4PWTA

Crystal structure of peptidoglycan-associated outer membrane lipoprotein from yersinia pestis co92
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
b'NATENGSNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
publication title Crystal structure of peptidoglycan-associated outer membrane lipoprotein from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
molecule tags Membrane protein
total genus 43
structure length 130
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4pwtA01
2N48A 3S0YA 4G4XA 3S0HA 2ZF8A 2LBTA 3CYPB 4ERHA 2LCAA 4RHAA 5EB1B 3TD3A 4G88A 2W8BC 4B62A 3WPXA 2MQEA 3S03A 2HQSC 3OONA 3TD4A 2KGWA 2K1SA 4ZHYB 4ZHVA 4G4ZA 4B5CA 4G4VA 3S06A 3S0WA 1OAPA 4PWTA 4R40B 3S02A 4G4WA 4G4YA 3LDTA 3TD5A 2ZVZA 5EAZA 3KHNA 1R1MA 3WPWA 4ZHWA 2AIZP 2ZOVA 2ZVYA 5EB0A 3CYQA 3IMPA 2L26A
chains in the Genus database with same CATH superfamily
4ZHQA 1E7KA 5JH7A 4YJ2A 3RYHA 2YYEA 3JAKB 5EO3A 3VO8A 4HNAB 4BT3A 4BVRA 1FFXA 2RHHA 1XHOA 4I50B 3WPXA 2MQEA 1TUBA 2Q1YA 3WJRA 5J2TA 4C8EA 5EZYB 4YJ3A 2R751 3CCSF 5C8YB 5CB4A 3IR9A 1CLIA 1QD9A 1W5EA 3FPIA 3KHNA 3IKFA 4X1YA 3CB2A 2AIZP 5EB0A 3M1XA 1Q7YH 1W5AA 4X1KA 4TUYB 2GVIA 5GIPC 4NUTA 3JCMM 1VQKF 1FNJA 3JASB 5AVMA 2WALA 1RLGA 5IJ0B 4WBNA 2ZAUA 3FD6A 1OFUA 3UT5B 4F6RB 1NMUB 2HS0A 3I7TA 1YHQF 5HY1A 5DCVA 2YXZA 3D00A 3KJKA 2JNBA 5BMVB 4HNAA 3CD6F 3NMUC 1S72F 3VMFB 3S06A 3RYCB 5J2UB 3KIZA 4X1IA 3P4EA 5IYZA 2VGNA 3CYQA 3JAWA 3N4ZA 1XV2A 3CCUF 4C4WC 2HS4A 5GONB 1IV4A 3WGKA 3S0HA 3CG6A 4O4JA 2I6DA 4TV8A 2LBTA 3GYQA 3G71F 2CSLA 1W5BA 2VXYA 4G88A 1IV2A 3DDNA 5CA0A 3CCRF 1M1KH 3HJWC 2VGMA 4TUYA 5KMGA 5LYJA 2PHNA 1FNKA 2HP0A 3JVHA 1K8AH 4PWTA 4G4WA 3HKCB 2H8EA 1VQVA 3G4SF 4BW0B 2ZOVA 5EWRA 1W3EX 4M8IA 1GO0A 1GO1A 2L26A 3HKDA 5HXZA 3RYCA 1K9MH 5J2UA 4O4HB 1JY8A 4BVSA 2NMUA 2W8BC 5JVDA 2UYNA 1KC8H 3N4YA 3N2KA 1W41A 2V9YA 5HY0A 3WGMA 1H48A 3IEQA 2CWJA 3ESJA 1VH8A 3S0WA 1OAPA 3LDTA 3F6MA 5EAZA 1RLUA 4ZI7B 5HY4A 3WPWA 5KX5B 1YJNF 5GANK 2KTUA 4IIJB 4RQOA 4I4TA 5IT9M 3WJPA 5JQGB 1VQ4F 3V7EA 3J7AR 1X7OA 4ZHVA 3RYIB 3CCQF 3T80A 4I55A 4B5CA 2H8CA 2Z1EA 4O4HA 2AIFA 2OTMA 1W2BF 5ITZA 5LP6B 3C8LA 1COMA 4ZOLA 2P6YA 5GAPK 2IQQA 3ZP4A 3ZP7A 1H7MA 4O2AA 2ZODA 2AMTA 4NQ3A 3OW2F 4C81A 3IMPA 3LWQC 3HWUA 3O85A 3S0YA 2Z1UA 3R0PA 1X52A 3RE3A 3C9SA 5LXTA 3KJJA 1JFFB 3CYPB 3K12A 1VQ6F 3J80M 1W55A 3S03A 3JAMM 3JALA 4IIJA 3ZO8A 3RA6A 1TVKB 3AGKA 5MN6A 3CMAF 3IKEA 2CHSA 1W5FA 4TV9B 5EIBC 2OHWA 3RYFA 3RYIA 2OTJF 4O2BB 2UYKA 3Q8HA 4EB6B 3G6EF 1JD1A 3FFMA 3MCQA 4U3JB 3E22A 2CHTA 4DRXA 4B45A 2QA4F 3F0EA 3CC4F 3V4DA 2KG4A 1KQSF 1CN7A 1W59A 2BO1A 3JARB 3N2GB 3JAKA 1GX1A 4X20B 5JCOA 2IAFA 4C8GA 5FLXM 3WJQA 5GINC 2GLZA 4C8IA 2ZVZA 4I50A 3FD5A 1VQMF 1W581 3D54A 1VK3A 2KTVA 4EI8A 4O4LB 1KD1H 2N48A 1IV3A 2LBWA 3SIUA 5EZYA 5LP6C 3KE1A 4G4XA 5GIOC 1TVKA 3I55F 4U39A 3I3FA 5C8YA 2GZLA 5IJ9B 5EB1B 3TD3A 1YI2F 1QAHA 3EORA 2F9ZC 3C9TA 1RQ2A 1W40A 3TD4A 1YJ9F 4ZHYB 5JCOC 4U3JA 1PXWA 3HTNA 2QI2A 3LWPC 1VQLF 5FNVB 3JASA 2BTUA 2BTOA 5IJ0A 1GZ0A 1SZQA 3K2XA 2VAPA 5HWEA 3UT5A 4F6RA 5LOVB 1DBFA 1Q8RA 1KNJA 1UI9A 3JARA 3MCAB 5BMVA 1NJIH 3ELCA 1UFYA 4BVQA 3MQWA 3ON1A 4FFBB 3VYUC 2RHJA 4BT7A 4RHAA 2Z1FA 1RQ7A 1SA0B 3ZOPA 3HKBB 3VI6A 5LA6B 4TZZA 2Q1XA 3VOBA 3MBMA 5GONA 3WXMB 1VHAA 5IJ9A 2UYPA 1VQ7F 2B33A 1XBIA 3VTIC 5B8FA 1YGYA 1T0AA 4BT6A 3ERNA 3FBAA 3OBYA 3PAFA 4B46A 1JJ2F 1VQ9F 5HY2A 5FNVA 2UZHA 5EYPB 3WGLA 3RA5A 1SDSA 2FC3A 3HKCA 4LNUB 3CCMF 1X7PA 4EI7A 2R6R1 2Z1TA 5CA1B 3C9UA 4BY9D 4ZHQB 3HKEB 5JH7B 2VAWA 2OTLF 4YJ2B 3RYHB 3WGJA 1FFXB 3WGNA 3HAXD 1M90H 1SA0A 3HKBA 2CZWA 1VQPF 2QEXF 5LA6A 2LBXA 5HXUA 3K0TA 5G4UC 5J2TB 1YQNA 4YJ3B 3CC2F 5MN5A 3NK6A 3U0OA 5CB4B 1YIJF 2H6LA 1Q86H 4ZI7A 1QU9A 4X1YB 2CVLA 2KGWA 3E20B 3V7QA 5KX5A 2BTQB 4LCKA 4G4ZA 4BT4A 4X1KB 2QTPA 4G4VA 1Z5VA 4LNUA 4G4YA 5EIBD 2OZBA 4BVTA 5JQGA 5CA1A 1R1MA 3LWRC 1DT9A 1N8RH 3HKEA 4X3MA 2HRYA 1Q82H 1RA4A 2ZF8A 3SIVA 5LP6A 1U43A 3NK7A 3MDOA 4X1IB 4B62A 3LWOC 5IYZB 3OONA 1IPAA 3JAWB 1YITF 3QUWA 1J7HA 1X25A 2EWCA 4ZK7A 2RB9A 3CPWF 1JFFA 1XRGA 4O4JB 2ALEA 4TV8B 3S02A 3IEWA 3CCLF 3P10A 3JATB 5HP8A 5CA0B 3L7QA 1W57A 3NVKE 5FJ4C 3VYTC 5KMGB 3M4SA 4XCQA 5LYJB 1NQ3A 3C9RA 1ZWZA 3M84A 2HP0B 3CMEF 3VOAA 3CXCF 3I56F 4TV9A 4O2BA 3D01A 3HKDB 4EB6A 3BYQA 3CCVF 4EI9A 4KWEA 1U3PA 3DC2A 5JVDB 1K73H 3OBWA 2UYNB 3N2KB 1Q81H 1JN1A 2I6RA 3N2GA 4X20A 4E6EA 1QVFF 4C82A 3JATA 3LYBA 4IHJB 4BT2A 4O4LA 3NVIB 4X3LA 2HX0A 4NWOB 2FGYA 3V3TA 4I4TB 1VQOF 3J81M 1W42A 2RHOA 3LFOA 3E1YA 1U40A 3VYSC 3F0GA 1U3LA 1IV1A 3F0DA 2DT4A 5MN4A 4I55B 1H47A 1ONIA 1CK2A 3K14A 5G4VC 2LCAA 5ITZB 1T0KB 3LMEA 4O4IB 4ZOLB 5LOVA 1FSZA 2HRUA 2K1SA 4O2AB 3GHZA 2HVYD 2HS3A 1VQNF 3CCJF 3CC7F 1PF5A 3GTZA 4R40B 5LXTB 4FFBA 4IHJA 2DYYA 2G9IA 2RHLA 3TD5A 3VIUA 4DXDA 1QVGF 2HP3A 3CPQA 1ODEA 3F0FA 1YJWF 1TUBB 3PLAC 3JALB 2PMPA 2CW4A 1KNKA 4ERHA 2UYJA 3QHDA 2HQSC 3QTYA 3RYFB 3B6NA 2IG8A 2Z01A 5EYPA 3E22B 5HP7A 4BT5A 4O4IA 4DRXB 1VQ5F 1VQ8F 3LWVC 3VCZA 2VAMA 4WBNB 4ZHWA 5A2QM 2ZVYA 3P0ZA 3CCEF 1Z5WA
chains in the Genus database with same CATH topology
2N48A 3S0YA 4G4XA 3S0HA 2ZF8A 2LBTA 3CYPB 4ERHA 2LCAA 4RHAA 5EB1B 3TD3A 4G88A 2W8BC 4B62A 3WPXA 2MQEA 3S03A 2HQSC 3OONA 3TD4A 2KGWA 2K1SA 4ZHYB 4ZHVA 4G4ZA 4B5CA 4G4VA 3S06A 3S0WA 1OAPA 4PWTA 4R40B 3S02A 4G4WA 4G4YA 3LDTA 3TD5A 2ZVZA 5EAZA 3KHNA 1R1MA 3WPWA 4ZHWA 2AIZP 2ZOVA 2ZVYA 5EB0A 3CYQA 3IMPA 2L26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N48 A;  3S0Y A;  4G4X A;  3S0H A;  2ZF8 A;  2LBT A;  3CYP B;  4ERH A;  2LCA A;  4RHA A;  5EB1 B;  3TD3 A;  4G88 A;  2W8B C;  4B62 A;  3WPX A;  2MQE A;  3S03 A;  2HQS C;  3OON A;  3TD4 A;  2KGW A;  2K1S A;  4ZHY B;  4ZHV A;  4G4Z A;  4B5C A;  4G4V A;  3S06 A;  3S0W A;  1OAP A;  4PWT A;  4R40 B;  3S02 A;  4G4W A;  4G4Y A;  3LDT A;  3TD5 A;  2ZVZ A;  5EAZ A;  3KHN A;  1R1M A;  3WPW A;  4ZHW A;  2AIZ P;  2ZOV A;  2ZVY A;  5EB0 A;  3CYQ A;  3IMP A;  2L26 A; 
#chains in the Genus database with same CATH topology
 4ZHQ A;  1E7K A;  5JH7 A;  4YJ2 A;  3RYH A;  2YYE A;  3JAK B;  5EO3 A;  3VO8 A;  4HNA B;  4BT3 A;  4BVR A;  1FFX A;  2RHH A;  1XHO A;  4I50 B;  3WPX A;  2MQE A;  1TUB A;  2Q1Y A;  3WJR A;  5J2T A;  4C8E A;  5EZY B;  4YJ3 A;  2R75 1;  3CCS F;  5C8Y B;  5CB4 A;  3IR9 A;  1CLI A;  1QD9 A;  1W5E A;  3FPI A;  3KHN A;  3IKF A;  4X1Y A;  3CB2 A;  2AIZ P;  5EB0 A;  3M1X A;  1Q7Y H;  1W5A A;  4X1K A;  4TUY B;  2GVI A;  5GIP C;  4NUT A;  3JCM M;  1VQK F;  1FNJ A;  3JAS B;  5AVM A;  2WAL A;  1RLG A;  5IJ0 B;  4WBN A;  2ZAU A;  3FD6 A;  1OFU A;  3UT5 B;  4F6R B;  1NMU B;  2HS0 A;  3I7T A;  1YHQ F;  5HY1 A;  5DCV A;  2YXZ A;  3D00 A;  3KJK A;  2JNB A;  5BMV B;  4HNA A;  3CD6 F;  3NMU C;  1S72 F;  3VMF B;  3S06 A;  3RYC B;  5J2U B;  3KIZ A;  4X1I A;  3P4E A;  5IYZ A;  2VGN A;  3CYQ A;  3JAW A;  3N4Z A;  1XV2 A;  3CCU F;  4C4W C;  2HS4 A;  5GON B;  1IV4 A;  3WGK A;  3S0H A;  3CG6 A;  4O4J A;  2I6D A;  4TV8 A;  2LBT A;  3GYQ A;  3G71 F;  2CSL A;  1W5B A;  2VXY A;  4G88 A;  1IV2 A;  3DDN A;  5CA0 A;  3CCR F;  1M1K H;  3HJW C;  2VGM A;  4TUY A;  5KMG A;  5LYJ A;  2PHN A;  1FNK A;  2HP0 A;  3JVH A;  1K8A H;  4PWT A;  4G4W A;  3HKC B;  2H8E A;  1VQV A;  3G4S F;  4BW0 B;  2ZOV A;  5EWR A;  1W3E X;  4M8I A;  1GO0 A;  1GO1 A;  2L26 A;  3HKD A;  5HXZ A;  3RYC A;  1K9M H;  5J2U A;  4O4H B;  1JY8 A;  4BVS A;  2NMU A;  2W8B C;  5JVD A;  2UYN A;  1KC8 H;  3N4Y A;  3N2K A;  1W41 A;  2V9Y A;  5HY0 A;  3WGM A;  1H48 A;  3IEQ A;  2CWJ A;  3ESJ A;  1VH8 A;  3S0W A;  1OAP A;  3LDT A;  3F6M A;  5EAZ A;  1RLU A;  4ZI7 B;  5HY4 A;  3WPW A;  5KX5 B;  1YJN F;  5GAN K;  2KTU A;  4IIJ B;  4RQO A;  4I4T A;  5IT9 M;  3WJP A;  5JQG B;  1VQ4 F;  3V7E A;  3J7A R;  1X7O A;  4ZHV A;  3RYI B;  3CCQ F;  3T80 A;  4I55 A;  4B5C A;  2H8C A;  2Z1E A;  4O4H A;  2AIF A;  2OTM A;  1W2B F;  5ITZ A;  5LP6 B;  3C8L A;  1COM A;  4ZOL A;  2P6Y A;  5GAP K;  2IQQ A;  3ZP4 A;  3ZP7 A;  1H7M A;  4O2A A;  2ZOD A;  2AMT A;  4NQ3 A;  3OW2 F;  4C81 A;  3IMP A;  3LWQ C;  3HWU A;  3O85 A;  3S0Y A;  2Z1U A;  3R0P A;  1X52 A;  3RE3 A;  3C9S A;  5LXT A;  3KJJ A;  1JFF B;  3CYP B;  3K12 A;  1VQ6 F;  3J80 M;  1W55 A;  3S03 A;  3JAM M;  3JAL A;  4IIJ A;  3ZO8 A;  3RA6 A;  1TVK B;  3AGK A;  5MN6 A;  3CMA F;  3IKE A;  2CHS A;  1W5F A;  4TV9 B;  5EIB C;  2OHW A;  3RYF A;  3RYI A;  2OTJ F;  4O2B B;  2UYK A;  3Q8H A;  4EB6 B;  3G6E F;  1JD1 A;  3FFM A;  3MCQ A;  4U3J B;  3E22 A;  2CHT A;  4DRX A;  4B45 A;  2QA4 F;  3F0E A;  3CC4 F;  3V4D A;  2KG4 A;  1KQS F;  1CN7 A;  1W59 A;  2BO1 A;  3JAR B;  3N2G B;  3JAK A;  1GX1 A;  4X20 B;  5JCO A;  2IAF A;  4C8G A;  5FLX M;  3WJQ A;  5GIN C;  2GLZ A;  4C8I A;  2ZVZ A;  4I50 A;  3FD5 A;  1VQM F;  1W58 1;  3D54 A;  1VK3 A;  2KTV A;  4EI8 A;  4O4L B;  1KD1 H;  2N48 A;  1IV3 A;  2LBW A;  3SIU A;  5EZY A;  5LP6 C;  3KE1 A;  4G4X A;  5GIO C;  1TVK A;  3I55 F;  4U39 A;  3I3F A;  5C8Y A;  2GZL A;  5IJ9 B;  5EB1 B;  3TD3 A;  1YI2 F;  1QAH A;  3EOR A;  2F9Z C;  3C9T A;  1RQ2 A;  1W40 A;  3TD4 A;  1YJ9 F;  4ZHY B;  5JCO C;  4U3J A;  1PXW A;  3HTN A;  2QI2 A;  3LWP C;  1VQL F;  5FNV B;  3JAS A;  2BTU A;  2BTO A;  5IJ0 A;  1GZ0 A;  1SZQ A;  3K2X A;  2VAP A;  5HWE A;  3UT5 A;  4F6R A;  5LOV B;  1DBF A;  1Q8R A;  1KNJ A;  1UI9 A;  3JAR A;  3MCA B;  5BMV A;  1NJI H;  3ELC A;  1UFY A;  4BVQ A;  3MQW A;  3ON1 A;  4FFB B;  3VYU C;  2RHJ A;  4BT7 A;  4RHA A;  2Z1F A;  1RQ7 A;  1SA0 B;  3ZOP A;  3HKB B;  3VI6 A;  5LA6 B;  4TZZ A;  2Q1X A;  3VOB A;  3MBM A;  5GON A;  3WXM B;  1VHA A;  5IJ9 A;  2UYP A;  1VQ7 F;  2B33 A;  1XBI A;  3VTI C;  5B8F A;  1YGY A;  1T0A A;  4BT6 A;  3ERN A;  3FBA A;  3OBY A;  3PAF A;  4B46 A;  1JJ2 F;  1VQ9 F;  5HY2 A;  5FNV A;  2UZH A;  5EYP B;  3WGL A;  3RA5 A;  1SDS A;  2FC3 A;  3HKC A;  4LNU B;  3CCM F;  1X7P A;  4EI7 A;  2R6R 1;  2Z1T A;  5CA1 B;  3C9U A;  4BY9 D;  4ZHQ B;  3HKE B;  5JH7 B;  2VAW A;  2OTL F;  4YJ2 B;  3RYH B;  3WGJ A;  1FFX B;  3WGN A;  3HAX D;  1M90 H;  1SA0 A;  3HKB A;  2CZW A;  1VQP F;  2QEX F;  5LA6 A;  2LBX A;  5HXU A;  3K0T A;  5G4U C;  5J2T B;  1YQN A;  4YJ3 B;  3CC2 F;  5MN5 A;  3NK6 A;  3U0O A;  5CB4 B;  1YIJ F;  2H6L A;  1Q86 H;  4ZI7 A;  1QU9 A;  4X1Y B;  2CVL A;  2KGW A;  3E20 B;  3V7Q A;  5KX5 A;  2BTQ B;  4LCK A;  4G4Z A;  4BT4 A;  4X1K B;  2QTP A;  4G4V A;  1Z5V A;  4LNU A;  4G4Y A;  5EIB D;  2OZB A;  4BVT A;  5JQG A;  5CA1 A;  1R1M A;  3LWR C;  1DT9 A;  1N8R H;  3HKE A;  4X3M A;  2HRY A;  1Q82 H;  1RA4 A;  2ZF8 A;  3SIV A;  5LP6 A;  1U43 A;  3NK7 A;  3MDO A;  4X1I B;  4B62 A;  3LWO C;  5IYZ B;  3OON A;  1IPA A;  3JAW B;  1YIT F;  3QUW A;  1J7H A;  1X25 A;  2EWC A;  4ZK7 A;  2RB9 A;  3CPW F;  1JFF A;  1XRG A;  4O4J B;  2ALE A;  4TV8 B;  3S02 A;  3IEW A;  3CCL F;  3P10 A;  3JAT B;  5HP8 A;  5CA0 B;  3L7Q A;  1W57 A;  3NVK E;  5FJ4 C;  3VYT C;  5KMG B;  3M4S A;  4XCQ A;  5LYJ B;  1NQ3 A;  3C9R A;  1ZWZ A;  3M84 A;  2HP0 B;  3CME F;  3VOA A;  3CXC F;  3I56 F;  4TV9 A;  4O2B A;  3D01 A;  3HKD B;  4EB6 A;  3BYQ A;  3CCV F;  4EI9 A;  4KWE A;  1U3P A;  3DC2 A;  5JVD B;  1K73 H;  3OBW A;  2UYN B;  3N2K B;  1Q81 H;  1JN1 A;  2I6R A;  3N2G A;  4X20 A;  4E6E A;  1QVF F;  4C82 A;  3JAT A;  3LYB A;  4IHJ B;  4BT2 A;  4O4L A;  3NVI B;  4X3L A;  2HX0 A;  4NWO B;  2FGY A;  3V3T A;  4I4T B;  1VQO F;  3J81 M;  1W42 A;  2RHO A;  3LFO A;  3E1Y A;  1U40 A;  3VYS C;  3F0G A;  1U3L A;  1IV1 A;  3F0D A;  2DT4 A;  5MN4 A;  4I55 B;  1H47 A;  1ONI A;  1CK2 A;  3K14 A;  5G4V C;  2LCA A;  5ITZ B;  1T0K B;  3LME A;  4O4I B;  4ZOL B;  5LOV A;  1FSZ A;  2HRU A;  2K1S A;  4O2A B;  3GHZ A;  2HVY D;  2HS3 A;  1VQN F;  3CCJ F;  3CC7 F;  1PF5 A;  3GTZ A;  4R40 B;  5LXT B;  4FFB A;  4IHJ A;  2DYY A;  2G9I A;  2RHL A;  3TD5 A;  3VIU A;  4DXD A;  1QVG F;  2HP3 A;  3CPQ A;  1ODE A;  3F0F A;  1YJW F;  1TUB B;  3PLA C;  3JAL B;  2PMP A;  2CW4 A;  1KNK A;  4ERH A;  2UYJ A;  3QHD A;  2HQS C;  3QTY A;  3RYF B;  3B6N A;  2IG8 A;  2Z01 A;  5EYP A;  3E22 B;  5HP7 A;  4BT5 A;  4O4I A;  4DRX B;  1VQ5 F;  1VQ8 F;  3LWV C;  3VCZ A;  2VAM A;  4WBN B;  4ZHW A;  5A2Q M;  2ZVY A;  3P0Z A;  3CCE F;  1Z5W A; 
#chains in the Genus database with same CATH homology
 2N48 A;  3S0Y A;  4G4X A;  3S0H A;  2ZF8 A;  2LBT A;  3CYP B;  4ERH A;  2LCA A;  4RHA A;  5EB1 B;  3TD3 A;  4G88 A;  2W8B C;  4B62 A;  3WPX A;  2MQE A;  3S03 A;  2HQS C;  3OON A;  3TD4 A;  2KGW A;  2K1S A;  4ZHY B;  4ZHV A;  4G4Z A;  4B5C A;  4G4V A;  3S06 A;  3S0W A;  1OAP A;  4PWT A;  4R40 B;  3S02 A;  4G4W A;  4G4Y A;  3LDT A;  3TD5 A;  2ZVZ A;  5EAZ A;  3KHN A;  1R1M A;  3WPW A;  4ZHW A;  2AIZ P;  2ZOV A;  2ZVY A;  5EB0 A;  3CYQ A;  3IMP A;  2L26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...