7A 3D36C 4EPTA 4RTMA 1TEZA 10MHA 3LY5A 1Q1NA 3KQOA 3PCTA 1BX1A 1CXZA 3FF1A 4W9NC 2JDIG 1RSOA 2NT3A 1XPOA 1SQ5A 2ZLBA 5FYDA 1OZ0A 2VYNA 2B4TO 2YJ4A 1P3JA 1HKHA 2ZB4A 3X2FA 3MBOA 2FWPA 3P32A 4AO7A 5TGDA 2C8KA 2LQTA 3VI3B 3OTOB 4ZOLF 3ZLUA 4BZZA 1RXEA 3OD5A 1Y7TA 1DS6A 4CM9D 4C05A 1RJ9B 3KAKA 3BL6A 2ISCA 3UF0A 4G25A 3IKJA 3K32A 1Y3IA 2XBMA 4GDFA 1QG4A 1FNMA 4K2AA 2AIFA 4DMHA 4MVJF 1Z25A 2R97A 3H01A 3QI2A 3FBGA 3FTEA 3RT1A 4ZEXA 2DH5A 3IBGA 1VP3A 2IBTA 2OT3B 1KO5A 2H06A 3VPSA 1YJCA 3BL8A 3W90A 3RBZA 4QJ4A 1E6MA 4PCLA 4UAUA 4FMTA 4RIFA 4NC9A 2C4MA 1H2SB 3B2EE 2CHSA 2XTNA 1WMSA 2JIBA 1V54B 5BUZA 5INTA 2LBXA 1FZQA 4DABA 1UAYA 3CC7F 5C1OA 2Y27A 4HNAB 4FBMA 3GUHA 3NM4A 3E8BA 1G98A 2OKCA 1DPGA 2H7VA 1JYEA 3BF7A 2HWUA 4O0MA 3R0VA 4FFDA 4AMUA 1JYFA 3CC4V 1WOYA 5DBEX 3O1HB 5IMBA 4GG1A 3ZKAA 3DVRX 4BB5A 3LPLA 4YMGA 1RM5A 4HLUC 4JC5A 1JQJC 1XN1A 4HDMB 4A9AA 4DUGD 2NZYA 5LJLA 2OGUA 3C97A 1CHNA 4FZRA 3HVKA 1KK3A 3HACA 1QP7A 4ZU6X 1Q1GA 1S72F 4K9QA 2GJAA 4MQ6A 1FLAA 3FH0A 3AR5A 3VHLB 4BASA 4HZUA 3HB0A 4GI3A 5ALPA 1G8PA 2NU8A 2ZTHA 2Y68A 4K3AA 4GEGA 4PW0A 1RLMA 2Z95A 1U2GA 1S4QA 3M7IA 5MFPA 4WOPA 1A9ZA 1KA9H 4CMAA 1TM3E 2DUWA 3NEYA 3RWBA 2RK6A 4ENSA 3KVRA 2ZRJA 2Q29A 4N41A 1HQDA 2AZ2A 1U4NA 5I9SA 4AT1A 3EEOA 4AUKA 4YCNA 4BBAA 5IVHA 1ZH0A 3I1YA 4DCVA 4RTNA 3NH9A 4RKFA 5JANA 1WA8A 1UJBA 4WXEA 4ZVUA 3BGIA 2F8MA 1NDHA 4TN5A 5L7YA 5L51A 3VNSA 4DPLA 4OFWA 2GPYA 4DB2A 2C59A 2OHIA 5G0TA 1D6SA 2GPNA 1WZ2A 3EW7A 3T99A 3DDUA 2IZ5A 1W34A 1ZAUA 3TW6A 1KH3A 4UCOA 4A1FA 5K3FB 1T0AA 1FNDA 3N76A 1T4MA 3CEPB 5EVJA 2Z4RA 2ZF8A 1U0BB 1MT3A 1JG1A 3GO4A 2FSSA 3EW9A 3V80A 1MLDA 3DZGA 3PHJA 3X1MA 5AYVA 5EAZA 1E1QD 1D4FA 3ORHA 1JU3A 3ZWVA 1XQ6A 1T8PA 1CQJB 3E9CA 2UYJA 3K15A 3DTVA 2XT6A 4XW2A 1QCYA 1T3SA 2C8LA 4OLHA 4BWVA 1R6XA 1SA0A 3GT3A 4C5AA 3OKAA 4C1BA 2AG8A 4BYMA 2AZMA 1IH8A 2Z2ZA 1NXQA 3MJDA 4WE3A 4L8WB 1QTQA 1YJ5A 1ZGGA 2VQEB 1TEXA 5HZHA 1GK9A 5ALTA 4UEQA 1T5EA 5E3JA 4L4SA 4NABA 1CSEE 2FPPB 2DFLA 3M4YA 4CI9A 4MEAA 4I6JA 1U97A 2ECQA 1IXYA 1I4DD 2VJNA 5B6PA 4PZAA 3A1NA 3MOSA 3DLIA 3I30X 4L87A 3V7NA 4GE3A 2ZOVA 2WQ7A 4X3LA 1C3EA 3MMZA 2Z2KA 3A9VA 5F2OA 4ZT3A 4X94A 5ALFA 1S2GA 2J3KA 5JJEB 3WV5A 4DDKA 3W79A 1J8MF 1R74A 4PYLA 4RSMA 2IEGA 3E8FA 4RW0A 3U9SA 1QPGA 3T4XA 4E88A 1E2HA 1NVWQ 1TMYA 4Q7LA 2H65A 1M9NA 2I3DA 3EXFA 4CT5A 4FT2A 3VVLA 1XTSA 1A5ZA 4EJ6A 1J2UA 3KZOA 2AG6A 3IAAA 1T1JA 4CKWA 4M3NA 3BDVA 4BX2A 2DJVA 1N1EA 1PW7A 2ZE7A 4L7QA 1LPBB 4JHLA 2F23A 1E2MA 1DC3A 1Z6QA 2PHZA 1U3VA 4QYWA 3HWUA 3GRPA 3TIFA 1C9JA 3CLVA 4QNMA 2HHAA 1CT9A 2A3RA 1TMOA 1L4UA 1W49A 1LBSA 2PA0A 1O97D 2DZDA 3VJKA 4UXIA 3TSAA 3TUZC 5FNVB 1VLQA 1ODSA 3KD2A 5DNVA 5CBHA 5ECYA 1DOZA 3ZNOA 3GROA 3IXMA 3ERNA 1C14A 5AI0A 4H3VA 3DLCA 3BWEA 2FLWA 2RHMA 3TQIA 1DBQA 2JBHA 2NQ8A 1XTUA 4BVRA 5B8FA 4KYIB 3N9IA 5AW7A 3NYRA 2BC9A 2V5AA 4EFEA 2N75A 4L74A 2CFCA 4FZ3A 4HX2A 2Q3HA 1VFPA 2WKPA 1Y8RA 3ESBA 4EPXA 4OP3A 4PLZA 2YXBA 1M1KW 4M9CA 1AY0A 5EWJA 3AVVA 2NTVA 1BMTA 4PC2A 1URPA 2EWVA 1CQXA 1GG9A 1UXJA 4B6SA 5E2BA 2V9ZA 3PC8A 1BHQ1 1OCEA 2WLLB 4X8AA 3ZN1A 1YIJF 2Q6VA 2BWJA 1T1EA 2FR0A 5EE3A 4REQB 1KI3A 5IEJA 4ZJZA 5IBPA 3D1VA 3DBRB 2AN9A 1GN4A 1WNTA 3ZE6A 4R51A 3DHYA 2ZIXA 2H5LA 3DP7A 1YB1A 3W5HA 4EVIA 2OWOA 4IO1A 1KDYA 3CC8A 3C3AA 1Y3CE 4YUYA 4I50F 2IYFA 2MYNA 3LT4A 1Z37A 1WETA 2OAGA 3GUVA 1GUDA 2QE6A 2BEWA 4I9WA 4U2BA 2D2VA 2ZUVA 3UGTA 3PNQA 4L5YA 2XJ4A 1XDZA 4MV8A 4NHEA 4J2HA 3TQSA 1Z7GA 3B3JA 3N86A 3WDLA 1LPSA 1KZ9A 4BX8A 4ILEA 1ACLA 3N39C 3GLGB 3P26A 4I1PA 1YU9A 3QVTA 3T0FA 1GRNA 1ZGBA 3ZKWB 3SYLA 4DSOA 4HRYA 1GFIA 3HCOA 5L6LB 3KVYA 2AUTA 1WE2A 1Q5OA 4Q12A 4F97A 3HRKA 1V8ZA 5EQFA 1GRJA 4M54A 2BN4A 2JFNA 4UAJA 1XJWA 4HS4A 3APOA 3QXSA 4JXXA 1NC3A 1C41A 4O5AA 1CLEA 3Q6MA 4JS0A 4XFKA 1J97A 3UXEA 5EIOA 3O93A 1WO8A 2XGGA 3E15A 2IXBA 1WBDA 4R69A 2VATA 2MR6A 5GV7A 3ZYZA 2X1MA 4FYKA 3WB9A 4Z6KA 4GOXA 1MAHA 3GGOA 3JYCA 3E9ZA 1OVGA 4OI0A 4TZ6A 2J87A 3WBBA 3DNMA 2K5UA 2OBXA 2FMFA 5EJ8A 5JBIA 2I6XA 4FS3A 4X1KA 3IAHA 2H2GA 3RIMA 3K0GA 3Q0TA 1JLRA 4EA9A 5FTLA 5L3DA 4C6TA 1MG1A 2ZZKA 1Y33E 1JIIA 3H5AA 4JENA 1BFDA 1QDUA 4NONA 2AC7A 2ZYGA 4ERHA 2C9CA 1U3LA 2O3RA 3L4SO 2AN5A 3GHYA 5I9BA 3TEFA 4U3JB 4HFMA 1IXSB 2F9FA 5JCJD 3ANTA 1E2PA 5HTOA 5IY5B 4PRZA 4HDKA 2CBXA 4CV1A 1UR5A 4NFLA 4C2AA 3A1TA 2WM9B 3CO5A 1D7AA 1C9DB 1I4LD 4D5EA 3WJ1A 2PUEA 2W58A 1E64A 1H7MA 1B1CA 2H92A 2Z8XA 4ZOLB 4JJEA 2OHJA 4DIMA 1RMTA 5EWRA 2HSWA 4DC9A 5IG2A 3I8SA 1N34O 1L7OA 3LYAA 1Q0RA 3VR3A 4OIFA 1R64A 7REQB 2WAXA 1YH3A 3HO1A 1ZU4A 4UZSA 4Y1RA 1NMUB 2EBFX 3C87A 3GRFA 4DAOA 5BPFA 3NG1A 2QD5A 4GMHA 3W8RA 1TVKB 1T3LA 3LXXA 4DY4A 3DT6A 4CR6A 4OBWA 1ADFA 4QULA 5L40A 3CWZA 3H18A 4WV3A 2ARHA 3SXPA 1SKQA 4ZICA 1PNQA 1Q82H 5E2AA 3HVUA 3T12A 4V03A 4BP3A 1XAHA 3SG0A 3SE0A 4MW8A 2JGAA 3GLSA 3SF8B 3ECAA 2UUBO 2EFCB 2J45A 1ZQ1A 2GJSA 2VUUA 2OHXA 1OXTA 4G85A 1V7CA 1EFCA 4Q4JA 4TMYA 1EIZA 5JMPA 1YQQA 3FOEC 3JAKB 1AUPA 1YB6A 4R5HA 1O9GA 1IOLA 2KBFA 4AHCA 1TIPA 2JCSA 1OVMA 1FUEA 3AX6A 2VF5X 3H2YA 2WPDG 3KZKA 3DEZA 2WHPA 2NTEA 4BFCA 1D5AA 3G8DA 2DM6A 4Z4QA 4RXMA 1QSGA 2IHKA 3N8IA 4ZA2A 1QR8A 3SX0A 4JHXA 4K9KA 5F76A 2E9SA 1EFPB 5K20A 3C1OA 5LLTA 4Y2YA 5GONF 4ABTA 3HEAA 1BS9A 4L6AA 1KMNA 2PSHA 3COZA 5DGXA 3TLEA 3FPHA 3HQ4O 2XAQA 4HQNA 5IT9M 4KPUB 4L5JA 4B3FX 5CH3A 4MV3A 3IS3A 4BNLA 4U2CA 3ZCCA 4AP9A 4PZLA 1QVVA 3N0RA 2E82A 1FCJA 2CBZA 1UKCA 4ZHVA 4UUMA 2VXOA 5ERXA 2L18A 2DQSA 5FBVB 2MHCA 4F92B 2JW5A 2P75A 2Z08A 1M2OB 1OXBB 2ZXWB 3ELUA 5TF0A 1C9YA 1AD2A 3ZZMA 4MQBA 4C3VA 5C5DA 2AD1A 4UCRA 3RUHA 5IDXA 2FPOA 2CW5A 3OIGA 2ZT5A 2HCFA 5F51A 3B89A 5IULC 1TFRA 4RHYA 3C6XA 2A5DA 2Y4UA 2VO1A 1XXHA 4UCUA 4GLBA 2WR8A 1GSHA 3NFYA 1N0JA 2ACKA 4IJQA 3R76A 3ZIAG 3VJMA 3GRKA 2TYSB 3S5UA 3VYTC 3EAGA 1PL4A 1NLZA 3PDJA 3LUPA 3EORA 3R20A 3O8LA 5DHPA 5DW3A 5PNTA 4QOGA 4NS1A 3T1HB 3WAKA 2VDJA 2KB1A 4ZAVA 4RIIA 4JNKA 4CMEA 4DGQA 5DNUA 1JZTA 2CB0A 4F4HA 2GJ4A 3CURA 3HCFA 4HZGA 3BDIA 1HA3A 1UDAA 3HCRA 4ZTBA 4L57A 1R4NB 2EW2A 3W2EA 4UXNA 1I51A 1AVTA 3UOAB 1RQLA 3ETJA 4JELA 3HSSA 1QKKA 1B2LA 4FSHA 1NUHA 1C29B 3GMTA 1YFKA 1DG1G 1NGSA 2Z1EA 2DB3A 1P1CA 4FR5A 1MC8A 1RPZA 4X97A 4MRMA 2OTMA 2YVLA 2ODWA 4TX1A 2TS1A 3HBJA 5CX1A 3SQXA 2C7PA 3QUTA 3CZ9A 2A14A 2XCLA 1JAYA 1U0GA 1NOJA 1I1OA 5IAGA 3PGLA 2GYVA 4EUFA 3FCOA 1KYQA 3JQ8B 2G83A 2JI7A 3GGSA 4F9GA 1TM5E 2PT7A 5H6RA 5HVNA 2W43A 3Q6NA 5SZIA 2OSBA 2CVZA 1D1TA 4YB8A 4JZGA 1J6UA 3BPZA 3RFCA 3RVJA 3ZGVA 2V0CA 3CZPA 2XRZA 1YA6A 4PX3A 5JSHA 3CNBA 3MJSA 1X1TA 4YASA 4FDAA 4HWKA 2FP4B 1X7ZA 3OP1A 3BD6A 2GZAA 3DCJA 1OGJA 1WPXA 3GFOA 3MPUA 2OFOA 2EZ8A 1A5BB 2PL5A 4WRRA 4WCDA 1TU4A 2R8OA 5K8TA 3UJHA 4YBZA 1GUZA 3QTYA 4FNGA 1YAHA 2I6QA 3WGZA 1TKCA 2QB5A 3CF4A 2WTMA 1B73A 1T35A 3CUSA 1ZRMA 4CKBA 3KUDA 5H59A 3CTMA 1CF4A 3G7SA 1NU8A 1A7JA 1HT3A 2GPWA 5F1KA 5KVCA 3VKGA 3WKEA 3OIYA 3QTBA 2LFRA 4ROSA 3JQBC 3O94A 4RETA 2QMYA 4X61A 2W6QA 1GPNA 5AKIA 1X94A 3PBKA 5FWNA 4JVMA 4GXQA 5A2QM 4J0QA 3U62A 1JIUA 1FDRA 4F8EA 1UMCB 1LF0A 1TK9A 3HHEA 5G4KA 3D5TA 3IAFA 4YQYA 2UXBO 3M5WA 5JAPA 1T25A 4DV6O 4HLQB 2NPFA 2R4QA 3ZDEA 5AM5A 3JSAA 3GLUA 1K0UA 1DBFA 4OMDA 4R0MA 2TMGA 2AOTA 5JAQA 3TQOA 3AC0A 3ODPA 1QX3A 2GZMA 4ON9A 3LYHA 5IZ4A 3STWA 3F46A 2G1AA 2OC4A 3OWHA 1A32A 4EENA 1KZGB 3JSNA 3P9PA 3GQBB 4R3UC 2Q4TA 1QCCA 1J0BA 4KXVA 2WUWE 2XQVA 4OQZA 2WLKA 5JHGB 2J3MA 5K51A 1BMFD 1CZNA 4X8OA 3RAPR 3DA8A 2FHSA 2FZ4A 3WZ2A 3JTEA 4I50B 3LCRA 1QYWA 1QGOA 5IX8A 3THYB 4TROA 2D06A 3ZRXA 1Z82A 1EQAA 1U7PA 3BA6A 3GZTB 2OLJA 5AK5A 4ESHA 5BSKA 4GXRA 2HX0A 3LWPC 3T7AA 2V7UA 4FKBA 4OI2A 3Q88A 1FLVA 1GEGA 2RGEA 1OXUA 4ZV7A 4DNFA 2RGUA 5HOQA 1AKNA 2WG2A 4R16A 5I01A 4MGHA 1EBOA 4BPBA 3PYMA 4OBEA 4KH0A 4PG7A 5FBKA 5HFNA 3SSMA 3OMAB 4I0WB 3OCVA 3SC4A 3RABA 3FJOA 4JUCA 4DV4O 1N7IA 3KT0A 2LE0A 2WTXA 4NAUA 4N4AA 4C08A 1XF1A 1XMOO 3KTOA 4IM7A 3CCVF 2PAFA 3GLFB 2DWCA 1PF5A 3S2UA 4G1EB 5DNCA 4YCCA 4XBFA 5EMMA 1WMAA 4UCXA 1JBQA 4RF5A 4K46A 4J7KA 3U7FB 3WGQA 4JR2A 4WTOA 1UBOS 1IBLO 5AW3A 2DETA 2FFHA 3FLAA 4BFVA 1BE0A 3H2KA 1JIQA 4P4TA 3PC2A 4DZTA 2D2IA 3HP1A 1COWD 4OAQA 2K2WA 5KDLA 5CTAA 3TKAA 3RU3A 3H9EO 4LYJA 4HNAA 1HETA 1T9HA 3NVKI 2HJHA 3TS1A 3QLTA 4AJ2A 3ABMC 4MB2A 4Q16A 1H8HD 2PH5A 1WKVA 4IINA 4ZBMA 4CMGA 4DEXA 4P3OA 2NPIA 4BEVA 1XJ5A 1O95D 1ZHHA 5IDVA 1C7QA 1KTVA 3UWMA 2EKBA 2IU3A 3TBHA 1QGZA 1RAHA 3QENA 4MTGA 3CH4B 1X9HA 3T52A 4HDMA 4G2NA 1VJRA 3BQMB 2VZEA 2FRDA 1VKJA 2BHSA 1LF5A 5KVQA 4QUHA 2IXFA 2YJZA 2ZBEA 3VXKA 4H4EA 4Q6BA 4ZJPA 3D6UA 2ORYA 4FKMA 4QOJA 3N3AC 1BE1A 1RP7A 4Z9YA 1VDMA 4C0WA 2ZT8A 2OTLF 3S0HA 2C07A 4UTOA 3FPSA 3FMPB 4YI3A 3HDYA 2FEKA 1KDPA 4F38A 3IPAA 3BH6A 1URFA 1EYZA 4J0CA 4YAJA 2R65A 3D7MA 3K5NA 3K8YA 4IF6A 1DUIA 3OEEG 4ETIA 4JP2A 3WGYA 3DTVB 1BKYA 5HGJA 1E1MA 4PV7A 3HR0A 1PRYA 4GUNA 3KU1A 1DHTA 4J6EA 3AINA 3MM4A 4UASA 1JZSA 1Q7YH 4AJOA 1STOA 4HNUA 2QT1A 4IMJB 4P35A 3I92A 3PI6A 5F2NA 3EUEA 1ZMOA 1TRHA 2GTHA 1M75A 2Q27A 5DRYA 3FGPA 4HBGA 2YIDA 1PKXA 1K4DC 1M1YE 4TV9F 4LF4B 1Q11A 1X80B 4XSGA 5KNDH 5HMMA 5DNYB 4E70A 4B3JA 4I8DA 2YV3A 4C0AC 1TQ4A 1H85A 4DWWA 1HRDA 3IPYA 3PI7A 2RN9A 2Y66A 4C7UA 2YV1A 2CVHA 3GRVA 3O2QB 2FQXA 3SBEA 2G9UA 4MKZA 5E4TA 1B3RA 3IP9A 1WUKS 4M83A 4NMLA 2QD1A 1MFPA 3BPSA 2WTUA 3GA0A 1L8QA 3ZBQA 1CQJA 1FMTA 4OB7A 3EXFB 3G8CA 2EULA 1CB0A 2RGXA 3SX4A 1KSJA 4AULA 2IU4A 2YH2A 2VUHB 2O3QA 5A4MS 1ULHA 3LECA 3K96A 1QS0B 1B8PA 1VJ1A 4EFMA 4XAQA 3BEDA 3FTFA 3AFIA 3CNEA 3CVYA 3DL2A 2DT8A 2VNHA 3KOYA 5GONB 5AKGA 4IIDA 2XADA 3MMNA 3NC1C 1C3JA 5AI6A 4EA7A 4G5GA 2W00A 4FOPA 3CSXA 3CD6V 2FPPA 3K1TA 1T2DA 4H7HA 2PV0A 1RPRA 2O2IA 4QO7A 5B58C 3HA5A 2DQ4A 2X5KO 5KTKA 3INGA 3MLBA 4W7SA 1UBTS 4BQRA 2RAUA 1YD7A 4JLVA 1XKQA 1Z9BA 4NXMB 4AWXA 1J4AA 4PLYA 3LD9A 3CW2A 4KAFA 4UREA 5D85A 2CE2X 3EVGA 2BRUC 3AUAA 1O8BA 4MUFA 3QNEA 5KYNA 4G26A 3UHPA 3L8HA 2WWHA 1MABG 4KXXA 3NHFA 2Q5ZA 3LL7A 3SY8A 5IJ9B 1W2GA 2Y1KA 4GIBA 5JZSA 1NI8A 3MTIA 3AHHA 3F5FA 3EDOA 1OBOA 3WZMA 5AI9A 5C53B 1SCIA 4JLOA 3BJEA 2YBEA 3D2CA 1ODFA 3K72B 1QVAA 3AJAA 5HQJA 1U2DC 2X6RA 1R0CA 3GLVA 2RBEA 3ENNA 4KREA 2ZDIC 2IIVA 4DF3A 4G4JA 2BBOA 4ZREA 1V0JA 1DTSA 4L9RA 3NYWA 4PYRA 3P71T 2PUVA 3KV1A 4IOKA 1A8IA 3NTXA 5DP2A 3GF4A 4IDCA 5SZJA 2O2CA 2OCYC 2OLEA 3AU8A 1CR4A 2B21A 1YJ9F 5FNVA 3AEZA 1P2DA 4DUYO 4PZCA 2BEVA 5HY1A 2PBRA 1Y3BE 3RG2A 1JWLA 5DK6A 5B3SB 5EHIA 2V1XA 4ZO6A 5HKAA 1GARA 4DLKA 5H1YA 1UWKA 2NTJA 2GYUA 1CUWA 2Z1MA 3V8BA 4JI5B 3RRZA 2HHHB 4OKSA 4DLUA 2Q6TA 4LZLA 4YECA 2C8VA 4L7VA 4PYKA 3L8GA 3IUEA 5ALOA 2QEXF 2WLLA 3CV3A 3W3AD 4FCCA 4REQA 1G9TA 5DWDA 5EFZA 2C2WA 5AKXA 3IEKA 4LS3A 3OT5A 3ZMVA 3DBRA 2F64A 5BW6B 2XUKA 3SSNA 1EGHA 1RI5A 2E2WA 3GJ7A 4NCXA 1IPEA 1UJNA 2W6MA 1GGJA 3P3PA 2X1HA 4Y0AA 1X4TA 1WF3A 3CX8A 1DEOA 1X1QA 2AMFA 2Y99A 5HF8A 1JRLA 1WZUA 2W11A 1Y8CA 5AD1A 3JAMM 4E12A 4RD6A 5ALIA 2YINC 2FSVA 3OF3A 1TLTA 2VTDA 1SUIA 4G0NA 1TJ4A 1RLTA 1ESDA 1BFUA 4YIKA 3GB9A 2DOKA 5F7JA 5LL6P 4AYXA 4U2EA 1EVLA 4OGFA 2JGLA 3RHZA 2GAFA 2A9RA 4OHVA 3H84A 1PDOA 1NUTA 3GLGA 1RU3A 1XNQO 3N58A 3KZVA 4QBHA 2BFCB 3ZKWA 3ML1A 4LJSA 2GT1A 2PGDA 3TECE 3SPIA 1GZ4A 1DJOA 4R9RA 2YDYA 3VM6A 4MUXA 2CL5A 3IIJA 2G17A 4HDKB 4DS3A 3IAUA 2IBZH 1L3BA 4ARIA 1W5FA 2WKWA 1AUQA 5KYWB 1IUOA 4RKEA 3K35A 4HLCA 4P5PA 5FBWB 3H97A 2IZOA 2PHNA 3I8XA 3I1FA 2JEXA 1IJEA 4M1SA 2FKAA 3SJUA 3WYFA 4DW0A 4GW3A 1M6NA 5EHXA 4NRDA 1HR0O 4LJ7A 2NTYC 2RGWA 2JFUA 4CDMA 4TWIA 1GHTA 2H3EA 4AW9A 3L7KA 2FV8A 4KQFA 4Y1RB 1X0XA 2XVAA 2JCVA 2XZTA 3ZBHA 5HJEA 3RSLA 4URWR 5CEJA 3IURA 4MQ4A 2F3PA 2ODEA 1TM1E 3KV3O 4BEJA 1EUQA 1TF7A 5IANA 5ANRB 3P96A 4NIMA 4EGQA 1WEKA 4M99A 1RHMA 1IN8A 2G72A 4DL9A 1S8FA 3MDOA 2R62A 1E3DA 2D8AA 2JBWA 2PL3A 1NVKA 3SMVA 4ALMA 4U3JA 1M5UA 3HFGA 1P0CA 5AM4A 5L3ZA 2XQGA 4XJXA 3KVNA 1TYZA 1XZAA 2GUZB 1E79G 2O48X 4CKZA 4U7PB 3ZS8C 4C4PA 1CE8B 1K9VF 3ITDA 4G0WA 2G9ZA 3AOEA 3BMNB 2OCDA 2WEKA 2G70A 4LY0A 4N8SA 1ONIA 1EUCA 4L8YA 4S2EA 4J80A 2RDMA 3LX4A 4MINA 4U0JA 2P9TA 3KJZA 1C1YA 4DAEA 4R98A 3ZMUA 3AF0A 2QRMA 3PDUA 3RW0A 1ELOA 7REQA 2JA1A 2AX4A 2DN9A 4WZZA 2WHPB 3DE3X 5FJJA 3OD4A 4IUBS 1HLGA 2QTPA 1HNWO 2C9OA 4HH0A 5K3BA 1TVKA 3VVBA 3WMXA 4ESEA 3UJAA 2CSUA 4RIGA 3A3OA 1CJBA 4O33A 1LLCA 1JSRA 1T4BA 1Q57A 1L1FA 1OE0A 2PWBA 4W8HA 2RIPA 4GRAA 4BQPA 1L4GA 3C3KA 2BISA 1DJNA 1JMVA 3QKTA 3H05A 3V9AA 4XUCA 4H7JA 3W7BA 3J81k 2IPAB 2RJOA 3W6OA 4EI8A 5L53A 4L73A 3ANXA 4ZTZB 2A0WA 1ZEJA 3SF8A 3N2ZB 4IJ5A 5AK3A 2A8YA 3DC5A 1PGQA 1ZOPA 1SOWA 4Y30A 1IOZA 4CMIB 4TL8A 5EE1A 1B2RA 4I2NA 2WSLA 3RBAA 5TDHA 3JAKA 3NO4A 4R8CA 5LP1A 4B2YA 1R00A 2LBWA 2AMVA 1S3FA 3WR5A 2OCIA 3FA2A 2J9XB 3K9BA 1TU3A 4ZHYB 1CFJA 3U37A 2H94A 1Y5RA 3AG7A 3WTCA 2HMYB 1EX9A 4U63A 2EBOA 2R9VA 1P1KA 4H7KA 3R8FA 1C2TA 1Q3KA 4R84A 4JBXA 1G8SA 1X19A 4G4SO 5EMLA 5T57A 4D82A 4ASUD 1GGMA 3U7RA 3CXUA 4MKFA 5J4YA 1EFPA 4L07A 3NFRA 3MWFA 5FUWA 3AEXA 4UVGA 3O91A 1HDXA 3E8XA 3PGMA 2XCIA 4XJTA 4KPUA 2Z8YA 3QYFA 2Z2YA 4GKJB 4G9BA 4CF6A 3Q7SA 2C00A 2GZLA 1NNLA 3VR4H 2LIVA 1Z3IX 1B6RA 2YW9A 2PPLA 3W5BA 1V7PC 1UC8A 4K81B 4CCYB 3BSSA 3KEFA 4YACA 3EA4A 5CVTA 2BF4A 1PDWA 3SJQC 1U6IA 3N2KB 3FYIB 2EG5A 3R3YA 1VQ5F 4TSRA 4M8LA 3DXZA 4RD3A 4JV5B 1EUDB 2QZSA 5B3LA 2YOFA 4RPGA 2PI5A 5BR1A 2DWOA 2PWZA 3OJCA 1M2OA 1XTRA 5HWSA 2O2JA 2IXAA 1L5GB 4ZIRA 1G18A 2XNSA 8MHTA 2A88A 2EHJA 1WF6A 2C2AA 1IEXA 2XMQA 3KL2A 4TV9B 5EPUA 3RIXA 2V6BA 1TA9A 3PFNA 3DMFA 2B99A 2JRCA 3D6MA 5CX1B 1W73A 5H02A 3WV4A 2C2GA 2YYZA 4LOLA 1KHTA 3SPHA 1I1NA 3IJRA 4DILA 4MAMA 2Q8QA 2OZPA 1IJKA 2GCPA 1RPNA 3ABOB 4H16A 4B76A 2ZTSA 3WLLA 1S96A 1KRWA 1C4KA 1LSSA 2B20A 4R7ZA 3K0KA 2P2YA 3IJ5A 2BV3A 4JMLA 1XMPA 5HXAA 1ZUNB 4FMBB 2PJZA 2FHPA 1LBIA 1X7ZB 3FF4A 1OX6A 4ZVPA 1ESEA 5E9JA 2PEYA 1A04A 1SD1A 1E2GA 1KOGA 5IWCA 2X77A 3DCNA 3EF3A 4R9VA 1FXVA 3ABZA 3PIRA 5IF9A 1D4ZA 3TVYA 5JJ5A 5K8IA 1A8SA 4C0JA 2VYCA 1ZZEA 3WNCA 2OPHA 3LH5A 3HJRA 3WK5A 4IJUA 2GSWA 2XUPA 5JALA 3HJBA 4Q9JA 1J07A 2G5PA 4ZGBA 2G40A 3E3NA 2R6CA 1RRGA 4TYNA 4JJGA 1RJFA 1YDFA 2GTPA 4EKNB 4LHYA 3JWIA 3VSDA 1PL8A 3JQ8A 1P4HA 1KL7A 1N3BA 4OXIA 1I13A 3AGKA 1GO0A 2EJCA 3A6DA 3ZLVA 4JJ7A 4ERXA 3GFRA 4FUTA 4PGAA 4CL3A 1A97A 2HGZA 1WW2A 1CEZA 4QJFB 4AQ7A 3G82C 4PXSA 4YRKA 3ZRSA 1ZNQO 4C4XA 5TPZD 2ZB2A 2GCGA 3N5CA 2YDEA 2I9KA 4XA8A 1GP2A 2P06A 4JKIA 3JD0A 3MRXA 1GR1A 4Q39A 3MHSC 1ADBA 1H94A 4JYPA 4YV2A 1GU0A 1Z0UA 3A4MA 5C52B 3EZ7A 3OZGA 2GDZA 3PQ7A 1QGAA 3G80A 1ZDMA 2AR0A 1X86B 4AJEA 4PNHA 1U94A 2I62A 1COMA 1TC2A 2Q0XA 4MUJA 1YTLA 1KI7A 3MA0A 1PEYA 3IKTA 1M72A 3OI7A 1HDEA 4NAHA 4X85A 1QONA 3E9DA 2O0HA 1DBPA 3K0DA 4JKYA 2M6KA 5B5SA 4PQEA 3TM5A 4QPCA 3HU1A 3PB3A 5EG5A 3AJEA 4X6XA 4KKXB 4Q3BA 4CIBA 3HDHA 1JR9A 1U3DA 3AB7A 3ONDA 5DWQA 2ES4A 2QMOA 2IYZA 4MPRA 2G06A 1AQUA 3GGGA 3DZFA 1P6QA 2FVYA 5LYJF 5KVAA 2IYEA 1ZGCA 1VE1A 1G16A 3RT9A 4ZAWA 1UMCA 3OR6C 1YVEI 3I56F 2HJ9A 1P1JA 2EIMC 1MC1A 4OA5A 3AU9A 3AY6A 2R5FA 4X8MA 5GPBA 2QLMA 3PC3A 3RJZA 3IAS6 2CZQA 2P5SA 2NYAA 3RSZA 3SC3A 4LE1A 1LTHR 1HV8A 2QKCA 1GYPA 3ZWMA 3KCYA 3PITA 1GVHA 2YN0A 4QNRA 4YRJA 4YCDA 2ZJYA 4HWGA 1YQWA 2D00A 1YK1A 3KJXA 3UGJA 1W0KG 3GQBA 3IULA 1KZHA 4IHKA 3WY9A 4CFSA 3D6TB 2WI8A 3CCMF 1DWOA 5D86A 2LCIA 4I50A 3DBVO 2O7RA 4Z1MG 1QH1B 3O6VA 3THYA 1KJIA 2VBIA 2ZVJA 1E96A 4UJ5A 4B80A 3F98A 3BFRA 2QE7D 4WKCA 3J81A 1Q0SA 1Y1PA 1QFJA 3ZHUA 4LK2A 4XM2A 4AVYA 4CHTA 4ZK2A 1S8NA 3VAZA 3P0ZA 5A71A 5JJKA 1ZN7A 1KDZA 5BO5A 1QHEA 3R6LA 4B62A 5ERGB 3ZHOA 4JI8O 3VC1A 5IHXA 3A3NA 3JD4A 1YQGA 3TD6A 3BBPA 1PO7A 3LRPA 4PIVA 1VSVA 5IF3A 3GLFA 1BDJA 1AXGA 1RLIA 3ZY6A 2IPOA 2O8FB 4F5ZA 5BV7A 2O20A 3AP1A 3FKSG 4C3ZA 1WKBA 4KE7A 5AW6A 3O2NA 2BL4A 2ZAUA 3C3XA 3U11A 4C7XA 2F59A 2QAIA 3Q4HB 4UMVA 4XTRA 3QRWA 2Q50A 2PH3A 3F9RA 3IHWA 5CMLA 2WYHA 1VIVA 4RVDA 2B4KA 1NVPD 1GADO 2DPYA 3NHUA 1RMYA 1ZU5A 1JR2A 1NJIH 3F7TA 4CPDA 1Y5MA 2CMKA 4KO4S 1I2CA 5L3SB 4JTDB 2CF5A 4IEEA 4BO9A 1I4OA 3B48A 2VYFA 3R8CA 2J4CA 1K68A 2JFZA 3UCFA 3WRVA 4R2JA 2XXAB 1H47A 1SOUA 3VDMA 5DIZA 2CK3G 1KP3A 2RH4A 3GJ0A 3F2IA 5BQFA 1F17A 5HZGA 5C5EA 6YASA 2Y1OA 5IEBA 1Q15A 5H68A 1N2ZA 2EIJC 4HO1X 4RELA 4CLXA 3S06A 5COQA 3CSDA 1YQDA 2GO1A 2LZ0A 2HMAA 1V48A 3V46A 3IQHX 1MMMA 4WA7A 1DXYA 3Q4GA 2VQSA 3CA8A 2QNRA 4QOIA 5H9CA 2NAFA 4ZDIA 2VP2A 4PWYA 5FTMA 5IDYA 5C9ZA 3M9WA 1FDVA 3P8ZA 2GILA 1E2UA 2D2EA 2Q2OA 1CTQA 5BQPA 5B64A 4PHTA 1UXKA 1MRNA 4M46A 4NBUA 5DCLA 2EBUA 4RZ3A 3SYMA 1QO9A 3LY7A 1OGYA 1E69A 1X7YB 4PCAA 4H33A 2I66A 3CU5A 4U2GA 4PYMA 1GWNA 1N2SA 5DTJA 3OZBA 1TJ5A 2LRHA 1LPNA 2GN0A 1UBSB 4Y2TA 2HD4A 1G1AA 1LI7A 4E2WA 1IXBA 3D4LA 4OHXA 4YRNA 2J6IA 3K9GA 3DHNA 3T15A 3HV2A 3L92A 2UUAB 1TGYA 3GPIA 4P4LA 3L7LA 5ALZA 3HJHA 1KGDA 4RFLA 2G7MC 1YWGO 1X80A 1UEIA 3LBIA 3SU8A 4RHTA 5JBNA 4AF6A 2XCTB 4OQDA 4CCAA 1YGPA 2Q3CA 3UFBA 2WWYA 2O0KA 4XEUA 5KTSA 2W2OA 2GWRA 3PC8C 3STHA 3RRFA 4NBWA 4MI9A 1MQ8B 2AN1A 1P7VA 5C31A 3S2GA 1TLLA 5TT1A 1J22A 2DQ3A 4QUAA 3C9RA 1XDSA 2XWSA 4IDEA 4FHDA 5AMXA 2TMKA 1Z4LA 4RTJA 2PYJA 1U3GA 3GA5A 1FRZA 4F0JA 4DVJA 1T3HA 3LNNA 2C82A 4PXYA 4XDGA 1YTFD 4MNTA 1IN7A 1N2JA 4GYWA 2P7IA 4K6OA 4YR9A 1QS0A 1XT6A 4AZSA 5DFAA 2EJRA 2H5IA 3E5HA 2VJKA 5C81A 5BN3B 1N7GA 1GQFA 4BLUA 4YMIA 5GONA 2DTEA 2ZGVA 4TMTA 4D9KA 4AM8A 1H6CA 1IY9A 1SB9A 2D5AA 2QG4A 4UMFA 1RTTA 3TKYA 1W4RA 1PLJA 5KYYA 4ZT7A 3V55A 3DEAA 1J5XA 3OZCA 2HHLA 4KZPA 3F6BX 5H3LA 2BEVB 2WA3A 3A3PA 1YF2A 3LWDA 4IWYA 3HGMA 1D1QA 4UZFA 3FFQA 1NTOA 4R4JA 2JARA 2R79A 4GO1A 2VWHA 5IJ9A 1TDJA 3TTWA 1H1TA 3I05A 4MVJP 4OJTA 1G7TA 3E1SA 3RTDA 5F1OA 3HYNA 3OKFA 2YCBA 3U4MA 3EEBA 2ETVA 3II6X 3Q3CA 1XZGA 1M1ZA 3BWMA 1S9DA 2P9EA 2BFEA 2KWIA 4ARAA 3M33A 4QFCA 4EEZA 4X3CA 3PDHA 3GDHA 4YV7A 1D0SA 1PFYA 4RJ2A