4PWTA

Crystal structure of peptidoglycan-associated outer membrane lipoprotein from yersinia pestis co92
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
NATENGSNLSSEEQARLQMQELQKNNIVYFGFDKYDIGSDFAQMLDAHAAFLRSNPSDKVVVEGHADERGTPEYNIALGERRASAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAFAKNRRAVLVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
publication title Crystal structure of peptidoglycan-associated outer membrane lipoprotein from Yersinia pestis CO92
rcsb
source organism Yersinia pestis
molecule tags Membrane protein
total genus 43
structure length 130
sequence length 130
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4pwtA01
4ZHYB 2LCAA 3S03A 5EB1B 3CYPB 3CYQA 1OAPA 4G4XA 3S06A 3S02A 3IMPA 3WPXA 4B5CA 2ZF8A 4G88A 3WPWA 4G4YA 2ZOVA 4RHAA 3LDTA 3TD4A 2W8BC 3S0YA 4G4ZA 2KGWA 4G4VA 4PWTA 3S0WA 4G4WA 4ZHWA 2MQEA 4ZHVA 4B62A 5EB0A 5EAZA 3KHNA 3TD3A 2ZVZA 3OONA 2ZVYA 1R1MA 2AIZP 2N48A 3TD5A 4R40B 4ERHA 3S0HA 2L26A 2LBTA 2K1SA 2HQSC
chains in the Genus database with same CATH superfamily
2LCAA 1VQLF 3RYHB 1VQPF 1CN7A 3JARB 4X1KB 1TVKB 1W40A 1YQNA 2KTUA 1NQ3A 3M84A 4IHJA 5GIOC 1YJNF 1Q81H 2CZWA 1ONIA 3JAMM 1VQ7F 4WBNB 3ZP4A 3N4YA 1M1KH 1W5AA 2OHWA 3N2GB 1KD1H 5FNVB 4TUYB 3KHNA 3V3TA 1IV1A 1W581 3RYIB 3VOAA 4O4JB 3DDNA 1H7MA 3WGJA 2H6LA 4C8IA 3LFOA 3JAKA 3VO8A 3N2KB 3G71F 2Z1TA 3JAWA 3JVHA 5IYZA 1K9MH 1RQ7A 3CC4F 3VIUA 5EYPB 3N4ZA 2HS0A 5JH7B 5BMVB 3WPWA 1CLIA 3C9SA 2F9ZC 3FD5A 3CCUF 2BTUA 3RYHA 5KMGB 4BT4A 1XRGA 4RHAA 1ZWZA 4I4TB 3JARA 4X1KA 5HY0A 1TVKA 1QVFF 4WBNA 1VQNF 3N2GA 1U40A 2BTQB 2RHOA 4TZZA 2ALEA 4TUYA 3RYIA 1JD1A 4I55B 4O4JA 5EB1B 1YJWF 2HP0B 3QHDA 3K2XA 5IJ9B 4O2BB 3HKDB 1FNJA 3N2KA 3M4SA 1VQVA 4BT3A 1GO0A 3MQWA 2ZOVA 3C8LA 5EYPA 2R6R1 3PLAC 5JH7A 3CXCF 5BMVA 1N8RH 2P6YA 3SIUA 3KE1A 5KMGA 5KX5B 2VAMA 4NQ3A 3K14A 2VXYA 4I4TA 1IPAA 3WJRA 2Q1XA 1GX1A 1R1MA 2AIZP 3WXMB 2L26A 4KWEA 2VAPA 4O4IA 4ZOLB 2HS3A 4YJ3B 3CYQA 3I7TA 1UI9A 3NK6A 2YYEA 4ZHQB 1ODEA 4I55A 2NMUA 2HP0A 2UYKA 1YI2F 3J7AR 1RQ2A 2I6RA 5IJ9A 4O2BA 3FD6A 3HKDA 3JCMM 5ITZB 2KTVA 3BYQA 1YITF 2DYYA 4BT2A 4BVQA 1W3EX 5GAPK 3F0DA 4I50B 2GLZA 4TV8A 5KX5A 5EO3A 1DBFA 3F6MA 2BTOA 2QA4F 2VAWA 4X20B 5EWRA 1W2BF 5DCVA 1W5FA 3HKEA 3MBMA 3RA5A 3LWPC 5JVDB 1QVGF 3D54A 4E6EA 4ZOLA 2CWJA 2V9YA 4YJ3A 4X3LA 2JNBA 4G4YA 3EORA 1SA0B 1Q7YH 4YJ2A 3NMUC 1S72F 3E1YA 4DRXB 1U3LA 4ZHVA 1QAHA 4B62A 5EB0A 3CC7F 5EIBD 5HY4A 5ITZA 2LBXA 1SDSA 3JAWB 4RQOA 5IYZB 2QEXF 4LNUA 4I50A 4ZHYB 3CYPB 3O85A 3NVIB 3RYCB 1QD9A 4X20A 2RHHA 4EI7A 4BVRA 2VGNA 2Z01A 3F0FA 3LDTA 5IJ0B 5JVDA 3HKCB 3NVKE 1VH8A 5G4UC 3IR9A 3CCLF 3J80M 1SA0A 3Q8HA 4B46A 3LWQC 1KQSF 1T0KB 4DRXA 3CCVF 3I56F 3VYUC 3K0TA 2CW4A 3ZO8A 1TUBB 3UT5B 1SZQA 3V4DA 3OBWA 3RYCA 2CHTA 1W57A 3DC2A 4EB6B 3C9RA 4G4VA 4BVSA 1W59A 4O2AA 1QU9A 2ZODA 5IJ0A 3HKCA 2OZBA 3FBAA 2UZHA 1GO1A 3J81M 4O4IB 4O4HB 3GYQA 4B45A 1VK3A 4ERHA 3CMAF 4DXDA 2K1SA 2AMTA 2OTLF 3VMFB 1E7KA 3ERNA 4G4XA 1FNKA 1U43A 2RB9A 4BT7A 3S02A 2BO1A 3KJKA 1TUBA 3UT5A 4BY9D 2W8BC 3GHZA 3RYFB 1X25A 1JFFA 3P10A 3S0WA 2IQQA 4TV8B 1U3PA 1X52A 4EB6A 1VQ6F 4BVTA 1VQKF 1W5EA 3I55F 2UYNB 3ZOPA 3HKEB 3IKEA 4O4HA 4ZK7A 3SIVA 2OTMA 1H47A 2CVLA 3S06A 1Q8RA 4U3JB 4G88A 1KNJA 3VYTC 3CMEF 4YJ2B 3PAFA 4ZI7B 4M8IA 5MN4A 1GZ0A 2KGWA 2RHJA 1XHOA 3CG6A 3OW2F 3D00A 5EAZA 3RYFA 1NJIH 3RE3A 3HAXD 5B8FA 4LNUB 5LOVB 5HP7A 5C8YB 5AVMA 3WGLA 3S0HA 3V7EA 1NMUB 5JQGB 2HP3A 2Q1YA 1JY8A 2UYNA 1K8AH 4B5CA 3HTNA 1J7HA 3CPWF 2FGYA 4C81A 4U3JA 3G6EF 5LP6B 2CSLA 1XBIA 2PHNA 3CCSF 3M1XA 2G9IA 1YHQF 1Z5VA 4ZI7A 1X7PA 4BT6A 5HXZA 1YGYA 1PXWA 2ZVZA 4X1IB 3JALB 3HKBB 3P0ZA 5HWEA 3HWUA 3QTYA 3TD5A 3JASA 4XCQA 4ZHWA 2AIFA 2HQSC 5LOVA 2DT4A 1VQ4F 1RA4A 5C8YA 5GINC 4C4WC 1VHAA 4C8EA 3GTZA 4FFBB 5GONB 3IEWA 5JQGA 3ELCA 4LCKA 5J2UB 3ZP7A 4O2AB 1W41A 3VOBA 2EWCA 1M90H 3E22B 5CB4B 3LWVC 2HRUA 5MN6A 4G4WA 3KIZA 1KC8H 4NWOB 1X7OA 5LP6A 3JATB 5LP6C 2ZAUA 3CCQF 4X1IA 3JALA 2Z1EA 3HKBA 5GANK 2OTJF 4C82A 3IMPA 3LYBA 3VTIC 3LWRC 3F0GA 2UYPA 2GZLA 1JFFB 3RA6A 2HVYD 3FFMA 4F6RA 4FFBA 5GONA 3TD4A 3S0YA 3FPIA 1CK2A 1VQ8F 3NK7A 5J2UA 4G4ZA 1RLUA 2RHLA 1W42A 2HS4A 2IAFA 5G4VC 5HY2A 3E22A 5CB4A 1UFYA 3WJPA 1JJ2F 2VGMA 1KNKA 3E20B 2N48A 3IKFA 3JATA 3WGNA 4X1YB 1IV4A 4C8GA 2QTPA 5LXTB 3HJWC 4X3MA 2H8EA 3D01A 2IG8A 2Z1FA 4HNAB 1Z5WA 4NUTA 4EI8A 2FC3A 5J2TB 1YJ9F 5A2QM 3CCEF 2MQEA 3ESJA 3VCZA 5FNVA 3OONA 2R751 1VQMF 3B6NA 5EZYB 1VQOF 3QUWA 1IV3A 3S03A 3KJJA 1JN1A 1OAPA 1IV2A 3MCAB 5LYJB 1K73H 4O4LB 4X1YA 2HRYA 3WJQA 4IIJB 5LXTA 5CA1B 3F0EA 3V7QA 5LA6B 2GVIA 2I6DA 1VQ5F 2PMPA 4BW0B 2QI2A 4PWTA 1H48A 1COMA 5HY1A 4HNAA 5HXUA 3I3FA 1FFXB 5J2TA 3AGKA 1YIJF 3JASB 3WGKA 2LBWA 1XV2A 3U0OA 4U39A 3P4EA 5JCOA 1RLGA 2LBTA 5MN5A 3VI6A 5JCOC 5IT9M 5EZYA 3WPXA 3CD6F 5LYJA 3CCJF 4TV9B 3CB2A 3C9TA 4O4LA 3G4SF 4IIJA 5HP8A 3LWOC 3CCRF 2B33A 5CA1A 2HX0A 1Q82H 5LA6A 1W5BA 1PF5A 3TD3A 2YXZA 5CA0B 2Z1UA 3WGMA 3VYSC 3CC2F 3MCQA 3L7QA 1FFXA 1OFUA 4R40B 5FJ4C 3LMEA 1FSZA 3OBYA 4IHJB 3R0PA 2H8CA 3C9UA 2UYJA 3CCMF 4F6RB 1VQ9F 4EI9A 2ZF8A 3MDOA 2KG4A 2WALA 4BT5A 3T80A 3ON1A 1W55A 4ZHQA 5GIPC 1DT9A 4TV9A 3JAKB 1Q86H 5EIBC 2CHSA 2ZVYA 3K12A 3CPQA 1T0AA 3IEQA 5FLXM 5CA0A
chains in the Genus database with same CATH topology
4ZHYB 2LCAA 3S03A 5EB1B 3CYPB 3CYQA 1OAPA 4G4XA 3S06A 3S02A 3IMPA 3WPXA 4B5CA 2ZF8A 4G88A 3WPWA 4G4YA 2ZOVA 4RHAA 3LDTA 3TD4A 2W8BC 3S0YA 4G4ZA 2KGWA 4G4VA 4PWTA 3S0WA 4G4WA 4ZHWA 2MQEA 4ZHVA 4B62A 5EB0A 5EAZA 3KHNA 3TD3A 2ZVZA 3OONA 2ZVYA 1R1MA 2AIZP 2N48A 3TD5A 4R40B 4ERHA 3S0HA 2L26A 2LBTA 2K1SA 2HQSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHY B;  2LCA A;  3S03 A;  5EB1 B;  3CYP B;  3CYQ A;  1OAP A;  4G4X A;  3S06 A;  3S02 A;  3IMP A;  3WPX A;  4B5C A;  2ZF8 A;  4G88 A;  3WPW A;  4G4Y A;  2ZOV A;  4RHA A;  3LDT A;  3TD4 A;  2W8B C;  3S0Y A;  4G4Z A;  2KGW A;  4G4V A;  4PWT A;  3S0W A;  4G4W A;  4ZHW A;  2MQE A;  4ZHV A;  4B62 A;  5EB0 A;  5EAZ A;  3KHN A;  3TD3 A;  2ZVZ A;  3OON A;  2ZVY A;  1R1M A;  2AIZ P;  2N48 A;  3TD5 A;  4R40 B;  4ERH A;  3S0H A;  2L26 A;  2LBT A;  2K1S A;  2HQS C; 
#chains in the Genus database with same CATH topology
 2LCA A;  1VQL F;  3RYH B;  1VQP F;  1CN7 A;  3JAR B;  4X1K B;  1TVK B;  1W40 A;  1YQN A;  2KTU A;  1NQ3 A;  3M84 A;  4IHJ A;  5GIO C;  1YJN F;  1Q81 H;  2CZW A;  1ONI A;  3JAM M;  1VQ7 F;  4WBN B;  3ZP4 A;  3N4Y A;  1M1K H;  1W5A A;  2OHW A;  3N2G B;  1KD1 H;  5FNV B;  4TUY B;  3KHN A;  3V3T A;  1IV1 A;  1W58 1;  3RYI B;  3VOA A;  4O4J B;  3DDN A;  1H7M A;  3WGJ A;  2H6L A;  4C8I A;  3LFO A;  3JAK A;  3VO8 A;  3N2K B;  3G71 F;  2Z1T A;  3JAW A;  3JVH A;  5IYZ A;  1K9M H;  1RQ7 A;  3CC4 F;  3VIU A;  5EYP B;  3N4Z A;  2HS0 A;  5JH7 B;  5BMV B;  3WPW A;  1CLI A;  3C9S A;  2F9Z C;  3FD5 A;  3CCU F;  2BTU A;  3RYH A;  5KMG B;  4BT4 A;  1XRG A;  4RHA A;  1ZWZ A;  4I4T B;  3JAR A;  4X1K A;  5HY0 A;  1TVK A;  1QVF F;  4WBN A;  1VQN F;  3N2G A;  1U40 A;  2BTQ B;  2RHO A;  4TZZ A;  2ALE A;  4TUY A;  3RYI A;  1JD1 A;  4I55 B;  4O4J A;  5EB1 B;  1YJW F;  2HP0 B;  3QHD A;  3K2X A;  5IJ9 B;  4O2B B;  3HKD B;  1FNJ A;  3N2K A;  3M4S A;  1VQV A;  4BT3 A;  1GO0 A;  3MQW A;  2ZOV A;  3C8L A;  5EYP A;  2R6R 1;  3PLA C;  5JH7 A;  3CXC F;  5BMV A;  1N8R H;  2P6Y A;  3SIU A;  3KE1 A;  5KMG A;  5KX5 B;  2VAM A;  4NQ3 A;  3K14 A;  2VXY A;  4I4T A;  1IPA A;  3WJR A;  2Q1X A;  1GX1 A;  1R1M A;  2AIZ P;  3WXM B;  2L26 A;  4KWE A;  2VAP A;  4O4I A;  4ZOL B;  2HS3 A;  4YJ3 B;  3CYQ A;  3I7T A;  1UI9 A;  3NK6 A;  2YYE A;  4ZHQ B;  1ODE A;  4I55 A;  2NMU A;  2HP0 A;  2UYK A;  1YI2 F;  3J7A R;  1RQ2 A;  2I6R A;  5IJ9 A;  4O2B A;  3FD6 A;  3HKD A;  3JCM M;  5ITZ B;  2KTV A;  3BYQ A;  1YIT F;  2DYY A;  4BT2 A;  4BVQ A;  1W3E X;  5GAP K;  3F0D A;  4I50 B;  2GLZ A;  4TV8 A;  5KX5 A;  5EO3 A;  1DBF A;  3F6M A;  2BTO A;  2QA4 F;  2VAW A;  4X20 B;  5EWR A;  1W2B F;  5DCV A;  1W5F A;  3HKE A;  3MBM A;  3RA5 A;  3LWP C;  5JVD B;  1QVG F;  3D54 A;  4E6E A;  4ZOL A;  2CWJ A;  2V9Y A;  4YJ3 A;  4X3L A;  2JNB A;  4G4Y A;  3EOR A;  1SA0 B;  1Q7Y H;  4YJ2 A;  3NMU C;  1S72 F;  3E1Y A;  4DRX B;  1U3L A;  4ZHV A;  1QAH A;  4B62 A;  5EB0 A;  3CC7 F;  5EIB D;  5HY4 A;  5ITZ A;  2LBX A;  1SDS A;  3JAW B;  4RQO A;  5IYZ B;  2QEX F;  4LNU A;  4I50 A;  4ZHY B;  3CYP B;  3O85 A;  3NVI B;  3RYC B;  1QD9 A;  4X20 A;  2RHH A;  4EI7 A;  4BVR A;  2VGN A;  2Z01 A;  3F0F A;  3LDT A;  5IJ0 B;  5JVD A;  3HKC B;  3NVK E;  1VH8 A;  5G4U C;  3IR9 A;  3CCL F;  3J80 M;  1SA0 A;  3Q8H A;  4B46 A;  3LWQ C;  1KQS F;  1T0K B;  4DRX A;  3CCV F;  3I56 F;  3VYU C;  3K0T A;  2CW4 A;  3ZO8 A;  1TUB B;  3UT5 B;  1SZQ A;  3V4D A;  3OBW A;  3RYC A;  2CHT A;  1W57 A;  3DC2 A;  4EB6 B;  3C9R A;  4G4V A;  4BVS A;  1W59 A;  4O2A A;  1QU9 A;  2ZOD A;  5IJ0 A;  3HKC A;  2OZB A;  3FBA A;  2UZH A;  1GO1 A;  3J81 M;  4O4I B;  4O4H B;  3GYQ A;  4B45 A;  1VK3 A;  4ERH A;  3CMA F;  4DXD A;  2K1S A;  2AMT A;  2OTL F;  3VMF B;  1E7K A;  3ERN A;  4G4X A;  1FNK A;  1U43 A;  2RB9 A;  4BT7 A;  3S02 A;  2BO1 A;  3KJK A;  1TUB A;  3UT5 A;  4BY9 D;  2W8B C;  3GHZ A;  3RYF B;  1X25 A;  1JFF A;  3P10 A;  3S0W A;  2IQQ A;  4TV8 B;  1U3P A;  1X52 A;  4EB6 A;  1VQ6 F;  4BVT A;  1VQK F;  1W5E A;  3I55 F;  2UYN B;  3ZOP A;  3HKE B;  3IKE A;  4O4H A;  4ZK7 A;  3SIV A;  2OTM A;  1H47 A;  2CVL A;  3S06 A;  1Q8R A;  4U3J B;  4G88 A;  1KNJ A;  3VYT C;  3CME F;  4YJ2 B;  3PAF A;  4ZI7 B;  4M8I A;  5MN4 A;  1GZ0 A;  2KGW A;  2RHJ A;  1XHO A;  3CG6 A;  3OW2 F;  3D00 A;  5EAZ A;  3RYF A;  1NJI H;  3RE3 A;  3HAX D;  5B8F A;  4LNU B;  5LOV B;  5HP7 A;  5C8Y B;  5AVM A;  3WGL A;  3S0H A;  3V7E A;  1NMU B;  5JQG B;  2HP3 A;  2Q1Y A;  1JY8 A;  2UYN A;  1K8A H;  4B5C A;  3HTN A;  1J7H A;  3CPW F;  2FGY A;  4C81 A;  4U3J A;  3G6E F;  5LP6 B;  2CSL A;  1XBI A;  2PHN A;  3CCS F;  3M1X A;  2G9I A;  1YHQ F;  1Z5V A;  4ZI7 A;  1X7P A;  4BT6 A;  5HXZ A;  1YGY A;  1PXW A;  2ZVZ A;  4X1I B;  3JAL B;  3HKB B;  3P0Z A;  5HWE A;  3HWU A;  3QTY A;  3TD5 A;  3JAS A;  4XCQ A;  4ZHW A;  2AIF A;  2HQS C;  5LOV A;  2DT4 A;  1VQ4 F;  1RA4 A;  5C8Y A;  5GIN C;  4C4W C;  1VHA A;  4C8E A;  3GTZ A;  4FFB B;  5GON B;  3IEW A;  5JQG A;  3ELC A;  4LCK A;  5J2U B;  3ZP7 A;  4O2A B;  1W41 A;  3VOB A;  2EWC A;  1M90 H;  3E22 B;  5CB4 B;  3LWV C;  2HRU A;  5MN6 A;  4G4W A;  3KIZ A;  1KC8 H;  4NWO B;  1X7O A;  5LP6 A;  3JAT B;  5LP6 C;  2ZAU A;  3CCQ F;  4X1I A;  3JAL A;  2Z1E A;  3HKB A;  5GAN K;  2OTJ F;  4C82 A;  3IMP A;  3LYB A;  3VTI C;  3LWR C;  3F0G A;  2UYP A;  2GZL A;  1JFF B;  3RA6 A;  2HVY D;  3FFM A;  4F6R A;  4FFB A;  5GON A;  3TD4 A;  3S0Y A;  3FPI A;  1CK2 A;  1VQ8 F;  3NK7 A;  5J2U A;  4G4Z A;  1RLU A;  2RHL A;  1W42 A;  2HS4 A;  2IAF A;  5G4V C;  5HY2 A;  3E22 A;  5CB4 A;  1UFY A;  3WJP A;  1JJ2 F;  2VGM A;  1KNK A;  3E20 B;  2N48 A;  3IKF A;  3JAT A;  3WGN A;  4X1Y B;  1IV4 A;  4C8G A;  2QTP A;  5LXT B;  3HJW C;  4X3M A;  2H8E A;  3D01 A;  2IG8 A;  2Z1F A;  4HNA B;  1Z5W A;  4NUT A;  4EI8 A;  2FC3 A;  5J2T B;  1YJ9 F;  5A2Q M;  3CCE F;  2MQE A;  3ESJ A;  3VCZ A;  5FNV A;  3OON A;  2R75 1;  1VQM F;  3B6N A;  5EZY B;  1VQO F;  3QUW A;  1IV3 A;  3S03 A;  3KJJ A;  1JN1 A;  1OAP A;  1IV2 A;  3MCA B;  5LYJ B;  1K73 H;  4O4L B;  4X1Y A;  2HRY A;  3WJQ A;  4IIJ B;  5LXT A;  5CA1 B;  3F0E A;  3V7Q A;  5LA6 B;  2GVI A;  2I6D A;  1VQ5 F;  2PMP A;  4BW0 B;  2QI2 A;  4PWT A;  1H48 A;  1COM A;  5HY1 A;  4HNA A;  5HXU A;  3I3F A;  1FFX B;  5J2T A;  3AGK A;  1YIJ F;  3JAS B;  3WGK A;  2LBW A;  1XV2 A;  3U0O A;  4U39 A;  3P4E A;  5JCO A;  1RLG A;  2LBT A;  5MN5 A;  3VI6 A;  5JCO C;  5IT9 M;  5EZY A;  3WPX A;  3CD6 F;  5LYJ A;  3CCJ F;  4TV9 B;  3CB2 A;  3C9T A;  4O4L A;  3G4S F;  4IIJ A;  5HP8 A;  3LWO C;  3CCR F;  2B33 A;  5CA1 A;  2HX0 A;  1Q82 H;  5LA6 A;  1W5B A;  1PF5 A;  3TD3 A;  2YXZ A;  5CA0 B;  2Z1U A;  3WGM A;  3VYS C;  3CC2 F;  3MCQ A;  3L7Q A;  1FFX A;  1OFU A;  4R40 B;  5FJ4 C;  3LME A;  1FSZ A;  3OBY A;  4IHJ B;  3R0P A;  2H8C A;  3C9U A;  2UYJ A;  3CCM F;  4F6R B;  1VQ9 F;  4EI9 A;  2ZF8 A;  3MDO A;  2KG4 A;  2WAL A;  4BT5 A;  3T80 A;  3ON1 A;  1W55 A;  4ZHQ A;  5GIP C;  1DT9 A;  4TV9 A;  3JAK B;  1Q86 H;  5EIB C;  2CHS A;  2ZVY A;  3K12 A;  3CPQ A;  1T0A A;  3IEQ A;  5FLX M;  5CA0 A; 
#chains in the Genus database with same CATH homology
 4ZHY B;  2LCA A;  3S03 A;  5EB1 B;  3CYP B;  3CYQ A;  1OAP A;  4G4X A;  3S06 A;  3S02 A;  3IMP A;  3WPX A;  4B5C A;  2ZF8 A;  4G88 A;  3WPW A;  4G4Y A;  2ZOV A;  4RHA A;  3LDT A;  3TD4 A;  2W8B C;  3S0Y A;  4G4Z A;  2KGW A;  4G4V A;  4PWT A;  3S0W A;  4G4W A;  4ZHW A;  2MQE A;  4ZHV A;  4B62 A;  5EB0 A;  5EAZ A;  3KHN A;  3TD3 A;  2ZVZ A;  3OON A;  2ZVY A;  1R1M A;  2AIZ P;  2N48 A;  3TD5 A;  4R40 B;  4ERH A;  3S0H A;  2L26 A;  2LBT A;  2K1S A;  2HQS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...