4PWTA

Crystal structure of peptidoglycan-associated outer membrane lipoprotein from yersinia pestis co92
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
NATENGSNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Peptidoglycan-associated lipoprotein
publication title Crystal structure of peptidoglycan-associated outer membrane lipoprotein from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
total genus 43
structure length 130
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4pwtA01
4ZHVA 4G4ZA 4G4VA 5EAZA 4G4WA 3WPXA 5EB0A 5EB1B 4G88A 2ZVYA 2N48A 2ZOVA 3TD4A 4B62A 3S06A 4ZHYB 2LCAA 2MQEA 2AIZP 2LBTA 2HQSC 2K1SA 3OONA 2L26A 4RHAA 3IMPA 3TD5A 3TD3A 3LDTA 4ERHA 3S0HA 3S0YA 1R1MA 3S0WA 2ZVZA 4PWTA 3S03A 2KGWA 2ZF8A 4G4YA 4ZHWA 4G4XA 3KHNA 3WPWA 4B5CA 3S02A 3CYPB 1OAPA 4R40B 2W8BC 3CYQA
chains in the Genus database with same CATH superfamily
3CC7F 1Z5WA 4O4IA 4ZHVA 1DBFA 5ITZB 5LYJB 4ZHQA 1X7PA 3D54A 3M84A 1VHAA 1Q82H 4B62A 5CA0A 2Z1TA 1W42A 2VAWA 3PLAC 1GZ0A 1VQ5F 4C8EA 1TVKB 4ERHA 3VTIC 5KX5B 2QEXF 1W5AA 1GO1A 2KGWA 4O4IB 1YJNF 3IEWA 4G4XA 3NVIB 3RA6A 3WGJA 3WJPA 3CYPB 4ZI7A 4BT7A 3GYQA 3VO8A 4YJ2A 1S72F 3OBWA 5CA1A 3F0GA 2R751 3M4SA 4NQ3A 1W5FA 3SIUA 5IYZB 5IJ9A 1VQ9F 1QVGF 3HKBA 2HS3A 1JY8A 1VQ7F 3JALB 1VH8A 2HRUA 4O4HA 3ZP7A 2LCAA 5JH7A 2KG4A 4ZI7B 3MCQA 3MQWA 3TD3A 3CC4F 1SA0A 4F6RB 1K8AH 2HP0B 4YJ2B 2I6DA 3HKDA 3WJRA 5CA1B 4YJ3B 2UYKA 3CPQA 5HP8A 5IJ9B 3RYCA 1CN7A 3IEQA 1Q7YH 3HKBB 4BW0B 4C8GA 4O4HB 4X1KA 5EB1B 5JH7B 1QAHA 3FPIA 2ALEA 1SA0B 1W2BF 3E22B 1VQMF 4X1YA 2ZOVA 5MN6A 1W581 3HKDB 2DYYA 5HWEA 2ZAUA 1W5BA 1DT9A 1JD1A 2H8CA 5FNVA 3LWVC 2HQSC 3S0YA 3RYCB 4I55B 2QA4F 3S03A 2JNBA 2ZF8A 1ODEA 4X1KB 1JJ2F 5MN5A 1IV3A 3JVHA 3CCRF 2FC3A 5AVMA 2F9ZC 3CMAF 2VGNA 1T0AA 1KNJA 3F6MA 4X1YB 4IHJA 5EAZA 1RA4A 2ZODA 3I7TA 4G4VA 5EWRA 3NMUC 3HKCB 5FNVB 2CZWA 2OTMA 2Z1EA 3WXMB 3CG6A 3G71F 4TUYA 3JARA 2LBTA 3I55F 3N4YA 4IHJB 2GVIA 4X1IA 3BYQA 3N2KB 4B5CA 1N8RH 3VYUC 3DC2A 5LA6A 3LMEA 2G9IA 3CCJF 3LWPC 4R40B 5B8FA 2DT4A 5CB4A 1U43A 4DRXA 3JARB 1VQLF 1VK3A 5EZYA 1XRGA 3CCUF 1ONIA 4C4WC 3WGNA 4X1IB 3HKEA 4BT3A 2MQEA 2IG8A 5GIOC 3CCVF 1CLIA 2L26A 3C9UA 3N2GA 3AGKA 5HP7A 5LOVA 3CCMF 2OTLF 1RLUA 2CHTA 5FJ4C 2UYPA 5CB4B 4DRXB 3MBMA 3CCQF 2R6R1 3K2XA 1SZQA 4U39A 5EZYB 2GLZA 3CC2F 3K14A 5GONA 2HP3A 3DDNA 2KTVA 3HKEB 2Z1FA 3D00A 3JASA 5FLXM 3F0FA 1KC8H 3V3TA 3N2GB 3IKEA 5LOVB 3P10A 3F0DA 3B6NA 5KMGB 1KD1H 2OTJF 4X20A 4ZOLB 5JCOC 2QI2A 1R1MA 1K9MH 5GONB 1ZWZA 5J2UA 1Q86H 5LP6C 1H48A 2YYEA 3ERNA 3JASB 5JVDA 3RYHA 3VI6A 4ZHQB 1JFFA 5LP6A 1T0KB 3WPXA 5CA0B 4G88A 3VMFB 4EB6A 4O2AA 1RLGA 1FFXA 4O4LA 4TV8A 1X7OA 2RHLA 1VQVA 1COMA 5J2UB 2Z01A 3IKFA 5JVDB 3RYHB 1JFFB 5EO3A 1VQPF 3HJWC 4NWOB 4B45A 4M8IA 4ZK7A 3S02A 1J7HA 3ZOPA 3VYTC 5HXZA 3JAWA 4O2AB 2Q1XA 5EYPA 3N4ZA 1K73H 4O4LB 3RYIA 4TV8B 1YQNA 4G4ZA 4EI7A 2CW4A 4FFBA 4O4JA 4RQOA 2N48A 5MN4A 2I6RA 4B46A 3CCLF 3C8LA 4KWEA 3CMEF 1X25A 3NK6A 3JAWB 3JATA 4HNAA 3RYIB 4BT2A 1FNKA 1YHQF 3P0ZA 4U3JA 4FFBB 2CWJA 2EWCA 3CB2A 2WALA 1QU9A 3NK7A 2AIFA 3IR9A 1W40A 1VQ4F 2OHWA 3KJJA 3JATB 3WGKA 1XV2A 3M1XA 1Q81H 4HNAB 5A2QM 1X52A 2AIZP 3KJKA 2K1SA 2CSLA 5GINC 4NUTA 3VOAA 3OW2F 2B33A 2ZVZA 2GZLA 4I4TA 1W57A 1W55A 3WGMA 2UYJA 5EIBC 2FGYA 2HRYA 4O2BA 5HY1A 2HVYD 1TUBA 3CYQA 2RHJA 4BT5A 5J2TA 4TUYB 3PAFA 3ON1A 3HWUA 1KNKA 2UZHA 3QHDA 3E20B 3V4DA 4I4TB 4WBNA 3FD6A 4TZZA 1Q8RA 5LA6B 4O2BB 1NJIH 1W41A 1VQOF 5GIPC 3J80M 4DXDA 5J2TB 1M1KH 3JAKA 1IV1A 3R0PA 1QD9A 1VQ8F 4I50A 2W8BC 2YXZA 3NVKE 1QVFF 5GANK 1W59A 1YIJF 1UI9A 3FFMA 3O85A 3L7QA 1XHOA 2HS4A 1FNJA 1YITF 1VQNF 1U40A 5HY2A 3T80A 3G6EF 4BT4A 2OZBA 2HS0A 1RQ7A 3JAKB 3JAMM 5GAPK 4I50B 2Z1UA 2BO1A 4G4YA 3LWRC 4LCKA 2RHOA 3KHNA 1W3EX 2BTQB 5JCOA 1U3PA 3VYSC 3I56F 1YGYA 5C8YA 1OAPA 4EI8A 2BTOA 4BVRA 2QTPA 2H6LA 3QTYA 2PHNA 2BTUA 2PMPA 4X20B 3VOBA 2RB9A 1IV2A 1VQ6F 5LXTA 5IYZA 3K12A 1PXWA 4C82A 1CK2A 2IQQA 3GTZA 3KIZA 4TV9A 5C8YB 1W5EA 4EI9A 3CCEF 3JALA 3QUWA 5LP6B 5IJ0A 1M90H 4E6EA 4BY9D 3J7AR 4F6RA 5JQGA 4EB6B 2HP0A 3P4EA 3HAXD 1GX1A 4BVSA 1FFXB 1GO0A 5EIBD 3K0TA 4YJ3A 2KTUA 5BMVA 2HX0A 3U0OA 5LXTB 3MDOA 4TV9B 2Q1YA 3I3FA 5G4UC 1OFUA 3TD4A 5IJ0B 2VGMA 1H47A 4BVQA 4LNUA 2CHSA 3E22A 4RHAA 3J81M 5JQGB 1H7MA 5EYPB 3V7EA 3Q8HA 3S0WA 4PWTA 3C9RA 5BMVB 3RYFA 3CD6F 3G4SF 2V9YA 2AMTA 3V7QA 4XCQA 4O4JB 1IV4A 4I55A 4C81A 1KQSF 3WGLA 1FSZA 2VAPA 2VAMA 5EB0A 4LNUB 5DCVA 4IIJA 3C9TA 3ZP4A 2RHHA 3HKCA 4ZHYB 1NMUB 3RYFB 4U3JB 3OONA 3VIUA 5G4VC 2LBWA 3IMPA 3S0HA 1XBIA 3OBYA 5IT9M 3EORA 5HXUA 2UYNA 3JCMM 3HTNA 4IIJB 3CCSF 1JN1A 3N2KA 3LWQC 3KE1A 1SDSA 3UT5A 3MCAB 2H8EA 1NQ3A 2ZVYA 3D01A 1RQ2A 2P6YA 1E7KA 3C9SA 3FBAA 4X3LA 3SIVA 3CPWF 2UYNB 2NMUA 3TD5A 3LDTA 5HY0A 1TUBB 4BT6A 4ZHWA 3UT5B 1YJ9F 4BVTA 1IPAA 1YI2F 3LWOC 3FD5A 3ZO8A 2IAFA 4G4WA 4WBNB 3LYBA 1VQKF 2LBXA 4C8IA 1UFYA 3LFOA 3VCZA 2VXYA 3E1YA 1Z5VA 4X3MA 3S06A 3GHZA 5ITZA 3RA5A 5LYJA 3ESJA 3F0EA 3WJQA 5KMGA 5HY4A 3RE3A 3WPWA 3CXCF 3ELCA 1YJWF 1U3LA 4ZOLA 1TVKA 2CVLA 1PF5A 5KX5A
chains in the Genus database with same CATH topology
4ZHVA 4G4ZA 4G4VA 5EAZA 4G4WA 3WPXA 5EB0A 5EB1B 4G88A 2ZVYA 2N48A 2ZOVA 3TD4A 4B62A 3S06A 4ZHYB 2LCAA 2MQEA 2AIZP 2LBTA 2HQSC 2K1SA 3OONA 2L26A 4RHAA 3IMPA 3TD5A 3TD3A 3LDTA 4ERHA 3S0HA 3S0YA 1R1MA 3S0WA 2ZVZA 4PWTA 3S03A 2KGWA 2ZF8A 4G4YA 4ZHWA 4G4XA 3KHNA 3WPWA 4B5CA 3S02A 3CYPB 1OAPA 4R40B 2W8BC 3CYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHV A;  4G4Z A;  4G4V A;  5EAZ A;  4G4W A;  3WPX A;  5EB0 A;  5EB1 B;  4G88 A;  2ZVY A;  2N48 A;  2ZOV A;  3TD4 A;  4B62 A;  3S06 A;  4ZHY B;  2LCA A;  2MQE A;  2AIZ P;  2LBT A;  2HQS C;  2K1S A;  3OON A;  2L26 A;  4RHA A;  3IMP A;  3TD5 A;  3TD3 A;  3LDT A;  4ERH A;  3S0H A;  3S0Y A;  1R1M A;  3S0W A;  2ZVZ A;  4PWT A;  3S03 A;  2KGW A;  2ZF8 A;  4G4Y A;  4ZHW A;  4G4X A;  3KHN A;  3WPW A;  4B5C A;  3S02 A;  3CYP B;  1OAP A;  4R40 B;  2W8B C;  3CYQ A; 
#chains in the Genus database with same CATH topology
 3CC7 F;  1Z5W A;  4O4I A;  4ZHV A;  1DBF A;  5ITZ B;  5LYJ B;  4ZHQ A;  1X7P A;  3D54 A;  3M84 A;  1VHA A;  1Q82 H;  4B62 A;  5CA0 A;  2Z1T A;  1W42 A;  2VAW A;  3PLA C;  1GZ0 A;  1VQ5 F;  4C8E A;  1TVK B;  4ERH A;  3VTI C;  5KX5 B;  2QEX F;  1W5A A;  1GO1 A;  2KGW A;  4O4I B;  1YJN F;  3IEW A;  4G4X A;  3NVI B;  3RA6 A;  3WGJ A;  3WJP A;  3CYP B;  4ZI7 A;  4BT7 A;  3GYQ A;  3VO8 A;  4YJ2 A;  1S72 F;  3OBW A;  5CA1 A;  3F0G A;  2R75 1;  3M4S A;  4NQ3 A;  1W5F A;  3SIU A;  5IYZ B;  5IJ9 A;  1VQ9 F;  1QVG F;  3HKB A;  2HS3 A;  1JY8 A;  1VQ7 F;  3JAL B;  1VH8 A;  2HRU A;  4O4H A;  3ZP7 A;  2LCA A;  5JH7 A;  2KG4 A;  4ZI7 B;  3MCQ A;  3MQW A;  3TD3 A;  3CC4 F;  1SA0 A;  4F6R B;  1K8A H;  2HP0 B;  4YJ2 B;  2I6D A;  3HKD A;  3WJR A;  5CA1 B;  4YJ3 B;  2UYK A;  3CPQ A;  5HP8 A;  5IJ9 B;  3RYC A;  1CN7 A;  3IEQ A;  1Q7Y H;  3HKB B;  4BW0 B;  4C8G A;  4O4H B;  4X1K A;  5EB1 B;  5JH7 B;  1QAH A;  3FPI A;  2ALE A;  1SA0 B;  1W2B F;  3E22 B;  1VQM F;  4X1Y A;  2ZOV A;  5MN6 A;  1W58 1;  3HKD B;  2DYY A;  5HWE A;  2ZAU A;  1W5B A;  1DT9 A;  1JD1 A;  2H8C A;  5FNV A;  3LWV C;  2HQS C;  3S0Y A;  3RYC B;  4I55 B;  2QA4 F;  3S03 A;  2JNB A;  2ZF8 A;  1ODE A;  4X1K B;  1JJ2 F;  5MN5 A;  1IV3 A;  3JVH A;  3CCR F;  2FC3 A;  5AVM A;  2F9Z C;  3CMA F;  2VGN A;  1T0A A;  1KNJ A;  3F6M A;  4X1Y B;  4IHJ A;  5EAZ A;  1RA4 A;  2ZOD A;  3I7T A;  4G4V A;  5EWR A;  3NMU C;  3HKC B;  5FNV B;  2CZW A;  2OTM A;  2Z1E A;  3WXM B;  3CG6 A;  3G71 F;  4TUY A;  3JAR A;  2LBT A;  3I55 F;  3N4Y A;  4IHJ B;  2GVI A;  4X1I A;  3BYQ A;  3N2K B;  4B5C A;  1N8R H;  3VYU C;  3DC2 A;  5LA6 A;  3LME A;  2G9I A;  3CCJ F;  3LWP C;  4R40 B;  5B8F A;  2DT4 A;  5CB4 A;  1U43 A;  4DRX A;  3JAR B;  1VQL F;  1VK3 A;  5EZY A;  1XRG A;  3CCU F;  1ONI A;  4C4W C;  3WGN A;  4X1I B;  3HKE A;  4BT3 A;  2MQE A;  2IG8 A;  5GIO C;  3CCV F;  1CLI A;  2L26 A;  3C9U A;  3N2G A;  3AGK A;  5HP7 A;  5LOV A;  3CCM F;  2OTL F;  1RLU A;  2CHT A;  5FJ4 C;  2UYP A;  5CB4 B;  4DRX B;  3MBM A;  3CCQ F;  2R6R 1;  3K2X A;  1SZQ A;  4U39 A;  5EZY B;  2GLZ A;  3CC2 F;  3K14 A;  5GON A;  2HP3 A;  3DDN A;  2KTV A;  3HKE B;  2Z1F A;  3D00 A;  3JAS A;  5FLX M;  3F0F A;  1KC8 H;  3V3T A;  3N2G B;  3IKE A;  5LOV B;  3P10 A;  3F0D A;  3B6N A;  5KMG B;  1KD1 H;  2OTJ F;  4X20 A;  4ZOL B;  5JCO C;  2QI2 A;  1R1M A;  1K9M H;  5GON B;  1ZWZ A;  5J2U A;  1Q86 H;  5LP6 C;  1H48 A;  2YYE A;  3ERN A;  3JAS B;  5JVD A;  3RYH A;  3VI6 A;  4ZHQ B;  1JFF A;  5LP6 A;  1T0K B;  3WPX A;  5CA0 B;  4G88 A;  3VMF B;  4EB6 A;  4O2A A;  1RLG A;  1FFX A;  4O4L A;  4TV8 A;  1X7O A;  2RHL A;  1VQV A;  1COM A;  5J2U B;  2Z01 A;  3IKF A;  5JVD B;  3RYH B;  1JFF B;  5EO3 A;  1VQP F;  3HJW C;  4NWO B;  4B45 A;  4M8I A;  4ZK7 A;  3S02 A;  1J7H A;  3ZOP A;  3VYT C;  5HXZ A;  3JAW A;  4O2A B;  2Q1X A;  5EYP A;  3N4Z A;  1K73 H;  4O4L B;  3RYI A;  4TV8 B;  1YQN A;  4G4Z A;  4EI7 A;  2CW4 A;  4FFB A;  4O4J A;  4RQO A;  2N48 A;  5MN4 A;  2I6R A;  4B46 A;  3CCL F;  3C8L A;  4KWE A;  3CME F;  1X25 A;  3NK6 A;  3JAW B;  3JAT A;  4HNA A;  3RYI B;  4BT2 A;  1FNK A;  1YHQ F;  3P0Z A;  4U3J A;  4FFB B;  2CWJ A;  2EWC A;  3CB2 A;  2WAL A;  1QU9 A;  3NK7 A;  2AIF A;  3IR9 A;  1W40 A;  1VQ4 F;  2OHW A;  3KJJ A;  3JAT B;  3WGK A;  1XV2 A;  3M1X A;  1Q81 H;  4HNA B;  5A2Q M;  1X52 A;  2AIZ P;  3KJK A;  2K1S A;  2CSL A;  5GIN C;  4NUT A;  3VOA A;  3OW2 F;  2B33 A;  2ZVZ A;  2GZL A;  4I4T A;  1W57 A;  1W55 A;  3WGM A;  2UYJ A;  5EIB C;  2FGY A;  2HRY A;  4O2B A;  5HY1 A;  2HVY D;  1TUB A;  3CYQ A;  2RHJ A;  4BT5 A;  5J2T A;  4TUY B;  3PAF A;  3ON1 A;  3HWU A;  1KNK A;  2UZH A;  3QHD A;  3E20 B;  3V4D A;  4I4T B;  4WBN A;  3FD6 A;  4TZZ A;  1Q8R A;  5LA6 B;  4O2B B;  1NJI H;  1W41 A;  1VQO F;  5GIP C;  3J80 M;  4DXD A;  5J2T B;  1M1K H;  3JAK A;  1IV1 A;  3R0P A;  1QD9 A;  1VQ8 F;  4I50 A;  2W8B C;  2YXZ A;  3NVK E;  1QVF F;  5GAN K;  1W59 A;  1YIJ F;  1UI9 A;  3FFM A;  3O85 A;  3L7Q A;  1XHO A;  2HS4 A;  1FNJ A;  1YIT F;  1VQN F;  1U40 A;  5HY2 A;  3T80 A;  3G6E F;  4BT4 A;  2OZB A;  2HS0 A;  1RQ7 A;  3JAK B;  3JAM M;  5GAP K;  4I50 B;  2Z1U A;  2BO1 A;  4G4Y A;  3LWR C;  4LCK A;  2RHO A;  3KHN A;  1W3E X;  2BTQ B;  5JCO A;  1U3P A;  3VYS C;  3I56 F;  1YGY A;  5C8Y A;  1OAP A;  4EI8 A;  2BTO A;  4BVR A;  2QTP A;  2H6L A;  3QTY A;  2PHN A;  2BTU A;  2PMP A;  4X20 B;  3VOB A;  2RB9 A;  1IV2 A;  1VQ6 F;  5LXT A;  5IYZ A;  3K12 A;  1PXW A;  4C82 A;  1CK2 A;  2IQQ A;  3GTZ A;  3KIZ A;  4TV9 A;  5C8Y B;  1W5E A;  4EI9 A;  3CCE F;  3JAL A;  3QUW A;  5LP6 B;  5IJ0 A;  1M90 H;  4E6E A;  4BY9 D;  3J7A R;  4F6R A;  5JQG A;  4EB6 B;  2HP0 A;  3P4E A;  3HAX D;  1GX1 A;  4BVS A;  1FFX B;  1GO0 A;  5EIB D;  3K0T A;  4YJ3 A;  2KTU A;  5BMV A;  2HX0 A;  3U0O A;  5LXT B;  3MDO A;  4TV9 B;  2Q1Y A;  3I3F A;  5G4U C;  1OFU A;  3TD4 A;  5IJ0 B;  2VGM A;  1H47 A;  4BVQ A;  4LNU A;  2CHS A;  3E22 A;  4RHA A;  3J81 M;  5JQG B;  1H7M A;  5EYP B;  3V7E A;  3Q8H A;  3S0W A;  4PWT A;  3C9R A;  5BMV B;  3RYF A;  3CD6 F;  3G4S F;  2V9Y A;  2AMT A;  3V7Q A;  4XCQ A;  4O4J B;  1IV4 A;  4I55 A;  4C81 A;  1KQS F;  3WGL A;  1FSZ A;  2VAP A;  2VAM A;  5EB0 A;  4LNU B;  5DCV A;  4IIJ A;  3C9T A;  3ZP4 A;  2RHH A;  3HKC A;  4ZHY B;  1NMU B;  3RYF B;  4U3J B;  3OON A;  3VIU A;  5G4V C;  2LBW A;  3IMP A;  3S0H A;  1XBI A;  3OBY A;  5IT9 M;  3EOR A;  5HXU A;  2UYN A;  3JCM M;  3HTN A;  4IIJ B;  3CCS F;  1JN1 A;  3N2K A;  3LWQ C;  3KE1 A;  1SDS A;  3UT5 A;  3MCA B;  2H8E A;  1NQ3 A;  2ZVY A;  3D01 A;  1RQ2 A;  2P6Y A;  1E7K A;  3C9S A;  3FBA A;  4X3L A;  3SIV A;  3CPW F;  2UYN B;  2NMU A;  3TD5 A;  3LDT A;  5HY0 A;  1TUB B;  4BT6 A;  4ZHW A;  3UT5 B;  1YJ9 F;  4BVT A;  1IPA A;  1YI2 F;  3LWO C;  3FD5 A;  3ZO8 A;  2IAF A;  4G4W A;  4WBN B;  3LYB A;  1VQK F;  2LBX A;  4C8I A;  1UFY A;  3LFO A;  3VCZ A;  2VXY A;  3E1Y A;  1Z5V A;  4X3M A;  3S06 A;  3GHZ A;  5ITZ A;  3RA5 A;  5LYJ A;  3ESJ A;  3F0E A;  3WJQ A;  5KMG A;  5HY4 A;  3RE3 A;  3WPW A;  3CXC F;  3ELC A;  1YJW F;  1U3L A;  4ZOL A;  1TVK A;  2CVL A;  1PF5 A;  5KX5 A; 
#chains in the Genus database with same CATH homology
 4ZHV A;  4G4Z A;  4G4V A;  5EAZ A;  4G4W A;  3WPX A;  5EB0 A;  5EB1 B;  4G88 A;  2ZVY A;  2N48 A;  2ZOV A;  3TD4 A;  4B62 A;  3S06 A;  4ZHY B;  2LCA A;  2MQE A;  2AIZ P;  2LBT A;  2HQS C;  2K1S A;  3OON A;  2L26 A;  4RHA A;  3IMP A;  3TD5 A;  3TD3 A;  3LDT A;  4ERH A;  3S0H A;  3S0Y A;  1R1M A;  3S0W A;  2ZVZ A;  4PWT A;  3S03 A;  2KGW A;  2ZF8 A;  4G4Y A;  4ZHW A;  4G4X A;  3KHN A;  3WPW A;  4B5C A;  3S02 A;  3CYP B;  1OAP A;  4R40 B;  2W8B C;  3CYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...