4DRXB

Gtp-tubulin in complex with a darpin
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
431
structure length
424
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title A designed ankyrin repeat protein selected to bind to tubulin caps the microtubule plus end.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
total genus 164
structure length 424
sequence length 431
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4drxB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4drxB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4drxB01
4TV9A 5FNVA 5JQGA 5LP6C 5ITZA 5GONA 5IJ9A 5C8YA 5IJ0B 4X1KA 5IYZB 4TV9B 3HKDA 5FNVB 5CA0A 5JQGB 1JFFB 1W59A 2R751 5ITZB 5GONB 5IJ9B 3JALA 3VOBA 5C8YB 2RHLA 4O2AA 4X1KB 5CA0B 3UT5A 4EB6A 3JALB 3N2KA 4O2AB 3E22A 2VXYA 3M89A 3UT5B 4U3JB 5JCOA 3VO9A 4EB6B 3N2KB 1W581 3E22B 5EZYA 5LOVA 5LP6A 1Z5VA 1W5FA 5J2UA 5EZYB 5LOVB 5MN5A 1TUBB 3JARA 5KX5B 3JAKA 4O2BA 5MN6A 4WBNA 3V3TA 4EI8A 4DRXA 5JH7B 4O4JB 3JARB 5BMVA 2RHHA 3JAKB 4O2BB 4ZI7A 4WBNB 5LXTA 2R6R1 4DRXB 3VOAA 5BMVB 5J2TA 4F6RA 4ZI7B 3HKDB 5LXTB 4I55A 1W5EA 5J2TB 4F6RB 4B45A 2GVIA 3HKEA 4X20A 3RYCA 3N2GA 4O4HA 5EIBD 3WGJA 5CA1A 5CB4A 4TV8A 5JVDA 4E6EA 3RB8A 3HKEB 4X20B 4FFBA 5LYJA 3RYCB 3ZBQA 5M7EA 3N2GB 2Q1XA 3ZIDA 4O4HB 5CA1B 5CB4B 5LP6B 4EI9A 2BTOA 4FFBB 5LYJB 2VAPA 4M8IA 3RYIA 5J2UB 4U39A 5LA6A 4ZOLA 1OFUA 1SA0A 4X1YA 3RYIB 4I4TA 3JASA 5LA6B 4ZOLB 3ZBPA 2XKAA 1SA0B 4X1YB 4I4TB 1FSZA 3WGLA 1W5BA 2XKBA 3HKCA 4EI7A 4HNAA 4XCQA 3VPAA 4YJ3A 3HKCB 4I55B 4IIJA 5EIBC 3HKBA 4TUYA 4X1IA 4IHJA 4HNAB 1W5AA 4YJ3B 4IIJB 1Z5WA 3HKBB 3RYFA 4TUYB 4X1IB 3RYHA 5IYZA 4IHJB 3WGMA 4TV8B 5JVDB 3RYFB 3RYHB 3M8KA 4YJ2A 3C8LA 1TVKA 3CB2A 4KWEA 4YJ2B 1RQ7A 1TVKB 4U3JA 2VAMA 4O4LA 3VO8A 1RQ2A 5EYPA 3WGKA 4O4IA 4ZHQA 3JASB 5KMGA 4O4LB 4DXDA 1FFXA 5EYPB 4B46A 4O4IB 4ZHQB 2BTQA 1RLUA 2RHOA 4LNUA 2RHJA 1TUBA 5KMGB 3JATA 5MN4A 1FFXB 5KX5A 2BTQB 1JFFA 3JAWA 4I50A 4LNUB 5JCOC 3R4VA 2VAWA 3JATB 2Q1YA 5JH7A 4O4JA 3WGNA 5IJ0A 4I50B 3JAWB
chains in the Genus database with same CATH superfamily
4CU2A 2G7ZA 1QYRA 2Q9LA 2HDHA 3LOUA 3D36A 1RM0A 4BDSA 3R7AA 2VXYA 4EY3A 3R3XA 2REQA 3DONA 1JG7A 3R7BA 3LWRC 1GO2A 1JAXA 1GK9A 2A0FA 4O5OA 3ROTA 3MD9A 3T4EA 2PRSA 4GBED 4FM0A 3VJLA 3L5KA 5LVAA 1VQLV 1J0XO 2Q0AA 3WLRA 2JGKA 3L6CA 3LC7O 3HUUA 4RPGA 3GJ8A 3IBGA 1TZKA 5CXUA 1YRBA 1M2OA 3E8HA 1VG0B 2XWPA 5AI4A 3PPVA 3K6SB 4YJFA 4KXUA 3ESQA 1E4EA 3HWSA 1T26A 5HF9A 4E03A 1UAGA 4FMDB 4JODA 4J10A 5A0VA 2W90A 3HXQA 4QEDA 1XCLA 4I4LA 1N6LA 4AYWA 2NO4A 3MOSA 1ZUQA 1N33O 1I24A 4OH1A 3AJAA 3DM9B 2GFIA 3NB0A 2V59A 3FNHA 4BNTA 3IAS6 4AURA 4JYPA 1YJBA 4KP7A 1L7XA 2FZLA 4BB5A 2ZE6A 3Q98A 1SCNE 2AF3C 3RWOA 4CS3A 5ALSA 1BYUA 4TTVA 1M66A 3Q2OA 4OXQA 2UZIR 5K0NA 5CFNA 4UXIA 1L7BA 3AFIA 4YAWA 3RS3A 4DSOA 2NM0A 3CUUA 3USZA 4CS2A 4IO1A 4BXOA 2H65A 3MAJA 4MMYB 4DLPA 4Z2AA 1K6MA 2NU6B 1ZOOA 4OYLA 4KQCA 4G89A 3F7OA 3TBHA 1I0HA 4ZGBA 3CFYA 4X6LA 3VISA 1RBZA 1FQOA 2VPPA 2IP4A 1GGEA 1I3LA 1B15A 4U2CA 3ENQA 2NMVA 3R40A 3BEHA 4ZCTA 2I65A 3FWYA 1VIMA 1XLTA 3FRJA 1OCOC 3L6RA 2IXFA 5JCZA 5KEIA 3TQOA 3C3YA 1MIOA 4J42A 4C0XA 5CNJA 1K5SA 1GT91 1JE1A 2XD9A 5ITZB 3RQSA 1XMVA 2JJ8A 1XNQB 3TLMA 3DDCA 5FBQB 4HMPA 4JBNA 3CCLF 1NMYA 5C7IO 3DFMA 4QGBA 4II3A 4MYDA 5T8KA 3LC1O 4N65A 4NXMO 2CSXA 5B3JC 1W2BF 5LYYA 1GGFA 3N2GA 1JQ0A 1M74A 2VBIA 3SKYA 1R0WA 3DEYX 3AGKA 4R84A 4JNKA 3H1KH 4W4TA 5IDVA 2IEYA 2PUFA 3UAGA 2JFPA 3G6KA 2MMGA 1HETA 3MTJA 5JECA 4KB5A 4NHEA 1L0LH 4QPPA 5HF6A 2Q3MA 3FLEA 3M4YA 2G0TA 3A31A 3GJQA 1V35A 4M0CA 3S2UA 1C0IA 1M7HA 3NV9A 2RHJA 4Q34A 3EH2A 2Y99A 2OVBA 3PR1A 3ESBA 4GNRA 1TUEB 5ENDA 2GI4A 3UG7A 2H2HA 1HFJA 2FTKE 2C2WA 1N33B 1S4QA 1XXHA 1RKVA 3ZKAA 4YIPA 2BH9A 3ENWA 5CJJA 4NENB 2UYYA 2C7OA 1I3NA 3DE5X 4CQLB 5JBIA 2PZFA 2WLJA 1CIPA 4JELA 1GUDA 4TKUB 5I7AA 5TY0A 1X3LA 2UUBO 2CZQA 3H1AA 1SHKA 1H85A 1UBEA 3WG9A 2VQEO 1TA8A 1E0AA 3PNLA 2XT0A 1ZICA 1T5OA 4U8HA 3CKLA 4FD2A 3SLKA 1ORHA 4AJEA 3PQ3A 4AMZA 3ZDBA 2VHVA 3HPQA 4FX2A 4N01A 1UPCA 3NBUA 3L18A 5LP6F 1CUGA 4PG4A 2FSIA 2BMAA 4HI0E 4H37A 3ED5A 2QMOA 4YECA 4YV0A 5BNWA 3DUFB 2AYYA 3CF0A 3G2JA 4RW0A 3WDLA 2VP6A 4LVUA 4IGGA 3SIUA 5DN6G 4GWGA 4JA2A 3EF0A 4A6PA 2MCFA 3CJRA 1I4WA 2H6EA 2IEDA 4ABYA 3SYMA 3I6MA 1EZ4A 4BJ1A 4QIWF 3OBIA 2BE3A 5INTA 4L3VA 4EI8A 1N6KA 2XTNA 2B37A 1U8FO 1PL7A 1F4LA 5ICSA 3V1TC 4FFBA 3Q7SA 4OL0A 4NXMB 3GFOA 3TDNA 2GN4A 5H9WA 2Q1TA 3AOEC 2QP3A 3AI2A 1NUPA 1B6RA 1CUXA 1N2OA 5D7BA 1C3OB 2OFPA 3G7UA 4BQOA 4PLGA 3ZJZA 5IMSA 2DPGA 3PRJA 4FZ1A 1UXKA 4DHEA 1NP7A 3HTXA 3ZZUA 4Z1MA 2J3KA 1SZJG 1L8OA 2GLUA 1H65A 1DIGA 3OX3A 3CG6A 3IQWA 1YQUA 5B1EA 3MCZA 4J3NA 1XOIA 3SXUB 5IVKA 3O93A 3CW2A 3W7TA 4AN0A 3QPUA 3V6LA 3L05A 4D9EA 1QVFF 4C30A 4N6NA 2ONCA 3QKSB 3V8RA 3AVOA 1Q0QA 4BNDA 5T41A 4B79A 1EDBA 3I28A 3UO8B 2BSKA 4MV6A 2Z95A 3UMRA 4P7BA 2GF2A 1OH8A 1R8QA 1U0EA 1NW9B 1HFEL 3DOHA 3ABTA 1NATA 3DMTC 2WTXA 3ZZ0A 3UTCA 5KTPA 2WHRA 1V8OA 4LV6A 3KQQA 1JEQB 1QTNA 2UUBB 3WK6A 4KO8A 2GNOA 3UH1A 1W5BA 4N5HX 3OQ6A 5AW1A 2KMLA 2ZE8A 5FXMA 3DCYA 4U7NA 1GQSA 2VQEB 2XT9A 2C9OA 3NPMA 2BGGA 3S0WA 1YL5A 2Q67A 2WVHA 2C4NA 4JWKA 5ERYA 2CXSA 1YL7A 3KFLA 4GD3Q 2P2DA 1DLJA 3EF3A 2Q3EA 4FS3A 4P54A 1SQGA 2VDWA 1UOPA 1UFQA 5JU6A 1Q1QA 1T9GR 1ZG3A 1KQOA 3FTCA 5DN9A 2FQYA 2A0XA 2A0KA 1ODLA 2H2IA 5A2QN 2XBLA 1SHLA 1RSOA 2C94A 4BWGA 1MZFA 1RHJA 1NAHA 5MN5A 4CKXA 3VC1A 2JI6A 1Z26A 3AK2A 1VSUA 1DHRA 3MJCA 4AJLA 4L95C 3PNBA 3L8CA 1SU4A 2XB9A 3OFKA 4MSUA 1KPIA 4TRNA 3VOTA 2Q7OE 1ZGAA 2QQEA 2Y2UA 1P31A 2OWOA 5LP6B 5AM5A 2VAPA 4C7UA 2PL3A 2E9SA 4A0GA 1KMHB 5HPYB 1VI2A 5A4KA 4B3FX 1OU4A 3L7BA 4NL4H 2CXQA 2G9ZA 5HUJA 2JGMA 1DO2A 1W1UA 4W4KA 1VHDA 1MRZA 3KZOA 3HGTA 2BGKA 5HILA 3SYAA 1M90W 3T1QA 5KSYA 1U9CA 2YMLA 5IY5C 3IKTA 2JEYA 2FWIA 2JG3A 3NBXX 4IZIA 4MTGA 1VFNA 1FU8A 1CS0A 4DV2O 1B8VA 2CCGA 3OM1A 5EIWA 2C31A 3SZOA 3K0CC 5JYDA 2AUTA 4AW9A 4Z9YA 1WP9A 5JASA 1V1MA 4RHEA 5B7PA 2CLLB 2PGIA 1E2BA 3B4SA 1UK8A 2AZ2A 3QEMB 2ADPA 3PC2A 3HM9A 4YRRA 3ZIDA 2ZT6A 2O2CA 1P0FA 2J3LA 3WLMA 3TD9A 1P7VA 4YMSA 1LKZA 2XYVA 3KOUA 1KAHA 4H59A 3GRUA 1TO6A 4BNHA 3LWNA 1EWKA 4BGDA 3DYBA 2BM1A 1Y34E 1Z8NA 2J3IA 3QLVC 4U2DA 4ZRMA 3FIUA 4DUZO 4ZP1A 2GK6A 1CD5A 1PYGA 1RWPA 3W5AA 4RMIA 3MCVA 2MSWA 1WABA 1W47A 4PA4A 1FNKA 3NOQA 4W4LA 4KZKA 4WFQA 3CZPA 4DQLA 1YRWA 3CPHA 2MDTA 2FMUA 2FLWA 4RD6A 1RRGA 1IMOA 2PLWA 4F9FA 4ECAA 3G4SF 1BDIA 5TMPA 2WT8A 2ZVQX 4A8JB 3ON1A 2QN9A 1I08A 1VF6C 2V7QA 3OZIA 4Q1DA 3M33A 1R0BA 3KPJA 2IS2A 1ZBDA 2R65A 1J5PA 2W11A 4PGMA 3VJRA 1Z4IA 1SULA 3QVMA 2QTFA 5IVPA 3F5MA 1Z38A 4EHAA 4EGAA 2BI4A 3LSQA 2ODQA 1J8VA 2JRLA 2OB1A 2RGEA 2I4OA 2G3YA 5IT4A 5IN5A 3ROZA 2R1VA 5JQWA 3ETLA 4UUJC 1TM4E 2JVKA 1JYEA 1N5IA 4NYJR 2AMJA 3ID6C 2Q46A 1BGWA 5ABPA 5FFFA 1UKBA 1QYIA 1GG2A 3MIZA 4UEJA 4UHDA 1X80B 2I6XA 4D82A 1KSHA 3ZGNA 3PKIA 4CIAA 1E9VA 1G20A 3KOWA 3C3XA 2PHZA 4REOA 3TNFA 4NBKA 3SFVA 2JHPA 5J9FA 4A9AA 1MH9A 2DM6A 4NH4A 2PH3A 2VEOA 4CGZA 1K92A 1CF4A 3S29A 3MJTA 2AL7A 4I9WA 1RBYA 1ORQC 5ALZA 3FOCA 4KMMA 3AUFA 4F7DA 2X7XA 2EWVA 4QWWA 3KSBC 2XIJA 2FPRA 5B1IA 3DVLA 5HDBB 2IZ1A 4HQ6A 1V5WA 3R0IA 4QAQA 5LMNO 4J75A 4A23A 3WGMA 2PNJA 3KQUA 3SKVA 3HU3A 4KWEA 1XNRO 1IZZA 4Y2XA 3GRZA 2QQ0A 2OD7A 5FLYA 2QBYA 2BP7A 3INRA 4PW0A 2TMDA 5MF6A 3O4FA 1X7PA 4DUZB 3DHNA 2VF2A 4DQKA 4WZ6A 2AIRA 2HNBA 3OW2F 4OK5A 3EVAA 2BFAA 4TVOA 5FI5A 3E4CA 3ZGXA 1UMCB 4JI8O 1XPRA 4WL0A 3IDSA 1Q3TA 3RS9A 4XJVA 4AP5A 1LEHA 3T1VA 4RGQA 1KMMA 1PV1A 2JI9A 2IXEA 4K6GA 2CHTA 1IN6A 3IAM1 4CL2A 3OJXA 4B44A 1UFVA 5HY4A 3IT1A 3WRXA 1YR1A 1NW8A 2PUWA 2QM0A 3DZIA 4MVOA 4JU8A 3D3EA 3FB5C 1EHYA 4P4LA 3BWDD 4MDFA 2POQX 4R1TA 3VX3A 1WXFA 4B31A 3Q5DA 1ZMXA 1XB2A 4FYKA 4KKVA 3F5TA 1FFXA 3RS8A 1G8AA 3VIUA 1SQSA 4KUMA 3QU7A 3D2CA 2EV9A 4HAXA 3PXUA 3AW8A 3LNCA 2DUMA 3TQSA 2AEFA 4RPIA 1YJ8A 3LQRA 3ITNA 2I8AA 4KYVA 5JLJA 1Z34A 4CMKA 4IX1A 4HYQA 5IJAA 3TD6A 3SWWA 4LCJA 2CFCA 2ZWVA 1EUCB 5EJMA 1ILEA 1YOVB 4LP8A 1QRAA 1DDGA 1K86A 1OX6A 2CKDA 4XE5A 4J9YB 3VSEA 1NSYA 2BBSA 2H52A 5K0ZA 1VYUA 1PV0A 4MR8A 4IH4A 3UJBA 1CKEA 4Z7JA 3SJBC 4C4WC 2W2TA 3HO6A 3P30A 4FLXA 3CXUA 1GCIA 2WWFA 4QWMA 3E0QA 4DBLE 4IDAA 1CR2A 3K0FA 1J99A 4HHEA 3U9SA 2LJ2A 4TTSA 1IH8A 2ZJZA 3CMAF 5LMNB 4PQYA 1O9GA 3ISTA 4EKGA 5REQA 1JR9A 3HJRA 621PA 5CURA 4LOHA 1XNRB 3LZ6A 2RC5A 3SJQC 1PZGA 3PQ4A 4W9NA 1X1AA 1X7OA 4XARA 1RYBA 5FX2A 3QKIA 1PJBA 5HY0A 1J06A 2IJHA 5CDSA 1V39A 1FDTA 3TEJA 2YWEA 2OHIA 2CDRA 2X6BA 1GGNA 3BHPA 3NHJA 4JI8B 2UZ3A 5EKXA 4EUNA 3F71A 4N7MA 4LY3A 4JL8A 5E0OA 5L6MB 1GCOA 1VPDA 1YZTA 4PNPA 4WNAB 4IIEA 3BD6A 5C9ZA 1PSZA 5EI5A 3LDDA 4UCFA 1RLIA 1QAMA 3ZQ6A 1T8RA 4GQIA 4PE5B 1S02A 5TARA 3TSYA 3MGGA 3KB2A 1GKIA 4GBGA 5MN4A 2GEBA 4F6LA 1Z16A 5F9MA 1TZCA 3V8VA 1E1QD 2KBEA 4Q4HA 2ZSIA 3ODPA 2B5OA 3NLLA 3VR5D 5J4HA 3STTA 1IVYA 1NBIA 2BEWA 1D5WA 3KSRA 5IFKA 1KJZA 1RT9A 5DM60 3JQGB 1JJFA 2XCQA 4XM2A 2BFFB 4ZJPA 4Q3BA 3EWSA 4MHOA 3WSVA 3I7TA 1R73A 3RUEA 5KYUB 1QIJA 3GAFA 2O7RA 1GL9B 3KZMA 1HE1C 4F5EA 4AUNA 4X60A 1L2TA 2A59A 4E15A 3GGPA 2Y9MB 4JVOA 3TSZA 3WJ7A 1MA3A 2ETNA 2FEXA 2L69A 3LUDA 4NV1A 1EE9A 4TWBA 4YALA 4XWWA 5J2TF 1MAWA 4UTRA 3C3SA 5H4GA 1AMUA 2QSUA 3WZ2A 3H0EA 2Q2WA 4MVSA 5HP4A 2FOLA 1Q7EA 5JZSA 3O47A 4RM2A 4B9EA 1PLLA 2DLNA 3LSYA 1QX3A 4WW0A 1CLUA 1VMEA 5D3KA 1QRSA 2OFWA 3OOHA 4BWVA 1CSEE 1P39A 5GJWC 4HXYA 1RC0A 2I6TA 4LTMA 1JHOA 2PZEA 2VPXA 3CZRA 3JALB 2OG1A 4M9CA 1FFSA 4UOEA 1S0UA 1HKUA 2NAFA 1TJPB 3KJEA 1TU0A 3VSDA 3QKRB 2H57A 3FIJA 3I2YX 3NHAA 1SUDA 4C21A 4ER0A 4KPFC 1MLDA 5FEMA 3PD1A 2VH5R 2W6JG 4ZHQF 3RK4A 2ZUCA 3ZNPA 1WP7A 2ZAYA 4X6YA 1MEJA 2DKFA 3QGMA 2ZT5A 3CZQA 1M57B 1W49A 3B3FA 4ENVA 1DGSA 2WJWA 1RE1A 1M2JA 1TGVA 1Y66A 1C4OA 2JLCA 3OFJA 3QLJA 3RRZA 3ICVA 1HFWA 1RKQA 3IAS1 2H94A 4AMBA 3DE4X 2W4QA 2XUIA 5AUPB 1RXSA 5IN4A 1EVQA 1YHYA 2HCFA 3KUUA 2O50A 2LCIA 1SESA 1KFJB 3H2KA 1T0KB 1GITA 4K8XA 4QXAA 5HBRA 5LB4A 3ANTA 1K66A 1GPBA 4EG6A 1VLJA 2XMQA 3CLVA 2YEVA 1W42A 2M6KA 4EO9A 3V9AA 1Y67A 4IUBS 4KE6A 1D2HA 1Y8AA 2QSYA 1Z5GA 1ZRMA 5THXA 1YS7A 1ZD9A 3BZWA 2XTAA 2R7AA 3K0TA 2XVAA 3ED1A 4PZEA 2OWEA 5AM4A 2J7KA 3D54D 5CEEA 3GFFA 4FNAA 4L0CA 1QYVA 5E6SB 1BMTA 5I9NA 5GZ1A 1ZMOA 3DKVA 3OHPA 4LX8A 3W9YA 4GUDA 5EUCA 3X43A 2QP4A 3HKCB 1MX9A 1V3VA 3EJWA 1I14A 3H1IH 3G0BA 4RZIA 5HG0A 2FSGA 2F9MA 3HZZA 5CBGA 3VR4D 1CUUA 1FB5A 3TINA 3D59A 3HXKA 3GHZA 4LRXA 2GDSA 3U4HA 4BQIA 5LUAA 2Y67A 3DGFC 3SPXA 3UWDA 2DLDA 1DQRA 2G9RA 1CUBA 2XUDA 2DYRC 3I01M 1PJZA 4CF4A 3MJVA 1OI3A 3DDOA 4RHUA 4DDHA 4IWNA 3N27A 4M38A 3F4KA 1R9NA 3THXA 4IV8A 1WLEA 1C7EA 3PJDA 4NDNE 2V8BA 1JEJA 2PGNA 3R8FA 3HP4A 5J2TB 3L1JA 4HH0A 4BBAA 1QK5A 3M34A 2WSSG 1CYDA 2B98A 1SK8A 5JEEA 3RVQA 1Z5OA 4CPDA 5I7RA 3QV1A 5E1BA 4IDHA 2IOHA 3O85A 1P8JA 3RVYA 3IV6A 4HAWA 2WHPA 4CWAA 4MCJA 2D59A 2BMJA 2Y1OA 4B80A 2JAOA 3ZVMA 2ZUDA 3DMYA 3PUVA 4NNOA 5G0VA 3WK8A 4FM1A 5D6OA 3EGOA 4UCRA 1C1DB 1RRVA 3NPAA 2ZYWX 4Q4JB 4AK9A 3ZQ4A 3IE1A 1W73A 4ZT2A 4URYR 1VQ4V 5LP6C 4CC6A 2X14A 1KSFX 4LDPA 4A16A 2RK4A 3WICA 2GZAA 2VHWA 2JFNA 1ISFA 2DT5A 2X5XA 3PUIA 1PFGA 4FM2A 4ZRNA 2C8KA 4RXUA 3MA0A 4PO8A 3OZWA 1HQDA 1RHRA 5CMUA 3NTUA 4PQEA 3B82A 3WLFA 4O1IA 5FBLB 2KLBA 4JOSA 5I7UA 4L3OA 1QQBA 5BW8A 3JWIA 3C1UA 3K31A 3LUFA 1NJGA 3T12A 2JGRA 4OQDA 1JU9A 1UBLS 2G0NA 4WV3A 1MJFA 4X0EA 1NJSA 3TZ6A 3PNVA 2JHFA 1UWKA 3TFOA 2IJIA 4QSHA 3WE7A 1GP2A 4KUGA 4ILKA 1FA9A 2JD0A 2X0JA 1PKEA 1Z5NA 4GVPA 3S2IA 1DIAA 3CB4A 1M76A 2I2DA 4XXHA 2FPPA 3DGEA 5F21A 1GFZA 2I6UA 3GH1A 3GFRA 1Q7CA 2WWVD 1LJ8A 3O73A 4MIOA 2QYTA 2CFSA 4YRCA 1NVTA 4LYJA 5HCIA 3ISJA 2H16A 1KQNA 1LW7A 1X74A 1RHUA 4UAVA 4INJA 1G1AA 3ZWNA 1YB2A 2OO5A 2YIMA 1OCOB 2EU8A 1VQOV 1Z5ZA 4BO6A 1MOFA 2OK7A 1A5TA 3FD6A 4TGLA 1DSSG 5DHUA 3ZRWA 2VOJA 2HQRA 3ABQB 3BXPA 4BP1A 4F4LA 1AQIA 2UYPA 4L27A 3LFTA 1CUIA 1GWNA 3V48A 3WLIA 1HGXA 2EP7A 2CZCA 3KQYA 1R4NB 2FJ0A 1E9DA 4I0XA 3CG4A 4B3XA 1DDIA 1L5SA 3C3JA 5CX1A 3MMXA 2B0CA 1JIXA 5JYBA 4OXRA 5TX7A 4TMXA 1LI7A 1OLUA 2PT7A 3DVAB 5GVRA 3D8UA 2EL9A 5CLGA 3HUDA 2FUCA 2PT9A 5M34A 2H51A 5TIIA 3F5WC 2WTEA 3SSAA 1KEKA 1SZTA 2HT6A 1KAQA 5ALHA 2AJTA 3WLTA 1Y9JA 4D9FA 1ESNA 1ISRA 1DJNA 1TPZA 2G4CA 2I1QA 3R66A 4JL5A 1L9XA 3NP9A 5I01A 2YCBA 4LDJA 4MTFA 1PGPA 1RAEA 1MAUA 2PH7A 1YJ9V 3STUA 3AUSA 3A3NA 3ZE2B 3L70H 5BWNA 2FZKA 3T1OA 2PMWB 4UUQA 4DT1B 1QWOA 1DTWB 1E7RA 5FHQA 4DC0A 1XI1A 1VBKA 1PR3A 3F4BA 4C6TA 3L6OO 3VU1A 4B6JA 3SKXA 2AXQA 4IQ0A 5JT1A 1N6OA 1J6UA 3KCYA 5LL6Y 2PKEA 3PG5A 4XGIA 1NJIW 3ZO8A 4Q1VA 2F1MA 1HW7A 4H31A 1I3CA 5EESA 5BPHA 2VAXA 5CM8B 3H16A 4H13B 4QO7A 5I3CA 2EWWA 2V0CA 1STOA 1CVRA 2I1WA 3BGWA 4LCEA 4OQLA 1OASA 4HN2A 5JTUA 3L8DA 2KSQA 3JWHA 5DZSA 1Z5PA 3EFOB 1K4MA 3H1HH 3IUSA 3AHDA 3SHQA 5B3SC 3STYA 3MWKA 4Q39A 4Q3CA 3V55A 3KJFA 3INYA 2GXSA 2PGOA 4PR0A 3JYNA 4CLOB 2FH5B 4GMXA 3TB6A 2HMAA 4A2PA 4DAEA 1QU3A 3W8NA 1VIBA 3QX8A 3GLUA 4AXBA 2IH5A 2QA4V 5KTYA 1GLGA 4INPA 2XXBA 4TL6A 5B3AA 2ZIZA 3OY2A 4M7PA 4HB0A 4FNOA 3M4XA 4L72A 4US1R 3U2QA 2OFXA 1AGPA 4Y2RA 4RKWA 2YV4A 4EL0A 3RIEA 2ZATA 1WY7A 2XE8A 2YZKA 5ALUA 3OC0A 1NL3A 2PA0A 2Q6AA 3ESDA 4K9PA 3GP8A 3F2VA 1E5LA 3TD2A 3LY8A 1RC8A 3C39A 2BYTA 3DFFA 1IEWA 4TTTS 4FWIB 5JDCA 2YDYA 1SU6A 4LJ4A 3H1GA 1RPTA 1DO8A 3L1VA 3NO4A 2AXNA 3W3AH 3CMEF 2Y2VA 1NKSA 3EWIA 4L4ZA 1Y3AA 4B7XA 3AEZA 4EPYA 1GEEA 3PQ2A 1EFKA 3WRVA 3P5SA 4EW3A 3OD5A 4B45A 1SCIA 5DM0A 3A2MA 4FU0A 1NC3A 2QVXX 4PC3A 1KDZA 4KPEC 3PTZA 2WUGA 2QI9F 5J5AA 3GH3A 4ZCIA 4JOBA 1GTVA 1P72A 3CN9A 3DL0A 2KGWA 5C1BA 5B2EA 1G3IA 1JJAA 4KPUA 3PGKA 1BCSB 2XOXA 5HX7A 4Y2PA 1IQRA 4TT3G 3J81k 2C5AA 2XDAA 4L6CA 4CT0A 5B58C 1VM6A 5GGYA 1DV1A 2PEZA 3G9QA 5KUMA 3L7CA 2X0FA 4LZAA 4TKLA 5T6MA 1U3WA 3M70A 2NN3C 3R6TA 1OFIA 2IHVA 1NNUA 3ILVA 4WEQA 2QQ5A 4NARA 2QTNA 2OHFA 3RAPR 4O59O 5TVKA 4YCBA 3WYAA 3NBZC 2ROQA 5KQGA 4QT0A 4FVMA 4CKZA 2QGNA 1WEHA 1P7BA 3R5KA 3OMXA 3L4BA 3I53A 2EF0A 1AUQA 1SCJA 2KB1A 1XTUA 3WL5A 4U39A 5IZ4A 2XX3A 3RVJA 1SUAA 3VPHA 3OCZA 4CFZA 2B20A 2ZBFA 4J80A 4K5QA 4FGZA 4FCCA 1YU6A 3UVEA 3COZA 1R9JA 4GUNA 1WHSA 4UBJA 1LPNA 5FP0A 2XOKG 1A76A 1DE0A 3V1MA 5K99A 4O29A 2UAGA 3AINA 4WXRA 3G80A 3RVLA 3EXIB 2Z1UA 4C76A 5HIJA 5FAXA 5K2MA 1LI4A 3STVA 2OR3A 3WGVA 3KETA 3GGJA 4JT9A 3TGWA 1IN1A 5ICMA 2YY5A 3AR4A 3LUKA 3FAKA 1QG6A 5IY5B 4P9OA 3F6YA 2G4VA 3JAKA 4ZO8A 3Q8WA 2OIGA 2IL1A 5L95A 1EIZA 2K7ZA 1WP8A 3K57A 5F2KA 2A3RA 5K1PA 5J4VA 2QG4A 3NIBA 3GUCA 2R62A 3MCTA 2O1XA 2XTJA 4TTJA 5A5EA 3REQB 5LA6A 4BIUA 3LBNA 2VDVE 5F7OA 4XOUA 1UPAA 2R68A 2X4IA 3B8NA 2DMXA 5DH9A 4RYLA 3JCZA 1VIYA 2IWHA 1JHUA 5I7HA 2HLHA 4ID9A 5IVHA 1SHUX 4OU4A 3A7DA 4WUTA 2IEGA 3VO8A 3AFMA 4FLWA 4PTZA 4NOJA 2FW0A 2OUKA 4D56A 1NKTA 1KU0A 3GUYA 4UHCA 4R6WA 4CTJA 2O2IA 4NLLA 4L85A 3A6DA 5GONA 1AT1A 4FBMA 5CITA 1JALA 4FZ0A 1OR8A 3DKIA 3FE2A 4MIKA 5EQDA 2A3QA 2CFOA 1GN8A 3T5CA 4LH7A 3KXDA 1DKNA 3IAFA 2QEXV 3N2YA 4HNQA 2RC6A 3VHXB 1TRKA 3ZTYA 4B5CA 2X8BA 1VXRA 1N6PA 5J4YA 1MB0A 1RLJA 3X2QC 1K7DA 3P0FA 1YRLA 5AI9A 3SP1A 5K0SA 3CS3A 4E46A 1PQPA 3PNKA 5JZVA 4I5SA 2PX0A 4AFNA 3CXHF 3AIIA 4J1TC 1JN1A 1HG1A 1IJBA 3JQFC 5FYQA 2YWHA 4ZO7A 2YWRA 3FD5A 3KLBA 1X8KA 4YMHA 1Z28A 2XITA 4KN6A 1E1QA 1XFDA 4RMGA 2Q4EA 2Y4OA 1FC0A 5E7MA 3ZZTA 4KVZA 5GIOE 3HFJA 3NANA 1K9MW 4JR0A 1XO1A 4RXTA 3K70D 3KQVA 2IXTA 3VSAA 1KQPA 4UREA 1FXKA 2DY0A 1KEZA 5T4EA 3EODA 4OQNA 5DXFA 4PNZA 2IH3C 3D02A 3UFXA 2O1SA 3T7EA 5AW4A 1IPEA 2R60A 1XNGA 4XFKA 1XEQA 5K3FA 3PWKA 1L3CA 4ONEA 2CZWA 3I8OA 4BVLA 1SZPA 2RHHA 2R6CA 1Z8DA 4H7IA 2VWPA 1Z08A 1GM7A 3TXQA 2V3WA 4JOQA 3S2YA 3QE9Y 3F0DA 1G3QA 1DQPA 1TC2A 3PPIA 3MAQA 1I51A 3WGJA 3MQFA 1EK2A 5BN5B 1LX6A 3I01A 4WHMA 1Q22A 4G0QA 2BZGA 4BV2A 4KRYA 1RYMA 1YKSA 1ZK4A 2WWXA 2BGUA 3WGLA 1K73W 5KNCH 5KDOA 5AM0A 4UUMA 1KQ3A 3KFVA 4BP3A 4I1RA 4MZXA 4F1WA 2VQFO 4HLCA 2FXIA 1FTQA 2H7YA 4A5SA 1L1FA 4YV1A 2J48A 2CD7A 2I2FA 4IMIB 3CEPB 4O4LB 1LDYA 4LSGA 4XVUA 3TOXA 5HWEA 4GG1A 4Y9RA 1R8XA 3RAGA 3DO5A 4TTQA 1NKVA 4CTNA 1U02A 2QD1A 2SCUA 2P6MA 2XQJA 2FWAA 2HRZA 2ASVA 5KYYB 4CI9A 4R6ZA 3PDIA 1FS6A 4J0IA 2NQ2C 1ZZGA 2ZIXA 1FJ2A 3BCRA 4FLTA 4WA8A 1SRRA 1ID8A 4R8CA 3W5UA 1G3RA 1SVKA 3BRSA 2UZAA 2D1TA 4WCFA 1DEXA 5K3OA 4LJ7A 2E5FA 5FWDA 1P61B 2QVYX 4IKEA 5BXZA 4X54A 2GKOA 3W6NA 1G7SA 3ES9A 2ICAA 4R3WA 2PRIA 3LU1A 1ZI8A 3CEIA 4U7PB 3E1KA 4P58A 3WBBA 3QBDA 2WIGA 3VC7A 2NOAA 3QLUA 2QTAA 3CF2A 1LWNA 1D03A 3LCMA 5F98A 4QBTA 5LYJF 2IHKA 2BMVA 2IV7A 2OL4A 1T8WA 4J7JA 1T43A 1BT8A 2OCYC 4LNUA 3FZNA 1VTKA 4L5YA 4EYOA 5LSAA 2HFKA 4UNPA 3R41A 5T4FA 4DYVA 2A1IA 3P9PA 2PL1A 3TGLA 4IJUA 3EDRA 5K3CA 1Q5OA 1AZLA 1CJVC 5CHEA 1D4FA 4FEAA 5DK6A 3D54A 1NW4A 3ILYA 3WLHA 1P7ZA 5J63A 3H83A 4JJGA 2EFYA 3QU4A 4EUEA 5EWMB 1QHHB 2XASA 3PGJA 4EYEA 3GJTA 5DIZA 2XUMA 4BNJA 3ZE0B 3OGIB 4WESA 4QNHB 1AQNA 1OZ0A 2GEFA 2VRWA 1I7SB 1T4CA 3UICA 2HIAA 1MP0A 1ESDA 2C7BA 2HU8A 2A9FA 4DM4A 2BL4A 3CUYA 4LI3X 5EMLA 4BFCA 1N9ZA 1D6NA 4LNHA 2Q5FA 1KI6A 4X85A 5DISB 2W4MA 3CZAA 1IOVA 1V7QA 1U2ZA 2JKZA 2Y71A 1QGUB 2HMWA 4EG1A 1PW7A 1QJ4A 5KSWB 3GPIA 5JCPA 2J08A 4I5IA 2X5JO 4WFAV 2VQFB 4K87A 2JBWA 3KQPA 3AZOA 4V0MA 2AMVA 2ZSFA 1QO9A 1BXGA 1JR6A 2JLSA 1NSTA 1SG0A 2P78A 3QUBA 3I39X 1GU7A 2GBFA 2JARA 4DV5B 2ECFA 3KCQA 3LUJA 3NQ41 2N1BA 4U63A 4FFWA 1XQ1A 2PN1A 2JLQA 4X63A 4B84A 4AF7A 1GQRA 1NUHA 1EXVA 2WW8A 2I4MA 1LVUA 4WKBA 5IX8A 3L0PA 1T1EA 4KR0A 2HQ1A 3M6LA 2PZKA 1G1MA 5DB4A 1Q44A 2X22A 4YP0A 5DU2A 3WZMA 4G0PA 2C57A 3KNZA 2HH9A 3NTRA 4DYDA 4MWEA 4R54A 3NS7A 4NABA 4UVDA 2YZNA 1IHXA 1Z4LA 1UMDA 1SBIA 1YI2F 5JAPA 2HSWA 4FR2A 1LBSA 3OPYI 1Z6YA 2I4TA 2WM8A 3CB2A 5I9IA 3AJDA 3ZVRA 1ND5A 4AUEA 3TMYA 3L8EA 3FCCA 2RI0A 3QVNA 3FZGA 5CIYA 1X8XA 2R8YA 5EUQB 1QG0A 3EVDA 1GL3A 2WM2A 4GDMA 5C8XA 3AKYA 1H93A 2DBRA 7ADHA 4D5GA 2VATA 4PYIA 1M1NB 3HK2A 1KDVA 1OAOA 3WX0A 3OUZA 4DKXA 1CY6A 1PZMA 5KQMA 2Q27A 3FAZA 5I7EA 3JD1A 3NHKA 4Q0MA 1ULAA 4JB8A 4F45A 1Y76A 4D9MA 4I9FA 1VKNA 4NUTA 5ADUS 4CKCB 3FWKA 1KE2A 4Q4DA 1GRQA 4US2R 5C8DA 3ZNQA 1QHXA 3GV0A 5LYJB 3OVMA 2BPOA 3SSOA 2KJQA 1T0BA 5KOJB 4NK4A 5FO1A 4RH3A 1B6TA 4ZZ0A 3MHHC 3MWYW 3SYQA 5E95A 3ZX5A 4F9EA 1GNVA 3COPA 3EZ2A 2YVKA 1VQ7F 3WNBA 5D7NA 4LW8A 1ZWKA 2VT3A 2GASA 1B93A 2X0EA 3H5WA 3IFSA 5J40A 4P6VF 2I99A 3BWBA 2PSDA 3I55V 1GPKA 3TAUA 1WUYA 3M89A 2Q68A 3BK1A 3G6EF 1S2MA 4DANA 2BMFA 3ST7A 1EJBA 3NNSA 2PRZA 2JIMA 3C3WA 1NU8A 3ZXYA 1XU4A 2DYSC 3QENA 3J81N 4ND2A 1HBJA 3KSMA 1OJHA 4CN8A 2L42A 3QOXA 3ER9A 2X1VA 1T9AA 3W2HA 4RVFA 2NV6A 4LIPD 5JI3E 3ADCA 1SA0A 5E9WA 2FCAA 4W9MC 5BT9A 1OV4A 4WOCA 1E3WB 1FNNA 2WPDD 2Q8NA 5H82A 2XUAA 3JY6A 3VR1A 1X1BA 2GRAA 2BFDA 1Q86W 1CEYA 1QVWA 4RKFA 1QAOA 4MVUA 3GJ0A 2P1DA 5I5GA 1JSRA 2R1TB 1GGHA 2HUPA 1NVWQ 5DO9A 4G1VA 4BECA 5DX0A 1W59A 1ZMBA 4G8BA 4IF6A 4FFPA 1QCEA 4MV5A 1HEIA 1HX7A 2WYUA 2WABA 3OE7G 4N48A 3WLNA 1K8YB 1WJGA 1OFVA 1BDJA 4Q1CA 4QUBA 2B7LA 2KM1A 2XNDA 4FMTA 4DIUA 1U9IA 4L28A 4KFCA 1NBMD 4TWIA 2V4UA 1S3GA 5GJCA 5H4HA 4MVJA 3ZRVA 5EUBA 1ZIYA 3JQBC 4D8XA 5KNDH 1N2IA 4GMKA 4ZDJA 1X1CA 5LZ8A 1XTQA 1OYYA 2PK3A 3ABSB 4ZVRA 2OCAA 2YY6A 3ZWWA 2Y0IA 4KCGA 2C54A 3QKUA 5K03A 1UL1X 4MUGA 4EF5A 1OX4B 1SUBA 4AVYA 4ON9A 4ZBMA 2ZUEA 4L5BA 2I29A 2ZI4A 4K7JA 1VRVA 1UJCA 3I0MA 4C4YA 1A0OA 4D3XA 3AKEA 3IV9A 3GBPA 4DFDA 4PICA 4TLEA 3PNSA 4Q15A 2X3FA 1YZVA 2BV3A 4GI7A 1S2NA 2PIDA 3Q3GE 4LMAA 3W6ZA 1YVPA 2AV6A 3HBNA 2PU5A 4AAYA 3KQWA 1T0HB 1ST3A 5CPBA 4UV8A 4V0QA 3C87A 2BE9A 3MF4A 5C5EA 3LHFA 4I2NA 2IYRA 1L9KA 2IBSA 1M6YA 4E22A 1E6MA 2O6LA 3Q8LA 1DS6A 3RBZA 3AM3A 3ZJYA 4PCLA 2O19A 4EHNA 2DYRB 2RN9A 2A1UA 4PG6A 1N0HA 1MQ9A 3QPAA 2QPLA 5FL7D 3G0CA 4WXYB 5FTWA 3FF4A 3R6DA 4TYMA 1GADO 2H0AA 2JF0A 1BQZA 4TQUS 4MEBA 1QH1B 4UD6A 5HS6A 1E2IA 1JQEA 1RXEA 4IQFA 3T15A 5FTKA 3AVUA 3TOZA 3ZHBA 2FQWA 3B1ZA 1NBHA 1U65A 1NBWB 3BMXA 4HXGA 1MBZA 2LIPA 3N0XA 4CMHA 2IZ5A 1C50A 1CFZA 3FNRA 1RTTA 3OAAD 1TCBA 3MCAA 1ZJZA 1VGVA 2A7QA 4YJGA 2VK2A 3WLKX 3VO9A 5AR1A 3F6MA 2SICE 1YI0A 1Z68A 4FGJA 4X94A 1T5EA 1L6IA 4JH0A 4FIZA 1YC2A 1RCFA 4HZ3A 4WKCA 4O0LA 4WKPA 4GWLA 1YFZA 1L7QA 2PYLA 3RH0A 2K9PA 4I5DA 4DNOA 4M7RA 1ZNWA 2OXTA 5AJTA 3IUNA 4HLUA 1RQGA 3M9XA 4TYWA 4ZHWA 3B9RA 4LYYA 4CH4A 4IDNA 4W7IA 4QU8A 4ZDIA 1JVBA 2WJZB 2ZZMA 1PEYA 1N8KA 4F2DA 4Z54A 1O5IA 4A15A 4RTMA 2EILC 1ZUNB 1FXUA 1UF9A 1NRIA 1LWOA 2V6JA 4XRGA 5FBRB 4J0QA 4JEHA 3Q3CA 3R3JA 5FPRA 2ZUVA 4Q9AA 2RB9A 3P2IA 2CVZA 4IT5A 1QP0A 1Q43A 2OV4A 5AHOA 1ATIA 4MTCA 3U7FB 3GFBA 3K3WA 1BVYF 3L9WA 3PGA1 3VR2A 1NQ3A 2UUCO 3OICA 3AONB 5CLLA 2AOVA 1G6UA 4NDAA 1M2VA 2AG0A 5KVVA 5BWBA 3JZIA 5AHKA 3WA6A 3O90A 1NPTO 5FA8A 1V11B 4S12A 2BM0A 4UVGA 4KO4S 3BILA 1XD2B 1JV2B 3LY7A 3TGPA 1Z6XA 4MAMA 2AVDA 3K79A 3CRCA 3QO7A 2NU8A 1EJ6A 3NJ8A 4FOLA 2JLRA 1V0JA 5B4VA 5H8WA 3VDNB 3BSWA 3B1VA 3K9AA 3TIFA 2QI9C 2JIBA 4H0FA 3NBMA 3AEKA 4EHJA 4XIJA 4D5EA 1NQAO 1EFPB 1K34A 3ZD9A 4YIHA 1NXWA 2JGNA 3OX4A 1W2HA 2V9PA 1DF5A 1LPBB 2FZVA 3E5NA 4FJ0A 1JGTA 1X1QA 3ITDA 1NR7A 3F4LA 1N3LA 2G83A 3IQXA 2X9GA 4N4AA 4FJCC 2EFEB 3RUDA 4G4VA 3H87A 3QEAZ 2MSKA 1N7IA 5KTTA 1H0HA 2P2YA 4UEKA 4D0NA 4OFBA 1HTBA 2W6NA 3KSAC 2IIVA 4GH5A 3CPSA 1XKLA 1C7IA 2Z83A 3ETDA 1HT0A 1DL5A 4GOOD 1QE3A 3FG9A 1SB9A 1Y1QA 3K58A 4ZO9A 2WSLA 3E5RA 1NVVQ 5BXQC 1B41A 2UVPA 3ADBA 4F06A 2CVOA 2IYUA 4JUCA 2ZTSA 2ERCA 4MGEA 1QU9A 1RQRA 2YJ3A 1IWPB 3ZZMA 1SXGA 3EGEA 5L4LA 2IJJA 1Q21A 1M1KW 4XTCS 3ZGZA 4H1WA 1C8LA 3MMSA 1WBJB 3L46A 2AG8A 5E2IA 1ECFA 3RTBA 1GSIA 1AJPA 5FOQA 2X8AA 3K35A 4ZT3A 4DV2B 3NBKA 4HQFA 1D5CA 1GA1A 4UM8B 5HRAA 4FMBB 4JOCA 4WN3A 4Y9UA 1O3YA 2LE0A 1ZMTA 4GR4A 3CNBA 5B3SB 1O96B 2RAUA 3RT1A 1IXYA 3CVOA 1WHTA 4ZOBA 2UUCB 3VNAA 2A5YB 1SKVA 2QKCA 2Y4NA 4DKJA 3MUOA 4QRDA 5EHIA 3KVVA 5CFLA 3K4PA 3I5XA 3KAKA 1A69A 1RWNA 1UPTA 3VTFA 4DM7A 4FLEA 4ZHYB 2E76B 1VE9A 4RHAA 9LDBA 1IK4A 3QI7A 1YV9A 3A6HA 4KSCA 1LZKA 1L1EA 3GT4A 1C9JA 4G86A 5B1HA 1JT2A 4KMOA 4I4IA 2ETXA 3FUTA 1VQVA 3Q12A 3Q7RA 2V7EA 5CVUA 3RODA 5DEIA 1C1HA 1K06A 2PIAA 4BRZA 3UGQA 1QAHA 1CZUA 2ASEA 4G85A 3ROPA 2B1QA 1IBRA 3WWYA 3Q6IA 4CM9D 1NUUA 5GMOA 1RQNA 1USIA 4QIHA 3H5OA 2I6DA 5CBKA 2QX8A 2CJFA 5DN6D 4FYMA 3TPCA 2VTDA 2VF5X 1VCOA 3CGGA 4FEYA 1SXIA 2HOQA 4HDKB 3HBJA 4LF6O 1XZIA 3M9WA 4PXSA 3C5VA 1KVUA 1LQ2A 3TLBA 5JH7F 2VUTA 1E0KA 3GG9A 3WOHA 4KVGA 1N4AA 3BGVA 3JQRA 3K6SA 4C1BA 3FB7C 1AUXA 2AT1A 5JD4A 1Z7BA 3AR5A 4YAKA 4MDEA 3V2IA 4QZVA 1TYDE 4HDAA 1X14A 2I2WA 1JT9A 5GGXA 3RSCA 1Z0UA 2A5LA 4JEIA 2PZ8A 3L7JA 1JHRA 4X97A 2VJDA 2X5KO 2P9ZA 4KE8A 3R9XB 1VE3A 4W5OA 4EO4A 3A1CA 3B2EA 3ONEA 1QPGA 2DWQA 2LP7A 2BDTA 5A3SA 2GAJA 3EZ6A 4XTRA 5EE5B 4QFBA 1UKAA 3C5HA 3K73O 1RHQA 5KTSA 4BIIA 2R8XA 3QW4B 4B6FA 1ZEJA 1B3QA 3DLTA 1I33A 1BWPA 4G5FA 3WFJA 2UDPA 1XMQO 2HXGA 4N5LA 3L0BA 4LCBA 5DX1A 1FRVA 2BEKA 2NU6A 3GDHA 3EZYA 3NTQA 1G21B 5CDHA 1J2TA 3Q10A 2R9IA 1ZH8A 4BJ5A 3ZUGA 1FNDA 3WIVA 4QGAA 3HV0A 2IW5A 1X7WB 1UMBB 2Q41A 4Z8YA 2O8NA 1SKUA 2AN5A 1TQDA 2HKOA 4IZ6A 4FNMA 2YRWA 2X9NA 3AJ8A 5ITZA 3NWPA 1B6QA 4F3YA 4ZAGA 5J9PC 4URFA 3ISVA 4LZOA 4XGKA 4J7KA 1G98A 1ROPA 2ATEA 3JQAD 5FUYA 3LX8A 1WZNA 2RAFA 4EZBA 5LKRA 1XUQA 2YFYA 3S1LA 2OB2A 3LP8A 4YUZA 4NAVA 2PL5A 4UOZA 2FDRA 2Q3CA 4C2TA 5GTHZ 3Q8XB 1MPTA 1ECJA 5LMZA 3PIRA 3CF6R 1XU9A 3A0BZ 1VZ2A 3PDWA 4MH0R 3VMMA 221PA 1GTZA 3JVUA 3BE6A 3GG2A 4DIDA 1P74A 2UU9O 1WSWA 4KR9A 1T2AA 4YRAA 2A78A 4LF6B 3O3MB 4TLBA 4JFAA 1H05A 3A1WA 4GI1A 1NN0A 2WOJA 3I6YA 2Q0QA 1TUEA 2OE2A 2NZ8A 2J0EA 1JPXA 4X00A 3V4DA 3GQBB 5EG5A 2YQ5A 4DA8A 4O0MA 2VHCA 1SOUA 4ZJYA 4NENA 4AM8A 4KWTA 1WA8A 3PICA 1U28C 4LF8O 4TKUA 1KK0A 5JH7B 5DBFA 4HNVA 3PE4A 4QBHA 3N8HA 4FR5A 3DAGA 3PQ7A 4KQ1A 5TGDA 3K0DA 1MO6A 2C5GA 3CISA 4UVHA 4CIWA 2BGJA 4PJ0Z 1OQAA 2X15A 4E3ZA 1VLMA 3T9FA 2EP5A 3X2QB 1BX0A 1XMQB 3UA4A 4KQWA 3JQAB 4D0GA 4NDZA 3O8RA 3ZJUA 4OMDA 1BA2A 1USVA 3L8MA 1V1JA 5FD8A 2V3VA 4MIYA 3DUFA 2JFWA 3J7AR 2B8EA 4Q3EA 4B35A 3K9WA 4HDSB 2WD9A 3PYMA 1I4LD 2Z01A 4YRZA 1IV3A 2C2MA 4RWZA 3IQHX 1SUWA 5CD9A 1R0YA 4RV4A 3CCJF 4N3GA 2PXAA 3LK7A 4R9RA 2CJPA 1O0SA 4M60A 4QUHA 1Y6RA 4QGGA 4RHXA 4D3ZA 1KWKA 1E61A 1P18A 1YACA 4F2WA 1W5EA 4MVRA 2I2BA 1LPSA 1R9GA 3SNKA 1IBCA 3WWOA 3GLKA 3RM3A 1OFUX 1SQ0A 3PHIA 4DA4A 3TLYA 2YZGA 5F12A 4YO7A 1C3OA 4PGHA 1PTJC 1NULA 2B33A 2Y69C 2FN9A 3C70A 1YZGA 3FPCA 4TXHA 1VCMA 3Q9NA 1Z36A 1JDSA 3H8JA 1YR7A 4E70A 3AUKA 2UU9B 5B36A 3J7TA 4Q7KA 3G89A 1N9GB 1NN1A 3DBOB 4G65A 3QNEA 1WUKS 5HZMA 4ARBA 3B20A 4IDOA 1XCJA 3V1YA 4EDHA 4Z53A 3SXUA 2AK3A 3C7AA 5BSRA 1ZW6A 3OPNA 3E9MA 3AM5A 3PRYA 4XWAA 4D0LB 4N0PA 4CE6A 2Q45A 3QKSA 3IVGA 4WJZA 4DMMA 3OC6A 2AFHE 4FGLA 1EP2B 2E3JA 2Q3DA 1NQUA 2ZAGA 4M1KA 5K8JB 2WPDA 4B8ZA 1FMJA 2YXDA 1C7ZA 3RAJA 3FYUC 1KNJA 1RXCA 3VGPA 2VPZA 5E7IA 1VA5A 4LF8B 2VYFA 4L8LA 4EI9A 1JEQA 5KOIA 1SC9A 5K0GA 4U5QA 1SEVA 2CHSA 3IAYA 3B60A 2VJLA 2XAQA 1IHPA 3W5IA 1DG1G 4DLXA 3R7LA 3WDKA 2V55B 3VNVA 1ND6A 4F93B 2QAIA 1HLGA 3P19A 2AEEA 4DCVA 2JIZG 2Z6AA 2ZCEA 1XTZA 2AKEA 2H4YA 3HYLA 1JJ2U 5K0EA 2M1XA 3FZQA 3TLZA 3CPQA 4R2XA 2YJGA 4NZOA 3LT2A 1A1SA 3HHPA 3KU1A 4LTNA 3RC1A 1XI2A 2QRQA 3CP1A 4HFNA 2Q73A 1BQEA 3SC4A 3FXAA 1SK9A 4X61A 1PD1A 1KMHA 3DMNA 4PYQA 2CY0A 1EAMA 4EX6A 3NI2A 4C4ZA 4IDDA 2G8LA 3CH4B 4YASA 1NTMH 2PGDA 3GRYA 4GOJA 1YBHA 4YREA 1DWOA 1SD1A 1ZWLA 5IC4A 3B7WA 1E7YA 3AY3A 4AWXA 5C7YA 1GQYA 1I7NA 1J2UA 4ZHQB 4P7GA 1L7AA 4L9WA 3S0JA 1KEUA 2IZ7A 3T3OA 2JD2A 1MO4A 2LW1A 1Q15A 3A1NA 2VTBB 1E2MA 5U9CA 2RG7A 2VF8A 1NVMB 4J29A 5FL7A 4AZ0B 2P9HA 3EB9A 4B4UA 1ENVA 1DMRA 1BGVA 2GO1A 4P4UA 2X6TA 1COMA 2Q50A 5H9VA 4FDVA 4OHZA 5K0JA 2RGGA 4UBLA 3QEMA 5K20A 4UHHA 1V7ZA 4BAGA 1Z8HA 3N9IA 2Y66A 1ZD2P 1W25A 2Y4UA 4CKWB 3MRXA 3ZHRA 1GCAA 5JMTA 3GHHA 1WDLA 1M2KA 4NTZA 3W9UA 2DE0X 1UBFA 4HC4A 5DOZA 1A5SB 1BDMA 1QR9A 2IHZA 3CSSA 2KX7A 3ACDA 3J7AC 2QMHA 4A8TA 3FFTA 2ZTUA 1GDHA 4N23A 4MMXB 1L5NA 4CT4B 4XYLA 1G59A 4C5AA 2FGYA 3GMTA 1GNSA 5CU7A 3AHIA 1PX2A 3ZXXA 2ZJ2A 2M1ZA 4UKDA 3OWOA 3AW9A 4H3VA 2WG2A 3IT2A 3FHLA 3FMIA 3UK2A 1KRXA 1W581 3DYIA 1KOFA 1CVLA 4RJIA 3RC7A 1NVBA 3EMKA 4KBFA 4EJ6A 3CZ5A 3PRKE 4RDIA 4ZT5A 5BSMA 1VKJA 4RVHA 4A8JA 4R01A 1FLNA 1JLSA 1SKMA 4RWEA 2MYNA 3I2HA 2W42A 1A4UA 1AU9A 4JI3O 2QQGA 4TXLA 2FW8A 2Q6KA 4RV5A 5BV7A 1ZIOA 4BPBA 1H2ZA 4F84A 1WUJS 1QH0A 1DXYA 2GERA 4RKQA 2EWMA 3NTXA 2J09A 4URVR 4ZYXA 4NMXB 2RHDA 3N8IA 1MB9A 2JB9A 2J6BA 3K71B 2F23A 3I23A 3TR5A 1FYWA 3KUDA 1G8HA 3KOYA 3UF0A 2XUOA 1P3JA 5B5EZ 4EVIA 3O83A 1F0PA 1U3TA 1SIOA 1X80A 3KOMA 6YASA 1PN3A 1S7GA 4MB6A 4RIFA 4Z9BA 3CIFA 1Z9BA 2JI4A 4D57A 4A7PA 4ZPXA 4ZANA 1YIAA 2EBOA 1VQMF 3PYLA 3D1VA 2V7WA 3WTCA 3I0NA 5C8YF 3NTOA 1JXQA 3AG1C 1K88A 5ADHA 1ZVMA 4KN5A 1GD1O 1Z2AA 2BBOA 4Q3NA 4TKVB 3TUIC 2DYSB 4R2JA 2BKEA 1I01A 2QN6A 4MINA 4D8TA 1VHQA 4ZC1A 4HVTA 1N9KA 1A2QA 4B3DA 5AH0A 1SC3A 2JJ1G 2QTMA 2ZB4A 1OBOA 2DFTA 3QPBA 2B36A 2R00C 2M98A 4EW2A 2NYUA 4D6PA 1L7RA 1P6UA 4ERXA 5AXCA 3W7VA 1F4MA 3BWEA 4Q9JA 1EVJA 4HPXB 3UEOA 4MLPA 5IJ9B 5BWCA 5CYFA 3PGVA 1UMCA 3M6WA 3INTA 3N8GA 4GECA 3T7SA 4XIYA 2ODEA 5CNMA 5E2AA 1E32A 1RYYA 3AR9A 1EXNA 1ZK3A 3AM4A 4PWZA 4OLBA 2P3QA 5D01A 3RA5A 2FMFA 4LXGA 1W34A 3GELA 2QJFA 2JCGA 2DCUA 4I50F 4WSOA 5FYDA 4I14A 2RK3A 3HACA 4N18A 1D9ZA 2W6JD 3HWRA 4JI3B 4I5EA 4G4GA 3GRFA 1LR1A 2ZP1A 2A7WA 3EIQA 2RNBA 1LLCA 4R8SA 5IXSA 4C4XA 4LDAA 4XIIA 2G1UA 1O9HA 5LZ9A 3AI7A 3RSLA 3ROEA 3W8EA 2WP8J 5SYAA 1FDSA 2Q5ZA 3EPPA 3KUXA 5J58A 2PX3A 1WG8A 3H17A 2O1EA 3OKFA 4JYMA 1QR8A 1BOOA 3WKAA 1CQJB 3ESYA 1MC1A 1T15A 4QLOA 3LPLA 1EUCA 4PCAA 2B69A 4UTOA 1ONBA 1B8PA 4C01A 4CUZA 3WP0A 2QMUA 1TEHA 2IH4A 2OBFA 3KO8A 2FXVA 3S1AB 4B3JA 2NZUG 5HIIA 2PF4E 1WB5A 3CYFA 4L2IB 1QQTA 6LDHA 1PWHA 4M55A 5F2OA 2EJVA 2AOUB 3KTFA 2QGZA 4DB2A 3SF8A 4EWLA 5ADVA 5AW0A 2BW0A 2APJA 2D1RA 5GPBA 5GV8A 4CM9A 1WB4A 3PJGA 4LV8B 3TQQA 4V0LA 2Q5IA 4EQ6B 1DT5A 3VYSC 1XRLA 5ITWA 3D8HA 5LWQA 3TJTA 5DN6A 4DR4O 2X9QA 4U9IS 2IZOA 4QPDA 4YT5A 4YDSA 2FMHA 2GUZA 1GY8A 5C8YB 3TF5A 1DX9A 5EXPA 1CJSA 2VEDA 3U4CA 1HKHA 5TNXA 1PFQA 4D4LA 4UTPA 1VQ9V 3IO5A 1JZSA 3S06A 4UZSA 2IDJA 3OIWA 2UYGA 4QOGA 4MUYA 3DSQA 3VAZA 1COWG 3JYOA 4JZ2A 5DVZA 3ZY6A 4PZZA 4ZAWA 5CVJA 4CL0A 5KC9A 2HHAA 5EXTA 1CJTC 4WGFA 5KA5A 5CIWA 2NV0A 4R2LA 2XUGA 4OD0A 4TWZA 3B3GA 1OYWA 1RPOA 1WB8A 1MZEA 1XQ9A 2QKAA 1H0SA 1K7XB 3GUHA 5THQA 1IBLO 4RJTA 2WSSD 1OV6A 1UC9A 2NVWA 3G17A 3DNFA 1RACA 4R3UC 1JAZA 2FMTA 5A9TA 3TQFA 3HBMA 4OGGA 1OT5A 3O8LA 4D7SA 4XJTA 3T5DA 1BVUA 5AMXA 2AG1A 1O4VA 2FV8A 2ZWIA 5KMGB 2ZUWA 3R4VA 2QN8A 4Z7OB 1K4KA 3ORQA 4G84A 2EILB 4RD4A 2D0IA 4DCOA 4K0KO 3WGUA 3JQGA 1HDXA 1EX6A 3LT4A 3D6TB 3E15A 3IIEA 1YB1A 1DKUA 3FZYA 1GGVA 4UVBA 3PYXA 2BFFA 1XV2A 4EGFA 1GN2A 2QUBA 5KYUA 1K3FA 2HDNB 3PLNA 1W8DA 1KZYC 5E8JA 4U7GA 2NYRA 1KYYA 4DM3A 2VQ3A 3ZDXB 4M1OA 3DT6A 1RXWA 2FI1A 3FWHA 5FLKA 5B7QA 3UXHA 2ZSBA 5HMMA 3BWXA 3KJQA 3M4NA 3H2SA 5ALIA 2X0NA 4JI4O 2F4VO 5CLFA 3PQDA 2E2WA 4ALKA 1GPNA 1S8OA 4OGFA 3SYTA 2QV7A 1E79G 3THRA 2AS0A 3VYTC 4Q1AA 4X91A 4JJ6A 2D2CB 4MK4A 2ZDIA 4BN0A 2HA4A 5AKZA 4OHBA 3C5WP 3NTLA 4ENRA 5AYVA 2XAHA 1P73A 2Z5UA 5EKDA 3RGGA 3U3XA 3JALA 3ZMUA 3OETA 1PK8A 2PKCA 3E9QA 2PUGA 5HKBA 2AQKA 4DR4B 1GX1A 1IXZA 1PBTA 1URPA 4YDHB 1W9MA 3QKRA 1KJJA 1HNNA 1U2EA 2NTVA 4IOKA 4FWBA 2UZ1B 2G08A 1H9CA 2OKGA 2PS9A 1V8BA 4NWIA 1HXHA 4B5KA 2H07A 4ZEXA 1Y89A 2FPIB 3VR5A 2GVNA 3OQMA 4MUXA 3BKXA 4BFLA 2V8OA 4QQRA 3CC4V 2D8AA 1PDWA 1OUMA 1IXRC 6CHYA 4D79A 2RBKA 4PWTA 3UWSA 5DLEA 2H5JA 1GCUA 5EIHA 4S0ZA 4MRMB 3O7WA 2P9FA 5TRTA 4XA8A 2JLAA 3BD7A 1THZA 4MQLA 2Z1EA 1OYOA 1L0BA 1E2QA 3U4DA 4FFSA 2BFWA 1IBLB 1CDEA 4Q6WA 4B3RO 1NVDA 4PA9A 5EMMA 1PR0A 4CT5A 1AB3A 1H3NA 4AKIA 4CV2A 3EVEA 1FVFA 2J85A 16PKA 4PQRA 2CLIB 1I4OA 4E2WA 1ULBA 1PGOA 3B7PA 5H3LA 1SWVA 2ZAIA 1FMFA 3KQTA 5LPNA 2X4GA 4G5GA 2OCPA 3OOJA 3S0YA 5B8FA 2GNPA 2RGXA 2V4MA 4Q1BA 4K0KB 3MWEB 1TEZA 1Q1GA 5IYDO 1QK4A 2HFEC 4B2YA 1R74A 5B6PA 3I6BA 3HVRA 3U17A 2Z5VA 1UBJS 2Z8ZA 2PUAA 1R8JA 1Z74A 4REQB 1P4JA 4PBSA 2PBFA 4GW3A 4YAFA 5MDHA 2YMMA 1BHBA 5GANK 4ZHVA 5K4HA 3HKCA 4ZVKA 4E1AA 2WJJA 3TIXB 3KDPA 5HGJA 1TTHA 4B3HA 4M99A 1T8SA 1S3JA 2GBOA 2OMKA 2RJ3A 4BO9A 4TSKA 3BFJA 4CNQA 2E89A 1Q3KA 2OC4A 5JC8A 3QWBA 4JI4B 2F4VB 1DRKA 2AN4A 4YRBA 1T5SA 1JTEA 1IM2A 2KE5A 5DCUA 4A6DA 1IUKA 4ZVLA 4R31A 3KHSA 2PLRA 2XZLA 1SOVA 3OEHG 1KC1A 1G6OA 1AUOA 1UAAA 5CFRA 5J1TB 5HZKA 1H42A 1JG3A 1CNMA 4KLAA 3ROKA 3F6EX 2H4XA 1WNSA 5J2TA 2F93B 4BEVA 3CURA 4LCUC 3EWNA 3MBKA 5B37A 3EGDB 2H8EA 2HPAA 4JBGA 4EIWA 2GTAA 1UK7A 5JSFA 3D6UA 1S5JA 3DXYA 3UKDA 2AMFA 4XQ9A 3K0AB 5GVSA 4KE7A 3H97A 3EC2A 1NF9A 4YR9A 4WPGA 1ZSYA 4P36A 4UBMA 2WIBA 1UPXA 1ORTA 4YAGA 2F8LA 2X2PA 3KPVA 4RE6A 1C1DA 3KEQA 2EJWA 4Q4JA 3WK4A 2OXCA 3I05A 3G6WA 2WJHA 2YTZA 2H2FA 4KK4A 5KSOA 3JAWB 4A36A 1V43A 3RBVA 3RT7A 5J1SB 4B3RB 4GX0A 2DQ0A 3G9TA 1A4RA 4EPWA 3LO8A 1TJ4A 3M0EA 3TOVA 5BW5A 2ECKA 2NO7A 1Y3IA 3VR4A 1SPBS 2JGEA 3LDTA 2JZOA 1G5IA 4RVCA 3RPEA 2XSZD 3HEMA 1P0CA 3QA3E 3RJZA 1E99A 2FR8C 1SB8A 3P20A 4KPGA 3OJLA 4W99A 3EPKA 3RNOA 3ESZA 3ETNA 3BF8A 4WBNF 4TVBA 4EP1A 3CJQA 3P3PA 4EAQA 4GPD1 2V6BA 5A9SB 4LK3A 1JMVA 4J9UE 4X8AA 4HOYA 3ZMSA 1G4AE 3SBXA 2QXUA 5HP8A 2IY7A 4RANA 1Z0FA 2YI8A 5D86A 1U7PA 2QXTA 1CEXA 1XA4A 2P2ZA 1VEWA 4NX2A 4MUFA 4TT3D 4AZVA 1CR1A 3BTUA 2O06A 3A28A 1NZ6A 4RJJA 4OLFA 1YDGA 3MB8A 2HCTA 1XU7A 4CV1A 1FTGA 2EYQA 3VDRA 2ZQMA 4QASA 1E1MA 5FV7A 4WAUA 1QZZA 4F9TA 1E5DA 3SG0A 1DXQA 4Q47A 1PU2A 2ZQZA 2W8BC 3SM9A 2ZBDA 4YP6A 2HJFC 1FFYA 4MW6A 2HD4A 1R3KC 2MK3A 3WGOA 1VGRA 1FP1D 1M34B 2Y0EA 5B3JA 1K0FA 1W29A 1K5QA 4CMIB 3TVYA 1FQKA 4WY5A 3D9QX 3HAXD 2EBFX 4QGFA 1LZLA 3G5UA 1Q3HA 4S04A 1T5DX 1Z5WA 2JIDA 4CM6A 1JVMA 2J33A 1NG9A 1KI3A 3DVAA 4NZZA 2XUHA 3D3QA 2R79A 4M46A 1VCIA 2VQSA 3P2MA 2K4MA 4IV0A 4L0DA 4UNIA 1XUOA 2EJCA 2HZBA 3AEQB 5CB8A 1SFRA 1P6XA 1UMKA 3IMGA 1THTA 4GOND 3LYLA 3H13A 1N77A 1PT5A 4HFJA 2EX1A 2XUJA 2XOKD 1XL1A 4ER7A 3BWVA 2AC2A 1L8QA 2AR0A 1CEZA 3GLHB 2YYZA 4IL5A 1KF0A 4RL4A 3ML0A 4N82A 4RF2A 3NK6A 4KDCA 3G68A 3OF2A 3ICEA 2RBEA 1Q1AA 3C48A 1E8NA 1WMFA 2EHJA 2JEXA 1WD7A 1EI9A 4Q9DA 1S8FA 3UJHA 4DT1A 2QLMA 1DTWA 1Y6GA 5CW2A 1BCRB 2C8LA 2P5TB 4UBKA 4BAUA 1N1EA 2NSLA 3K30A 4RO0A 4DQVA 2AHRA 3VPAA 1N5OX 4RK5A 4WH0A 2GCGA 5AVUA 2UVQA 4E1VA 2EW8A 3DXFA 2PQ0A 1T3HA 4UZFA 5HNKA 5JNVA 3EZFA 2XZOA 1AQYA 5FWYB 2BR3A 5JFGA 3EFOA 2PYDA 5AVZA 3TBFA 4R40B 3UXEA 1IM5A 3IRUA 1OY1A 3KWLA 3V3TA 3D4BA 3K4HA 4CLOA 4X3MA 4WBNB 4B4VA 3D0RA 2F48A 1BS2A 3WHPA 4P34A 2HDOA 4LF5O 4RPLA 1IXBA 1Y5RA 1U0BB 4WLUA 1G8YA 1AB6A 2NW6A 2ZXEA 4N5DA 1DGQA 2ABWA 1JDNA 1X1EA 4ZKDA 3JVEA 2J3HA 1LDNA 3I32A 3LTNC 1H4TA 5AVRA 1XVVA 5F78A 1GQOA 1C14A 2FNAA 3K7EA 1Q12A 3AOEA 3L1KA 2YSUB 4M36A 4L4YA 3SPJA 1X1TA 3T5GA 1QQAA 2ORIA 3AR2A 1U0GA 2Y69B 2A9PA 3BUSA 4OO3A 5JD3A 1PP4A 4E2FA 3K9QO 1XJ0A 4BLSA 2E82A 3HO8A 1QSGA 1QFJA 1QIIA 1PIWA 1KO8A 1ZU4A 4TUYF 3TTUA 2I80A 5F9FA 2KWIA 2CSUA 3FNQA 4XR9A 1IB0A 2CHQA 1G8JA 1UWCA 4TN1A 3PKJA 1YA6A 3IVRA 1QORA 1KYXA 2GHQA 3G2MA 3FWZA 1Y9EA 3HUFA 2F1RA 5JIBA 2R6R1 3T3MB 1UUFA 2XCIA 5JUWA 1B0ZA 3JSLA 1ZAKA 3MLAA 2C58A 1O58A 1M7BA 4E12A 3GUVA 1S5HC 1Z47A 5B66Z 1JKMA 3OTOO 2GPWA 1P1HA 3VVMA 4CUKA 2O59A 1SUIA 3FYUB 3D6NB 2P8JA 4EI7A 3B2QA 4UHEA 4HJRA 4W82A 2YC2C 3DMTA 4Q9IA 4FLZA 1ZA1A 1A8IA 4KBYA 4RIGA 4LF4O 1BCSA 3R7FA 2WWHA 5ECGC 2VJKA 3BD8A 2XECA 1YOBA 1M67A 2ADFA 3D3WB 5ER6A 2V9ZA 4XGQA 5FHRA 4BBPA 1JLKA 4GM1A 3DC7A 5F35A 1B00A 3AVXA 4DSAA 3AH8A 4HMQA 3LCJA 4PHZA 1LRJA 1OBHA 4FHFA 2VYQA 4G4WA 4KPYA 3UCFA 3IJ4A 1Z2CA 2NUTB 1QAQA 2HAEA 4H4EA 3BKWA 1HTWA 5DGTA 3UPUA 2FSSA 5BR8O 1XDCA 4FNGA 4NCHA 3RFTA 1NMZA 1ML4A 2LKCA 3OE5A 3CJTA 4M53A 2QRHA 4JJZA 3K3PA 3UWPA 1W0CA 4KOAA 3WLJA 1F4VA 4MVZA 1TKAA 4PYNA 4AJIA 2GARA 4GZMA 2JCBA 2IQ5A 2JNWA 1JPJA 2GOYA 2QNRA 5IAGA 3EPRA 1PDVA 3QK7A 3K2XA 4C0QC 2H1IA 5KYVA 2QNBA 5CVVA 3FPIA 4DBLC 3BH0A 3SX4A 1RWKA 4CEJB 2JAHA 3CHXA 3I9V6 4NCIA 1E62A 3W77A 2CGNA 1WVGA 5B1YA 1J9GA 2GYVA 2ZITA 4Q00A 4HNHA 3AGQA 3LWZA 1QD9A 4JLUA 3NATA 2ODPA 4B3IA 3IAUA 3A26A 1YJAA 4M49A 2FW9A 4YROA 3SQLA 3W5BA 3AV0B 3QVVA 5BT8A 3TG8A 4RGVA 5CEJA 2YJ5A 5DRYA 1QPZA 3K0CA 4YK7A 5JG7A 5AHXA 4DQUA 1N2CE 2IDMA 2FFJA 3FVVA 9GPBA 5IM4F 1NJ6A 4QGPA 2OV8A 4MP3A 3O31A 4ZK2A 2WD7B 2HWWA 1K08A 2Y0CA 4TUYB 3OOYA 3OTOB 1V3UA 2WMYA 2YXBA 3HJAA 2Y27A 5DLPA 3DXXA 4WFEA 4PZ0A 4CODB 1KD1W 4FHGA 4TXNA 4NECA 4LF4B 1NP6A 1T6NA 1Z3CA 2Q1YA 1B2RA 4EHFA 2UUPA 3TIVA 3QLVA 1S9HA 4QHSA 1W94A 5DM6V 2FJUA 2R97A 3K0KA 1DADA 1AVTA 1G2PA 2HK6A 4RSMA 3GFQA 3JZDA 1W48A 5JRZA 3WWEA 4MGKR 4YXFA 3VHXA 1KAGA 1QGZA 3C41J 4YBZA 2WSSA 1V6AA 1MDBA 4L8GA 3NNDA 3O95A 5BV0A 3MGCA 3I83A 4UJ5A 4HUJA 4J0CA 4JJAA 5BR8B 5B6JA 3R3ZA 1VQ6F 1LBIA 5DXAA 4ZREA 1OLSA 1VBMA 3NGXA 2ECQA 1T2EA 4QE3A 3EIEA 4JY7A 4UBIA 2O6HA 2NUAB 1AKMA 3G8AA 1VF6A 1IATA 5I8WA 1F2VA 1RYHA 1E94E 3R7WB 2C5EA 2QTGA 3RFUA 5I7VA 3E70C 4RH1A 1QO7A 2R72A 3RRFA 3LUAA 4BW0B 5J5CA 4P93A 4BX9A 2BZ0A 3NIDB 3MUNA 1XK7A 2Y9PB 4MTLA 3CCUV 5H5NA 3NYWA 4P8RA 1TUBA 3QJYA 3CZ4A 3O1HB 2BHNA 3TZBA 1DEHA 4DJJA 2ZRBA 2ZROA 3ZU2A 1BH2A 4A03A 3DS8A 2G5PA 2B9ZA 2LBWA 4JBYA 4R2HA 4RJ2A 3VPGA 3TEMA 1PGJA 1S3IA 4EVQA 2NZJA 3THYB 4LH6A 4DY6A 4DLUA 1KBHA 2PUJA 3RFRA 3G2HA 2Z56A 1PQUA 5JROA 3H1LH 2PT6A 5BN5A 4EW1A 1SKYB 3GLGA 1P4RA 3FUUA 5FNZA 1ISJA 3E53A 3D7KA 1XEFA 1KQFA 3AG1B 2PJUA 2I62A 2VS0A 5KAFZ 2A88A 2P9QA 3NCTA 4HNAB 1L4UA 3VPCA 5L51A 5TMEA 4OFXA 2J0UB 4AF8A 4RPKA 3EZNA 2R5FA 2QORA 1RWMA 4EL5A 4O4LA 4IIGA 4OBBA 3C3MA 4H0CA 4IIFA 4WNCA 1JE0A 3I52A 2Q3BA 1CZKA 5JXHA 1B06A 1L7NA 4GZLA 3WXMB 3RVNA 5H0IA 5KYYA 3M5PA 3K8ZA 3KTAB 3KVYA 3IAAA 5CX4A 2JD1A 3LLMA 1R00A 4XSVA 3AUXA 1J8FA 4K1XA 1VPEA 1Z2PX 4BO5A 1PTKA 1S2DA 3TZEA 4WFIA 1C4WA 1KYVA 1I2DA 4MW5A 4IFBA 4NMHA 3H5TA 1WBDA 1VP9A 4Y9DA 4JTDB 1FVXA 3CSUA 5JCJD 1GYQA 1FU7A 3PE6A 5KX5F 3NV7A 4EY5A 2BSXA 2JHGA 5IJXA 5EPEA 2UUAO 2I6QA 2HHJA 3ZDYB 4OHUA 3GJSA 1BEUB 4KN8A 2H6LA 3H1BA 4Z9AA 2WNIA 3ANLA 2HBYA 4BGVA 4WZAB 5FPQA 3B3QA 3WLAA 3H9VA 4N21A 4KL1A 3VUFA 3ZN0A 1G7TA 2YICA 3OFSA 4QPNA 1WZUA 4E6PA 1BMFG 3UT6A 4OAPA 2CHFA 5BW6B 3X1JA 4URUR 5CDGA 2DWUA 2RGYA 1NMXA 3ASZA 3U49A 3NM4A 4EJMA 2WB4A 5DNUA 2ZSKA 2QG6A 1MOZA 5EWMA 3UA3A 1QHHA 2X8JB 4XKJA 4EFEA 4TMKA 1I9GA 4K3AA 4JI7O 2PV0A 4L1KA 3HH8A 4GLXA 4DA7A 3OE7D 2HNAA 2W6PA 3EVNA 4GI5A 3FCEA 2A0YA 4HDOB 4MWCA 5TVGA 2ZJYA 4ZT6A 2GEUA 3BXGA 2ORWA 1WZIA 5KQLA 2WHYA 4UCQA 3ZZ1A 1WP4A 5HUHA 2VXBA 1QGED 3JU3A 3D01A 5CLQA 4BLUA 1C8KA 4WKNA 3SJBA 3R6LA 1ZNXA 3PJSK 5FLEX 4B8YA 1QGUA 2CV0A 1TVKB 3QYAA 4DLKA 1S01A 1M8GA 5LMUO 2JAWA 2RJOA 2C2YA 1AUVA 1ZUIA 2PG3A 5ICFA 3REOA 3M4ZA 3UQ8A 4F0JA 1H2NA 2C83A 2XTMA 3RHFA 3VYSB 3TPFA 4U3JB 1GRNA 3CLKA 3E9DA 2FW1A 4X41A 2D7DA 1J0CA 1A2KC 1LPMA 4HO1X 4JPRA 1WB7A 4IVRA 3PXGA 1RP1A 2OO7A 3G9XA 1HDZA 3GFVA 4Q21A 5HQ3B 4BGIA 3PC7A 1ZP6A 3ABZA 4C2BA 1XOUA 1ZN2A 1DIRA 5T5QA 2L35A 3CNLA 4RU1A 1PYOA 1D4ZA 4JLWA 3IBTA 1G9TA 2WYOA 5BMVF 2PO7A 4NONA 3K9BA 2UZHA 1KKLA 1EG2A 3HP7A 2HWUA 3DDWA 2PQMA 4GWKA 3HJGA 4PYKA 1HDEA 2ZIGA 4YGXB 3QBEA 2NXWA 2UUAB 5FWNA 2RH8A 4MVWA 5CJ2A 3P8ZA 1V9PA 3TN7A 3ZCUA 2P30A 3DHEA 1UBCA 2R11A 4DRYA 1M1NA 4RJLA 3F5SA 5BSWA 1T4GA 2BI7A 1SD5A 3E9RA 2RONA 4AY2A 1BE3H 2H4FA 4O4IF 1F4NA 3OONA 3EW7A 3LA6A 3CCQF 1D0IA 4P3OA 5KHLB 2IW1A 5KX5B 3S27A 1LBTA 2C9YA 1N2GA 4IGFA 4AJ4A 1LU9A 4CKCA 3I73A 1SR8A 1NONA 2GZMA 3WNVA 2CFIA 4F4IA 1FDUA 7ABPA 1DCMA 5LYJA 2IP2A 4JI7B 1KI8A 2Z4RA 5KOJA 2DJ5A 2C0QA 3OOWA 2MSNA 4NE9A 4FE7A 2YJTD 3WJAA 4G9EA 1HMYA 5AVXA 3ORHA 1EB8A 1FY2A 3V2GA 3VU0A 3HVJA 3HYRA 4ERHA 3HZOA 2NVUB 5T4BA 1T1JA 4QG7A 1AKTA 1B14A 4EJFA 2WQ6A 3F5QA 2FKAA 4H4CA 4IDGA 2D62A 4YMLA 4CQLA 1OH7A 2B5UA 3IMPA 2R85A 3WTBA 4U8GA 1T5HX 2FEKA 5A0TA 1U04A 2R84A 1U7TA 5LMUB 3VYTB 2W6OA 4J07A 1XVUA 3C0KA 4RA9B 4XUDA 2HGZA 3WG7B 4Q1EA 4KVAA 4ATNA 1K98A 3B9PA 3C1TA 2HU7A 1SZDA 4IOLA 4PLCA 2XIQA 2YN2A 2ADMA 4Q6GA 3ZLVA 3HXLA 2Q5CA 2NSDA 2I4RA 5JFOA 1DAKA 3RBAA 3JZFA 2QUJA 3BL8A 1OAAA 4IUYA 1L7EA 5CDFA 2R8ZA 2XRYA 5HP7A 3QJ5A 4PSKA 4LBVA 1KO1A 1MR3F 3MJFA 1BD3A 5TQ0B 1YVUA 1E3WA 4S05A 2WSBA 1QCYA 2X58A 3ASNB 2JKVA 2HP3A 4MB0A 3ZH9B 5EWLB 3HCRA 1GPMA 2XOKA 4DJFC 2JPDA 3O9OA 5IF3A 1U9YA 3AETB 1ZM7A 5J3JA 5A5VA 4RFLA 3BIXA 2R1TA 1RPRA 3SYKA 2W2MA 4A6EA 4HSEA 3MCWA 2PEYA 2C1XA 2WSIA 4JXXA 2E74B 4A4DA 1SU7A 2YJ4A 4B6GA 1ZH6A 4ZU6X 1G42A 5F9HA 1F6BA 3AUJB 3H8WA 4PV1B 2G1AA 1KE1A 3E3AA 2Y1XA 1XBIA 4NU8X 5BMVB 1PD0A 1W7AA 5DK4A 5KQRA 3HFRA 2AJDA 2CV1A 4INZA 1QANA 5HFNA 1D4AA 3CX8A 3WA7A 2AR7A 4UEWA 2I5PO 1G7CA 2VHYA 3EEQA 1OX4A 3PJFA 2A1TS 3V8NA 4AU1A 1RAGA 3MS2A 1AA6A 1ZH4A 5ESDA 2R8PA 2PUCA 1N92A 1XDBA 7GPBA 3H6KA 5EP2A 4HH1A 1VHTA 5D87A 2OTJF 3R0JA 4ICGA 4O4IB 4QTUB 1VYTA 2O05A 3SE0A 2VT6A 1H1DA 5IBCA 2YUAA 2G5TA 5CEFA 1RQPA 2YWFA 2XD4A 4R8VA 2E4XA 4DA9A 4WIAA 3WYEA 3L43A 4EB6B 1D9XA 1GARA 5H83A 4K03A 4FOTA 3Q41A 3DZCA 2FR0A 1OXUA 4G1BA 1PG2A 3E2EA 3T9BA 1U3CA 4UAUA 5H6QA 1Q1ZA 1S2LA 1OAKA 5NULA 3F6PA 4ZMBA 4R1MA 4DIKA 5HJ2A 2G9VA 1IWBB 4RMJA 2POCA 2EZTA 3RSSA 2HQSC 2WAXA 1WL8A 3F9CA 1NZFA 3NTVA 3FF1A 4RZQA 2CTQA 4IUDS 1QH1A 1Q7TA 2MOKA 4M1SA 3WJQA 2HFJA 4XWTA 3OZSA 1ZA2A 2FRDC 5DHFA 1T3ZA 3RI3A 4Y7CA 1NBMA 4ID3A 1M9NA 1VMDA 2FVYA 4KVFA 1VHWA 2PUDA 4FM9A 2PU7A 5TJ9A 3SS7X 2CYBA 5P8WA 3S4YA 1UR5A 1QC5B 5FBWB 3DMDA 2F64A 3N6RA 4BNKA 3E8GA 1B76A 2QTTA 3SDLA 1HDJA 1DAIA 1ZJJA 4OXXA 3CS5A 3BGOS 4MV3A 4IYRA 3KXLA 4BT4A 3CO0S 3G3EA 2XQGA 3GWZA 1KFKB 5LNK1 5B1OA 1J0BA 5LP6A 1IZ7A 4G56A 2AZDA 3AUTA 4CR6A 1AOXA 2OQVA 3B1JA 3GPLA 3S68A 3ROQA 2AK2A 4UUNA 2VBGA 3QVOA 4DGSA 1TU3A 5GZ3A 1WKCA 3Q15C 1H23A 3DVQX 3ESXA 3CTMA 3Q3VA 3SF0A 1THMA 4GRIA 1FXWF 3M49A 1BRTA 1MG1A 1ZUNA 3S0HA 5FWAA 2OAEA 1W2WB 2W58A 3PDJA 1U63A 1QU2A 1SXJE 3DDZX 2YBDA 1T8YA 3TXYA 1F5NA 3UMYA 1ZESA 2BH2A 1YL6A 4B48A 3OSUA 3BE5A 4CYMA 3E9NA 3RASA 1BKSB 1H1LB 2C1EA 5I48A 1TQ8A 1DNPA 2G5GX 1KDRA 5DCLA 4AO7A 4V1CI 2XCLA 1PRYA 1E5QA 1RBMA 3HU5A 4C03A 2DHEA 3VQXA 1IG3A 4WE3A 1YJNF 3BAZA 4KKXB 2ZRNA 3JQCA 1SDSA 3OY7A 1V11A 3OAAA 2QTWB 1M1ZA 2WZQA 4DIOA 3BMQB 3BPZA 3OKPA 4DYLA 5JWPA 1CUZA 4EY7A 4DLAA 4V0NA 2P27A 5HVNA 2R8OA 3QPVA 5G2OA 4BZWA 4BVKA 4IMRA 3TAHA 4LJ5A 3E6AA 2W8BB 1W2GA 3OI7A 4Z4QA 4MYSA 3JAMM 4H3KB 2IQQA 1CF2O 2GV9A 2E4ZA 3LUPA 4D4KA 1WPXA 4OM8A 1EFPA 1YF2A 4JB3A 5JCXA 1S6YA 2AQIA 2C00A 1RHMA 1JHYA 2Q3FA 1VSTA 1F12A 3FPBA 1NE7A 3GZTB 1TAQA 1TU4A 5E9JA 2CBZA 1JJ7A 3KB8A 1VSVA 5KB3A 4WK2B 1B16A 4FUQA 5ESRA 4HAYA 5H3HA 2PBLA 3VPBA 2PCLA 1FYJA 3VAAA 1JSCA 4QTYA 3HNOA 3THWB 1NXQA 1XDWA 1BS1A 3FMFA 4O8ZA 3AB8A 3ZCSA 2ZB8A 1MJNA 1VQKF 1SCUB 3SNHA 4DR7O 3N2NA 3EDCA 1P7YA 3B89A 5CCBA 1Z4JA 2EX0A 2AC7A 5FUMA 1XLWA 1Q17A 2QVZX 1NZDA 3S03A 5JPDA 2F3SA 1H9AA 4F85A 1JMKC 2ZQ5A 5EQFA 5JANA 3GJ6A 3ELBA 4LHXA 4QTZA 1MJHA 2Q8QA 1ZC4A 4DXAA 3EVCA 1T2CA 2I34A 3GEGA 4PELA 1A27A 3DE0X 3GB9A 3A70A 4DWVA 1KB9F 3RSHA 5IT9M 4DS3A 1OBFO 5GIOC 1P84F 4GR5A 2EDCA 1LK5A 5JVDF 1N2XA 3PXXA 3B6KA 1UM9B 5H6RA 1LD3A 1VQPV 3WRWA 1K8QA 1XMPA 5CR9A 3WL4A 2ZR7A 4GSYA 4DA6A 3Q6MA 1EVLA 3ZCVA 2DQSA 1O96A 4OAQA 3IC7A 4MHTA 1KRHA 3BJIC 2RSLA 4R9NA 3QLEA 3GZNB 2J45A 3NAMA 3U7JA 2JL1A 2VXCA 1P81A 1OX5A