4DRXB

Gtp-tubulin in complex with a darpin
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
431
structure length
424
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title A designed ankyrin repeat protein selected to bind to tubulin caps the microtubule plus end.
pubmed doi rcsb
source organism Artificial gene
total genus 164
structure length 424
sequence length 431
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4drxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4drxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4drxB01
5MN5A 2R6R1 5EZYA 3RYCA 1W59A 4I55A 3HKCA 4YJ2B 4U3JA 1W581 5FNVA 4O4HA 1RQ2A 3N2KA 4LNUB 3UT5B 5ITZB 4IIJB 3C8LA 3RYIA 3ZIDA 2XKBA 1Z5WA 2VXYA 2BTQB 4O4LB 4X1KA 5LOVA 5J2TA 2RHLA 4I4TB 4EI9A 3R4VA 3JASB 5MN4A 2XKAA 2GVIA 5EIBD 4X20B 5BMVB 4YJ2A 1W5BA 4LNUA 3RYIB 5EYPB 5ITZA 5IYZA 4X1KB 5LYJB 1RLUA 4X1IB 3JAWB 3E22A 4IIJA 3HKBB 2R751 4KWEA 3VO9A 3HKDB 2BTQA 4O4LA 2Q1YA 1SA0B 4I4TA 5JH7B 4O2BB 5C8YB 5KX5B 3V3TA 3VOAA 5LP6A 4TV8B 1JFFB 4YJ3B 3JASA 3RYFB 3WGKA 5MN6A 5IYZB 5BMVA 4X20A 5CA0A 4X1YB 3E22B 1W5AA 5EYPA 2VAWA 5GONB 4EB6B 5JQGB 5LYJA 4X1IA 3JAWA 2RHJA 3ZBPA 5LA6B 1TVKB 3HKBA 4IHJA 4I50B 4ZHQB 5LP6B 1W5FA 3HKDA 4DRXA 1SA0A 4O2AB 5JH7A 5JCOA 4O2BA 5C8YA 5KX5A 3WGNA 5CA0B 1FSZA 5EIBC 4TV8A 1JFFA 4YJ3A 5LP6C 3VPAA 3RYFA 3WGLA 4U39A 4HNAB 5LXTB 4FFBA 4X1YA 1OFUA 4IHJB 4EI8A 3WGJA 5GONA 3RYHA 4EB6A 3CB2A 4DRXB 5JQGA 4O4JB 3JALB 1TVKA 5LA6A 4ZHQA 4I50A 5M7EA 5KMGA 4O2AA 5JCOC 4FFBB 5JVDB 4F6RB 5J2UA 3RYHB 5IJ0B 4DXDA 4HNAA 4ZOLA 5LXTA 1TUBA 5IJ9B 5CA1B 5KMGB 3VO8A 2RHOA 4O4JA 4O4IB 4XCQA 3JALA 1FFXB 4EI7A 3RB8A 5CB4B 5J2UB 2RHHA 3JATB 3HKEA 4ZOLB 3JARB 1TUBB 3WGMA 3N2GB 5JVDA 4F6RA 2Q1XA 3M8KA 4TUYA 4E6EA 5IJ0A 3VOBA 2BTOA 4ZI7B 5IJ9A 3ZBQA 4TV9B 1Z5VA 4WBNB 5CA1A 3JAKB 5EZYB 3RYCB 4B46A 4O4IA 3HKEB 1FFXA 1W5EA 4I55B 3HKCB 5CB4A 2VAPA 4M8IA 4B45A 4U3JB 5FNVB 4O4HB 4TUYB 3N2KB 3JATA 3JARA 3N2GA 3UT5A 2VAMA 4ZI7A 5LOVB 4TV9A 5J2TB 1RQ7A 4WBNA 3JAKA 3M89A
chains in the Genus database with same CATH superfamily
4Z2AA 1J8YF 1NIPA 5IKXA 3NU1A 3SHFA 4MCJA 3AVTA 1VMAA 3LQ1A 3BXEA 4B17A 1P2UA 2W9XA 4UCTA 3ZLJA 2B20A 2IU0A 2VS0A 2WT4A 4RY9A 3LX6A 1LUAA 3MJSA 4QUGA 1GSHA 3L0IB 2V6FA 2ZRAA 4A2WA 4CC5A 4RD6A 3DHNA 3I61A 5IJXA 4E32A 3ICCA 4EFLA 2HWYA 3G0IA 1QOQB 4QQ8A 1ISJA 3CLTD 1DIBA 4AJ1A 3J7AC 3MD9A 2GSDA 2R1TA 2R00A 2YICA 3EA0A 2Z0AA 4FZVA 4BV9A 3FI0A 1VHJA 4F6RA 1NQUA 1O5OA 3GUCA 2FSPA 4MARA 2A0KA 4B46A 2DYYA 3A4NA 3B9BA 3GNLA 1QU7A 2J6HA 2LDBA 2MSLA 5C5EA 2V9YA 1BD3A 2WJIA 3KSDO 4JLPA 4P4NA 1Q1AA 1G19A 1E1CA 5GWXA 4MUBA 4IHKA 3R7AA 4GKKB 1IZ8A 2HHCA 5D3KA 5AW4A 3L18A 2D3WA 5ELLA 4TQUS 3S1AA 1QLNA 1AKUA 3GPLA 4X1KB 1M2VB 5K3SA 4NDAA 2WJYA 1TFRA 2AX4A 1UJCA 5L53A 2GFIA 4UXIA 4BNVA 2HRUA 4ALMA 4LWZA 1WOMA 4NJMB 2YY6A 5EB0A 4QVIA 1Y6XA 3O8NA 5T6MA 1LDBA 1M57B 3WGUA 1K0FA 5C1DA 5M5BA 1GN3A 5FLEX 1ESZA 2BRUA 3DSQA 4YO8A 4BMNA 1PL6A 4OG2A 5IMSA 1P2DA 3QOWA 3TR6A 3TW6A 1K8AW 1P0PA 2KB1A 3GAMA 4TXNA 4QGHA 4Q9DA 1M2HA 3GMDA 2RB4A 2NVUA 4HLQB 3O2JA 3TCNA 4N7RA 5BR4A 1N0WA 3JXEA 1F51A 5FBLB 3ZV3A 5H9WA 3BXXA 2HT6A 3K6RA 4MH0R 3TVDA 3DFFA 3U7FB 1FPOA 4U3JA 3QXHA 5CP8A 3IILA 3N4ZA 4NUTA 3EF1A 4F4IA 3ST7A 4IIBA 4NENA 2JEXA 4JX9A 5DSZA 1USWA 1TKAA 3BZWA 2Q7OE 5AXAA 3WQHA 1LNSA 1FRFS 3H8WA 3B5EA 2XBLA 2ZI9A 2X86A 3BD8A 4AYWA 1XR3A 3MLAA 3IAS1 2OWOA 4V3CA 1PEYA 3GTZA 1VJRA 1Q0UA 1NFQA 1SVSA 2WJWA 2FW0A 3T7AA 4AKHA 1GA6A 3DMRA 3IUEA 4Z9XA 3BQNB 2YV3A 3NVDA 2YS8A 3AVQA 1NBWB 3FOFC 1A9YA 3ER8A 1MQ8B 3WZLA 4X3MA 1SWWA 1CUYA 4JBXA 4RTNA 5IJ0A 3LUHA 1FFXA 4QE7A 2WFZA 3GBSA 4P5PA 4J4HA 3UJCA 2W6NA 3I5UA 2R6JA 2PWBA 3IXLA 3S68A 3UCSC 2ZYIA 4TT3G 1SVWA 3AF2A 2YYAA 3P0JA 2GNAA 3SWWA 3FZQA 4LPKA 5FI0B 1NQOA 4WN9B 3F0GA 3QE4A 2CK3G 1S0UA 1N6OA 2HLDD 3CB4A 2ETVA 2YDXA 4UEOA 3GDFA 1Z8FA 2IYYA 2XZDA 1VDZA 3VC2A 1G2QA 4CQJA 1I0LA 1N25A 4Q39A 4FXOA 1GPKA 1Z0SA 3OO1A 3A1DA 4HC4A 3WMGA 1UUFA 2B5WA 3S29A 3RRMA 1JBKA 3VHXB 1GARA 2FSUA 2ZU0C 5ALTA 1ZGAA 4EEZA 1YS6A 1Z29A 1AB5A 4DGQA 1NTKH 1RYMA 2XB9A 3H4MA 5L3DA 5EE9A 1YOVA 4GBMA 4UUNA 4KN6A 1C41A 1GFWA 4BNLA 3BXZA 3IP3A 2Q3LA 3HNRA 2XTAA 5G4VC 1JN1A 3M6MD 3BA9A 5JMPA 5KB3A 1B8NA 3KPJA 3T7SA 3EISA 2ETXA 1D7OA 4HZUB 3OQIA 4DDKA 1JHQA 2ZRHA 3VFDA 2NO4A 4WZBB 5F35A 3WYEA 2QP4A 2QQ0A 2CB0A 2QMYA 4DKXA 4W8GA 4N7JA 4YCAA 4JJZA 3LK6A 1FP4A 2B3DA 4LV6A 1P9WA 4PPYA 4RFSB 5F4BA 2HF7A 4ZREA 2HX1A 2WU1A 1J00A 1XF9A 1N4CA 2CE7A 1QB7A 3GQVA 1VCNA 4YI3A 5KYVA 4QUJA 1K06A 3QVGB 2VTVA 1P5FA 4PELA 2JD1A 1R73A 4RMGA 2IW1A 5DISB 1PFQA 3LUDA 2OCCC 3Q2OA 1W76A 2GLTA 4W6QA 1RXIA 1W2BU 1SBYA 3V55A 1TX4B 4DS3A 5ALPA 1VECA 2XQVA 4C0WA 4YV7A 3FPKA 3HA2A 4C82A 4DB4A 3EZNA 1SCKA 4AYTA 1R6KA 4UB8Z 2MIIA 3ZGOA 2I2DA 2OXFA 4OAQA 4Y6RA 2ZRKA 2ZU6A 3KQOA 4OSPA 1OGIA 2LCFA 1VKHA 2B33A 1ZRNA 3DLCA 3ZIDA 2FRDA 2JCXA 2CN1A 2WJ3A 2CE2X 2ORIA 2AYXA 5CVEA 2B5VA 3AR7A 5E7JA 4PIMA 3QVVA 3K5WA 2ZB8A 2QT9A 1QHNA 1C9JA 3NHRA 3OOYA 4KLNA 1UKZA 3HPRA 2QX9A 4MWOA 4WNCA 1YZYA 5F1PA 1PGNA 1JR6A 1DC7A 1A7JA 3DBLB 4LMBA 2CEKA 1Y66A 4BUCA 3A1WA 3ZZNA 3HEBA 1A9SA 1T9GS 4LCEA 1UJ5A 3MT9A 4MR7B 3I01M 4EB3A 1A2OA 1CP9A 2YBEA 4YRSA 4Q1BA 3E5NA 1DIHA 4W9MC 5ER6A 5AKJA 1UZUA 3TXXA 2EHDA 3HA7A 5LHHA 1C9EA 2WHEA 1DTSA 4W9NC 2ZR9A 3DUFA 5LLTA 1ORIA 2PAFA 2QMEA 3C7KA 3RWBA 1JZTA 1ZGZA 1W93A 3WISA 2JF0A 4HPJB 1CS4C 4CKCB 1R18A 3WWEA 3T3OA 3R74A 2IITA 3ELCA 3AX6A 3O47A 1UZNA 5HP7A 3KP1A 3CC4F 1YVDA 2UUAB 1RWOA 3GVCA 1K7SN 4QJFB 2UYPA 4MR8A 2VHQA 1QJCA 5BUCA 2YMQA 1TM4E 4A8TA 1Y7LA 2A7QA 2IW5A 1V3TA 2ORYA 4KGXA 4NV0A 4ZMSA 3AVXA 1XQYA 1C1YA 1FRNA 3BL6A 1UZAA 2FF5A 2IODA 3ZD9A 4X6XA 4YMTA 1FNCA 4H7KA 1OTYA 4DUGD 3MPUA 3R5JA 2PGNA 3BE4A 5DW0A 1LPBB 2GH1A 3TM4A 1B6SA 4Y3UA 3UPTA 2H1LA 5BR7A 5DGHA 1LV7A 2QM0A 5H5JA 3FIUA 1MG0A 3LTNC 3R0XA 3ULKA 2VAMA 4H4CA 3TNFA 3THWB 3DYBA 4ZP1A 1J5EB 4OHVA 3D3WB 1RRPA 1T1EA 4MCHA 1R6UA 1AKEA 3DYIA 5JXWA 5JLAA 4RM3A 2FUKA 2OCYC 1M2EA 2UZ3A 4A10A 1ZMTA 2ZDIC 4BTEA 2X5JO 2VWKA 4RIHA 5IH3A 4P0TA 2C2MA 3N07A 3ZHYA 4ZJYA 3X44A 5AI9A 3OJFA 1DRVA 1KFCB 4UNQA 1O9BA 1I0IA 4CKBB 4PFKA 5EWJA 1CK2A 2NU6B 3EXAA 2QEXV 1Z4IA 1HRKA 4CUZA 1CU1A 2WSSD 5AHXA 2JFFA 3FAZA 1OAPA 3D7RA 4D4JA 1KDZA 1JOYA 1BDJA 2EJWA 1AU9A 4U7NA 2QOEA 5KVAA 2DE0X 1QV7A 3EMVA 7YASA 1IEXA 4MWSA 3ZIAD 2OQRA 5G1NA 5KHHA 3B12A 3O7WA 2OA0A 1AKQA 3T5MA 4DYHA 5I48A 5TISZ 1V55B 3CY6A 3NIWA 2G6BA 5JS6A 4Z7NB 2A7XA 3AKEA 4HB2A 1F1JA 2DJ5A 5DCWA 3KYJB 1O2DA 3WIUA 2RHWA 1BMDA 4FXPA 4R0MA 1GGNA 4IH9A 1VQ4F 5CIWA 2RKOA 3DEFA 1XHXA 1Z13A 2ZPAA 3K4HA 3VOTA 2O5VA 2HRRA 4P86A 4KXMA 1KJ8A 1U0EA 5TEVA 4B7UA 1M6VB 2PJUA 5IVKA 3H18A 3F96A 1VL2A 1VXOA 4CEIB 2RGGA 3KR1A 2QA4F 4Y1FA 1W41A 2V9ZA 2COUA 2ZXWC 1U2DA 1R8XA 3OGIB 3PI6A 1X74A 2R5FA 2CHFA 4F5YA 1XUQA 3ZW9A 3RFRA 2JD0A 4FFMA 5BNWA 4G4VA 3HM2A 4POOA 1TI7A 3TIIA 2X6QA 1EX1A 3QF7A 1FL9A 1Z5VA 5TPZA 4WY5A 1Y3CE 3VAYA 5JWOA 1L1FA 3OCVA 4CM6A 1DL5A 1IHYA 1Z4MA 4FFVA 2HBQA 4QQFA 1DAKA 3LW7A 3OH8A 4MAAA 3AP1A 4P7JA 2F90A 5BN1A 4U5QA 3NGLA 2WTUA 4DEXA 5ALVA 4OGGA 1G60A 4DW8A 1QH1A 1XQ8A 3GEBA 4B5LA 2DUNA 3GR6A 3SQOA 4O6VA 4REOA 1PTKA 4UBMA 4JGSA 3ZI0A 2YJZA 2VS1A 1GWNA 4X1YB 3LVRE 3A6ZA 3SPIA 1IBSA 2L35A 3S7TA 1R15A 3MT0A 3SYKA 4QHYA 1YA6A 4AWBA 1GG5A 2QK4A 3B78A 5GINE 3V1KA 3PE4A 5B3JA 2AX3A 3PHJA 4CH4A 4Y2TA 1IE3A 2DPGA 4JQYA 1JHPA 1Q57A 2OORC 1FFEA 2I34A 1SVLA 1ADGA 4XFDA 1BHJA 4ETNA 1GNLA 3IAHA 3PUJA 2Q3CA 3DT9A 1T1IA 2SCUB 3VYUB 2UUBO 4C3OB 5L40A 3O3OB 5EE1A 3MJCA 3NHZA 5KX5F 2YNMA 1UDRA 4TT3A 1NBHA 1ORDA 4NATA 1BS9A 1Z8DA 4BX8A 3LY9A 1NUTA 2D5AA 2JDID 4KVGA 1YULA 2REOA 3P20A 2O7VA 2XJ4A 3FAVA 1NNUA 1RPRA 3RRNA 1GPUA 3BWEA 1M54A 2CK3A 1XCGB 1EB9A 1OBCA 1K9MW 4RMHA 1TYCA 1G8HA 3IEVA 2X1VA 2JI4A 2BFBA 4EY8A 2H17A 3JCZA 5MDHA 3VU0A 1DDOA 4L9AA 3I3FA 2ZAOA 1VB3A 2C58A 2PMWB 1NVXQ 3D6TB 2B6NA 3OLCX 3FLMA 1A82A 3IVMA 4OM7A 3Q4GA 2F3SA 3BKWA 3JVUA 3TE6A 1PPJH 1D03A 1QRAA 3Q7PA 1JU3A 1T8UA 4TKVB 3ICVA 2B6HA 4TSFG 1M56C 1WBJB 2ID9A 4LE2A 1XZPA 4BWAA 2H18A 1EBBA 4CM9A 1RAFA 3PFNA 1FX0A 3K16A 3PD1A 2J4DA 3C3EA 5JFTA 2DR0A 2NQ2C 1ZPDA 4Z7JA 4BKMA 2A1UA 1JJ2U 4L07A 2WHPA 4E5VA 1RCUA 2VHUA 1V5EA 1OHHG 2AEEA 2YIJA 1KYVA 3GPIA 2A9KA 3WGKA 4N6NA 2X9GA 1ISMA 4MQUA 1TRHA 5IJAA 4OVKA 3G0HA 3DMYA 2TS1A 2AI1A 3LG2A 3H11B 3QKIA 2UXCB 1JX6A 2ODTX 4FOOA 7ABPA 4UBIA 3DL2A 4D0RA 5HJ2A 2YHUA 2WWRA 3IPYA 5TXGA 1C0EA 4OOFA 5GZ3A 3AB7A 1UBRS 5LQUA 2NLOA 5M2QA 1EINA 1KI3A 1I5YA 4ARSA 2PKCA 4EUEA 2OBMA 3AEUA 2CFTA 4AICA 1X70A 2DUMA 3IQXA 3WGQA 2J0VA 2NO9A 3ZWDA 1Z4PX 3AKZA 3DTYA 3OZRA 1HT3A 4KVAA 2HZBA 4LZOA 4L5CA 1YJNV 3IQGX 4E5DA 3OJWA 3ASOB 4BVFA 5CVUA 4OBXA 3V34A 5K3OA 5ARDA 2VNHA 5LZ8A 3O31A 1MJ5A 1A9TA 1C7RA 3SU8A 3EFBA 5A2QN 5IZCA 1M72A 2O50A 3RVOA 3RW0A 3LP6A 2WSLA 4QBKA 4TXLA 4WGFA 5EPUA 3G9XA 4CH5A 3P2EA 2O3RA 4LYFA 5A7FA 3LVBA 2KHZA 1H2WA 3KJFA 1TGVA 1OCRC 3PGJA 5A3SA 1I3MA 1QIEA 5EC2C 2VUHB 5DWVA 1SBQA 2R7MA 1QSGA 1NC1A 2RK4A 1QHTA 2J7PA 2O2DA 1BCSA 4I5EA 3KHTA 3HSSA 4C4TA 2V97A 2FSFA 3UWDA 3TZKA 2PLRA 3IEUA 4BRWA 2D8AA 4ICGA 1UXJA 1BE3H 1T1JA 2BI8A 5DVZA 1QPZA 4I5FA 3ME5A 4OU5A 4QRDA 4ZQIA 5GJBA 1GLNA 1T25A 1C8KA 4ISCA 2AVNA 4TWKA 1ODSA 2IYUA 3P2MA 1RM0A 3ABQB 4NPHA 2HA5A 3G2JA 2VNAA 3S0JA 1U99A 2UYGA 4DT1B 1XNGA 3KOXA 4KFUA 4MVSA 2P4QA 2IHKA 2ZLBA 3L3BA 2I71A 3LDUA 3A4VA 1H2BA 2HPHA 3LCJA 3E3OA 1EFRA 1U4NA 1TM7E 5F33A 4IGFA 4RDIA 4YIHA 2XOXA 4MVJI 4OH7A 2XUAA 3N70A 5CFPA 4AUKA 2CNWA 2DSNA 1C9MA 5HCIA 3BWMA 3H1AA 1YB1A 3UTDA 2CWJA 3U4IA 1M4UA 3ONNA 3U81A 4RTMA 3PKIA 1R9NA 2ZYDA 1ZZEA 4JOBA 1DFGA 2B34A 3D7SA 1CJTC 3C7DB 3JSAA 2PYLA 1NJ5A 3WDLA 4G4WA 1ZSVA 4TYPA 2XMCA 2YY7A 4D6XA 3ZHRA 2EGHA 1ADYA 2JJ1A 1OFGA 1XMJA 3P7MA 2EJBA 4C20A 2RJNA 1VQMF 3FKSG 1S96A 5D5QA 1BVRA 4TS1A 4NYMR 3TQTA 1OAOA 2A84A 3GRAA 3R3HA 2WUEA 2QRVB 5CEFA 4KFTA 1GDTA 1P7ZA 3D2CA 2AFHB 3MNFA 3MINB 2WLIA 2Q5EA 2O8FA 1RCFA 3KSAC 5K3DA 4DIMA 3VTZA 4YY3O 2W00A 2QL9A 4DCJA 3KQQA 1P17A 1A1SA 2R62A 1IMOA 4I08A 5H3HA 1JNYA 2ECOA 1X52A 3W4IA 6PFKA 1WZCA 2ONYA 3CPHA 3GWOA 4YALA 4TTIA 2WTNA 2OECA 4PPNA 4H0LB 3UHOA 4X1IA 3QWFA 4IWNA 4HJRA 1DZ3A 4KVFA 3N86A 2VNSA 1H2XA 4D7TA 1UT6A 1PZNA 3LM8A 1LX6A 4O2AA 3CGWA 3THXA 2FPPA 4N76A 1C9YA 4HGOA 4BO5A 4MA5A 3FWZA 3BGWA 3FMPB 3EAFA 3CZPA 4DJTA 2PUVA 5AI4A 1Q6IA 4UUQA 3MUEA 1W36D 2IY9A 2OFFA 1XQVA 3FZEA 1WDWB 1R8YA 3UXYA 2FSGA 3FB7C 1OROA 5CMUA 1UI9A 1VPVA 1KJZA 5AO9A 4PRLA 1XMPA 5HA5A 3C41J 4KPUB 1K4KA 4ME6A 3MRXA 1PYGA 2ZM6B 4X7RA 1PG5A 3AETA 4YMIA 3ML1A 3DEAA 3IIKA 3O4IA 3CHXA 10MHA 2ZWMA 3KQKA 8LDHA 5B1HA 4I5SA 1T6ZA 3Q2KA 3TD4A 2DTEA 3G9ZA 4DMHA 4EYSA 1GGHA 4A6DA 5FTNA 4R8LA 2OESA 1NVKA 5JDIC 1QS0B 3E9CA 2E85A 4U7HA 4FFNA 1ZRHA 1E4EA 1W35A 4TMVA 1TOAA 4P32A 2I4TA 2X1HA 2GM3A 1QFYA 5KPJA 2CSLA 1I7PA 1B2LA 1P0QA 3OIDA 1SRQA 3IBFA 4X94A 2BC9A 5AJHA 4ZV4A 2JFHA 1NLUA 4BGDA 2VGNA 2PWAA 4RORA 2YYEA 4BO8A 4L8JA 2VHXA 1RXYA 2CJYA 1L4MA 3OTWA 4FCCA 4Y2GA 4YJ3F 3F98A 3D5TA 2OC4A 4MP6A 5MN5A 3V8EA 1BFDA 5K3AA 4FJ1A 5INTA 2VP3A 4DRZA 3IRUA 3OAAA 4DMMA 3I1IA 4RKQA 5KAIZ 3E5HA 3NANA 2FF7A 5DXFA 1LZKA 3LE8A 4WLVA 4L22A 2D1FA 3WICA 2H2FA 2DJIA 4OM8A 5DLPA 3UZUA 5JASA 1Y81A 3EOZA 2ZZKA 2WTEA 4IXDA 2ZWPA 2BFNA 4UMDA 1UKBA 3STLC 3ZK7A 4UUBA 1FSPA 1E6MA 1II9A 4O0MA 4WERA 1SUDA 4LF5B 1B42A 3IKMB 3BD6A 4RHYA 3I23A 3L04A 1D6MA 3CCCA 1QVGU 4PHTA 3LFOA 4YJ2F 1J20A 4CT0A 1W4RA 1BJRE 3A1NA 3L7AA 1VFPA 5D3ZA 1FMTA 4LRUA 5KREA 3VZPA 2Z6VA 3HR0A 3MZ0A 4TSFA 4EMTA 2MQEA 3AGPA 4NQRA 2FUNB 3VVLA 3WGIA 1E2PA 2WM3A 4D8TA 4JNCA 3KWJA 1V11B 2YUTA 3EXHC 5KNCD 1EWVA 4BLPA 5KC9A 4HEHA 3ZY3A 1ZOPA 5LQKA 3AG1B 1KO5A 2E4XA 4H2DA 3TBHA 4XXHA 2PO7A 5BYKA 3L92A 5JH7B 1C1XB 1R3UA 5I9IA 3IAYA 3AVWA 4B7KA 4XDLA 5CT5A 1P2SA 4KQKA 5IY5C 5LD2C 2CL5A 2K4MA 3IYLW 3E9ZA 1SQGA 3CNHA 2B9VA 2HDNB 1GA1A 5FBZA 5K2OA 1Y76A 3M7IA 4PGHA 1QVFF 4CIVA 3N8DA 1VQ5F 1NJGA 2OUKA 4ZHYB 2J33A 4H1VA 3JTEA 4RWUA 4AJLA 3CZCA 1W4CA 1V1JA 3N2KB 1MFZA 5FA8A 4A3SA 1QAQA 4AZSA 1QV9A 2POCA 4A6XA 1GUBA 3RH0A 2NU7B 3RFCA 2NXJA 1FP6A 4WK0B 1PL0A 2B4KA 2FK7A 4DR2O 5CXSA 1XDWA 4BVGA 2O8CA 4RACA 1MBZA 4K88A 2VNJA 1B16A 1P9RA 1EESA 2HHAA 2G5PA 5AVOA 1YI2F 5LYJA 1YS9A 4UV8A 4DA8A 1PVDA 2VJMA 1JB1A 4XX0B 4J0HA 5KSWB 1B8VA 4AILC 1EEHA 1VPDA 2BGMA 3OTFA 3B53X 4PRZA 3EIWA 3CLRD 3RSOA 2G38A 2DLNA 3ZLUA 1C4XA 2ONKA 3LLVA 1JYSA 1HSOA 4JYCA 4C87A 3JAKB 4M37A 4DCGA 1RWWA 3KTDA 5DU2A 2NU8A 2PTMA 4MW2A 3AP2A 5DB4A 1WXGA 1J1UA 4P38A 1MX9A 5HKKA 1L4YA 1OGYA 3IVGA 3ACBA 3MWDA 2J3JA 4Z1MA 1L5GB 2EJ7A 3HYRA 3IUSA 2G08A 5AJTA 3UA3A 1BMFG 3OT4A 1X7ZB 4OJQA 4DEVA 3ON5A 1K9VF 4I2VA 2AZXA 4QICA 4PA7A 3G68A 4WLEA 2Y99A 4BX0A 2HU5A 2OBXA 3A05A 4IBOA 1KU0A 1B3QA 1ZM2A 4ZBMA 1XP5A 2FPGB 4GQBA 3BC1A 3WJPA 1XNJA 3ORFA 4HX5A 1A4UA 2X9LA 4BP3A 3S02A 3NRBA 3OCXA 1M10A 2ZAGA 2H8KA 1LNQA 1QGUB 2V74B 3ZVKA 1GSAA 1Q0QA 3H2HA 5DTJA 2HIMA 3IA7A 5K4GA 4NXMB 3VV2A 3USCS 2ES4A 1BWQA 2X7XA 1TTTA 1CE8B 1ZM7A 1OBOA 3EK2A 2RK3A 2VDVE 4DJ5X 4YR9A 1QP4A 6ADHA 1EVLA 5ALGA 5JCJD 4JNKA 2GXUA 3SC6A 3Q6MA 1OLXB 4JI4B 1O6FA 4LG1A 3IP1A 2P91A 1KP2A 1D7AA 2M6YA 5FPOA 2FWBA 3BHPA 2Y1GA 4WNIA 2I2XB 4EPWA 3O93A 4LRYA 1DARA 1RQNA 3BZBA 4M0UA 4KJZA 2AW3A 4WLUA 1XREA 3FUTA 3PGKA 4BLSA 3WP1B 1D6NA 1VIAA 1XMXA 3MG9A 4GH5A 3AFOA 4DLXA 4JQSA 3O8QB 1KOGA 3KNZA 1ZMRA 1YD7A 1C0IA 3OFNG 4GPAA 1JTEA 5IEJA 3V7UA 3TB4A 4LZNA 1LCIA 1VEWA 4Z9AA 2M6RA 1K88A 2QN9A 2WTAA 2XV1A 4IIUA 4BLOA 3IJEB 4UEQA 3FRJA 4OP1A 1XNRB 1I3LA 3PC7A 1IVSA 2KM1A 3CXHF 2QQ5A 1F17A 4FGSA 4HVLA 4RK7A 4NMWA 5CM9C 4JTAB 3DMFA 1EXDA 1V8ZA 4ZDJA 2WWXA 3P9IA 2HC9A 5IXYA 4HDSB 3IAS6 1I24A 2VTBA 2BFEA 2LCAA 2CMFA 5A02A 4JJ7A 2DFVA 3UFXB 2Y76A 3NHUA 4I0XA 2OXTA 1YAHA 3FPJA 4H7JA 4K2AA 3AM4A 5DLQC 3UUFA 3ZIUA 1UH5A 1UBGA 2K9PA 3DH0A 3ILVA 3SCZA 4WKCA 1JXMA 1Q83A 4IYJA 4NONA 2C03A 4JUDX 2ATXA 2VT2A 5IBPA 5DMXA 2NUAB 3KAJA 1Z8HA 1FFAA 2XXAB 4IH4A 5CXXA 4CG0A 2BBOA 5FRDA 4KE8A 1WZ2A 1G5RA 3HACA 5ITWA 1W85B 3U3DA 4EMUA 3I55F 1WVIA 2GUGA 3OLXA 3S0HA 2BH2A 1ZGBA 1RTTA 4GS5A 4I36A 1HDOA 4ITVA 2Q3BA 4JK3A 4OLHA 1VGRA 4HSGA 3CINA 1GN4A 2L0XA 2ZIFA 1ODJA 1QBKC 1U3PA 1BH6A 3KD2A 1ESNA 1GMGA 4Q05A 4WTOA 1U0RA 2BM0A 5GONB 3LZDA 1KJQA 4HKTA 2VK4A 5IM4A 4HWOA 2OCCB 3W04A 3BA1A 1AT1A 3LHKA 1CZHA 2QR4A 4S04A 2JIPA 1VA5A 1NW5A 4OI4A 5LQMA 5DPMA 3C9UA 3TIFA 4D99A 3T7TA 3H1KH 4QPPA 4M9XA 4IZHA 3M3HA 4J3JA 4F38A 1SG9A 3GFOA 2Y2UA 2P22C 2CXQA 2OTMA 3F6EX 2N1MA 1KMHA 3PJGA 2Y8EA 1X1AA 3GP5A 1NF9A 4GOXA 1XFDA 5KJCA 1SCQA 1P6QA 3PHHA 1RI2A 1F2VA 4IUCS 3EF3A 2NVBA 2Z8ZA 1SVNA 3U3MA 3RVYA 4MA0A 4DCVA 1N3IA 1T3TA 1VB5A 3AT1A 2J0EA 1N78A 4RQBA 1RKQA 4E2XA 1ISRA 3DMDA 4TSKA 4HR7A 4MB0A 4LXQA 1M0TA 4J29A 4KDRA 3PWSA 4U7GA 2FZCA 2FEOA 1JV2B 2J85A 1E1YA 1DX6A 1BEUB 2PJZA 3EEOA 3Q0IA 1X42A 2J0UB 4G89A 2E4VA 1E6CA 1MNQA 5JADA 1SIOA 1PNMA 4OFXA 1H5NA 4ZN6A 4LK2A 3V2GA 4CWAA 3UQ8A 3I05A 4QAJA 3V4OA 4FYVA 4H37A 4WWHA 1ZN7A 1QRSA 4Z8XA 2WJZB 4IJUA 3NDIA 2Z6AA 3LWPC 3DOCA 3G88A 1G3QA 1V16A 4XDGA 2H2HA 2ZUSA 1RBMA 3PQ2A 3KLBA 4BNHA 4DMFA 5TMDA 4MWGA 1U7UA 3WYDA 4AF7A 1GNTA 2WE7A 1Y3FE 5J5CA 3OJCA 3NTXA 3X2EA 2TMDA 4FINA 1PJTA 4M7WA 1SZTA 2P77A 1EN5A 4O4IF 1QFSA 2CLHB 4YRZA 1PV4A 1E7RA 1V1MB 1W48A 1QV6A 2DFTA 2O07A 4YPVA 1YVPA 4G8BA 2WFAA 4ZCSA 2BMJA 3ENWA 2FW6A 3PEVA 3OBWA 1KERA 3M8AA 4C8GA 4LRSB 3AXTA 1DJLA 3FCEA 3VX4A 2QQFA 4V03A 2WIDA 2I55A 4LBYA 1E0JA 421PA 1FYFA 5H4GA 4F91B 5DDIP 3CZMA 4I14A 1A96A 3GLIA 3W5HA 2QTOA 3H0CA 5EG5A 1FU4A 4RANA 3VR4A 1CBUA 1HOTA 3GRPA 3S70A 3B3QA 1F12A 4G1BA 4WKBA 3O4JA 2WLLB 3PX2A 1I7DA 5T67A 3KTAA 4EA7A 2ZB3A 3E84A 2RKBA 3N7TA 3VX3A 3H5AA 1UM9A 4BN0A 1EP2B 2AWOA 4C14A 2VK2A 2B25A 3D8TA 4O02B 3RF6A 4YHBA 2L2QA 4H1UA 1SKBA 4JJAA 5JMWA 1TNDA 5FPHA 2NX2A 3PFHA 4YMGA 3KSZO 1N57A 4EFEA 1XKXA 1NV8A 1P8JA 3AFGA 4TTPA 4ZVPA 2CXRA 1PUJA 2YHIB 3IDQA 2PZEA 1M93A 3OPVA 2JH9A 4X9XA 3IUPA 4RGVA 1HNNA 1U3CA 2QMOA 3LVQE 1LRKA 4RV9A 1TK2A 2Q2WA 3AUSA 4A92A 3TDNA 5HP8A 3K31A 1TYDE 1JVMA 1OFTA 3HDGA 4LRXA 3B6MA 3K5LA 4G56A 1R0SA 3NO4A 1K8ZB 3JRXA 1FNKA 2CNKA 4JZKA 1ECCA 1ICEA 4KQ2A 1OA1A 4YDHB 4L78A 3O0TA 3UPDA 2MMGA 4RXTA 1FFGA 4Q9HA 3RJ9A 2OG2A 4U6NA 3QE9Y 1H8EA 3W5UA 3NPMA 1ZOSA 1EFKA 1QRRA 1MMMA 2OMEA 5K51A 4J75A 3S0YA 4Z4CA 1VE7A 3Q8XB 1J0DA 2WSYB 4C0BA 1RZVA 2ZXWB 1MIOA 4PLWA 1YDGA 1CR6A 4LVNA 3E20B 4ARUA 3DAPA 2FN3A 4DE5A 3TSWA 2WIFA 5CCXA 3OLZA 2X58A 4PNHA 4MW3A 4PZLA 5E79Z 1CEYA 1JRLA 3KUCA 3CF2A 1FUEA 3P5BA 1TQHA 4LOJA 3OOHA 1W0JD 3I01A 2GPSA 4IGIA 1YRQA 2PGGA 2RHRA 4MPTA 1WUKS 4URFA 4G0YA 4V2UA 5GJCA 3U9LA 4OXSA 4TUYF 2XNCA 5B8FA 3SQLA 1JR4A 1G6HA 3WRYA 3NPAA 3V4SA 2PZMA 4NG5A 5B3LA 1I08A 2NZXA 3U1VA 4WZ6A 4XYGA 3FZYA 2PV0A 4D0LB 4IF6A 1SEPA 1M8JA 2QW1A 4AIRA 1S5LZ 1TQDA 3J7AU 4ZU1X 3BMQA 3PYXA 4CIAA 3I04M 4X85A 3Q7SA 1L5WA 1KOFA 2I8LA 4HGQA 2IBTA 1MNAA 1IQ0A 5L3EA 4UZEA 2KE5A 1TW2A 1ZHHA 1M1UA 3T6KA 2UYCA 5GQSA 1VJDA 2M98A 4LDJA 1E64A 3UAWA 3AR8A 4N5DA 1BQEA 5NULA 2DLCX 4G4JA 5A04A 1I6LA 4E7PA 5KDLA 2UUAO 2BN4A 1AILA 2PGAA 4FGKA 3T3DA 4GP6A 3CEAA 4LK3A 3PKZA 2WA3A 4QAQA 1Y4ZA 3CRZA 4TLCA 1G7SA 3TSCA 5JSUA 1R9JA 5ALIA 1IHDA 5BSUA 3M6XA 2YASA 4PBRA 5BYJA 1QQ6A 4MUFA 5IVPA 3D3IA 5LIRA 4YRKA 3M1IA 1JP7A 5K99A 5DBFA 4F4UA 3C14C 1YE8A 1MUUA 1X7XA 2IIBA 2NMUA 1W8IA 3EORA 4WV3A 5C7LO 3G1WA 1E61A 2IHZA 3U6KA 2XDYA 2F93B 3IJPA 5BV0A 1TYBE 4QGPA 2DM6A 2QYTA 4RF4A 4R1QA 4JAAA 5TPZD 3KT8A 2HQRA 1G7TA 4DXWA 1GCAA 5E1DA 1MAUA 1XRNA 1J5EO 1M56B 2O0LA 3CCJV 1CYEA 3ORQA 3WYAA 2XAAA 1MVNA 4JP5A 2I6SA 2GDSA 1WSBA 1LNZA 3NB0A 4Y7DA 1E58A 4TMTA 1N33B 3RIHA 5LUAA 1G55A 3ODPA 4XOUA 2VUSA 3ZVMA 1YS1X 3TK1A 1QQ7A 1L8AA 1RRMA 1YJ5A 2YXHA 3W8NA 9ABPA 1G3MA 3QVKA 2B21A 5C0OE 1NW8A 2DWCA 3JZMA 2QI2A 4HXFB 4JFRA 2FLVA 1DLBA 2NQTA 4F12A 4QUIA 4QU8A 3RYHA 5DLDA 2HO4A 1BA2A 1A27A 4OQMA 4R31A 2OXCA 1YVWA 2PFSA 2E5WA 4MW4A 1PU2A 2XCOA 1K7XB 2GA9A 3OOEA 3RHTA 3P30A 1WXEA 2X1LA 2EWMA 4NZ9A 3WYBA 1T8TA 3PEFA 4UPEA 3FTEA 2H8PC 1C9KA 3NETA 3ZGYA 2V0NA 2NVWA 3T80A 1I3KA 2W93A 5LMUB 1JJIA 3GA7A 3LT2A 4E5PA 3W8RA 4BQNA 1HE5A 3AI2A 1YR7A 2KMLA 2PWPA 2XYRA 5CFMA 1ZK0A 4L51A 2V1XA 5E38A 3HBAA 4O5OA 3CNBA 4B7CA 1ONIA 3OWXA 3RYIB 1YU6A 2WJJA 1XDZA 3IB3A 2GZMA 3KTFA 4BB0A 3AY0A 2GN8A 3KJXA 5KYTA 1X7WB 2CH7B 4XPIA 1L3IA 2AFIE 2XAUA 1TCUA 3AFNA 2P1ZA 3DFZA 3G67A 3RS2A 2WAOA 4TL9A 3LBNA 2X0KA 3RTAA 2HQSC 3GRVA 2ODQA 1LBHA 3DTVA 3H1LH 3W6UA 2XE6A 1GUZA 4G5HA 3L7MA 1VQOF 4DW0A 1NXVA 2PUTA 3M5DA 1U31A 4NFHA 4B09A 2QKSA 4NOLA 4P93A 3LT1A 3F9IA 2WJ4A 1M0SA 5HSGA 1RWMA 4CM9D 1INLA 2CMHA 3ONFA 1Z56C 4S05A 1KMCA 2F23A 1G20E 1YQXA 4GP7A 4AMZA 2XGGA 4X88A 4ZVLA 3QQ5A 3QEMA 2XBMA 2AW9A 5HF5A 5KUMA 4EA8A 1HDEA 3W3AA 4B73A 2RHMA 3EULA 1W8DA 1FTGA 4CLDA 1R6NA 4H77A 4KYUA 4QTXA 1AKNA 3RUFA 2FG7C 4ZOBA 2AN4A 3L4KA 2Y1FA 5T41A 2G9RA 4LNHA 1FQJA 4BLVA 3N53A 4MW0A 3M6FA 4JPRA 3RW9A 1QTNA 3LSSA 2D5CA 5FDFA 2M9MA 1PJQA 2D2IA 5CLLA 2KJQA 4YA6A 2CVPA 1E32A 3BHIA 4UBJA 1S6YA 4KEAA 1DO0A 4A91A 3RFTA 4QOGA 4JA2A 4UCOA 2R1ZA 4KKVA 3GJ4A 4RJLA 2VBGA 4F6CA 4YRPA 2L82A 1YFKA 2JGIA 4P54A 1MHPA 3EHEA 1R0LA 5TIIA 1R0BA 1S9HA 2X6AA 4X3OA 2PUFA 1BQ0A 4RSMA 4A2CA 5F23A 1DCFA 3HA3A 3SX2A 3KZCA 2QJRA 3ITNA 1O6ZA 4PYQA 3ZX5A 3KVOA 2VN8A 3R20A 4FHZA 3AK4A 4KSYA 2QL6A 3LGSA 1WTCA 1FBTA 1LI4A 1USUA 1P49A 3I92A 1W5FA 1I4EB 3NUZA 3L8YA 4TLMB 3VKFA 1S72V 3PRJA 1H93A 2CHVA 1IWPB 2C2BA 3K5IA 3TD3A 2Q0XA 1O95C 4NQZA 4QE9A 5A0TA 4N12A 1NG9A 2VK1A 2WEKA 4C03A 1FBNA 2J7PD 3ADCA 3CLHA 1FUUA 3NIBA 1JD1A 2Q8VA 5ELXA 4DSOA 2YFYA 2H8CA 4AJHA 1IFXA 1AA6A 1XD2B 4ZOEA 3QBVA 4FX5A 1DPGA 2CSUA 3F5FA 1QKIA 1EQ2A 1P1HA 1PUXA 4OFBA 2K87A 1JFLA 3C5VA 1MQ9A 1IUNA 3C97A 3DGFC 5FPQA 4L3VA 1NM5A 3IEIA 3LWZA 3L4JA 3LX5A 3E0XA 4MSWC 4DDHA 3QPDA 1DRUA 2C4UA 3ZU5A 4LA4A 4WIAA 1K75A 3ZZTA 3L9WA 2VRNA 3IEPA 2FNAA 1SXPA 5C53B 3MK31 4Q1FA 2UXCO 1B6GA 3OMXA 3GFQA 4TL8A 4BZWA 1E4VA 5AOBA 3SJBA 2QNBA 3K70D 4N5LA 3TLAA 3UN1A 3GPCA 1XPOA 3QKRA 2EG9A 3T3PB 1U7ZA 3IKJA 4JC0A 4BNYA 1EFRD 1ST2A 4OL9A 3LPLA 3V9AA 2PGJA 2PL9A 2GN4A 2Z4RA 1XMVA 3RJMA 2QPOA 3ZWAA 1TCCA 1R5BA 2CNWD 1DGSA 5B3SC 4ML3A 2GTAA 1M5TA 3GZTB 4UCQA 4RQUA 3CRVA 4OPMA 5IJZA 3WLRA 3MRVA 1GXSB 3W8DA 1NURA 3CZ9A 3JVIA 1OJLA 4D7AA 5EIEA 2OGUA 3G7UA 2BKVA 1NBME 2CVLA 5GMOA 3IFXA 2H85A 1ZGJA 4B3DA 3KKYA 1RAAA 2QVZX 2ZW9A 2E2WA 4XARA 3QSYA 2FQWA 1R4MA 2EOAA 2FGYA 2GRUA 3RK0A 1G59A 3D6HA 1N9GA 1MENA 3U3RA 4PDRA 3CCEV 3K9SA 5FTKA 2G04A 1WEKA 3DUWA 1FA9A 3F7YC 2JJ1D 3ONWA 1E1DA 1KBHA 3GFBA 3WY9A 3SJQC 1TZ2A 3MMPA 3A3PA 1VBNA 2OP1A 4TKZA 4AB1A 3SPCA 2WAMA 1E6UA 2BHSA 2CNBA 2J87A 2W6MA 4GVXA 4CU2A 4DC1A 3UMYA 3HCDA 4WJLA 3GLSA 1SBCA 3G5AA 2LKCA 3G80A 4AJJA 2Z95A 1CEZA 3LPMA 3ZDYB 4OB6A 5TV2A 2ZIXA 1QNFA 5HYVA 1ADJA 3NBUA 4X6LA 3I28A 1QPBA 1YI1A 3AIKA 2O2HA 4CF3A 3DE0X 4YP1A 2QPLA 4OD0A 1T4BA 2QRPA 5J2TA 4OBBA 1LD3A 2D4HA 3PFIA 4GICA 4PANA 3JZFA 4EZEA 3PDIA 4RHXA 3RT7A 3S2UA 1H9AA 4DIFA 1M2WA 1E5TA 2XCIA 2H0QA 2I1WA 2OV6A 1RWXA 4MVJG 2BFOA 2VRCA 3H0EA 3HLKA 5L7TA 3MWFA 1PZHA 4M9SA 4JJGA 3HU3A 4JDPA 3DZIA 4EGJA 3VVMA 4MQEA 2EIJC 2FEKA 3QUQA 2PRIA 3IOEA 2BKLA 3E8HA 3OOSA 1KGSA 4CF4A 3W7BA 4GYCB 3I6MA 2R5NA 4XSGA 4M1QA 1VKZA 4BIZA 2ZRCA 3QFSA 4LCJA 2OLKA 2Y68A 1IZZA 4FDVA 1W46A 2RGUA 2C2ZA 4B4DA 3H1PA 1XQXA 4V1CI 2TMYA 4M87A 1UQRA 4CQMD 1DIOB 3DZFA 5L3QA 4GWLA 4A0SA 1X9GA 3R5XA 1KYZA 5ALHA 3O21A 3G7SA 2EX3A 2VTDA 4C6HA 3B3AA 2CVOA 4M49A 4F3NA 5TF0A 2P27A 3Q5EA 2WD8A 3OR6C 1A0OA 1IPFA 3C6KA 1RT9A 3D1LA 4CCYA 2YRXA 4X62O 3JQ9C 1RPZA 2AHYA 1KI8A 3INRA 3O8OB 4D8XA 1JKJB 2XUFA 4FFPA 4FYYA 4KZPA 5TE9A 2Q07A 2HLHA 2BFCA 2D0OB 2FQ1A 2HSJA 1SKUA 3AMVA 5DCLA 4NCHA 1PQWA 2XF2A 3PI7A 3OZIA 5K3BA 5L3CA 2XMPA 3QOXA 4YXWG 3E7DA 3LGAA 4GE3A 1A9XB 1V2HE 3VI4B 4R6XA 3ZW8A 5HVNA 3OAAD 5JDCA 2CUNA 3F8WA 1N32B 3DAGA 1MOFA 3IDAA 3ZBHA 4XRRA 4IQ0A 1WU7A 1PBTA 4UXJA 4C3VA 1VMGA 4MUKA 3H5VA 4B8ZA 5E6UB 2AC2A 2X1MA 4JZGA 3QTYA 4D9KA 1H2EA 4JBIA 5CN0A 4WZBE 2G6TA 1E60A 4IVRA 5JNLA 2CLDX 3HDHA 2VEOA 1P7WA 4Y2SA 2XCSB 4HWGA 4ZHQB 4I4CA 1QC5B 5C8XA 1MVOA 1CJUC 2EILC 4DIEA 3A2KA 2ZVYA 3OQMA 4ENWA 2AWNA 4YO7A 1WABA 3OIGA 5U9CA 4OHRA 2SHKA 3MTIA 4MWDA 3ESCA 4K03A 3BFVA 1M5IA 3PQ7A 4DM4A 1MABG 1X80B 1JSRA 4DIKA 1TAQA 1KMIZ 3GZNB 3STHA 3SBOA 3C5WP 1VHDA 3BRWA 4XGKA 4DUPA 1F2UB 1LWOA 2QN1A 3EVFA 4OHCA 3ERCA 1TC1A 3UK1A 1P4HA 2Z6QA 3C6XA 5BRJA 4FYPA 1I33A 3A4TA 2UUOA 3JWGA 2LFSA 1RFLA 4HB4A 4PRKA 5CFOA 1R9MA 3FZGA 3BPSA 4KR0A 2F66C 4FC6A 1UJWB 1T6XA 3RSLA 3EY9A 4XTCS 5CJJA 4DCOA 4EJSC 5CH8A 1OH8A 4HUQB 4U9HS 3IAEA 2GOYA 3FTPA 5E4TA 2EZ8A 5HKLA 2DFDA 2QGFA 4D46A 4DBZA 3TH5A 2RMKB 3BVPA 1NUUA 5I9LA 4MMZB 4JGIA 1LU9A 2FPKA 2FUEA 2B4TO 3FOCA 4NMXB 4WH0A 3TCXB 4BIUA 2XVZA 1SQQH 1Q7BA 3I45A 5BR8B 5HDQA 4NTZA 3MLEA 3EBLA 3QVOA 2PZLA 1T0JB 4UHCA 1NDUA 4QFDA 2QAGA 3X2FA 1PAUA 2YFHA 4C05A 4FMBB 1GSIA 2CXXA 1BH2A 4GGPA 1B1AA 1TJPB 3BKXA 3JYPA 4ZANA 1CF9A 4BU1A 1ZIOA 1OC4A 3SLGA 1OI3A 4X92A 2JAXA 1FLNA 2BEWA 4L72A 1DU4A 2FUCA 2X2EA 5EJ9A 2O8BB 2Z98A 1IG0A 4W1SA 4LMPA 4LF5O 1QK4A 1RJ9B 2G77B 4G2TA 2YVKA 4NPAA 4WI1A 5KHOC 1NKDA 4QG3A 5JTUA 3D9QX 5F4ZA 2ZIEA 2V6GA 2P1DA 4ZTUB 4FNGA 2CXTA 2VDQB 2CV1A 2P1RA 2GEUA 1F3LA 5FTJA 1CY7A 4ND4A 4B7ZA 4ZRDA 1IB0A 1WHSB 1J90A 4AQYB 4E2YA 4KR2A 3THSA 3E58A 1QYWA 2VKTA 2NXWA 2NAFA 4HATA 4N0QA 3ZBQA 4UVIA 3CRRA 5E8JA 5EMHA 2G1AA 3MBIA 4E2LA 5HKKD 1GPJA 1OYYA 1VARA 3B7GA 5BUSA 4P4UA 3FYIB 3OIYA 4Z1MD 3UC9A 2PFGA 5EKDA 3F74A 1L5MA 4B4KA 4DC0A 1YDWA 4EKIA 3C8LA 3EFOA 4J3FA 3NHWA 1XLUA 4OAOA 4L76A 4GUNA 3TG2A 1ZK3A 3F3YA 1CD5A 2Q46A 3RS3A 3QUBA 2AN9A 4WCVA 4PZ0A 5FV4A 4WCEV 1M1YA 3W9YA 1L1EA 1BDHA 2J48A 3RVJA 2C77A 2JGLA 2G9IA 5COQA 3L4BC 2CBZA 3D00A 4IAOA 3I4FA 3COSA 2WKSA 5BWMA 1GPYA 1MOPA 2AQIA 2C92A 2HPZA 2AJCA 4JLMA 2M2IA 4YQYA 1YR6A 2EAUA 1A04A 4BFXA 5KYWA 2EZPA 3VR2A 2DB3A 3QLJA 3PNVA 2QP3A 1IQRA 1Y8CA 5DN6D 4UMFA 3AOEA 5I9BA 4G0VA 2JFOA 2QZ9A 4MGYR 2V96A 4KMSA 3I3OA 5AOCA 5FAKA 1Z47A 2Z0MA 4PFSA 3S06A 3ZY5A 1X87A 5BXZA 2LO1A 2OTLF 2H1IA 5GV8A 2C3OA 4FFKA 3DP9A 4F5ZA 4EENA 4J16A 1EAYA 4UEKA 2ZGVA 1J23A 3Q5DA 5BOVA 5FBWB 1LY1A 4CEJB 3GCWA 4L4YA 2C3YA 1P4JA 2BBSA 2CLKB 1YJ8A 2L17A 2NV0A 2BSKB 3QWIA 3N76A 1J0CA 1UBCA 4HAIA 1SHZA 3OLVA 1VLZA 3KYBA 1HC7A 5TVKA 1KYYA 3F6RA 2CHUA 3EBOA 4AN1A 2DERA 4KR9A 5EWRA 4X45A 1K27A 1THZA 4XE5A 1RWQA 5HGJA 2O6LA 3R23A 2ZZNA 2LIPA 2P2YA 4EGCB 3Q5GA 3CH6A 5MF6A 4KLRA 1GZ3A 1NY6A 4DMUB 4J1NA 2QJWA 4PYNA 3TLZA 2QYHA 1M7GA 5IDVA 2B69A 3WU2Z 1E1KA 3NH6A 2XYPA 2PRYA 1NE7A 5AW8A 2ZTHA 3VI6A 1E6LA 3BEDA 4FP9A 3Q72A 1PN3A 3TI9A 5E7QA 4I9WA 4YCCA 4HRAA 2FKNA 3CRNA 4KLAA 1QVFU 3D0KA 5DHRA 4TYQA 4O4LA 3CCUF 2H6EA 2JIZG 3WK7A 1DZIA 3GEGA 1U8UA 3PRHA 3OFKA 5LQCA 1PZEA 1GQSA 4G24A 1PWXA 4K26A 3WL5A 5JW6A 3BGDA 5LA6A 4BATA 4FR0A 3EGOA 1AV6A 1I4WA 4NXMO 2PUAA 3WYGA 4YIOA 5TQJA 4CMIA 3K6SB 4HVCA 2C7OA 2ZJ8A 3DO6A 4X63A 2J5BA 1SZXA 4GX1A 1QF7A 1TYEB 4TUYB 2ZUWA 2QD5A 4ICIA 4MP3A 2A5YB 4JI4O 3NHAA 4UCXA 4N21A 5T57A 3GVIA 2LD4A 4HD8A 4IG9A 4EPTA 2YWHA 3CRAA 4I5IA 4KLCA 1ZAKA 4OFWA 4JYAB 1G0OA 4ZAZA 2GERA 4GSLA 2HBYA 2OO5A 3R3WA 4TKUB 4C2TA 5F2OA 4JBLA 1RFYA 2GARA 3WG9A 4J9ZB 3GGDA 3TR0A 1AY0A 4TV9F 3OJOA 3Q4HB 3FXAA 1BXRA 4NEGA 2AYZA 2BMEA 2BGRA 2GPWA 1YBAA 4GLFA 2EDAA 1DFIA 1I7QB 1K3TA 3DONA 3IKVA 2GESA 4J43A 1U7TA 2H0RA 2ZR2A 1QIMA 3HAXD 4DJEC 3G7NA 3TPZA 5GANK 1Y9EA 3WLTA 3AIOA 4I9FA 2IPAB 4Z86A 4HDMA 1T9GR 2DUJA 3WV4A 1CR2A 2OB1A 4PG4A 1WPXA 1Y4AE 1E96A 4H33A 3WKBA 3MWLA 7REQB 1AMNA 2BMFA 1NLZA 1OHHA 2RK6A 4G9BA 4MICA 5BRNA 1KVQA 1PFYA 4IXWA 4ACBA 1MTOA 1J8VA 1G3RA 2F1KA 3JYLA 5KNDH 3LWVC 4HBGA 4EG6A 1DJNA 3KZ1E 3R7WB 3MB8A 3S2ZA 3FD5A 2RH5A 2QRLA 5EWLB 5LKAA 2E7ZA 2JGNA 3TMYA 1ID1A 1J09A 3ABMC 3AF4A 3C9SA 4RZQA 3RKUA 4B81A 3IMEA 1NDQA 3KQUA 3TTVA 4ER5A 4RTPA 1ZD4A 1ZNZA 3HSKA 3Q1LA 2ACEA 2EJCA 4HUTA 5CJPA 1NP3A 2Y6UA 4YYEA 1GOTA 4LWSA 3B1XA 4CHTA 3G2OA 4L9RA 3AKDA 4IEEA 3PRKE 3WFZA 2JBHA 3BE6A 1U9IC 2VDPB 4KSCA 3D7KA 4LYEA 1Q0PA 2GO1A 2GYUA 4X6YA 3SLRA 2VDOB 3IKEA 1Q19A 3NWJA 2AOWA 1XJWA 1JUDA 4XIJA 3QFFA 1WCXA 5BPFA 4I55A 1EP1B 1ULHA 2EERA 1GU7A 4EGAA 1NKSA 4RA9B 1I7SB 1S1MA 5A0VA 2QT0A 2YSUB 3GLGA 5DSXA 1R0XA 1ZUIA 3GGCA 1QLEC 4RHAA 2JJ8A 3FBGA 1TA0A 3EVDA 3TLKA 3OZGA 1KJ9A 4JVOA 3EQ2A 1YV9A 3LDFA 4LRWA 3GUYA 1AX9A 5F2KA 4L5IA 1NKTA 4HDKB 1UKAA 2Q68A 3GT4A 3UAXA 1G6UA 5ELMA 4Q01A 2DBRA 1EFUA 1A72A 4YBRA 2MSCB 1NVMB 5KYYB 4KK3A 1U0FA 4DJJA 2KLHA 3DXZA 2WSBA 5CNJA 3VR4D 4HXGA 1YKSA 4CU5A 1RYDA 1NVPD 3Q41A 2D4AA 2AR9A 3FNGA 4WD3A 2R8ZA 3WB9A 3S27A 3DF9A 1GZ0A 2ZR8A 1JECA 3WIDA 3ASVA 2QAJA 2M7WA 2PS1A 1QFZA 4JU9A 3G1TA 3DHEA 2MSEB 2ZUEA 1B8UA 4ESOA 5TQ2B 3CKKA 1SBNE 5A1JA 1T9CA 3NDPA 3EJ6A 1Q7YW 4O4HF 1PT8A 1YTFD 2O8EA 1FXKC 3P45A 4RY0A 2F00A 3U4QB 1RHJA 5FLYA 3EDMA 5BN3A 3L0ZA 2JFNA 4FWIB 3D2AA 4RVGA 4ZV7A 1SNYA 1SCNE 1EVKA 3EVNA 1G98A 2RC5A 1GKKA 4UFPA 2YJGA 5B58C 1KJJA 4L27A 4PCLA 1O87A 1FX1A 4DV2O 4H7DA 2KQXA 3ZDDA 4MVJM 3BERA 1H8ED 5LP1A 3IUNA 3N27A 4EGSA 1E94E 5C46F 4BMOB 4L4SA 3M34A 1H2YA 4YASA 1ZKMA 2IZZA 2GUZA 3M49A 4CN8A 3FKSA 1V54C 1T9HA 1B26A 1E0SA 3GYGA 4HDNA 3N2YA 1QO7A 1ZWLA 2MHCA 3EPHA 5CH5A 5E6SA 3AI1A 4BCDA 1WR8A 2RI6A 3IH5A 3LX8A 5CMLA 3BCHA 1DC4A 1CRPA 1D5CA 3DPSA 2I80A 2P2LA 3VHQA 2E6UX 4BVSA 1W0KG 1K3EA 1MXFA 1BHAA 3M8KA 5HE8A 1V3UA 4OOEA 5DNWA 4PIVA 1XZMA 5CVVA 1YB6A 3IJRA 3IVRA 1QYDA 1G5PA 4PFJA 2EX1A 4OP2A 5AK3A 3GWGA 4TZKA 1O6BA 3K9AA 5ADUS 4KJXA 2AFHE 5LFAA 1IU9A 4KWTA 4CIBA 3W0LB 3DLIA 2ZFUA 4CF5A 1JIXA 5JRZA 3AM3A 3HP7A 4HF7A 2BJVA 4X1OA 3K4QA 2ASEA 3HV2A 4MVOA 3PUYA 2CCGA 5G3YA 1WMEA 5FPTA 1ZK4A 1XWWA 3RUCA 1XI2A 5IP5A 4CMCA 1KDOA 2JZNA 2PMEA 3N6XA 1B6TA 2EIMC 4OLBA 4EF6A 2GK7A 1CDZA 5EZ6B 3I1FA 1XTQA 1VK3A 5JCOC 2F1MA 3QF4A 2YS7A 3I9JA 3K2BA 6REQB 5AP9A 1J2EA 2R70A 4N9WA 2ABWA 4IDEA 1CZRA 1DNPA 1N0IA 5L4LA 1LDEA 2UZ4A 1GQQA 4GBJA 4P22A 3N5CA 5FLXN 3EY4A 3ZCXA 3G8YA 2YZMA 1ZVVA 4RADA 3VH1A 5DJ5A 1GN9A 5ISMA 2FW7A 2LE0A 5BSHA 4W1PA 2IV3A 5AI6A 3GJRA 1XXLA 3K2EA 1ZXBA 2HF8A 4U7TB 3RARA 2W4IA 2LW7A 2CJFA 3H9QA 4F06A 1YL7A 2UYKA 1YUNA 2ZITA 2OFWA 5DTRA 4QJ5A 5JBNA 3H9JA 4B5KA 1QRDA 3PNOA 4R41A 4F21A 3T34A 2BSAA 1FQOA 3TQSA 1QGYA 4PSKA 1X77A 1TB4A 4GP9A 3NATA 2FCAA 2HWXA 4RJ2A 1NI4B 2WVGA 5AM4A 3MBMA 2ZNJA 4WZAB 4GKKO 3KSRA 2F8TA 2C9YA 3AI3A 3C6BA 1AS3A 4BT4A 1JQ5A 3HWRA 2ZE6A 1E5DA 2P90A 3II6X 2Q1XA 1JWAB 2N47A 1G7CA 3G79A 3I04A 5B55A 2HD4A 4JQZA 4YRLA 3UW3A 5TT0A 5AIAA 2DH6A 3CF4G 3D59A 1E2KA 1F8XA 1BMQA 3P2OA 5KYUB 4Q7JB 1UC8A 4Z49A 3ZWNA 4C4RA 2G1PA 3TIGA 3TGLA 1CZUA 5JD5A 3H1EA 1SC1A 1FK8A 5MGBA 4IJKA 4DY6A 4NR0A 3M7MX 3W7XA 4E09A 1KNXA 4L8LA 2ENUA 4FCTA 1JPVA 3VYRB 3LSTA 4MIEA 3QHAA 3A6HA 3RVSA 3PGVA 5IT9N 4OYRA 3FUXA 4ZAYA 2CY0A 3S8MA 4K6CA 4TWJA 1SXQA 3N8HA 1LV8A 3CMMA 3JQGB 2ZK7A 4QX6A 2CW5A 3NWPA 2OL4A 4U4AA 2MSNA 4JI6B 1BO6A 2BGIA 1PD0A 3I9KA 2FZ4A 4CL8A 1FW6A 3QZUA 1BA3A 4RHTA 1MW8X 3SP1A 1TFUA 1IPEA 1S76D 2O20A 3SJUA 2RGWA 5B4TA 1JR9A 1L7MA 4CTJA 2RNBA 5C9ZA 3NC1C 3AUFA 2XVAA 1OWLA 2HHHB 4D3DA 3IE1A 1ZI9A 5K0GA 5KOHB 4Y2RA 1KVRA 3E83A 2QLTA 3SQXA 1WB8A 3E53A 3QYJA 3T4ZA 3JD4A 1VIVA 2QRKA 2HCBA 4L0DA 3ZS8A 2ESRA 4N18A 1EWTA 2VYVA 3TZCA 5CHEA 4EZBA 3NVIB 3G6KA 5E1AC 1AZLA 3NTRA 4B74A 5KX5B 3NBZC 2ZJFA 4DZTA 2ODNA 1Q0HA 1JEAA 1IB6A 3KPWA 3TQOA 4JMLA 2B2XA 3RROA 3C4VA 3JQCA 3PPXA 4B6QA 1BRTA 3RSGA 5HXZA 3GLQA 4RABA 4C88A 3DTVD 1DUVG 3G0CA 1CHDA 1AZSC 5BSGA 3U5ZB 4R9SA 1UMDB 1CSEE 3PQCA 2DTXA 1G8JA 4F86A 4XDJA 1LRLA 2QJTA 1RQGA 1Z7GA 1WKCA 1HNZB 2GBLC 2ST1A 1QE5A 1UL1X 1LC3A 3I0NA 5IBRA 4Q7LA 5TMEA 3E9QA 2K6GA 1PR9A 3OQOA 1PUIA 1P18A 1DK1A 1M6WA 1SFRA 1LX7A 4JV5B 4NXNB 4FMDF 3W3AD 4LY3A 2C4NA 2MR6A 2VR1A 3RDPA 3VKWA 1EGAA 3G9TA 4ENVA 4FDAA 2PYIA 3A31A 3K5PA 2XTJA 2ODPA 3CCSV 2CLSA 1WZNA 1SA0B 2B82A 2G4CA 3VSBA 1I13A 4HS9A 4HS4A 3K0FA 1UPXA 1ULZA 4KN8A 3W5DA 4U0KA 3I62A 3OTGA 2JGAA 4OPHA 5A4IS 4RAOA 1T5LA 2E55A 4J0JA 4OIFA 1FW8A 4Y1EA 3L6UA 2RHDA 2DU8A 4W5JA 3ONEA 2R79A 1NW6A 1U3WA 2ZWAA 2Z57A 2DPMA 5H6QA 4G85A 5EBLC 3PD7A 1UR5A 3UV3A 2E4UA 3HADA 4GE0A 5LMUO 4KR6A 3LPDA 1HYGA 5B3SB 2O5CA 1EK0A 4PYMA 2W2VA 3UWPA 2RGNC 1BMFA 4TLLB 4MTGA 1PV1A 3I8XA 1RA4A 4MX8A 4MR9A 4LZLA 5JE8A 1GV0A 1WEHA 1SHLA 2D7CA 4DILA 1R10A 1DHTA 4G9GA 3B36A 1OLOA 2N46A 2RH8A 2C8JA 3FJYA 3EWIA 3JPWA 4XDKA 3TTWA 1UPFA 5FO1A 1XTZA 3IR5A 1J97A 4G8JA 2RQ6A 2XCQA 2WSMA 3FB8C 5DRTA 5EAIA 3W5IA 3F1LA 1GQYA 5KVVA 3NCTA 1N5RA 5IXSA 1DXYA 4MAMA 5JHGB 3F71A 1MC4A 2VQDA 5DHTA 4NE9A 2YQ5A 1V1RB 3B09A 3T5GA 2OYCA 2W6ZA 1YKFA 2B2CA 2DT8A 1J1ZA 3MCWA 3PDWA 1FDRA 3TKAA 5IF9A 3S03A 4UQPA 1W6RA 4KZKA 3M5PA 4JELA 3DOHA 3V2UA 3OJ0A 2E48A 3JQ8A 3HJTA 1W88B 2JAWA 4J9VA 3UGQA 1MTZA 4L2IB 1F7YA 1QG0A 4QT0A 4UCSA 1K89A 2VBCA 1Q1BA 4RUFA 4ARZA 3C70A 2BFMA 2NPFA 4B6FA 4BJ1A 3K0KA 2AG5A 4QNRA 2W2KB 2WI8A 1YGYA 5IYZA 3MQ4A 1UADA 4EH1A 3EAGA 4MRMA 1VMIA 3BEHA 4BNKA 4YYZA 5A9SA 4ZCTA 2GBPA 3DPIA 1KNJA 4RS3A 3I5XA 4X41A 3JZDA 1DSSG 2TRSB 2JBAB 5A5DA 3G89A 1E2GA 3OFNA 3DW1X 3UXHA 4FD3A 1SURA 3EEYA 1CFZA 2FHSA 2QTBA 1F7UA 1NE2A 4C5AA 5JO0A 3VM6A 5CFLA 2BFFB 3NFRA 1WB4A 2Q8NA 3E1KA 1MQAA 3ESZA 3ZCPA 5JU6A 3H75A 1V4NA 2PQ6A 5K3EA 1V6SA 4QC2A 2OHVA 3FI9A 3OTOB 3EYWA 1UKCA 3SIRA 4CUKA 2HFKA 4FYJA 1SN7A 3CNNA 2FL4A 3T4XA 4J3NA 4PO8A 1K7DA 3KE1A 3PPYA 4RKRA 1U5CA 3B8EA 1TEZA 3OTHA 1WY5A 4EB0A 3L6BA 1ZM9A 3C3XA 3KLOA 3OKCA 1O89A 3P9KA 4I6JA 1PJRA 4WLNA 4ASUG 2QF7A 1P7PA 4D5GA 1A4XA 1R4ZA 1SIWA 3HN6A 4FZ1A 1BS1A 1WXIA 5CA0A 4Q3OA 1AA9A 1JSLA 5EJMA 2W6OA 1ZA2A 1QVVA 1YUBA 1E7WA 2CMDA 1PTJA 4Q24A 2NM0A 2JAHA 1ONPA 9GPBA 2A94A 1YJCA 2GZ1A 1CQJA 5FWAA 1WCV1 1WQ1R 2XA2A 3MGGA 1GQRA 4QDJA 5BO5A 4EVRA 3NTOA 5CDGA 1OQAA 4CDNA 1LPPA 2HFJA 2QORA 4K6FA 4RX1A 3PUIA 4FUTA 4FFLA 1QAHA 4LKRA 5BNTA 2CD7A 5AK5A 5EQDA 3EXIA 3QXCA 3ILHA 3KHNA 2FMXA 4PAQA 1U5BB 4KIUA 4IJ6A 1FTSA 1Y7TA 3ADBA 2WILA 3WQSB 2HEPA 5JFGA 2HK6A 2E76B 3VMFA 4RH3A 1UPCA 1L5HB 4FIPC 2R2GA 5EJFA 4CKWA 2Z6UA 4MV6A 4NMLA 1SD2A 1JGTA 3NEPX 4R71A 3UXEA 1ILEA 2HVYD 4R1NA 2VRCD 1ND5A 3EXG1 1W47A 5IASA 3VOUA 5I7VA 2QBYA 2C9DA 3NV9A 2C29D 2IOQA 2YNMD 1NT2A 2O14A 2XXJA 1ZWKA 3FPCA 3B5IA 3EODA 4TT3D 1DAOA 4P98A 2V7EA 1PS9A 3F7OA 2VAVA 1QRTA 2B98A 3ASYA 5JY6A 3WK8A 4CMHA 3VQVA 1D1SA 2CK3D 1KOJA 3T9AA 3O7MA 2MW2B 4UQLA 1QUEA 1ZVJA 3BF8A 2D2EA 2ZBUA 3A9VA 3VH4A 5F9FA 1ZCAA 4XFJA 1OU0A 1Q92A 3K8ZA 1J70A 1UT5A 3QXXA 2RHCA 4EJSB 1Q0TA 1OCRB 1MX5A 1JCHA 3BT7A 1WG8A 4DV5B 3NHJA 2NV2B 2CT8A 3JYQA 5P8WA 1X92A 1K8QA 5FV7A 4NZPA 4ADSG 3PG5A 2WDZA 2HP0B 1MR3F 3L7BA 4PPGA 5JI2E 1VPEA 2OVBA 3W7SA 1ZESA 3PYMA 4LC1A 1U81A 3QTCA 4JEIA 2NXCA 2GS9A 3UCXA 1SMKA 2ZT6A 3HKEA 1ATIA 4L4ZA 4RZIA 4RVCA 2Y1WA 4W5TA 2QGZA 3JU3A 2X4IA 4B3TB 4EFMA 4FMCF 2ZSJA 3T7JA 1GRNA 2FQQA 3MOIA 2OZLB 4HBZA 1OMOA 2A9PA 4KQ1A 3I5AA 1FB5A 3ES9A 1JA9A 2L42A 2FB9A 1Q0LA 4TXMA 2B83A 4F1JA 2WLKA 3DLPX 4KMMA 4BASA 5E2IA 4DSAA 5L7WA 1ECFA 1YGPA 5DCYA 4MZXA 4BL5A 1JKFA 4YJ3B 1CULC 4HLCA 2Z09A 4NYIQ 3BA8A 3CCLV 1IBCA 3LY8A 4Q9JA 2PD3A 5BQXA 3I8OA 1H2AS 4JN6B 4DADA 5BWCA 3E9RA 3HGTA 5D3MA 3SMVA 1US8B 3URMA 4Q5IA 3MJRA 1XAJA 4I5DA 4NV3A 4FFBB 3HR4A 1XIVA 2ZRBA 1M1NA 2PX5A 4C2AA 1RQPA 2VLBA 1RYHA 4E70A 1B00A 1UDWA 3BRWD 3K71B 4EOGA 1P0FA 3AHGA 4WOPA 1VLHA 2B4AA 1NBEA 1CP2A 2WG1A 4D8YA 1O4VA 4DR6B 2F9FA 2WICA 2AVDA 3I5DA 3DCJA 4IIFA 4YJ2B 2QXUA 1G4UR 2FA9A 5C52B 3QYPA 1CUWA 1KI1A 4EPVA 4MKGA 2VPYA 2VGMA 4F4DA 5KTPA 3F7MA 4MVZA 4X20B 1I6KA 3PWKA 1T9BA 3FHJA 3I9V1 1W2HA 1YQDA 4XB2A 4Y2QA 5LQRA 3CJQA 4K9MA 3BIFA 1ZJJA 2NW6A 4CR7A 4EYEA 1V8BA 4E94A 1JLLB 2IHBA 3ZCRA 3EZ7A 1MCZA 4ZI7F 5JSZB 3RFVA 4IG4A 1CUEA 1KFJB 5I4BA 3WGJA 1C80A 3RVQA 4R4JA 2QSJA 4UCVA 1USKA 1N8TA 3JWHA 2AL7A 1R88A 3MCAB 4GC9A 2YI9A 3SKXA 2QUAA 4Q4AA 2ECFA 4H7FA 1JSZA 3E9NA 5FT9A 2Z1DA 1N32O 1K34A 1LK7A 4P81A 4Q4CA 2X8JA 1JIQA 1ZMBA 2R8OA 2IH3C 2ZR0A 4NH4A 2YCLA 3R7LA 4WT7A 2ZYRA 4FEYA 3DZHA 1M1ZA 3WWYA 3OA2A 4AMBA 2N3ZA 3PIRA 4U63A 3IEKA 1XD8A 4LZWA 4GPD1 2NVOA 4GBED 3WKEA 4M0KA 1GZ5A 5AMXA 3FOBA 3EZXA 3V3TA 5E2AA 4DLYA 2BELA 5CT6A 3UJ3X 2V9CA 3P97A 5A6SB 2NTNA 4G2NA 3T0FA 1V43A 2FFBA 4Z4QA 1Z2EA 5B7NA 1U0NA 2NYAA 5CDUA 1T6BY 4TV8A 3KTOA 3OMNB 2Q0QA 1MO6A 4A27A 2VL7A 5IE9A 4DBLE 1DPFA 2J3QA 3CIFA 5CJ2A 4N0EA 3AEKA 1BX3A 3HK2A 4B2YA 1Y1SA 1W0CA 4BJHB 4KE7A 2X42A 3KKEA 1EIWA 4WUVA 1U8FO 1XXHB 2OD2A 2B78A 4EATA 1SHJA 4Z9BA 5BN5B 1CTQA 4BYGA 1A77A 2H00A 4MI6A 1KC8W 4LNAA 1ZH0A 1M2OA 1KE2A 4HVAA 1TQ4A 2VYFA 4RV4A 2A0YA 1ULTA 3TI7A 3RVZA 5AQEA 4F0JA 1S8OA 4FI3C 4LWQA 2XMQA 2FPSA 4Q1AA 4RSHA 4A16A 4F85A 1RRKA 4IWYA 3SR2C 2GEJA 5AK4A 5AJXA 1K86A 2O57A 1JHXA 2B8WA 3C3PA 1J49A 2BCGY 5L95A 4IVNA 4JOCA 5HBRA 3GC6A 3IT0A 2F64A 3GEMA 4NBSA 1MVLA 4J07A 2PGLA 3WGTA 4FZJA 2OGTA 2W7TA 4JJEA 5BR8O 3NBAA 4ZOQI 2BH9A 1P72A 4M83A 2VXCA 4DYDA 5AW2A 2BP7B 1ZH8A 4EYQA 4S1NA 1Q1QA 3FSGA 4AI6A 2RHHA 3DHWC 2ISSD 5JOQA 2BUBA 5B57C 2ZCJA 3T3EA 2BEUA 1I1HA 1WMFA 4NZYA 4JDUA 2QRHA 5KHLB 2PT6A 3WK5A 1QTRA 4WCDA 1ZA1A 2YWJA 1TK9A 3TSAA 1N5IA 1R4AA 3ENZA 3F73A 2DAPA 1FFTB 4NDNE 1Z7BA 5A06A 4UM9D 4ZXFA 3W4JA 2Q1SA 2I6RA 1EDEA 2IHNA 4G5YA 4N49A 1HQCA 1PDOA 1TMGE 1V71A 3RWMB 1Y0BA 4ZMBA 5EINA 3A27A 4AQYO 1U2SA 3M1YA 3H6HA 4HFMA 3O26A 4DUZB 4EY7A 1TADA 3LXRA 1YT5A 1ZJZA 3DMTA 5HUJA 2CEAA 5KJ1A 1VE1A 3EXHB 5JJJB 1EHCA 4LX0A 1NMYA 2E4WA 1W4AA 5BOSA 1EIZA 1O94A 3MTAA 4LOAA 2ZJAA 4HTFA 5AVZA 4A5OA 4KP7A 4PX2A 2P4VA 1GO0A 2Z2JA 3GD7A 3RRJA 4QPNA 1N2IA 1U2GC 1PK9A 1SXHA 3CKMA 5IY5B 5JO9A 2ZSEA 5LD2B 4D41A 1QIDA 2XKAA 4X97A 2R9VA 3SJCA 1A2QA 2EF0A 4ROSA 4D0GA 1PVVA 2FUG1 2RONA 2QQGA 4EVQA 1P7BA 3M4NA 5IG2A 2HTEA 3D0RA 4ABTA 2QIPA 3H2ZA 1C7FA 1ZAUA 3ANSA 4QYIB 4I6GA 1KZGB 5EMLA 1E1LA 5JAMA 2JAUA 4U7WA 3I9FA 2QJFA 2G67A 4DPMA 2WNSA 4IS2A 2QR3A 3UVEA 4XAQA 3GB7C 1BN6A 4K8XA 3OM8A 2CNDA 2WF9A 3QRWA 5HF6A 3GIWA 3H1TA 1RXCA 5FD8A 1DRWA 2JASA 4PG5A 2KS6A 3IP5A 3HDQA 4CW7A 4R81A 3VZDA 3WBFA 5E1MA 4UJ5A 4RXUA 4UDNA 5E1BA 1IXYA 2OBFA 1UC4B 2YIDA 3BMCB 4P35A 1FD9A 4Z0TA 3K1AA 3TOVA 4LXHA 1Z88A 3CVXA 4MP8A 1L4LA 1JDNA 1KC1A 3OEEG 1DG9A 2WLTA 2CGOA 5EOVA 5JXIA 2UYJA 3DTTA 1N2CA 4B6SA 1K8AH 1ELOA 3M84A 1P75A 4RBNA 2WFLA 3M9XA 1RWPA 4D9NA 3IPRA 4UVDA 4OPAA 3UHPA 1XHEA 2VT6A 1CZKA 1G63A 2FWAA 3OIWA 3V7EA 1U9CA 4ZT7A 3VZSA 1V96A 4A8JC 1J0BA 3ELDA 3NR2A 4TSFD 2NYUA 4CKEB 3HNOA 4FI3F 4EARA 3UWKA 4Q4DA 4MYRA 2ZM6O 5BUQA 2D00A 2H5LA 3DGEC 4GI7A 4FKZA 2GF2A 4DYVA 2CKMA 4EQZA 3G4SV 3MM4A 5LLSA 3NIFB 4OAPA 2ASVA 2Z8YM 3VJLA 4RTRA 5I01A 3C1TA 2Q5ZA 2OV3A 3QLUC 1OHHD 3V46A 3CH4B 3ZOPA 4MT8A 2C57A 5CFQA 5HQ3B 2VDJA 2QG9A 5GM1A 1BE6A 2P4UA 2C3PA 2IYFA 3VU9B 2QTMA 2AH5A 4PO1A 2DF8A 1SQFA 1IOWA 3QX7A 3KM0A 4Y1GA 1SVUA 1WPQA 2BTQA 3W06A 3FPFA 2OCDA 3S8EA 5C3MA 3R7DA 1Z73A 4H6PA 1GTJ1 2Y1KA 5HGXA 1YE5A 5TY0A 5FWNA 5JPIA 5SV2A 3ZX6A 3L7LA 4JX8A 1SXJA 4MB6A 5B64A 3ZW7A 4P4SB 1DUSA 1XDDA 4HRYA 2IOFK 4NCKA 3ZD6A 1XE3A 3OZXA 3VJMA 4KAJA 3ZV5A 2X8AA 2NUPB 1FUIA 4PYKA 1RC1A 2UZ0A 4E5YA 3PP8A 4KXRA 4J10A 2W11A 3WIOA 3G0OA 1Y7IA 3ZDQA 1XRGA 1IRXA 4LF6B 3K2QA 4PQGA 4IMIB 4JYAO 1X19A 4LDQA 1VIMA 1CDOA 5JG7A 2AC4A 2DN9A 3SEFA 3BDIA 2NAPA 3UJDA 2W6IG 3QKWA 2O8DB 3TECE 4RM2A 4ZVVA 3STTA 2WZDA 1JHMA 2VJCA 3IALA 1GT91 1XTVA 4WA7A 2FAXA 1OAAA 1L4NA 4B34A 3QIVA 5L8VA 1MKYA 2YFKA 3LYBA 1SQPH 3DOOA 4PSDA 2UU9B 1UK6A 4C0AC 3PUWA 3ZHVA 3L43A 1BEEA 3AJDA 5H0IA 4DQ0A 3WFIA 2JK5C 3K0SA 4YWHA 4XVHA 3PGMA 2H4HA 1PS0A 1SULA 3ZEAA 1NMXA 4O4IB 3B3JA 2WF6A 1ID8A 3K09C 4DMLA 4GKAA 1T5IA 4LCBA 4XWAA 3W1WA 5LJIA 3PX3A 2Q9LA 4KOEC 2ODWA 3IR9A 4RSRA 3W6ZA 4C7BA 4RH1A 5A7HA 5H7XA 5H83A 1ZGGA 4IKOA 2PMDA 2CMGA 3VZCA 5J2UF 3HVJA 1AGXA 3NM4A 3ENQA 5MN4A 1KIMA 4CI0B 2Z1FA 3U6BA 3B1VA 2VI5A 4ENTA 4F9EA 1VL1A 2J9FB 4JLSA 1SKYB 1L6IA 3VVBA 1XZJA 2RHTA 3VPAA 2EKQA 4LFBB 1UXGA 5FQOA 3KAPA 1QLHA 2Y48A 4II7A 1VJCA 4Q1DA 2HDWA 4UE6A 3MS4A 3LBYA 3TAHA 4JASB 1IXKA 1WKBA 1ZQ9A 4FMDB 2Q4OA 4ZVRA 4ZCIA 2AOVA 3HR8A 2VWPA 2FTKA 1Z5UA 3LXXA 3VAZA 1F0KA 5AW6A 3ZHUA 3UF0A 1M73E 3EWSA 3SYAA 5IVHA 2W4MA 2RB9A 1GN2A 3R6WA 2WE8A 2REXB 4A1OA 4J0KA 2YWEA 3WSTA 5I47A 1DXQA 3UATA 2XHZA 2IX9A 3FCAA 1DI0A 4C4XA 1BL8A 2GDJA 4ZEWA 1T4CB 1XJ5A 1QK3A 3S7ZA 4LNUA 4TXJA 3FKSD 2VT7A 5CX1B 3T5CA 3B3FA 1XLTA 2Q41A 2P40A 1VGVA 5ESDA 3ETQA 3A26A 3LGXA 2DR2A 2I3BA 2G8LA 3NKFA 4KIWA 4G81A 1IHUA 1XRJA 2F9LA 1EMDA 4U8GA 2X7RB 4NBUA 4HJXA 3AEQA 3A6DA 3CC7V 4FD2A 4OSOA 5FA5A 4EL5A 3RI3A 1HE8B 1QNMA 1SZDA 1AGPA 4YQZA 3G8BA 5JJKA 2QWQB 3RVRA 2HSWA 3EVTA 5C8YF 1HNXB 3QMMA 4ZAFA 4DWWA 2FFHA 1KKMA 1T8PA 1L4BA 4K9LA 1FS4A 1M2NA 2PQMA 4MVJA 3HS3A 1KTVA 4QUDA 2C2XA 3SVTA 1CHNA 4D26A 2M6KA 1N6KA 4ILEA 1RMTA 1UJ6A 1T15A 4L6AA 3B3GA 3OCWA 1G4HA 4DR7B 5IN5A 1YQUA 3COWA 4U2GA 1EUDA 2WHYA 4KQHA 4P5EA 1WCWA 2PT7A 4PS0A 2WALA 1IN5A 1TUBB 4FJ2A 3HJRA 2G63A 5KTSA 2XZPA 3F9CA 4MULA 2PV7A 1LPOA 3G71F 1YBFA 5EO3A 3QBTA 1ZIYA 2JZCA 5K0BA 5IT0A 3G8CA 2OUIA 2EL7A 4AIIA 1KVSA 4WEOA 2P9YA 2AOTA 3NIDB 5GTIZ 3FMVA 1FP7A 5L4NA 4BQRA 1L8XA 2UV8A 3K94A 3P0FA 1J99A 3E22A 3JYOA 1YRWA 3U1TA 3EE6A 3RS8A 2FR8C 3K9CA 4UTPA 1U98A 2WJGA 4P3XA 2XUPA 4KR3A 1QHEA 4YAJA 1A32A 3DVSX 1JF8A 5BMOA 1KDVA 2IFTA 3I39X 3GFRA 3DR3A 1CN7A 2HG5C 2XNDG 4CMBA 1OIVA 1UP6A 1E9SA 1BU8A 3U4AA 4ENPA 1XNRO 2I5PO 3ZU3A 4YXWA 3GEIA 3R75A 3OPNA 4QM7A 4ESHA 5IC4A 2N0SA 2XZTA 4PYLA 3MHHC 4JR1A 5KCMA 1XZCA 1YTUA 2QA5A 1O96B 2NWQA 4EHDA 1DWOA 4QECA 3ZX4A 1Y5MA 3GT3A 1T0PA 4ZIRB 1T9AA 5ECDA 5JATA 1T8SA 4CV2A 2C84A 2V6JA 2FY8A 3WLPA 4YP5A 2VPTA 1L4UA 1BMTA 1JFVA 4Q9IA 3UANA 1OIWA 1PSDA 4W82A 4U2EA 4LQDA 3T3GA 3K0AB 1E4YA 5EAZA 3DE6X 3R3JA 2ZVQX 4ZCQA 3ZYCA 2PYJA 4PYIA 3ZE6A 1MABA 2J41A 3U31A 4WBNF 3BWDD 3WAKA 4XB6B 1H1LB 4KQWA 4DRXB 4KYTA 4BFWA 2R85A 3T4PA 4DL9A 4C21A 1IBLB 1AKRA 4Q34A 5LXTA 4WY2A 1GEGA 5A4DA 2FX5A 1DKRA 2X8LA 3UMFA 3B2EE 3K5OA 3CZRA 3H6GA 3NNNA 2BJHA 5BW6B 5CK4A 2JIDA 4O63O 2INGX 4XQGA 1Z18A 4I9GA 2OO7A 3PF9A 2Y9PB 4HWPA 1DQPA 2WQ7A 3PNMA 3OW2F 3J81A 2VYVD 3QU9A 1V5WA 4JC5A 1GVHA 4LXTA 1N0JA 1GLGA 2WHRA 2UZIR 3B6JA 3MAGA 2N9UA 3AK2A 2HEIA 1ZCJA 2C5AA 2O7SA 4KREA 1XCLA 1KEUA 2B9EA 3QXSA 1N6LA 5ICCA 2J09A 4QJ3A 4E07A 1P9LA 1GADO 2C31A 2FOLA 3ZQJA 1EM8A 4B80A 1UOPA 3VR0A 1U8YA 4JAVA 1Z63A 1JH8A 4QFCA 3DZDA 5FUBA 4MVUA 2J5KA 5FJIA 5KMGA 4A0HA 1OYOA 1Q22A 5JV5A 2H4YA 3VR5A 4ZEVA 2IKQA 4D80A 1FXWA 4BGEA 2Z04A 1UEIA 3DKPA 2IXAA 1K9MH 1E3JA 4RPGA 3DEYX 3TOCA 3RN4A 2H1CA 3SYNA 4M21A 3OEHG 1IY9A 1DCKA 1QYIA 3GQBA 4QDUA 1JG4A 4R8VA 1JHYA 3DD1A 5ALLA 2RGEA 2BTEA 1OOEA 1L1QA 1RI4A 2QHXA 4TN1A 2QMUA 2DW4A 4KSBA 3LNMB 3AC0A 2YL2A 1NHGA 4QYMA 4XD2A 4EY6A 3T2MA 3QA9A 3SXUA 4LHWA 1FDOA 5E1OA 3JQAA 4YUYA 3IQZA 4O33A 4PAOA 2Q8QA 4LHYA 3GXBA 3VOSA 1G18A 4N1AA 4NU6A 1LDGA 3BGIA 2RFLA 4PWYA 4I50A 4ZZ3A 1CWUA 1I6WA 3PCRB 1ORRA 3L7KA 1JMYA 3HZHA 2HHHO 3PENA 1YQQA 4HLNA 3M3DA 1N8NA 3IO3A 3PHLA 1GN8A 2GYVA 4ZQEA 3ZGNA 1GKFA 1BMFD 4YDQA 3ADOA 3S44A 1VSVA 1JXQA 1C3OA 4CBCA 1UAAA 3ZWQA 4YH1A 2WYHA 1IM5A 4ZO6A 2NGRA 3LUKA 5TEWA 1Q81W 5FORA 1PHPA 1BVUA 3FFXA 1YJ9V 2I8CA 5A4FS 3PWTA 1B0ZA </