4DRXB

Gtp-tubulin in complex with a darpin
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
431
structure length
424
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title A designed ankyrin repeat protein selected to bind to tubulin caps the microtubule plus end.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
total genus 164
structure length 424
sequence length 431
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4drxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4drxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4drxB01
2GVIA 3HKDB 4O2BB 2RHOA 4I50A 5J2UB 4XCQA 3JAWA 3WGKA 4F6RA 5ITZA 4X20A 5LP6B 4DRXA 3E22B 4ZHQA 1FSZA 4I4TA 4LNUB 4X1IB 3HKEB 5EZYA 5JVDA 2BTQA 4WBNB 4B45A 4ZOLB 5J2TA 4TV8B 4O2AB 4HNAB 3WGMA 4E6EA 4O4LA 1SA0B 5CB4B 3WGJA 4M8IA 3ZIDA 3ZBQA 3HKDA 5IJ0B 4O2BA 1RQ7A 5BMVB 4U39A 5J2UA 5LOVB 5C8YB 5LXTB 3JATB 5EYPB 5LP6A 3M89A 3E22A 2Q1XA 4X1IA 3HKEA 4WBNA 4ZOLA 2VXYA 4TV8A 4O2AA 4B46A 4HNAA 3VO8A 3JALB 1SA0A 1W5BA 3R4VA 5CB4A 5FNVB 5LP6C 3RYFB 3RYIB 5IJ0A 3ZBPA 4TUYB 1TUBB 5BMVA 5LOVA 4U3JB 4IHJB 5C8YA 5LXTA 5MN6A 3JATA 4O4JA 5EYPA 1W5EA 3WGNA 5KX5B 3M8KA 1TVKB 3JALA 5KMGB 3N2GB 5LA6B 3UT5B 4TV9B 5FNVA 3RYFA 3RYIA 4EI7A 4TUYA 1TUBA 4KWEA 1Z5VA 3RB8A 4U3JA 4IHJA 4LNUA 3VPAA 3HKBB 4DXDA 5JH7B 5KX5A 4X1YB 1TVKA 5KMGA 2RHJA 5JCOA 3N2GA 4FFBB 5GONB 3RYHB 5LA6A 3JASB 5JQGB 4TV9A 2R751 1JFFB 4IIJB 5LYJB 1W581 3HKBA 3VOBA 4O4IB 3C8LA 5JH7A 4ZHQB 5CA1B 5JCOC 4EI8A 5M7EA 3HKCB 5CA0B 2R6R1 2RHHA 1FFXB 4FFBA 5JQGA 5GONA 3RYHA 3CB2A 3JASA 4ZI7B 1W5FA 2VAPA 1JFFA 3WGLA 5IYZB 4IIJA 5LYJA 4X1KB 3JARB 1W59A 4YJ3B 2XKBA 4O4IA 2VAMA 1W5AA 5CA1A 2XKAA 3JAKB 4O4HB 1OFUA 3HKCA 4YJ2B 5CA0A 3UT5A 1FFXA 3N2KB 4EB6B 5MN5A 4I55B 1RLUA 2RHLA 3VOAA 5IJ9B 4ZI7A 3RYCB 2Q1YA 1RQ2A 5IYZA 3VO9A 4I50B 4X1KA 3JARA 3JAWB 4YJ3A 4EI9A 4F6RB 5ITZB 3V3TA 4X20B 4DRXB 4X1YA 4I4TB 4O4JB 5EZYB 5JVDB 2BTQB 3JAKA 4O4HA 5J2TB 4YJ2A 5MN4A 3N2KA 4EB6A 1Z5WA 2BTOA 4O4LB 4I55A 5EIBD 5IJ9A 5EIBC 3RYCA 2VAWA
chains in the Genus database with same CATH superfamily
1T24A 1VP3A 1EFPA 1SUIA 5B66Z 1I24A 1XDZA 2ATXA 3LDEA 3GJQA 4DR1B 3A9SA 1WW2A 4LTDA 3MWGA 3IMKA 3KBOA 3OPYB 1ABBA 4LPKA 1O87A 3G5MA 5IT5A 3OBIA 3FAVB 5KX5B 4C4WC 2AKAB 3CJRA 2VATA 2DFLA 5C8ZA 3Q5DA 5EJIA 4CG2A 1ONIA 1D7AA 1YL5A 3OKCA 1PT9A 1ZK3A 1PFQA 2GDSA 3V5NA 3HCOA 2A6PA 2MWMA 3WMEA 4OFBA 4DOMA 2Q68A 3M49A 4QYIA 2VBFA 4X91A 2HM7A 1V9SA 4Y2YA 1FXHA 3RU2A 3HB5X 4G2KA 2EBHX 1VBKA 4ZAFA 4WVLA 4BLPA 3NVMB 4FNAA 1T2DA 4Z7QB 1V55C 2R8YA 1BCRB 3KXKA 5H83A 3DAOA 1A7JA 2AD5A 1UJ5A 4OMCA 3RA6A 3WLAA 2QVZX 3OQJA 4DRXA 4PTZA 3BTOA 2NW6A 4OQYA 2AKEA 2MINA 3GJYA 1MO5A 2P79A 3O8QA 4GLJA 2WUDA 2DFPA 4NMWA 4ZOLA 4FNMA 5LA6F 4E5MA 4X97A 3FB4A 1XJ0A 3PJEA 3B85A 4CMBA 3SPHA 4JI5O 3QQPA 2DFNA 3ZQ4A 1R0WA 1TVKB 1IZ3A 4UB6Z 1WLYA 4RHCA 4DDKA 2I3DA 1DE0A 3Q40A 1TA9A 2AIZP 1ZFNA 3CA8A 2NZVG 2BEUB 1Z0JA 3KS9A 2W8BA 4UU7A 4NBKA 2P3LA 4P93A 2JRIA 1SUBA 4AILC 2FW6A 3LK7A 4HAWA 1U11A 1BGYH 2J67A 1CS0B 3S29A 1U1FA 1QU9A 1SHJA 3BMCB 1AURA 4RQBA 2XWSA 4XSHA 4HT3B 4TTSA 3ZKAA 3BKWA 1H9AA 1WB6A 6YASA 4G0ZA 5JCXA 3ANSA 3EIHA 1VIDA 3SXUB 3GA5A 2ON6A 1NMQA 5DDIP 2J5RA 2X4IA 2PU7A 2QP4A 1EE9A 2A5LA 4XVQA 4EHLA 2F48A 2VJNA 4UUJC 5FNVF 5HOQA 2BOCC 2X0KA 1YA4A 2ZSHA 4TKUB 4DR7B 3E22A 4EAAA 1K9SA 3VC1A 3M1XA 3HCPA 5DTEA 3TAXA 3MRVA 2VDWA 2ZRQA 5A9TA 5LBUA 2PUCA 5LBTA 4OHMA 1I08A 3BKXA 2RSLA 2O50A 3KB6A 3UG6A 4NCXA 1IN5A 4XM2A 1D2EA 1PNQA 2R8ZA 2H07A 3GUHA 4II2A 1EWYA 1FUUA 1OREA 2ZQYA 4NKRA 3GLFA 2R68A 2VP2A 1I94O 3E1KA 1T4CB 3P2IA 3RWRD 2PD4A 1ACLA 1KARA 1QXSA 2XMBA 2GTAA 1EGHA 3CZ9A 2ZNJA 4MV7A 3DBHA 5B6JA 4OJNA 1WUKS 3DONA 4YJFB 3F2VA 1MG5A 2XGGA 5DM6V 3R7SA 4YAUA 5IDQA 2P6RA 5D7BA 3NATA 2NUAB 3ZW7A 1J0DA 4ZAGA 2REBA 1JDTA 2GM5A 1ZGBA 3BA8A 4M9RA 1K7CA 4XGKA 3INTA 1KKCA 1IQUA 4NZZA 3O1HB 1Y0BA 4IDOA 4YUVA 3JCMM 1EUDB 3EWIA 4TYQA 4LWSB 1J2UA 2BV3A 4B1FA 2XAJA 4GMHA 4TLDA 3V42A 3ZCXA 3P4UA 1EN4A 2AG8A 4MTGA 2G4VA 5IUKC 2XVMA 1A7UA 3RAPR 1S5PA 2F90A 4ENUA 1ZLZA 4E12A 4EATA 2AN5A 3C90A 2C4NA 2Q8PA 3WPXA 5TISZ 4PLHA 2YYAA 3BMNB 4G4IA 1CUJA 1S01A 1QM5A 1Z5OA 4K46A 2GN2A 4E07A 4LF4O 3EXFA 3CIOA 1G5TA 1K88A 3VV3A 3PNKA 5EHGA 2D5IA 1XVVA 3MCAB 3UHAA 1B93A 2OXCA 3UWOA 1AI5A 1N2XA 4LTMA 4CL8A 4UVIA 2E4YA 4YI5A 2YXYA 2PJRA 3PLRA 1P62B 2QGZA 3NBMA 3NPAA 4UXHA 4OK5A 4CKEB 1LJ8A 4D99A 5LWHA 3GFQA 4OFXA 2WILA 1WF3A 1RJFA 4JBHA 4II3A 1YE3A 2UVQA 3MWEA 1E64A 3RS8A 2HIMA 4CR6A 5JIBA 4A6EA 2GTHA 2IITA 3FYCA 1VG0B 5B6IA 3KCXA 1WLEA 4LF5O 1OBFO 1J8FA 2HADA 3WMFA 2ECOA 1VQ9V 2R6AA 1UFOA 1TGOA 3RHTA 1JLHA 4M99A 1U40A 2YV5A 2OFXA 2QTFA 4AX8A 1CR4A 1GLGA 1MN6A 4KQ6A 3KJXA 1W8DA 1VA5A 2XTZA 1CIPA 3V7UA 2P27A 3QA3E 4HDRB 1PZMA 2EKZA 2KSQA 1V95A 3BD7A 4ZEOA 5G0UA 1H0SA 2F9LA 3I0MA 4BNJA 5J2TF 5A7HA 2XT9A 1LZLA 3MERA 4BNVA 2B33A 2X1LA 1N0IA 2OWOA 4EYKA 4GRAA 3DCNA 5E3IA 5DHRA 3CMEV 5U1PA 2XUKA 2X5JO 2X6BA 4F96A 3I9NA 3C8UA 3SHFA 2JCXA 2XGMA 5DM70 5EE0A 3NKVA 2K7FA 3OHSX 4DY6A 4HEA6 1L7OA 5DLYA 4BVGA 1J0AA 1VQ4F 1YVDA 5HUJA 2WQ6A 5L3BA 2GDZA 2NTEA 4BP3A 3E9RA 3AFGA 1W55A 3IA2A 5L9AA 2JH9A 5HS6A 1KJJA 5K6AA 5EIOA 3MGAA 3W5BA 5B1SA 1RYEA 4JLPA 4TQAA 1GPLA 1E7YA 1RS0A 1HT3A 1HRDA 2C0CA 1KJIA 2FEXA 2A2ZA 4J7JA 4KO8A 3G59A 1GZ0A 5D1NA 2HP8A 1K5DA 3OFND 1SZQA 1NLYA 2WE7A 3DTVB 4QAQA 3MD9A 3ZVNA 4GI5A 4YRCA 1AQYA 4M0UA 3GJ4A 2C5HA 4LI3X 2RONA 2SCUB 3FOBA 4FHZA 1NUTA 3WJ2A 1H0HA 1PJBA 3HI4A 4NH0A 3U3KA 4R1TA 4HGPA 3DFMA 3KSBC 1WMEA 1X59A 1ILEA 1T4BA 2BZ1A 1DC3A 4BV3A 1J39A 3LPAA 1QIJA 2XSZD 2WPDD 4QHYA 2DT4A 3EG9B 4WCFB 5KYNA 4OHUA 4B5CA 5CM8B 1FFSA 3ZK9A 6PFKA 3EVDA 3TF5A 2FN9A 1ULZA 4YIHA 2VIIA 1BMDA 3GT7A 4HWTA 3VAYA 5L95A 2JCGA 2DBZA 3U19A 4J6FA 1W1UA 4GCZA 4J0HA 5CW2A 1FNNA 2ZJOA 1RKQA 2H8CA 1E2UA 4NOLA 2BFCB 5F3WB 1NQXA 3ULKA 4HDSB 4UEOA 3PUIA 1LSOA 3W90A 1R8YA 4Z4FA 2D3TA 4OGQB 4G67A 3H9GA 1NYTA 4HNUA 3STYA 3HDGA 2WNIA 4YRAA 2NO1A 1TTTA 5I7VA 5JMPA 4QGSA 4ZO6A 3B8EA 2QL7A 3RTDA 2HP0A 2F00A 3AILA 4E4YA 1GZ4A 2O0JA 1KERA 1WXXA 5TSDA 1YITV 3AIOA 4BN0A 3OTQA 1ESZA 4ERNA 4ZHQF 3LI2A 4DCCA 4DWWA 3PEVA 1XT6A 2M1XA 1E6MA 3OJXA 3KOOA 3N6XA 4QD3A 2JS5A 4MVJG 2O52A 3OM0A 2LXNA 4I66A 5DXJA 4FDAA 1WOMA 4X6XA 3WA7A 3JD0A 2NSHA 3OEHA 2X3FA 3UAXA 1L4LA 1XELA 2VHWA 1U7HA 4QUJA 4KN8A 4QM7A 3CMAF 4GE3A 1J09A 4Q1BA 5HK9A 2P62A 2W42A 4R40A 1LVUA 1YRQA 4H08A 1S4MA 5CMUA 4OXIA 1GCIA 4GF5A 3VNBA 1KHHA 3D3JA 1OVGA 4R0NA 1N36O 4B31A 4PDLA 3OFSA 3WOHA 2Z8YM 3OQ6A 1E20A 4HYTA 3R5JA 1FXUA 1ODSA 5CLHA 3RT3C 2VWHA 2BGNA 1GGKA 3KIPA 1EX6A 4MS3A 1N2CB 1ORRA 5LYYA 1JIJA 4LHVA 4LHEA 5EWMA 2AS0A 3O26A 1KMIZ 3OC6A 3GWGA 1E2GA 4Y2RA 5L45A 1RI1A 1I2DA 4CM4A 1UR5A 3A9UA 2JIOA 4B3SO 2WM2A 4FK8A 1HYBA 1BDIA 1IN6A 3GWOA 2V98A 3C6MA 3VC7A 4JBYA 5AVOA 3KP1A 2E5LO 2YI9A 4YJ3A 4RIGA 4YRMA 5KNDA 4DUYB 2CVPA 2UYHA 1JJ2F 4CKBB 4GMXA 3KALA 4N21A 2WZBA 3ZHRA 2IG8A 2QTSA 5ITZA 4E6EA 1VARA 4BMNA 1A71A 1P0PA 4YJHA 5EE5B 5C1IA 2ZXUA 1SKUA 4XDJA 2ERXA 4ARSA 4OO3A 3LMEA 2AFHE 4EABA 4B3GA 1NQ3A 5JYBA 3PHIA 2HHHB 1K9MH 4S3MA 4YO7A 4AD8A 2GGSA 1SNYA 2L42A 1T35A 2O7NA 4EX7A 2BFAA 1G3IA 1K5GA 3C3XA 4BNIA 3KZOA 1I01A 2CYAA 3SBXA 2QXTA 1R5OA 4LWOA 1G6KA 4PANA 1FX0A 5KJEA 2X1VA 3UB4A 1JW9B 3MUNA 3BGDA 1UT6A 3GFTA 4L6CA 2W48A 1FC0A 2JJ1A 4WT7A 3T5GA 2RC5A 2EBFX 4HWPA 4B3HA 1N8RH 4MQMA 3JWEA 3CCQV 5FWXA 2E1RA 4L0MA 5HP8A 4F8JA 2H06A 4MV3A 3Q88A 1N7GA 3KYDA 2GUZB 2IYOA 2HG5C 2NO7A 5IJ0B 1JECA 4OXKA 3Q0IA 3LCMA 2PWAA 1J1ZA 1X1EA 4FOPA 3CE9A 1GGMA 3TKYA 3RHSA 3ZY6A 4GC9A 1IXKA 4E0BA 4QQNA 3RVQA 2PGLA 5BMVA 1NC1A 2O2DA 5K3EA 3K20A 4YP6A 4ND8B 3HMQA 4CMKA 1TO2E 4YXWD 4MZDA 3RUEA 3QUWA 2CL6X 5KS2A 5CPBA 4QXAA 3OPQA 5DXFA 5B1IA 5EJ5A 1J70A 1D2HA 2OENG 1DKRA 3SZ3A 2M7WA 3WWPA 4DSAA 3M1AA 3DEJA 1SBIA 2K5UA 3PLAE 3O8LA 3EF1A 3UJBA 4HEHA 2DM6A 3OUUA 1HOXA 1VJ1A 3MAGA 2Z6AA 2J3QA 3QF4A 1PEKE 2FE1A 3TNLA 1C8LA 1JKJA 2H3OA 3IBSA 4UTZA 2FI1A 1KJYA 3TFQA 3BHNA 3KZMA 2AG5A 1T0JB 1SC9A 4M6WA 2FPRA 4NU6A 4MVJI 3GAAA 1YFKA 3H5WA 3N53A 2Y1OA 3QWHA 3ECAA 3E84A 2V6BA 1XDCA 3PUWA 4CCYB 2H92A 2ZATA 1V7PC 5TJ9A 4DA8A 4FYWA 1SU7A 3MXOA 1XNRB 1RU3A 5C8YA 1AP5A 3W7WA 4YP5A 4AYTA 4R1LA 1J7HA 1QGAA 3LVQE 5T4HA 3SYNA 2CTWA 2AZXA 3GY0A 4TS4A 1XZ8A 1QIMA 5HQJA 4N18A 1JZTA 2QX9A 3C6KA 3PFNA 1KYIA 3ZZ1A 1R64A 1RJDA 3I0ZA 5CLGA 3RYHB 2JFHA 5D51S 2GK4A 3RGBA 1F8XA 2VT3A 2XHZA 4EZBA 4JI2B 3RCBA 3ZMSA 2N0SA 2HXYA 4CDNA 3I0NA 4PSAA 3NS7A 2GEJA 2WFAA 4UZFA 5DYYA 1M7GA 3HBNA 3CT6A 3D54D 3AK1A 1Z0DA 4DJ5X 4PN7A 1TPYA 2BZGA 4FGUA 4PLGA 1CUBA 3IAEA 4U7GA 3DV0A 4CV0A 4EMBA 1VPTA 3ZHSA 4E5KA 3FETA 4MVJP 5KNBH 1TM2A 2A3QA 1W88B 2Z9BA 2PY5A 1ZM9A 2AR0A 3NC0C 4N7BA 1WAMA 2PZMA 5LMUO 1IUOA 3EZ6A 4GL2A 2D62A 4X41A 4RKEA 1C8VB 1SS3A 1XFAA 2AQKA 5EQJB 2ZFUA 3MWDA 4PPQA 1Q1EA 1ZR2A 4BNKA 3ZUPA 2HJFC 1RW4A 1LDNA 2CKMA 1SG9A 1JIUA 2Q8QA 1U1CA 2MTBA 3H99A 4CFYA 5HVNA 3INRA 3UOGA 4FR2A 3UO8B 1FDVA 3HV2A 1U80A 3GJRA 3UTDA 1OLXB 1PW5A 3EIEA 3VTKA 3CZPA 1TVCA 5EWJB 3QLEA 1SVKA 1WNSA 3B9BA 3G6WA 2INGX 1TFUA 1GYQA 4E1BA 1RP3B 4UD2A 1YRBA 1YL6A 3HDYA 2HK8A 1YI1A 2IEYA 2VYFA 4IIBA 3I6QA 4A92A 4W7SA 1SCUB 1JH9A 2FEWB 4GDMA 1RPZA 2JVDA 3DPSA 3G9QA 2HS4A 3WFJA 3VO8A 5C1BA 4NFLA 1JKIA 1OU0A 2QMHA 5AKGA 1V6SA 4CN8A 5L4SA 1QX4A 4LJ5A 3X0DA 2P0AA 4LF6B 2H4HA 3PE4A 2HWXA 3D6UA 4UQPA 3I1FA 2VCEA 2QJ1A 4BO7A 4R7TA 4R9SA 3D6VA 5FR2A 3MBMA 1BXRB 2FNAA 1IOZA 4MT8A 3VI6A 2OM2A 4C7OB 1WU8A 3KQVA 3HZRA 1TEVA 1ENOA 3QE3A 1G2OA 4N4AA 3MS4A 3TETA 1SBNE 4Q3DA 2FP4A 1TADA 4ASUD 1EFVA 3G17A 1KP3A 2JFFA 3ZN0A 2N42A 1MW8X 2MSKA 4J7CA 4JSTA 4MRMB 3R7AA 1L5HA 1W4LA 2H9AA 4IZOA 4RJ2A 3UGQA 1G55A 1A7AA 2BLNA 1KRHA 4OTZA 1IY0A 1AXRA 3RFVA 3K9WA 3CF4G 1LY1A 2W4IA 2CFTA 3OCVA 5G4LA 3NBZC 4UM9D 2OXIA 3VYWA 1EJBA 6REQB 3B6ZA 2ZBVA 2NN3C 3OZAA 2OO5C 4DF3A 1SXHA 2C57A 1F38A 1C7ZA 3W1VA 3NT4A 2AA3A 2PKQO 1QZUA 1Q1AA 3VPFA 5JMWA 1LFAA 2R9IA 1R4MA 5CXXA 5DYNA 4H4CA 1M33A 1XL1A 3DTVD 4C01A 3K1ZA 5JDIC 1WXQA 5E7IA 5ITWA 2Y4TA 4XARA 1GG2A 1NAHA 4XB2A 4QVKA 5EB0A 4JUIA 1EGVB 2IPAB 3EXG2 3S99A 2PPLA 3WY9A 4M0KA 1PP4A 4JTDB 3G6EF 1SVOA 4XKJA 1NR1A 3PDCA 5LQUA 1XPOA 3W6NA 4AG3A 3SLKA 1CUVA 3E8HA 2I71A 2EILC 1QQ6A 2PS1A 2HMYB 5DN6D 1COZA 3KJGA 2QM0A 2DYRB 1UFQA 3S0WA 3SSOA 2FPPA 4LR3A 5H4HA 5HP4A 1GZ6A 3WGKA 1NKDA 2V3WA 1NRWA 2I2WA 1GR1A 3KJZA 2GA9A 4LFCO 2WZDA 2UXDO 4RQUA 3QU2A 4O2AA 3OMNB 1YHZA 2Z98A 4XOIA 4ILEA 3H05A 5L53A 4GBJA 5BV1A 1I3CA 1NVAA 3N1UA 1Y81A 4D4JA 3IPAA 1FMLA 4J0FA 1N9GB 3KETA 2RGNA 1U4SA 2ZUCA 4LNAA 1RWXA 2CNLA 1TJ5A 1TAHA 4DR3O 2R11A 3EIWA 4WGGA 2P22C 1L5ZA 4MDFA 2R7NA 3KB1A 2WJJA 4BEVA 3ASNB 2DUMA 2VQSA 4PI0A 4HLUC 4KP4A 3R7FA 2G80A 1F6DA 5CEJA 3KQTA 3C7TA 1UJ6A 4FM9A 1DTWB 4UVCA 3LYBA 2GVDC 3QO8A 4EMSA 1SVLA 5AVJA 1E62A 5TV2A 3X1WA 2EULA 3IERA 3RSLA 2I91A 3VYTC 1AKYA 3QVGB 1ZSYA 3M4NA 1JD1A 1X1CA 2G9ZA 4TTPA 3KZNA 1GH6A 3A0RA 4PZ9A 1US6A 1EA5A 4NX2A 4JR2A 4RNDB 1ENZA 1GNLA 1G3UA 2QJRA 3LVFO 4J9VA 3GP8A 2GN9A 2PMBA 4G5QA 1LNSA 4ROTA 2H11A 3CYFA 2IVZA 4E5NA 3HY4A 3PI6A 3VHXA 2HSEA 4PIPA 1SKVA 2FZ5A 1VQ7V 4PHZA 1N0VC 5DGDA 1Y8AA 5AH0A 5IVDA 3NR2A 5AVMA 1DCKA 1SGWA 2CLEB 3MMNA 3VR3D 4G4JA 2J33A 1T9ZA 3A9CA 4RXTA 3KZCA 2Q6VA 1LPOA 1PX2A 3K6JA 3UOWA 5BV7A 1N3IA 3GL9A 5LDHA 4M9XA 3OLXA 1QR2A 1A9YA 3UMYA 5IDJA 5AJVB 2R79A 4PV7A 4WFQA 2VAWA 1UC5B 3TDNA 4E4RA 3CLVA 1SZJG 4OYHA 4L28A 4P3PA 1DS6A 4C76A 2XUOA 1PWZA 1QR8A 1Z25A 1G1AA 4PNHA 2B69A 1A8PA 5G4KB 3OQIB 2W83A 5HY2A 4B5LA 3I1YA 3GAZA 1R2QA 4GNKA 3JWGA 2JI4A 3TIGA 2QVLA 3OKPA 4X6YA 3GRFA 3LDTA 821PA 2IIBA 2ENWA 1KEEA 4ZYWA 3URMA 1O97D 4XDGA 1VKRA 2FL4A 1FS4A 1MO6A 3LUHA 3RR2A 4RKFA 1MABA 3KKYA 1JA0A 2QBYA 5DGIA 3BRSA 5C8XA 5T4FA 1ONPA 2HBQA 4HDMA 1SKYB 4E33A 1KJNA 5INTA 3NBQA 2BPOA 4C2BA 3IMPA 4H77A 1NDUA 5ALPA 2GUGA 4DB4A 1M6EX 1PUIA 3PEUA 2DHCA 5BR8B 3WIVA 4BGIA 1CZUA 1A97A 4OHWA 3FDIA 1H85A 1MO4A 3KAJA 4EI9A 4I0XB 2KI5A 4K86A 4XB1A 5HNKA 1AM4D 4A8JA 4GOXA 5A4IS 3DVLA 1FYVA 4YT2A 2XUMA 1XF9A 1U0NA 4DXAA 2RB4A 1YGYA 2Q3CA 5BR7A 2YICA 1BGVA 1YKFA 5E4YA 1T13A 1JKFA 5CFPA 4YWHA 4X24A 3R5KA 1XD9A 4X6LA 4CMHA 4LBZA 5JBNA 4TSFD 4J3NA 4XGNA 4XIIA 3DL0A 1EN5A 4F60A 1HDRA 3PHBE 5K1PA 1BC5A 3PNSA 2VSOA 5IZCA 3K72B 3WZMA 5JQGB 2JHCA 4BLTA 1GEEA 5CEEA 2H29A 1PUJA 5CPFA 3PTLA 3RUIA 3EY4A 4NFHA 4XGQA 5DLDA 1J49A 2C88A 2WYOA 4O4IA 3BL8A 2MU1A 3GBSA 1N57A 2HWKA 1V16B 2DWEC 3RJ5A 5LQCA 1DBQA 4ZO9A 2CLCX 3U10A 3RTBA 3STUA 2Q27A 5ALVA 1U2GA 5B1YA 4OEHA 4R3WA 5SY9A 1CRZA 4KRYA 5I9NA 4W5OA 2UUAO 3H1LH 1DC6A 2CLDX 1Y9DA 1VYHA 4AJ2A 2IAFA 1CRWG 3TM5A 3PD7A 4ENVA 5GIPE 1CJMA 1XTKA 1W48A 1ZJ6A 4QGFA 3SZGA 2AJCA 3VV2A 4ECAA 3W1EA 3AG5A 1WHTB 2JNBA 4IPTA 5FEUA 1X1DA 3WGZA 3VNSA 1ZK4A 3KJEA 1GAQA 1M2OB 1UBJS 1GVHA 2RB9A 3WK6A 1KJ8A 3M1IA 1K3FA 4MTCA 4FB4A 1F9AA 4B4DA 2Z3VA 2FPWA 3DDZX 2N04A 3RC3A 4A6PA 2O5CA 4QXRA 2PTGA 3NP9A 1UFVA 2P5TB 4OLBA 1S76D 4QUBA 3THYB 4KQGA 5FULA 2X8BA 1HR0O 3CPWF 1NF2A 1KVRA 3OX2A 4UZSA 3OR7C 2IYAA 3OAAG 1LFDB 2LGWA 3IHWA 1W25A 1DOZA 2ZB4A 1UOEA 4YFVA 1VK3A 3SR2C 2GHQA 1O3YA 4LDJA 4D56A 3RADC 3NB0A 2GTSA 2O2YA 1T8WA 4Z4EA 1R88A 4TLAA 4LXTA 1NMSA 5U9CA 1P6QA 2HN9A 4X95A 3FYSA 2Y93A 4N5LA 4ZHSA 3MVEA 1QAHA 1A0OA 3ZWAA 1FU8A 4DV1B 2WR8A 4X7RA 2MYTA 1A8HA 1X7XB 2Y68A 5KYTA 4ZV7A 2QRMA 3W7SA 1SF9A 1IUNA 3OZDA 4IX9A 5E4JA 2R1VB 4ZVRA 3BAFA 1EMDA 4JGIA 3P9YA 5ILQA 4ZEMA 1WXFA 2EP8A 3PWTA 4FEYA 1I6KA 4NNOA 5HKOA 2YXZA 2HO4A 4LKRA 2BJHA 1KYOF 1GLVA 2X6RA 2I54A 4GUAA 1U3FA 5G53C 1C9EA 2WM3A 1XZMA 3KZ1E 3RARA 2GRUA 1JF8A 5CBHA 1X0XA 3OZXA 4CMGA 3BF8A 3S2FA 2DYKA 4O2BA 1NI3A 1X8KA 4NKGB 2QKAA 3B6EA 1KO1A 2D2XA 4D42A 3VVCA 1HQDA 3FMFA 5IM4F 4WPGA 4JZKA 5JMOA 5G2OA 5KEIA 4F2GA 1XZKA 5AYVA 3KVVA 1GTG1 3D6NB 3DWIA 1EFHA 3MT0A 1JR2A 5JCOA 3P32A 2WAOA 2QWPB 4U7DA 3ADOA 5B2ZA 1Q81W 5K0GA 1JN1A 1NSYA 3CCEV 4J16A 1PYGA 3VVLA 5BVHB 4OOEA 2F1IA 4KV7A 5KHLB 2AKYA 1OBVA 4OXRA 1PT7A 3LQRA 1K73W 2JIZD 2OQ2A 3NHRA 4FSXA 4KNVA 2GEDA 4GRDA 4AJ9A 3W6ZA 3FOEC 4WV3A 3U17A 4TV8B 3D1LA 3PD0A 4DUGA 4F46A 4I8IA 3TPCA 3K9GA 1HE4A 3LWDA 3TR0A 2I78A 1C9DB 2QV7A 1X7DA 1P5ZB 1W0JA 4PGAA 3D3QA 4C0HA 2DPMA 3I34X 5JSUA 3RYIA 2O8DA 3OJEA 4P53A 4RTRA 4YCMA 5L7WA 4R83A 3WLSA 2O4CA 1V11B 4QUDA 5GTHZ 1XEQA 2R7KA 1VJTA 2NUPA 4PAWA 4B5KA 3K3PA 3VVMA 4BATA 3DZHA 4CHTA 2P2SA 2OAGA 2AQ8A 4JAAA 3W8RA 4URYR 3VR2A 4UOEA 2EG5A 1UEJA 3FNBA 1G8GA 1ZHHA 2DYSB 2Q5EA 4B4WA 2QAGB 5GV7A 3PWZA 4O2RA 3C43A 5ALDA 3G23A 4L50A 2O0MA 2WA1A 1QCEA 1JLLB 4EKYA 3F3SA 2VPZA 3F6EX 5A3SA 1K8RA 4O5OA 4O29A 3IEIA 4IF4A 3KEFA 1TCBA 4HDAA 4Q7KA 3LXRA 5DO9A 5P21A 1GGVA 4CEIA 3DW3X 2Z9DA 2AFIA 4WF9V 2C7PA 1VJGA 3NAGA 4G07A 1O95A 4CKWA 2QYSA 1Z4MA 1R10A 2CL5A 1F4MA 3JPWA 2COUA 1LW6E 1FVOA 2B8WA 3PSHA 4GM1A 2QLFA 1FFHA 4JA2A 2A1UA 3PNVA 1Z2EA 4LYFA 1NRJB 1QFSA 4H0FA 4M9ZA 4N6NA 1KAGA 3UTCA 4X9QA 2IYVA 4HDKB 5IYZB 1NU6A 2HIAA 5GP1A 3ASOB 1U7XA 2G7ZA 1LW7A 1POWA 2IVFA 3P5BA 4JB8A 4K3AA 5JZOA 3EIQA 3MPUA 1I10A 5CVDA 4HRYA 3ZNPA 1DBFA 4JYYA 1BE3H 4QDZA 3OQVA 4A2QA 3WGUA 4P2ZA 3WGJA 2HXGA 3U60B 3S27A 1DBPA 5E6SB 3VH4A 1J9ZA 1DMSA 4IF6A 2ZT5A 2W6IA 5T4BA 4GPZA 3R0JA 1EBOA 2I7TA 3ODGA 1OWOA 4DNPA 3U6KA 2ZZMA 2IV2X 2FN3A 2Y8EA 2IUUA 1YDGA 2CDBA 4G4XA 3TR5A 1C1HA 3FB1A 2N9UA 3Q9LA 4MAAA 2WIGA 2YI8A 4F6EA 2FKXA 1DKMA 3D8SA 1QH8A 1E9BA 1H2MA 2XDQB 1H38A 1N9KA 2P68A 1GPKA 3FVVA 3BMXA 4R54A 2O7VA 2DHRA 1QR6A 3OH8A 1XKTA 3NV9A 1RZ3A 2IIQA 5AW6A 5KHJA 3GI1A 4X84A 4IYHA 3IT0A 1KORA 1PLJA 3G80A 3VDXA 3FR7A 2IJKA 2WJ6A 4AY2A 1XA3A 3VC3A 4QJ5A 2AOUA 1GUZA 1SKMA 3LDDA 2UUBB 4BVJA 2PH7A 5C4GB 3NBKA 1JQ3A 1M90W 3L0DA 2GJKA 3TD4A 4RZ3A 3L9DA 4AZWA 1J2RA 3RFRA 5DV9A 3EASA 3MW8A 4WKCA 2AXEA 3CRVA 1BHBA 3UC9A 1TJ4A 2BGUA 2HYIC 3RU9A 3S5JA 3CNNA 1KWGA 2MW2B 1CCWA 1QH1A 2D0IA 2VBIA 5CDYA 1NTZH 2G40A 3O8NA 4CL3A 3CCMV 4PXSA 4I6GA 3DUWA 1PLKA 1P0IA 5BWLA 5FI1B 1AQJA 5HZKA 3ROQA 3IUYA 2Q3BA 2XUFA 4PLVA 4DYLA 5IVKA 1NE7A 4PYIA 5EC8A 3MSCA 1KDVA 1U8UA 1O6GA 2RJNA 3TOVA 3JX9A 2XNSA 4KGXA 1KMCA 4UBOA 2Z4RA 2R8PA 5J40A 4YMHA 3LIIA 1DMRA 1NUUA 4HB2A 4J0KA 2DJ5A 4PBRA 5KTYA 4RH0A 2FK7A 5CG1A 1W57A 1GRRA 2J0VA 4P9NA 4LQ4A 2ISQA 1WQ4A 1NI5A 4Q5IA 2VF4X 2IL1A 3FZQA 1HZZA 4KBFA 1JTFA 1ZHOA 5LD2B 1QU2A 1CY6A 3EXHB 5HK8A 4OK6A 1Z5NA 2ZAOA 3KVRA 1OYVA 5B1EA 3GGCA 2V7WA 1E1QD 4LFBB 1ZIPA 3GQVA 3L93A 3PD1A 4EGAA 3KZVA 4E4EA 4LMPA 3TG8A 3FUUA 3SX4A 2UXCO 3F3MA 1I80A 3VJLA 3I23A 4QTUB 2W2LD 1T3GA 3FNGA 4PAOA 1EFTA 3VMMA 1P81A 5I47A 3LQ1A 1YBMA 2B20A 4OU5A 3Q7PA 4U7TB 4X1KA 1UKYA 4IBOA 1BA2A 1OKKD 4ZRNA 3ZMZA 2HX0A 1YZYA 2XQGA 1RQNA 1P5JA 1M1YB 4RVSA 1BZKA 2PT5A 1LQTA 3P0EA 2NN4A 1AF7A 1X8JA 2FLKA 5GOTA 3D01A 5FA6A 3BHPA 4HUJA 1M1UA 5FQOA 3KSRA 4JC5A 5KU1A 2WKWA 3LKZA 3ZCTA 1YF3A 1RC8A 4G0OA 3HK2A 3RBVA 4WW0A 2BEVA 3LH5A 3GLIB 5DIFA 3WO1A 1JX9A 3DVRX 1E1RA 1A2QA 3V1TC 2O0HA 2R8RA 4DR2O 3C8LA 3MFQA 4W9MC 4PYQA 3DB1A 3CUEF 1TF2A 2Q7DA 4CIYA 2BT4A 3CBQA 2HPVA 1XHZA 4ZCTA 2CXPA 1JTEA 5FRDA 1K5PA 4M1TA 1BX0A 1E32A 2OORA 2CLLB 1T5OA 2PN1A 5CGZA 1CUSA 3KFLA 5FIUA 2VHEA 3HVRA 2OZBA 3J7AR 1PZXA 3LZ6A 2NGRA 3NVDA 3ZRXA 1FZQA 1BJKA 2ODWA 3PGJA 4C0QC 2ZAYA 4XFJA 5FR1A 1MPTA 5AJWA 2WIAA 3R4VA 2II6A 2YWDA 1YT5A 2OBXA 2PUGA 4FZ3A 4UPVA 4DV7B 4EI7A 3TQHA 1FQKA 4IVPA 5B2FA 4HNTA 1VHQA 3ZU2A 1R6NA 2X0NA 4DZTA 4YUXA 2JNWA 2X9LA 3RDPA 3ELCA 4TZ0A 3W3AA 3C2QA 4HGOA 2AJDA 3IC7A 7ABPA 3LPMA 3TLMA 1PT6A 2TECE 5KOJB 4LF8B 4RPJA 4JZYA 3SP1A 1IBLO 2QVXX 3K9SA 2IT1A 1O4WA 4B85A 4IJ5A 4BNLA 3IQFA 4LQCA 2WB4A 1OFUX 1I0IA 2BCJQ 3FPHA 2FMHA 5AVRA 1OILA 3PXGA 1PJTA 1CX9B 3IPYA 1E59A 4PM4A 5HXAA 3TZ6A 4K9RA 1NNI1 1AA6A 3WI7A 3KSMA 4C3VA 1T25A 3LUPA 2PX6A 1TU0A 1N33B 3F3YA 3RAJA 1I33A 3JQRA 3TKLA 5C4MA 5EBLC 3UKJA 3S2ZA 1GAEO 3RD5A 2Q4DA 1HEYA 3SYTA 2XZPA 1N32O 4DMGA 5TQ2A 2NZWA 3U4QB 3L7JA 1RVV1 4MUFA 4AF8A 4ERXA 2OUIA 1T3LA 4UB8Z 4P38A 2OKGA 3HFRA 3PNPA 2F7SA 1U81A 3RLIA 1T3HA 4F0JA 4KUMA 1DRKA 3RTGA 4MW9A 5JR3A 1OAAA 2ZVZA 3KVOA 4L5AA 2XXAA 1OLSA 2J0SA 1V5FA 2HH9A 2HLPA 4RJIA 3GR6A 4LZOA 4A0SA 1FXSA 1A5TA 4KPEC 4Z51A 3OJWA 2WWFA 2GLTA 5JC1A 4RESA 3O8OA 1LUWA 4MIYA 1KI6B 3W5AA 2FRDA 1PJAA 1UM9A 3OTIA 2ZZKA 1HDEA 3KHKA 4PFQA 3ND5A 2QN3A 4NLLA 2PUEA 3VQYA 3WRWA 4HYEA 3U39A 1SAYA 4I9FA 2J3DA 4H7HA 1ML3A 3VH2A 1P3DA 3JPYA 4L95C 1S2OA 3OQOA 4IDEA 2F3UA 3FNEA 1BD4A 1OX5A 3J80N 3PC3A 4RUFA 3G2HA 4UXNA 1QB7A 4L76A 5BY1A 2MYPA 5KMGA 2GN4A 5EJ4A 3I2FA 3Q98A 2XE6A 4K6KA 3KOXA 1E0AA 4YY3O 1NYLA 4BVLA 4K88A 3D43A 2JGKA 4Y9RA 2Q5QA 4UUMA 2ZI9A 4PSDA 4TYWA 3JVVA 3MUOA 1E7QA 1F9EA 1Y3CE 5C81A 4GICA 1G66A 4BZQA 1QGYA 2ET6A 1ESDA 4G0XA 3W06A 4WE3A 3HGQA 3T3OA 3I4LA 2GFHA 1HORA 1BWPA 5ILGA 3L0OA 1JPXA 3GEHA 3IAFA 4JI6O 1ISFA 1IBMB 1E2JA 3EMVA 3I2JA 4AF7A 2VSQA 1QIEA 2QSYA 5EYPB 1TQ6A 3HWUA 1B8UA 4M9QA 3I55V 5KSZA 1OGIA 2PUSA 3C3CA 4JLAA 1E1LA 3GD5A 3SJZA 3ZWWA 1V96A 1W3EX 1SIBE 2ZI4A 4ZJUA 4B40A 2BELA 4QJBA 5HRCA 1NAIA 1QK5A 4TKMA 4OJMX 4P54A 3QEAZ 4QU9A 3T1OA 2OZLA 5SY4A 1W581 2JK0A 1AKNA 3FNFA 4LZWA 4F45A 1PR6A 4Y6RA 2HJSA 1Z6GA 2XRFA 1NLZA 3NYIA 3DMTC 2ORVA 1FP4B 1T1IA 1JWAB 3IAHA 5TF0A 5KDLA 3OF2A 2WUWE 3R0PA 1K63A 1Y9ZA 3PU6A 1TLFA 2VOJA 3UK0A 1GP2A 4D5GA 4HN9A 5GGYA 2EDCA 2JVIA 1DELA 2C77A 5EP4A 3P5SA 3WDLA 2G4LA 4FZ0A 5CLQA 5AJYA 4TKLA 3UBMA 1NY5A 3MC1A 4LI0A 4KWCA 5A3RA 2JW5A 4WZBB 3TG2A 2VSNA 1NI4A 3MILA 4C5CA 1Y80A 2CB9A 4ADSG 4UNQA 2F67A 1VF6C 1TT5B 3K6KA 4GWLA 1JJBA 4PYRA 4UMEA 1FPOA 1SH7A 1B0PA 4UD6A 3GWKC 4YT4A 4Y6LA 2B83A 3O2NA 5K99A 4QPKA 3FA2A 4C81A 5CA1B 2RQ6A 4XFKA 2GEVA 4HS9A 4AS2A 3KQOA 3G2OA 2IM9A 4DEXA 2GEUA 5H59A 4PNZA 4GYCB 1FFXA 4M1YA 3E6AA 1HNXO 3I2KA 3WL6A 1QYRA 2F1KA 1VDZA 1PZFA 4N1AA 3RFUA 4RADA 3FNIA 2O0KA 1WTCA 3HB9A 4LNUB 5BW5A 1WD7A 4XDHA 1UK9A 1T5LA 2H59A 5I7AA 5H16A 4MPDA 2GI4A 4CKCA 4CG3A 1EQAA 4R9VA 1IZ8A 3A6HA 3M82A 3K9NA 1QAMA 2WD7B 2C0QA 4QXQA 1SXPA 3JQDA 2H1FA 3R9KA 4RVDA 3WJAA 1GCAA 2AN9A 1U0TA 3ENZA 3RSSA 1CQXA 4KGZA 1ZD8A 3GEIA 3O21A 3AERB 1T29A 2ZNIA 3OM3B 4OG2A 3A4NA 3NNNA 4JL8A 3GZNB 3E7DA 1IN1A 4HTFA 1XDGA 2NXNA 3SMQA 2ZRLA 3ZWVA 2XUAA 2WZCA 2X6TA 1IPEA 2IY7A 3LPCA 3VYUC 4K6FA 1Z18A 4W5JA 4XUGB 5DIZA 2EF1A 2QTVB 2J8ZA 1P45A 3D4IA 4YAIA 5E79Z 3EDMA 2ZB2A 5CH5A 2QA5A 3D2AA 4P32A 4Z4CA 1UMCB 1U9JA 2XAGA 4YRGA 1PR4A 2PUDA 1UPBA 2Q3HA 2WPDG 2GO1A 4QBGB 2QAJA 4FM1A 3O4RA 3G0GA 2PZEA 2O9JA 4CIVA 1ZL8A 1D2DA 4JBNA 1FUEA 1NPYA 4D2IA 1XZBA 4YEDA 4GGPA 1E9RA 3W6PA 4KQMA 2YBEA 5LQMA 1GNTA 3JARB 4G1MB 1CJTC 2DJVA 3NI2A 2QN6A 2ZU0C 1IRXA 4S1WA 1NC3A 1SRQA 4XYLA 5B4TA 4LVOA 4COOA 3RC1A 2XCIA 3MTEA 1DGQA 4RVFA 5BVGA 3JQ9C 1HE3A 2ADMA 3V7EA 3H2JA 2DMRA 3DFIA 2NT3A 3TCXB 3OZVA 1XL0A 5KNCA 1GPNA 2E3JA 3DMGA 1VE1A 2X4LA 4HSEA 4HS4A 2FUG1 1VH8A 3D2CA 1Z17A 3HBAA 3C3PA 3PWSA 5ED4A 5ALJA 4ZEVA 4EM6A 1YS9A 3T7DA 1J9GA 3ZTYA 5REQA 3FYUB 3LDGA 4MEAA 4FT4A 3BRWD 2PDAA 3VAAA 4WLNA 1P2GA 1GO1A 4AKSA 4YJDA 2P6PA 2UXBB 3KQLA 2Q9AA 3NBXX 3GJXC 4JUAA 4YAOA 1H4QA 1ORTA 5A3QA 5D3ZA 2G5CA 1YJNF 1XMIA 1F1BA 4DLTA 4XJVA 2ZI5A 5L40A 1YNSA 3ZWBA 1WXEA 3N5CA 5D3MA 3I8XA 3ZS8C 3LT5A 2LWIA 1V8PA 1IATA 4C0WA 1CEXA 4RA6A 3PPXA 5GY7A 2OQRA 5DSTA 5DLPA 3VNQA 3L5KA 3N2KA 2NTNA 4Y1RB 3TKAA 2YHSA 3WVNA 1P2DA 4RA9A 1JYSA 2G8NA 4M0LA 4BKOA 1E66A 1BS2A 4IOLA 5JRZA 2OGZA 3STHA 4C7BA 4M86A 3H1HH 3F6SA 4WJKB 1CS4C 5CVEA 5MN6A 2OMEA 4RPGA 1GYRA 2KG4A 1RBMA 2HKOA 2PWYA 1M1XB 3A4LA 5JSKA 1RAEA 4C22A 3MTGA 4PNEA 1T6XA 4HCJA 2AMJA 1GEGA 4CIWA 3DYIA 3LX5A 2WV7A 2GVNA 4XTCS 1RHMA 1RRKA 3ZNQA 1G8KA 2BKXA 1FFGA 5KWSA 4A6DA 4MDYA 1ORWA 4JH0A 1DQYA 3F74A 4EJSB 4U2DA 5LU8A 3I56F 5F2EA 4NCBA 4L5IA 5DHPA 5K01A 4ZQHA 1HMPA 9ABPA 1KF0A 2L6LA 1I1NA 1RTKA 3V1NA 5EL0A 2UXNA 1P33A 3DUFB 1W1IA 1U3DA 3HBFA 2R8BA 4QUEA 4G5HA 4B9EA 1VQ8V 3E3OA 2IZ7A 3UM9A 2EX0A 1C8KA 1ZHFA 1X42A 3ZBQA 4QU0A 2KSDA 1DT3A 4MVWA 1J9EA 4KBYA 2X7XA 3G88A 2JLBA 4OYYA 2QW0X 4Q3EA 1M8KA 1NF8A 1VMGA 2LRHA 3T38A 5EESA 3PGVA 2BFBA 4ILKA 3DBLB 3ZCUA 2BUAA 1EAYA 1V45E 2YHIB 4QU5A 2WT9A 1WA5A 2O8CA 1ZRHA 5CCDA 2WSSD 4P0QB 2JFBA 2AHOA 1Y82A 1IZ7A 2C58A 2B7LA 1GK9A 4HYOA 2Y0IA 5CFNA 4FI3C 3EGDA 3WLRA 3K16A 3NANA 4NU5A 1FFBA 2L19A 1W4AA 1Z5ZA 2XZLA 3Q3EA 3K09C 1I2CA 4EPTA 1Z07A 1G8MA 4LCBA 1Z4IA 2IHUA 4XRGA 3S2UA 5K2MA 4HJXA 2Q9CA 3LCVB 3JQ7B 1ZD4A 2BFOA 4Q0MA 3HWX1 4F56A 1FYDA 4B8WA 3IJPA 4F4UA 4HNVA 1DRWA 5A2QA 5IBRA 1K6JA 3Q8HA 5KU7A 3RLFA 3AUTA 1QKIA 4MUMA 4YPFA 5A6SB 5SYAA 5AVKA 5IP5A 2Q0HA 2E21A 5HOEA 2RN9A 1JE0A 5ITSA 1N2OA 2JFXA 2CZCA 1ZZGA 1NRXA 3D0RA 3CF6R 2NUBA 4S0ZA 3K0HA 1N1EA 2G6TA 3F9CA 4GVXA 3DH0A 5AJUA 1CYEA 3A10A 1J20A 4HWSA 4NRDA 5EIAA 2PYJA 4B82A 1Z8DA 4NDZA 2AC7A 4UVGA 5EUBA 4OQDA 3WS7A 5TJHA 5CVTA 2REQA 2ZTVA 3BZUA 4HBNA 1A1SA 3BJMA 3FB5C 3K4HA 2EARA 4TL9A 3OTFA 1MRZA 1ZICA 4LP8A 4ZBMA 1QBKC 2H0AA 3ND7A 3WGMA 1KMHB 4E3WA 4BNHA 2YJTD 3QIAA 3ZEDA 1NIJA 5JSZA 1GV0A 4FMDB 1VA4A 2QN9A 1CVIA 2IF0A 1X25A 3I4CA 5L3ZA 1U8EA 4E31A 1JR3D 2TSYB 3MINB 2ZYUX 1S2NA 3PVSA 1ZOSA 3HFGA 2J7PA 5BNWA 2VJDA 4BNDA 1N2EA 1W36C 2PAFA 1SB9A 2R1UA 2B6HA 1UEIA 3B82A 3I5XA 2C2KA 3C3SA 4MEJA 5ALWA 1T9KA 1XI2A 1Z35A 3FDFA 3ZCRA 2PUHA 3WLOA 4WUVA 3LBAA 3GHYA 5ESDA 3HSSA 3TL3A 1G16A 5ALFA 5H68A 2DTXA 1F2UA 5TF4A 1DFHA 4N3AA 3ZVMA 2Q5CA 2FSVA 4PC3A 1PBTA 4P2BA 3W6UA 2QMQA 1SC3A 3RNOA 2CNKA 4ZYZA 2YMMA 3ZRWA 2EJTA 3RIXA 3HJWC 1L1FA 4JV5O 2XUQA 2X15A 3NOVA 4EO9A 3U9SA 2R8XA 2ESRA 2JCVA 2KJQA 1O1YA 1KE1A 1X74A 2CNNA 1PWEA 1B6GA 3M6VA 3FWPA 1WUYA 1PBNA 5H80A 2EERA 4YDHB 3KOUA 4FI3F 5HSGA 3F0TA 4E22A 1Y74B 4JJIA 4KR6A 4AZ0A 1GZSA 1YBVA 1BH6A 1N8SA 4OHPA 2WEKA 4XIGS 1P77A 1VLVA 2Q5FA 3DC6A 4UBJA 3MWKA 1G0OA 1T5DX 4LDAA 2NX2A 1DLBA 5DK4A 2C5LA 4D9EA 4KH0A 2EIHA 4B74A 2W2KA 1JXQA 3I8OA 1TEHA 4DW1A 4ZT2A 3ORHA 3CC7V 3T4DA 1B8OA 4X7BA 4DSTA 1VMKA 1LKZA 1ENYA 3T1CA 3RWOA 3GLRA 1FK8A 4NTZA 3ACDA 5BSEA 3ITNA 4IMIB 3GZJA 1SQXH 4QJ4A 5KAPA 4QNRA 1GA4A 5JU6A 4RVHA 3C3DA 3JWJA 3TZHA 3MA0A 1FQOA 4X8HA 3APOA 4D46A 3FTFA 3GRAA 2XTNA 3C9UA 4U3JA 4YIOA 1V71A 3ANNA 3IBCA 4TROA 3JRWA 1FMTA 1MQ9A 1T9GR 4FOOA 4IRXA 2XCUA 1DCTA 1I9CA 1T0BA 4Y67A 2XGJA 5E8JA 1E96A 4BNFA 3EX7C 3VPBA 4H9GA 1E3WB 3J81M 2Z5UA 2I2BA 4KLCA 1T8PA 3SEFA 4URWR 3K8ZA 4E6PA 1ENPA 2A88A 3D4PA 3CCUV 2AR7A 1PL0A 3V3TA 1YRWA 4GVPA 3U3ZA 1SIWA 5DU2A 5ADWA 5LMCA 3AL2A 3BH0A 1Y66A 1QYVA 3A2MA 4WADA 3ZVKA 1MB3A 3HMKA 1V1MB 5DT9A 3QE9Y 1BOOA 1INLA 5LMZA 4LXQA 1M1YE 2N47A 1HFWA 3STTA 1NTOA 4GKVA 1RDFA 2Q2QA 4IO1A 4ZCMA 3KHNA 1NOIA 5KHHA 1G20B 2A57A 3FUWA 4L6IA 3IIJA 3VX4A 1MSDA 1NTMH 1FFEA 4PZYA 4ND3A 2PUWA 1L5LA 3DM5A 4Q3CA 5FF9A 4UNRA 5HZMA 3CYQA 1RLTA 1F2TB 5ILOA 3HWSA 2GPSA 4OXSA 2EJBA 4CWAA 2J5BA 5IANA 4LJAA 2GOYA 1BD3A 5DN6G 2YDXA 3MLAA 1ZS9A 1QTNA 1U63A 1IIBA 4QFBA 1M6VA 3OT5A 1SUAA 3LYAA 3UWKA 2J1LA 4EO7A 3ANMA 2ID8A 3VDMA 2V7XA 3E2EA 1O94D 2V3VA 1P31A 1Q12A 3IOCA 2Y1LA 5F77A 1JQ0A 3GDOA 2VEOA 3DPIA 4JBWA 2VWGA 1P3Y1 5DI3A 1DOAA 4E14A 3KXIA 4ZU6X 2WIBA 3INYA 4TWRA 1EIWA 2V7GA 3VU9B 3TRIA 4BVKA 3RKUA 4GYKA 4E09A 4RK0A 4OVKA 4LV8B 1JTVA 3T7EA 1CE8B 2V6FA 2VWQA 4Z8YA 4U9HS 4BQRA 1QQAA 2C82A 1IDSA 4OKNA 1JY8A 1WMBA 1PQUA 4ZVVA 1YI2F 4IJKA 5ENZA 3H9EO 2QY6A 2HGSA 3L8DA 1NMEA 4DV2B 3ZHQA 1RCTE 4R81A 3HHPA 5L3QA 1U0HC 4URUR 4LY0A 2OCKA 1BT8A 2PLNA 1LK7A 1ZYUA 3D0QA 2C1ZA 1FRNA 2FZWA 3PXCX 1KU0A 3VSDA 1S89A 1RPJA 4MVJF 4EPYA 3BMOA 3NOOA 5G0WA 4MSWC 5EZYB 1XNHA 5B1BC 3AEYA 1X86B 4KYVA 3BXEA 3PUHA 1WEHA 3K0CA 4IGEA 4Q4HB 1ZUNA 4BO3A 4M55A 3D1VA 2HWYA 5LOVB 5HBRA 1XYGA 5EUQB 4F3KA 1I32A 4KPGA 2ZW9A 3F7OA 4LCJA 1WEKA 1SZCA 2VDPB 5EFOA 4MPJA 4NYJQ 3WLHA 3R9XB 2P8JA 4WCEV 3TSOA 4TT8A 3P2JA 2OG2A 1X9IA 3L8EA 5AXDA 1EK5A 1PYDA 4RLFA 1U7DA 1KNXA 4ZVUA 1ZQ1A 4D0GA 1SUPA 4HATA 4WK0B 1XEWX 5KYKA 3DOFA 2R62A 1M8FA 4JOCA 1N8NA 4OH7A 5CEFA 4LDQA 3GH1A 3HV0A 3HA3A 1DJPA 2VH5R 3ZWQA 2P2GA 3IT3A 3PZBA 1V54C 1NUAA 3GEEA 1FXWF 1U02A 1E8MA 4IFEA 3B5IA 3IEMA 1R4ZA 4P80A 3AR4A 4GOND 3H65A 4F71A 3R3WA 2RDCA 2I34A 1E2BA 2NZYA 7ADHA 3RBAA 4XCQA 1NVUQ 3AV0B 2PR7A 4V0KA 2BH2A 1GG8A 5LP6A 3OG9A 1Y8RA 2Q28A 3VU0A 1WXHA 3NYQA 1T0IA 4GSKA 3LP6A 4CC5A 2VHXA 1N75A 1EDDA 4Y1GA 5ESXA 4Z4IA 5LFAA 4ZZ3A 5BOSB 3UJCA 2YN4A 5IMSA 4GR4A 4ANFA 3FTEA 2OHHA 2FETA 1GT6A 2D0DA 1MX3A 4PA3A 4JT4A 3OUSA 1QHHA 5GONB 4J94A 2ONJA 4OHXA 2YIJA 3PXAA 3L4EA 3OT1B 1N1DA 1M93A 1Q82W 2D3WA 1VRWA 3MG9A 3HCFA 2OXEA 2UVDA 3V8QA 3PYMA 3N8NA 3PXUA 2QD4A 1H4TA 4FM0A 1XZEA 1EXVA 1K98A 1N2JA 3DO5A 4JI8O 4DEYA 3OPXA 2HWWA 4ZVMA 2ACVA 4AHCA 1UDAA 2EWMA 3U3OA 3VJKA 2PO5A 5BV2P 1SVSA 4DY4A 2PXCA 3AVTA 1WCIA 3ZHOA 2CLFB 1CG6A 3GVPA 1FSGA 1PFYA 3RU3A 5CCEA 4TSFG 3PR1A 4DV5B 4K40A 4B81A 3OEED 2PSEA 4FHGA 4K6HA 4R1MA 4B73A 1JR3E 3BTUA 1M75A 4H31A 5E1OA 4WOPA 1QGED 3UG7A 4DUZO 2M32A 4DMLA 4YACA 5HY1A 2I0FA 4WCVA 2ZXWB 5AIAA 3REQB 3F4LA 2J9FA 3ER8A 1N77A 4GM4A 4DBZA 2WA2A 2FQWA 5B1AC 1E1DA 4RGYA 4GC5A 4AURA 3TJMA 1RC1A 1R16A 1V48A 2P91A 2PUAA 4OL9A 2XQFA 2V1DA 2ZSEA 1IK6A 2RMKA 2BUBA 2J41A 2LGQA 4RKQA 1GDDA 5G1PA 4PG7A 4OLHA 4ND5A 1JHZA 3HABA 3QLTA 1WKBA 3R0IA 4AYXA 4H7EA 3FVRA 5CFZA 4XAQA 3SPCA 2R96A 5IF9A 4DW0A 1MJFA 2I3BA 4AX4A 2AJ8A 4FZRA 1GKLA 5HTOA 3K5HA 4WN9B 3DZIA 5DCVA 2JFWA 5FJIA 1LTHR 4BUZA 4WZBE 4IDFA 2SBTA 1IHYA 3AFNA 3MJSA 4KO4S 4DCSA 3LT4A 3ZDRA 3OQMA 2R00C 5TGDA 1CQJB 2GRAA 3P9KA 1NU1H 3KPVA 5KTKA 5ITVA 4JU8A 4QPNA 4OPMA 2PS3A 2CZWA 1IHOA 3F71A 3EDCA 5FT9A 2EVWX 2JEOA 5SV2A 1Z12A 4K9LA 4QG7A 4AO7A 3AFHA 3O1IC 4A91A 1MU0A 2JFGA 2OBNA 5IBQA 3LOPA 3LLCA 3OY7A 5FL3A 4KLNA 3TLBA 4HN2A 4MS1A 5MN4A 1HDGO 5ESRA 4KJZA 5SZIA 4W5WA 3CF0A 3WGHA 3FUCA 3PC2A 2DQ4A 3IAS1 1VQPV 5FBZA 1R3IC 3S8YA 3GRYA 3R76A 3W2EA 5LQRA 2PLFA 5TPZA 4MKGA 3SZUA 1UKCA 1NQWA 5CJJA 2A84A 4YIPA 1JIQA 2FQXA 3O93A 2EZOA 3AM4A 5AHXA 4GP7A 3GGOA 4ARZA 3BXOA 1FP6A 2Q07A 1ZG3A 1WZIA 2WSLA 1CU1A 5IMBA 3ROEA 1FU4A 1GSOA 2VA8A 1BOFA 1HLFA 2I3GA 1KE2A 2UYNB 1AHIA 2R66A 1GPBA 2GCPA 4PBSA 3TZEA 4DIDA 4YCAA 2R0QC 4PJ0Z 2IP1A 2ZYWX 3P45A 3EFFK 4EG8A 3EY9A 1U7OA 2G04A 1DX4A 5CRIA 3IQHX 4I5GA 2BGIA 3ROXA 2PFSA 2H2IA 3CUTA 3GUZA 5LXTF 3VR0A 2VR1A 4HH0A 1GL3A 4C3OB 4MGEA 2GBOA 2HC9A 2QA4F 2BR3A 4BJ3A 4GXRA 5DCUA 4MR7B 3W3AH 4DARA 3TH5A 4K9NA 3IEVA 5GINC 4RO0A 3BRCA 2AMLA 3WX0A 1GQQA 1PTJC 3ICPA 1XZPA 5DK6A 2OAP1 5K0BA 3VPAA 4M88A 5KVSA 2B4KA 2VTKA 3S7TA 3AU8A 1FLVA 3CZQA 2RGWA 2ZI6A 3CE2A 3PFGA 1BVUA 2JIZG 2F1OA 1JSCA 2WIKA 3H01A 3HO8A 1MVOA 2VA9A 3VMFB 2Q6LA 5CN0A 2HQBA 4M8LA 3N07A 4LSZA 2ZTSA 4X1YA 5AW9A 4FR5A 4IZ6A 1ZH8A 5CW1A 3TECE 1IPHA 2FQ1A 2J5KA 3CEHA 3K96A 4INPA 2COEA 3BIJA 4BVEA 2QZPA 1CTQA 3PVCA 3EPHA 4IHJF 4G09A 4R41A 1LPMA 1DCFA 2ZRKA 3L6DA 4LJSA 5J1SB 4Y2QA 2GNAA 1VG1A 2QN2A 4QQKA 4V3BA 4X6UA 3TQFA 1MXFA 4ZFNA 1K8AW 4NAHA 2RGDA 1SXJA 5IKMA 1N2CE 4G01B 2AEMA 1TYZA 1CF4A 2PEZA 4GYJA 3AHHA 4CTOA 2CY0A 4KFCA 4KREA 2BFDA 2P7HA 3NASA 4RMGA 3MBKA 5DNCA 4MKFA 4FBLA 4RKRA 4J0CA 3A9WA 1WMAA 2ZM6O 1RKBA 2JAUA 4V0SA 5JE8A 3BOSA 5D86A 1P7YA 4KBGA 1UAYA 3N0WA 2EFCB 3IAYA 4AB1A 4BFLA 3MM4A 4OM8A 2ZINA 1Y8ZA 3WBKA 3U44B 3VYSB 1JYEA 1UBRS 3F8TA 2QIOA 2HA0A 2PRSA 2XYQA 1L5RA 3TLAA 1JQAA 1IHXA 1SBZA 1NDHA 2C31A 4DJJA 4BMOB 1JJOA 3K0GA 4ODIA 1S3IA 4B2PA 3JATA 2YVUA 1WIWA 1TQ8A 3M81A 1HNWB 2QSJA 2R6DA 3CURA 4BNZA 2F55A 4ZJYA 4N6GA 3NXSA 4ONEA 1MNAA 4HP8A 2BE3A 2DN9A 3I04M 3CT4A 2CNBA 3V2IA 4LBEC 1DIOB 4I1VA 4FDTA 1ADCA 3MTBA 3MB5A 3LP5A 4IFTA 1UKBA 4YJKA 2E89A 3SIWA 1GITA 1AS2A 3D9QX 4NH4A 1TD9A 5AJZA 3UMFA 1I7LA 3H4VA 4QPDA 2R9AA 3GK3A 5EQFA 2JATA 3R75A 2UAGA 4EFLA 2J3IA 3HUEA 1ZGAA 2HSGA 2W70A 3OZEA 4JI0O 2WWRA 3K92A 3L7LA 3R3UA 2WC1A 3REFA 1KYXA 4TWKA 2NMVA 1ZU5A 4AKTA 1BW9A 3GNSA 3PQ6A 2O6HA 1NH2B 5AHRA 3JALB 1Z6XA 2JZOA 4KRXA 1YUMA 5B7PA 1L7EA 2FSSA 1PP9H 2ALEA 4NULA 3M8KA 3T5PA 5FO1A 1WKVA 1ZUD1 2Q69A 4ZZ1A 1KI4A 1Q7YH 5BUQA 5IX8A 1QQ5A 1XAHA 2IXDA 2HNBA 1F7YA 2J9YB 1U5BA 4IOJA 2RAUA 3VR6A 4F9FA 3TUZC 5KNBD 1KDOA 2AHRA 1Z15A 4HAVA 4E08A 1N0WA 1MZVA 1COWD 4FN4A 3USZA 4ZAVA 5IXJA 3CCJF 3A11A 3ISTA 2ZB8A 3L01A 3AG7A 3V7QA 2PWZA 5EQDA 3QYAA 4ARBA 5JZVA 4CHGA 1OBCA 3SQNA 2RHLA 4YT5A 2V7QD 1SOAA 1EFPB 3U40A 1PNOA 3UC5A 4WAUA 3CEMA 4TMFA 4L9WA 2AXPA 2CNWD 3EUAA 3FF1A 4EVSA 1DG3A 3RA5A 4KLAA 5AVQA 3L4JA 4B6OA 3LWQC 2NSJA 3E9MA 2NPIA 4NYIR 2J9ZB 3H5RA 1OPXA 3AEQA 3IQEA 3WDSA 1HT2E 3PNOA 3ZQKA 2A06H 1KY5A 2H7XA 3H2YA 2FPIA 4EPWA 5AI8A 3WNCA 1RD4A 1CYDA 3OE7D 3QLVC 3ROPA 3ESJA 1BFKA 1K6XA 4YALA 4PGHA 4QYIB 1VRCA 4DCUA 4MV1A 1ATZA 2PKEA 2QEXV 2O48X 2HEGA 3JQGA 2NV2B 3OTOO 1D6NA 2AJLI 3FWNA 1YVWA 3GT3A 2JHFA 2TYSB 1K4KA 1QZXA 4A82A 3W7VA 3PZRA 4Y2UA 1A96A 3T7CA 1KOJA 4JLMA 3OCCA 3WIOA 1EM8A 4YDRA 3AG2C 4GX0A 1AK2A 4LECA 1KBHA 1Z37A 1DIBA 4DRXB 1S72V 4YA6A 4AZTA 3MS7A 4K1XA 1XMOO 3GXOA 4I55A 3T06B 5F3RA 4ZVSA 2IH4A 3O8QB 1KWKA 2ZJZA 2Y1EA 2I55A 4ZOLB 2HLDG 2IOQA 2E2WA 2B30A 2PL9A 1M2VA 3I2YX 5TDHA 2DSNA 4UCRA 1VQ5V 1M2WA 3COSA 4HPXB 2C8KA 5H9CA 2VPYA 4KP7A 1E1QG 1S3FA 2W8BB 4JYPA 2VF2A 1ZA2A 3IJRA 2ADFA 1LLDA 4X60A 4KJXA 4KI0A 3AL3A 2WLIA 2I4NA 3SJBC 2OT5A 4F3CA 1IV1A 4DIEA 1GM7A 1T2AA 3TMYA 3QXCA 3VKGA 3K9HA 2P4UA 1X94A 4YCDA 4OQXA 3CB2A 1DKOA 3CJTA 1TUGA 2IJGX 4GYYA 1LXCA 2R48A 2IE0A 4KXYA 4UVHA 4ZI7A 3DNMA 3D3EA 1KH2A 1K5QA 1UINA 4EPRA 4QDOA 2WPNA 3SHTA 4MHTA 2WUGA 4RWUA 5CUQA 3L02A 1YFZA 1YQGA 5IJAA 1SVMA 3IV6A 4M3NA 4TTJA 3H4IA 2JBHA 3FOAA 4MR9A 3E22B 2OC4A 3EGOA 1AVMA 3LF1A 3RTCA 3DJFA 1D04A 3HA5A 3D7KA 1UFKA 2VDWB 4L7QA 1G8SA 3RK4A 2BOVA 2Q5JA 2YXNA 5GVSA 5ICSA 1BCCH 4L5YA 4XYEA 4MWZA 2NVUA 4BT5A 3PJGA 3O5AA 2JASA 4MMZB 1PL8A 1YMUA 2D5AA 5FTNA 5TGZA 4IDAA 5A02A 2GK7A 3GEGA 5AKIA 3WB9A 3GLFB 3LY9A 3AL0C 2C8LA 3QTBA 3RIYA 4FLFA 5AO9A 3FPBA 3W4IA 3D2BA 1CB7A 4QPZA 4EUHA 3SPXA 5HG0A 2VAMA 3DBHB 1PL4A 3QPDA 3F0FA 4QEZA 2R6HA 3H5TA 3O9ZA 4HY3A 2QGNA 2IHYA 4O4HA 4IIDA 4JYAB 1KS2A 3DV2A 3W7TA 4L5JA 5J58A 2VT2A 3TLYA 1R50A 2PT9A 4MHSA 3B9PA 2Y2VA 4D92A 4PA9A 3OKFA 3OCWA 3KL2A 3Q2OA 5ISMA 3FFWA 4MVQA 5KNDH 3ZWMA 2BFPA 2HK7A 5EP1A 2IYSA 2X8WA 1EQ2A 3ORYA 4G24A 3I6BA 4WUTA 4LHYA 4H13B 4BTEA 5JH7F 2IY8A 1AP6A 3TPZA 4BVTA 2P11A 2UZHA 1C0EA 1I4EB 1IH8A 2BF7A 3PKIA 2ONYA 4Z4HA 2Y1DA 1XKLA 1U5AA 3IT1A 1AE1A 2G82A 2DEUA 1UJ4A 4D6TH 1M54A 3RF6A 2Z6VA 1MG1A 4YUZA 3EXFB 2VHUA 4ZZ2A 1QS0A 2X7RB 5DMHA 4Y2XA 5CA0A 3O7WA 2VNKA 1TAUA 4EFKA 4IJ6A 1AUXA 5AXBA 4YCSA 2Q6TA 2OCCC 1P7WA 5FHQA 4MPRA 5T8KA 5KQRA 1Z2PX 1KQGA 1FMFA 4R1OA 2G1PA 5LIPA 1CY0A 3TNDA 3CXCU 4KNWA 3CNLA 1X38A 1JLRA 1Q1ZA 2HHJA 3C6BA 3MWEB 5EJGA 4CLRA 1GPYA 3IHKA 1QCYA 1VIVA 2WYHA 3W7XA 4CV3A 1OXSC 3IDAA 1PR2A 4JB3A 1KH3A 3E0QA 2FMLA 2HMTA 1BGWA 5K5EA 2VTVA 4ABMA 3IH5A 1V8OA 4L0DA 4R31A 3FOZA 4CM9D 4ZO8A 2MMCA 1G98A 1PHPA 1G20E 1Z0KA 2VS1A 4Y6GB 1YK1A 4UCTA 5SICE 1OX6A 1NFQA 1XA0A 1D1SA 2NXCA 3QNEA 3PIIA 4YP9A 2B1GA 4QOFA 2JANA 1AB5A 5ABPA 1U3LA 2F4VO 5JBQA 2GO7A 3N58A 2PKRA 4WECA 1UT8A 1HV8A 1LNQA 2AIFA 2ZLBA 1LC3A 3EG5A 1IPFA 5ESWA 4I4TA 4NOMA 3MTQA 1JG1A 1ZOLA 4DEVA 3BAAA 2DECA 4BT3A 2R3SA 1WY5A 3B89A 4OJTA 5J9FA 4E2ZA 3E8XA 1DV1A 4A8TA 4YRZA 1YWGO 1MW9X 1GY8A 4UBNA 3DKKA 4JY7A 1CRLA 4Q48A 3GUUA 1OMOA 3RB8A 3GLQA 3TDKA 5K0CA 621PA 2UV8A 3OIWA 4FFNA 2A79B 3A0BZ 1KDZA 3KU1A 2JAQA 3EW9A 4V0NA 3DKRA 3W4JA 3PYXA 2QUZA 3VSBA 1U2DC 3CCSF 3GHHA 2A9PA 3ZIAA 4ZC8A 3I52A 4DV0B 4WFFA 4OKIA 2FSGA 2FPGA 1XUQA 3LCUA 3ROMA 3L18A 3U9TA 1OU4A 2JGEA 1XNQO 5CVVA 5KHOC 1XCGB 4EFMA 2PQ6A 3LWZA 1JI0A 3QBEA 3ZXIA 3ZS9A 2IX9A 3RUHA 5FL7A 3RJZA 3J81k 1XJCA 3Q41A 1U28C 3QO7A 2NU7A 4EB0A 3IEPA 4IQGA 2AZ0A 2WT8A 3DZKA 3F8SA 5DN9A 2RNBA 2IUYA 1T1EA 3OF5A 3VYVA 1FD9A 3E9DA 1WDKA 4C5AA 3H9UA 1JHDA 4A23A 4BRWA 3N27A 4AJHA 1NMXA 4A5SA 2OFFA 2OFOA 1QIHA 1SKYE 2TMGA 4R8RA 4XVRA 4WNAA 2VYQA 3MAQA 2CZQA 4WLOA 3L40A 4D1YA 4BO9A 2JFUA 5HILA 4DA7A 4AJ1A 5LC1A 3BGSA 1N1MA 1PS8A 1IE3A 4M36A 3UVEA 3OR6C 3I64A 4TMZA 4NFSA 3ZDXB 2IQ5A 3DMDA 4EARA 2GKOA 4FDVA 1HDIA 5IAKA 4Q37A 3ZJUA 2JI9A 3TO5A 3PQ7A 1VMDA 1TDJA 1L5YA 1GPDG 4RVUA 4I2NA 3F46A 1OXMA 2BKEA 3JAMA 1H6CA 2A59A 2BYTA 4HZGA 4DV6B 1E0SA 3TLKA 1X7HA 4KVFA 1GKKA 4Q9LA 3THWA 5BZBA 2ZRDA 2H7CA 1TOAA 2ZXFA 2HP0B 2JKYA 1XIVA 1NH2D 1FY2A 1QWOA 2XB4A 1O5TA 3C8HA 4RIHA 3F5DA 5HRAA 3CRNA 1HTWA 4MW2A 3T1HO 1Q17A 4UFZA 1R9MA 2WNSA 3FBTA 3ESAA 4B4UA 1VHDA 3WSTA 2P6YA 1KQFA 2ZE8A 3OFNG 4LS3A 1ZZEA 1H5NA 1HFJA 2ODBA 2GCEA 3DKIA 3HYRA 4YXFA 1J2JA 2IP4A 2WVHA 3AZPA 4MROA 1X92A 3IL2A 1ZAKA 3QHAA 1HT1E 3N6RA 4MQFA 1OIXA 1EDEA 2Q1WA 4R40B 3H6KA 3FYTA 2VTDA 1R6VA 5J2UA 2IV3A 1K66A 1DJMA 3B09A 3L92A 2YXDA 3TL2A 1IB0A 4U0JA 1J0BA 2XA1A 2K1EA 2DQKA 1R1BA 4CW7A 1BCSA 1QOQB 4MS3B 4RIIA 3L0ZA 1GQ2A 3RYFA 3CTMA 4EG1A 1BHJA 5EWMB 1FXKA 5BR4A 4H27A 1OLOA 3ILSA 3CSUA 4LW8A 2LR0A 1RTTA 1IAVA 4CM4B 5L4LA 4J1NA 5J23A 2WLKA 3K12A 4PC1A 5ALHA 4Q3OA 2PZBA 2C5AA 4YJ3B 5DISB 5CITA 4NBNA 3UT5A 5IT9M 1QTQA 5ITZB 4U3FH 3AKYA 1QE5A 2XWQA 1ZMXA 4QDUA 4YJHB 4BJ1A 3LYLA 3F4BA 2X0LA 4UCFA 2WTUA 4LJ6A 3AF6A 1VHLA 2WLJA 1D2GA 1FYXA 3FMIA 4C88A 2EU8A 2X5XA 1A3CA 1HYGA 4V0MA 1J33A 5IT4A 4A7PA 5JYCA 1KC1A 3U7EB 1KDTA 4UAUA 1T1JA 2D3OW 1Q0HA 4EG0A 2QPAA 2V0CA 3KWLA 2J0EA 1TYEB 1CZKA 2VGMA 1EDBA 1FX0B 2XYRA 2V65A 2QD5A 3H9JA 4FLMA 1H2HA 5AKXA 1UPTA 2CK3A 3TEFA 5A5FA 1SR8A 3UCEA 4KMMA 1FTSA 4TTAA 3JVDA 3OO0A 2UUCB 5FWXB 1VIYA 1C3XA 1RQ2A 2R6CA 4Q1FA 2IV7A 4RVOA 2P78A 2JA1A 3DE3X 3AF0A 3KYDB 1JJAA 4OD0A 1KECA 4KXRA 3MLBA 1PKXA 4KRFA 5KJ6A 3ZEAA 5BMVB 3N8KA 4DLPA 4MUNA 1OHHA 3SYPA 5FOQA 4IFIA 1C81A 2IP2A 5L3SA 3UMCA 2UYKA 5JNWA 3MJHA 1HW7A 2H17A 4B3TB 3O1LA 1AB3A 4OI4A 3OZFA 4UHKA 1DPGA 2BAGA 3P2EA 1KYVA 1R66A 4I1PA 2WMYA 2XAQA 3F6MA 3T3GA 3Q7EA 3QF4B 1JKJB 2X77A 4D97A 1YZHA 3B51X 2H1CA 5IKXA 1IY8A 3OECA 1UCFA 2XH8A 2ZE7A 4M6WB 1QYIA 3GLGA 3QW2A 3C3YA 3SJ7A 2DF8A 3N2YA 3TX6A 4EY7A 4DK1A 3G0DA 2R72A 4Q7MB 5DLEA 2XNDA 2GS9A 3T34A 3WYFA 1DCMA 4QODA 3AOGA 3ASVA 5C8YB 3FB7C 1C7JA 2B3TA 4DSNA 3M4XA 1TMKA 3OCUA 5TB5A 4BCBA 3FCXA 1B04A 4ER0A 1R0LA 7AT1A 2AMYA 1WG8A 4YAJA 4Y6PA 5KWJA 1H1DA 5DZSA 4UU8A 2A4KA 2QR4A 1CP2A 1OW3B 2ZJFA 3JRNA 1ZP6A 3OWHA 1JVNA 4WA8A 1R74A 1IRIA 1RRFA 4D02A 4B6SA 3UXHA 2C7GA 3DBOB 3QMMA 4X93A 4L2IB 2EWVA 4L8VA 2C2ZA 1A5AB 4DIKA 4I08A 3AEZA 1OCRC 1MT3A 3DV0B 2P9QA 4PYJA 1PJZA 2WWVD 3NAQA 4TL6A 2QRLA 4XUEA 2CJWB 4YXWG 4DYVA 4YQZA 1CWUA 2B94A 3KV1A 4V39A 4EP1A 1UXHA 4LUCA 4MUKA 1Z4JA 1FLNA 5JFOA 2W6OA 3R6DA 1LBEA 1W42A 3K5MA 4CC6A 1AUPA 4I3FA 3UB3A 3AF1A 3MWDB 2Z5GA 3U3MA 2EBUA 5EGNA 4PZDA 1HYEA 5EG5A 3FE2A 3T6KA 4S1OA 2RBGA 1ISIA 3L8GA 5H9VA 2BGRA 4ZT5A 1NNSA 2RHJA 2IHVA 5D5HA 3WKCA 2VTEA 3SDBA 1WQ1R 1JAYA 4IILA 1AJQA 1L7DA 4WFJA 2H4FA 2RHHA 3LF2A 5IN5A 1J95A 1TVEA 3RVDA 2GARA 4A2PA 3SR0A 1XMQO 4NV1A 3OWOA 4F4DA 3F47A 4CR7A 1MVNA 3WISA 1WP8A 4B79A 4O4JB 1LWNA 3CJHA 1V3VA 3X43A 2PM8A 3BILA 4B7AA 3LBFA 2WYUA 5I6DA 4Q15A 1GTL1 2QE7A 4WFIA 3UYLA 3HEMA 5DPMA 1QFZA 1M56B 2NO4A 3PQ2A 3Q85A 1NYQA 2FTKA 1C1DA 2OCPA 3OPYI 1B26A 1O0CA 5EOVA 1MFPA 2ANCA 1GPH1 2B5VA 5D5QA 3I05A 1NQOA 1LPBB 5K05A 4KHPB 3QUQA 2P9EA 2FP4B 3QX3A 1UH5A 1ZI6A 3B40A 4JLDA 1EFVB 5MFZA 3Q15C 2ZIXA 3MZ0A 4CQLA 4D6YA 3F97A 3LKDA 3CH5A 1L5HB 3M34A 3NBFA 4MIEA 1P73A 3WHLA 1VG8A 4ER3A 1T9GS 5T3UA 4JZGA 4BX2A 4GMFA 4FCWA 4IKPA 4R01A 1PZEA 3RC8A 3B5JA 3ESXA 1DQPA 4ZU1X 1D4FA 3B8MA 2R8EA 4UTNA 5KJFA 3QXSA 2L0XA 4H17A 4JLVA 1MV5A 3SLRA 3P2OA 2G6BA 3FPCA 3VYRB 3ZV5A 1SWVA 3WL4A 2GESA 3AVPA 5C3UA 4GQBA 4U7JA 3W4KA 4LYGA 4MV4A 3P4XA 5MGBA 4R2LA 5BYKA 3CHXA 3GNQA 2PA3A 2OFWA 5CXSA 1O89A 4QT4A 2FOXA 2Y69B 4GW3A 3C7DB 4O3FA 1JQLB 3EHDA 1K2WA 3CLTD 4NYMR 3V7YA 2YXBA 3GP3A 5TRTA 3UJNA 5AVSA 1U90A 5C93A 1VLJA 2CXRA 2Y48A 1L7QA 5SZJA 1ECPA 1H1LA 5G4VC 2IIPA 3FOWA 3AP3A 1B8PA 1NNUA 1MJNA 2O8VA 5F9HA 3T3IA 4X61A 2YZNA 4WSOA 1M5IA 1OTHA 1O7JA 1U2EA 5A9SA 1Z8NA 4G5OA 2PKCA 3LOQA 3E5HA 3ZKWA 5TIIA 2CN1A 2FDCA 3T94A 2YW2A 3HWRA 3MQWA 3UXEA 4O2AB 1RXCA 1LBSA 4PIMA 2HU5A 1YI8A 5BQOA 4ASUG 3SIXA 4RNCA 2LV8A 5EHQA 1BQ0A 3PV0A 3ZWCA 4IS3A 2WJIA 1YVPA 1FTQA 5LYJF 4MS4A 3AOEA 3IB3A 2ABWA 2E4ZA 1W29A 2VJOA 2QM8A 2IKQA 3HSKA 2P1ZA 2FY8A 3FMPB 3MQ2A 5KQSA 4A03A 2ZI7A 1W9HA 4AF6A 3KSZO 1H2SB 4MI6A 4X3CA 4FX2A 3GYBA 2YWRA 1SQQH 2Z83A 4RSRA 1I13A 2GZAA 5AUOB 2FPUA 3BWBA 2EJUA 4PW0A 3BJEA 1JEOA 1RLGA 2VYVA 4RK5A 3A0RB 5EK0A 1YC5A 2P9CA 3JQQA 3GV0A 4UEWA 2HGZA 2AVNA 3AYXB 3M5PA 5AI5A 3KL4A 2W6QA 5TQVA 3RM3A 1C3LA 3MGGA 1NZFA 3GLIE 3VHXB 3WJQA 2FUG6 1JLSA 1HQCA 5JNLA 1DJLA 4ESOA 5LQAA 5I45A 221PA 2YVLA 5AVXA 4N7MA 1S2DA 2IFTA 1ZY2A 3K5LA 3LAWA 1O08A 1YDHA 4FS8A 1QFYA 1SKBA 4YJ2F 3M8AA 3AHJA 4F6LA 2OPBA 2EHJA 1AQIA 1PGOA 2XRZA 3JASA 4M21A 3LY5A 4D3SA 5FFNA 3DD5A 5F64A 3PKZA 3HXPA 4K6CA 5JOQA 5CFLA 2HA4A 1ZN9A 1A32A 3DHYA 4NMLA 4OSOA 5C32A 3L75H 2H31A 2P2YA 3OQHA 2V4UA 3C3AA 3UEOA 2ZCEA 5JS1A 2ZDQA 1VKJA 1Q0RA 2NXWA 1BJRE 4QEDA 2V45A 4DUPA 1CQWA 3ADDA 1XD2A 1S1MA 3WRXA 4N41A 2LIVA 4QICA 2PUTA 4CJXA 4KC0A 3CZMA 2Z2XA 3MOGA 1D2NA 3T7SA 1PFUA 1KEEB 2ZQMA 2K4MA 4JS0A 2Q45A 5K3BA 2H4WA 3FVWA 5EZSA 4Q3NA 3TRFA 3Q7SA 1MABB 2QBYB 4OUDA 4W5NA 4LWQA 1V43A 1GA6A 4M8KA 1BHO1 3WQRA 1MZPA 4H7JA 3U81A 5I4CA 4HDMB 4Q3LA 3N2GA 2CHVA 4IVNA 4RHFA 4ZI3A 4MUGA 4OATA 1RFLA 2KQXA 1ZC4A 1TRKA 3I45A 4JQOA 3L9XA 4TS9A 2JFZA 5EXXA 5JCJA 3CXUA 4FLVA 4GR5A 5EPUA 5JZ9A 1V3UA 2E48A 3GCZA 1C80A 1IY9A 4UARA 3AETA 2DKFA 4A8JB 4TL7A 1TF5A 2VVTA 4R6WA 5HIJA 5CCXA 5AOVA 4F5EA 2OK7A 1WKCA 3KEGA 4J0EA 2VWKA 5IBPA 4DA9A 1ZQ9A 5FYDA 2YWFA 1VYUA 4FE4A 4R2IA 1X80A 2FWMX 2J9XB 1LBHA 1SZPA 1NMZA 4PLYA 4KQKA 3Q5EA 2DWUA 4A4DA 2JVKA 3EFEA 5J59A 5KNLA 3ITEA 1RRVA 4M22A 5JWPA 2ZTMA 1YJ9V 1ZUQA 5IAGA 4H18A 3W9YA 1ZJZA 3AY0A 4IO0A 3BK2A 5AOAA 1X8LA 5KLVH 3Q8MA 2EIMC 1EM6A 2X4GA 3QJYA 3P3NA 4O4IB 2OO3A 5FFMA 2JAPA 2TS1A 5TS3A 3FPKA 4MULA 2HV9A 3U37A 5GGXA 1DZ3A 4KR0A 2QKYA 3OVMA 5K8TA 3DDNA 3RAFC 3NWPA 1JHYA 1G6Q1 4NECA 3WQBA 4ZHWA 4MVUA 4NCHA 1PV4A 4BWVA 4A16A 2K2WA 2AG6A 3BCRA 5LB4A 3FSJX 1UK8A 2M6LA 5F2NA 2BSKA 4HUTA 2V55B 2HDOA 2CTRA 4GO1A 3LG2A 1JG6A 3ENQA 2R2GA 4RETA 1Y33E 3QBDA 1Q0PA 2AEJA 5E1BA 4D0SA 4UHEA 1XHFA 3ZJYA 5ENDA 1G42A 2YIBD 4J7AA 3X1MA 3TOZA 6ABPA 3TTVA 1GNRA 2BBOA 4JKYA 3CWZA 4AP6A 3B5EA 1JDBC 5JS7A 1ULBA 2G71A 5JJBA 4AFNA 2WVGA 3AK2A 3ZV6A 2L82A 4CFSA 5A5VA 4I14A 1MGPA 2CE7A 2BH9A 1FTYA 4RGVA 3VQVA 4RPKA 4DBLE 2V7BA 3QEKA 2JRLA 2I67A 1O96A 1WBJB 1FPQA 3KZIZ 2FEMA 5MN5A 3R2JA 1BMFA 3OONA 2W2PA 2BP7A 4R0MA 4D43A 3P9CA 3WL5A 1XC7A 2RFLA 1W2GA 3UWPA 3O92A 4A0QA 3VR6H 1J6UA 4UEKA 1RPTA 4DTIA 3TQQA 5IK2D 3RS4A 3VTIC 3D6JA 1OSNA 1SZDA 2RCNA 3AF4A 4HQLA 1XVAA 1M8JA 3T41A 4MJ3A 1SD2A 4GPTA 2C5SA 4LE0A 4FLYA 5DP2A 5GIPC 1VL0A 5A4KA 3P0FA 2MSLA 1QLHA 3QPVA 1MJHA 4X3LA 3A3NA 4KXXA 2DWPA 2BMDA 2J48A 3TQIA 4TSKA 1TU4A 2JEUA 4PZEA 3V4FA 4BU0A 4A9AA 1VCMA 1HWYA 5JSQA 3QKTA 1DAGA 4GFDA 4YO8A 2VQ6A 3TL6A 2AMVA 4AWXA 3GX1A 3WLMA 1CUCA 3AVUA 1VTKA 1ZM4A 1T9BA 2IYEA 1ZJ5A 5KI6A 4G0VA 3R1IA 2XT6A 2JAWA 1UIMA 5B1DA 5IHXA 3HTNA 2E6KA 1X3SA 5KA5A 3WYDA 4KQ9A 5HDQA 3DZBA 4Z3DA 3A1WA 4O2BB 3DEHA 5K8VA 2MHCA 4WWHA 2CXUA 1H3FA 5IASA 2Y05A 2UYGA 4NC9A 1C0IA 1XDWA 3AR5A 4CM7A 2VTBA 1EG2A 3W0LB 1XRNA 2CVZA 2YMLA 2ZKIA 4BB9A 3I4FA 4JROA 4YGXB 2E18A 3JVEA