5MN4A

S. aureus ftsz 12-316 f138a gdp open form (1fof)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSAEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title A Polymerization-Associated Structural Switch in FtsZ That Enables Treadmilling of Model Filaments.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 110
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5mn4A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5mn4A01
4HNAA 5FNVB 4O4HA 3JATB 2Q1XA 3N2GB 3WGKA 4KWEA 3ZBQA 4O4IB 4X20A 1TVKA 1SA0A 3JAKB 4LNUA 3ZBPA 5EZYA 4IHJB 5JH7A 4U39A 5C8YB 2RHOA 2VAWA 5LYJA 5CB4A 5EIBD 4I50B 3WGMA 3HKEA 1RLUA 4YJ2B 4O4JA 4ZHQA 5LOVB 4I4TA 4X1YB 3N2KB 3HKBA 3RYHB 3RYCB 4O4LB 5MN6A 1JFFA 5IJ9A 5LXTB 5GONB 4TV9A 1FFXA 3JASB 4TUYB 4YJ3A 1OFUA 4B45A 3HKCA 4IIJB 4EB6A 3M89A 4HNAB 4EI7A 1W5BA 4O2AB 2GVIA 1Z5VA 4EI9A 5EYPA 3HKDA 4X20B 1TVKB 1SA0B 3CB2A 5EZYB 3RYFB 5JH7B 5J2TA 5CA0A 3JAWB 5CB4B 5LYJB 3HKEB 1TUBB 3VOAA 2XKBA 4O4JB 4O2BA 4ZI7A 4ZHQB 1W5AA 5MN5A 5IJ0A 2RHLA 3E22A 3HKBB 4XCQA 4FFBB 5EIBC 3UT5A 4TV8A 3WGLA 3V3TA 4X1IA 2VAPA 5KX5A 5CA1A 1JFFB 3VOBA 5IJ9B 5LA6B 5M7EA 4TV9B 1FFXB 4YJ3B 4B46A 3HKCB 2Q1YA 4X1KA 1Z5WA 4DRXA 4DXDA 5JVDA 4O4HB 5LP6C 4WBNA 2BTQA 5JQGA 5ITZA 5EYPB 4E6EA 3HKDB 5BMVA 4LNUB 5MN4A 3ZIDA 4I55A 5J2TB 2VXYA 5CA0B 4U3JA 2VAMA 3RYIA 1RQ2A 3N2KA 1W581 2RHHA 5LP6A 4O2BB 3RYCA 2BTOA 5JCOC 5IJ0B 4I4TB 5LXTA 3E22B 5KMGA 3VPAA 5IYZA 3UT5B 3JALA 4TV8B 4F6RA 2R6R1 4O2AA 4X1IB 5J2UA 4IIJA 2RHJA 3JARA 4ZOLA 5CA1B 5KX5B 3WGJA 5FNVA 3RB8A 4EI8A 1W59A 3JATA 3N2GA 4X1KB 5JCOA 4EB6B 2XKAA 4DRXB 2R751 4O4IA 3JAKA 5JVDB 1FSZA 2BTQB 4WBNB 4IHJA 4M8IA 3RYFA 5JQGB 5ITZB 5C8YA 3JAWA 3C8LA 3R4VA 5BMVB 4I50A 4I55B 1TUBA 3WGNA 3M8KA 4YJ2A 1W5FA 4U3JB 5LOVA 3RYIB 4X1YA 3RYHA 5LP6B 4FFBA 3VO8A 4O4LA 4ZI7B 3VO9A 5KMGB 5LA6A 5GONA 5IYZB 3JALB 3JASA 4TUYA 1W5EA 1RQ7A 5J2UB 4F6RB 4ZOLB 3JARB
chains in the Genus database with same CATH superfamily
3IA7A 3V7EA 2A2ZA 2QGNA 3UCFA 3PQ4A 5T7BA 3AIKA 2R8BA 4ZOAA 1LBIA 3CKKA 4OHWA 4QAQA 5CW2A 1FC0A 2I8AA 3HFGA 4X20A 4XZ3A 1W2WB 2PTHA 2G07A 4V0QA 5J5AA 5JH7A 3OOYA 5KSWB 2ZW9A 3WSWA 2ZZMA 3Q72A 5HIAA 5EIBD 1YRLA 2BWJA 4UUOA 2PYIA 4RA6B 1JW9B 5A9RA 3J81k 5LSAA 5HIJA 2DM6A 3VCZA 4MLCA 1Q7BA 3BK7A 4NWOB 5DDIP 3BDIA 4KN9S 3OU2A 3VR5H 4TT3A 5MN6A 3R3ZA 1LBQA 5A62A 4OMFG 4IXMA 1KTIA 2HSJA 1MUUA 5DTIA 5BRNA 1Q0SA 2CMKA 2IHVA 3G23A 1XTVA 1XXHB 2QTTA 3FPCA 5F2EA 4XFDA 1AT1A 1DEKA 4QC2A 1JMYA 3TW8B 1J24A 1HR0B 3CMMA 4Q47A 1N4DA 3KT0A 3RGWS 1QIJA 4BNYA 1Z36A 3RUAA 3NBXX 4TZ6A 2GBLA 1DTWA 3OPYI 4KAJA 3SC6A 5LMZA 3EXG2 4YT8A 4FOPA 2B33A 1JHAA 4WZAA 4AP6A 2WMNB 2QRPA 3LIPA 3VU8A 5GIOC 5DX0A 1TQ8A 3HWSA 5IUJC 3L0CA 1S8OA 3GLFB 2P6RA 1HFEL 1NURA 2DE0X 2ZRKA 4I0WB 2PEZA 1P3JA 1IPEA 3GJ7A 5M29A 2ZYDA 1L8QA 1W88B 3W1WA 1WZIA 5EHGA 2RHDA 1OU0A 3NR2A 1RQPA 3QKSA 4FWTA 5F33A 1LZKA 2BZSA 4YJ3B 4BNKA 3K30A 1ZUHA 4GHWA 4A9AA 4WFKA 4HXYA 4Y7DA 1GTVA 1OYYA 1RXIA 1I2ZA 5FYQA 1B2LA 3DA8A 1EBBA 2CK3A 3IUJA 4RPIA 1SNYA 1M67A 5FPSA 5HFAA 3K5IA 4FGJA 2AUMA 4UASA 5ECDA 1S8AA 4I66A 3VPFA 6LDHA 1Y6FA 2PUFA 4N48A 1X0VA 3R6DA 5HWEA 1Q7RA 4QTYA 3R77A 3EXFA 1IL0A 4ZGWA 3BRWA 5AESA 3GUYA 3L46A 5K5EA 2E4VA 2D6FA 1A9SA 2BP7A 2HADA 4FYVA 5ALPA 4M0DA 4DXHA 2PSDA 3BD6A 4OMCA 1YQNA 3HNPA 3L0DA 3RT7A 5MGBA 5EIXA 3KM0A 3QEMB 3CUSA 3TKYA 1Z8HA 4CT0A 5A1TA 4ZTBA 3TMKA 4BFTA 3P2YA 1J7KA 1EX9A 2D1FA 2Y9PB 1EJ2A 3DAOA 4RESA 4V3BA 2ZT8A 1PFYA 1Z0SA 2YV2A 3ND6A 1EGVB 4RWEA 2H6EA 2FSVA 4X3MA 3LUHA 4QGBA 4D9CA 1USKA 3I55F 1KNJA 3TD4A 3AT1A 2Q3LA 5TX7A 5C32A 4CIAA 3CCVF 5AKXA 3B3JA 4G1EB 1DIOB 5AVZA 2O2ZA 2DFTA 4YCCA 2Z9BA 1C9NA 3G2IA 4JBIA 3ESJA 2QL9A 2H4WA 1ODLA 5L7TA 3X1YA 2HRQA 3JALB 4Q6BA 3DWIA 1I6MA 3R3YA 1DNPA 3NHJA 1IM8A 2YFYA 3NV7A 4INZA 1XZDA 1CQJA 1E3SA 2WNSA 2PXCA 4K6FA 4A10A 5CM2Z 5DHQA 4DCMA 1LLCA 3BTVA 1J33A 4R8LA 5G1OA 1QIDA 3V7FA 4AN1A 1T1RA 1EK5A 5K7SA 1ZH8A 4CCAA 1YJCA 2ZCVA 1E2HA 3L7LA 2JIZD 2VAWA 3AF5A 4QG7A 1HY3A 3QVOA 3T4EA 1CDOA 1A8UA 1HO3A 3A2LA 4TYQA 3EGWA 1NW5A 4GP6A 4NFHA 5FUVA 4KQGA 4HTAA 2PGJA 4CM8A 1NQVA 2PPLA 4NU6A 4OIFA 5CDHA 5K0SA 4OA5A 4O4LB 4PZLA 3JQ7B 4K05A 3MS4A 1AC5A 2M9MA 4Q4AA 4YP5A 1NN5A 4JELA 2M6KA 2BFOA 4GKBA 5HZMA 5LQNA 1KFEB 3BWCA 1VI6A 4UEOA 4I19A 4OH7A 1G8SA 3UMBA 3IKTA 3RH0A 1T9BA 5HUJA 3RUCA 1LPOA 5EJ5A 3KYIB 1BN7A 4R1UA 1T36A 1TNDA 2IHUA 3O83A 4U2GA 2HKIA 4X20B 4I8DA 3IQWA 2CC2A 4PBTA 4PO1A 2GPYA 3U7HB 2DCMA 5JH7B 4DMRA 3PF8A 3V46A 4OU5A 3G7UA 3RRXA 4OK3A 2B69A 4QPDA 3DLHA 1T5TA 3IIIA 3K1JA 4MJ3A 1ZH4A 1U6KA 4FMDB 4JENA 3TZBA 4YMGA 1QYDA 3COVA 5LFAA 4RJIA 3L92A 2KJQA 2PJUA 3RC2A 3D7RA 3DV2A 3HL4A 2UYCA 4Q24A 3LPAA 1OZ0A 1UPFA 1X19A 5CLGA 3KBBA 1GCAA 3GU3A 3OTIA 2V54A 4H7KA 1DAHA 5E8JA 2ZLBA 4N6OA 4O29A 1WRBA 2ZWVA 4CF6A 3IV6A 4WLVA 1L8LA 2ODPA 5DNCA 1X7HA 3G9QA 3TAHA 1LA2A 2ZB4A 5COAA 2IXAA 3KZNA 5TGTA 1DTWB 3MOIA 4WESA 5BW5A 3HA5A 2X41A 2OFFA 4WFQA 3RBXA 2I34A 2A84A 4L95C 2WIJA 5P8WA 4B09A 1KI1A 4D3XA 1VG0B 5JC1A 3I0NA 4FOLA 5EWLA 3OKAA 3HSSA 3SJCA 1CWUA 1EK6A 5CVTA 3BSWA 5KNBD 3OTGA 3HLKA 3K70C 3A4YA 2ON6A 3KB8A 3CNHA 4N82A 1FYWA 2QLLA 2MDTA 2DQYA 3J7TA 1J2RA 2HQBA 3QUBA 2OXEA 3QKSB 3ZTWA 4G0PA 1U7ZA 4A2PA 3AUSA 4R41A 1IRIA 1IE3A 5TDHA 5KVVA 5EHXA 5BRAA 1TT7A 5GV7A 2XCUA 4KUHA 4CKEB 1IG0A 1RAIA 4Z54A 1V3TA 5AW8A 2N75A 3IMPA 2BRUC 2W98A 4LCBA 3IEMA 1UKYA 3RSCA 1JH8A 2V5AA 1LY1A 2W6JA 1K08A 4MPRA 5BSVA 1NBHA 2Q9UA 3EXFB 5DXJA 4CIVA 1ZH2A 2VHEA 2RGXA 3OCXA 1KJYA 5SYNA 1VLLA 1MNAA 1OFHA 2ACVA 2BP7B 4PX5A 4RPLA 4XYGA 5DEOA 4B7ZA 5CEJA 2PUTA 4DMKA 3CGWA 3P96A 2JFUA 1SHJA 3VUFA 4KXWA 4CKBA 3T0GA 4U7HA 4ZAVA 2DAPA 2VJCA 3OPMA 2BI4A 4RCZA 2BSAA 4PS1A 5E1MA 5JYEA 1V16A 3L7DA 3OJCA 1IOVA 3HWWA 4HN2A 2EYUA 3D6MA 3M6VA 4ND6A 3I32A 3O0DA 3WYBA 2QIPA 2BFAA 1YHNA 3ITDA 3LD9A 4LNUA 3UHOA 1BN6A 2ACKA 2YDYA 4OXXA 1PLLA 2JFBA 3P1JA 3WDMA 2RI0A 4N6GA 5CX4A 3U26A 2AOUA 3HMKA 3L04A 3LY7A 2NT3A 2PUGA 4AZ3B 3A1WA 4ZHQF 3M6AA 2IV7A 5IWCA 1V7ZA 1LC0A 5KSZA 7GPBA 3LX8A 4B7UA 4H15A 1CYDA 3RC3A 2FW0A 4GF5A 4Q82A 1M54A 3OCYA 2DF8A 2QG4A 1EDBA 1QIKA 3IVGA 2XT6A 3JQBA 4MB2A 3L7OA 2Z43A 4IGKA 1E2LA 3LQ1A 4LDNA 3REQB 3O90A 1N2ZA 2VHVA 2OYSA 1CQJB 3ILVA 2X9NA 1NW4A 2HLNA 3GLHE 4G5QA 4KRGA 1XRRA 5DSXA 4ZRDA 3LDUA 1WL8A 2RC6A 4P1ZA 1HYBA 1VI5A 2Z09A 3QMVA 3R8CA 5I9LA 4PPYA 1C3JA 3WAGA 3PYXA 3HXQA 1ZD4A 4AK9A 5HXAA 3EB9A 1L4UA 5KYUA 1Z7YA 2DWUA 3IEQA 2FW1A 4Q7EA 2JFXA 3VTKA 4BP1A 5JNLA 1S6YA 4ZI7A 3AV3A 2Y3IA 1HE8B 3OHMA 1CUWA 3T9BA 3B6EA 4ZO8A 3EZFA 3C48A 1D8TA 3DC2A 1OZAA 3S2IA 4CM8B 3WKDA 5EIBC 3NQ41 2V4UA 1Y5NA 2VNAA 3RWMB 2CNOA 2XX3A 1QIIA 3EW9A 4MV4A 1FVXA 5HP8A 1GHTA 4MGHA 2EBUA 5IFLA 5B2ZA 1IMJA 1YZNA 2NYRA 3LRXA 5I7RA 3E0QA 1B15A 2WVAA 3SK0A 1Q44A 2EZ9A 2PZ8A 2IUUA 2IQQA 1VJDA 1T36B 1Z0ZA 2YMPA 5HMMA 2IWHA 4D4LA 4D9HA 2LCIA 1VCHA 2RH5A 4QUDA 1IMOA 1BVHA 1E7YA 3ZWKA 3QTTA 3ADBA 3NIFB 4KNWA 3NVAA 4JR0A 2EJBA 1HRKA 2XEDA 1Y9EA 2PA0A 1MFPA 2P2SA 4L72A 1TYEB 2EF0A 4TQGA 1BWSA 3M9WA 3ZK8A 2GN8A 2W4IA 3KIZA 1UK9A 3VA7A 1UDCA 3B6IA 4JBWA 3C3PA 4C03A 4HN4B 2NGRA 2G8LA 5KTRA 1HMPA 4L07A 3FYDA 4HBZA 3CC4F 3O84A 4RANA 1ZD2P 1T6ZA 4HV4A 2ENUA 5ICFA 4RGBA 1MO4A 3IP5A 1EWVA 2C5LA 1A50B 1DIRA 4QUHA 6PFKA 3O2JA 1KEPA 1ZOLA 3IBTA 4Q1EA 1T1IA 4UARA 3E4DA 1DDGA 1PT8A 1LEHA 1J20A 1D1SA 2IY8A 2Q5QA 2A1IA 2VJPA 2X9GA 3D8NA 3HFSA 1N9ZA 3L7KA 4K9NA 4P5DA 4U2DA 3QY0A 4LQCA 1LXCA 3LQYA 1AHNA 3K6KA 4WESB 2YV1A 4CM6A 2Q5IA 5FBKA 3VYSB 4MVWA 4QFBA 3GEDA 4ZYXA 4HR7A 5EWLB 4QJIA 2Z0MA 4ARZA 3QWAA 1BE6A 1TZJA 2XVZA 3T3NA 5K8TA 1GILA 5D3QA 1VQKF 3VO1A 4AF7A 4PSKA 1YGYA 2IAFA 1BU8A 5TF4A 2YFHA 4BN0A 1E9DA 3DYBA 4RD1A 3A1CA 2LBTA 3G9XA 3Q2KA 4NJOA 5CFQA 3SI7A 4C29A 1EGQA 4BEJA 4MP6A 3QTYA 4D8YA 1WUKS 3BMCB 1G64A 1NWCA 2Y66A 2VSOA 1UOEA 4BFZA 5IJZA 1GGKA 2OTMA 4MUIA 2FEWB 3N3AC 4O1HA 4RLQA 3D7MA 1J99A 2Q1WA 3OZIA 4JI3B 2VI5A 2HGSA 1AURA 4UEWA 1UFVA 5AKLA 4DSAA 2X5NA 2PH3A 4DDKA 4DRZA 2FXIA 1OIXA 1PN3A 2C83A 2HA4A 2HQRA 2SNIE 3LX4A 1GX1A 3PIDA 1XTBA 2NYUA 4CKBB 4QARA 3DP9A 2D1RA 2TMDA 2Y71A 2FN8A 5JXJA 2CNLA 2HF7A 1A8HA 4GPTA 4IV5A 5ALTA 4KGZA 5EMKA 1E4YA 1A5AB 3EOBI 3GEPA 5C4IA 2H1WA 1QH0A 1JHXA 4B76A 5HZKA 3BEDA 3ZQ4A 3I05A 4H6VA 3ZCVA 5HF5A 2J9RA 3NBQA 4M1YA 5FUBA 2AOUB 4OB6A 2AEEA 4OOEA 1NDUA 1XZBA 1TTTA 1Q84A 5CD9A 4EEKA 1B41A 4ZT7A 3R1IA 1OAOA 4X92A 1XTZA 4KO1S 4XVUA 2WFZA 1YONA 3OM9A 2PKRA 1JA0A 1OV4A 4ETMA 4AJJA 4LF8B 3VNUA 2ZYRA 1DAIA 2VAPA 5NLLA 2VQ6A 2CHFA 3ANSA 2V55B 3AHIA 1PFKA 2ZATA 4NOMA 4NCKA 1ZYUA 4I4CA 4H4CA 4HQ0A 1TI7A 2Q0HA 3A6EA 4EJFA 4DY6A 1IV4A 4EMSA 3I8OA 2AWNA 3L8GA 3IS3A 2X77A 1B8NA 3C7TA 3F5SA 3CR8A 3TNFA 3W8FA 1G3QA 3ND7A 1NNSA 4Q6WA 4E12A 4GWGA 1QWOA 2ILTA 3C1TA 4IZIA 4X90A 3AU9A 5E1OA 3DR3A 5FWAA 2I9KA 1IPAA 1ZX1A 5KYUB 4Z7JA 1AA6A 1P5ZB 3LA6A 4F8JA 1VRVA 3KFLA 4NQZA 3GUHA 2B0JA 1MGPA 4XTCS 1YACA 3CXRA 4FBLA 2R79A 1JLMA 4TSFA 2B4RO 4RVDA 2VN8A 4XXHA 2RHJA 1BCSA 4MB6A 1UADA 2KWIA 3N5KA 3JQ8A 1OX6A 3Q5GA 2WKWA 4RIHA 3M6MD 2IYZA 1BEEA 1A2OA 2ZU0C 3SXPA 4AFNA 1NWHA 1Q19A 2EJCA 2GLTA 2OCBA 3M0EA 4ZO7A 3TR5A 4MPJA 2GZ2A 3N9IA 5AOVA 4EPRA 1ACLA 4LG1A 3S29A 4DR6B 3GXOA 3DZBA 5CIWA 1E5TA 2O2CA 4ERXA 5HFNA 3VVLA 1U31A 3RSOA 3WMXA 3M2PA 2V7TA 2J3JA 3D31A 2XCLA 1EZ1A 4KO4S 3PGKA 4PPFA 4E70A 4CM1A 4HUTA 3AEXA 4ZALA 5CB6A 1JAYA 4L0DA 4OFZA 4QUIA 4NNJA 4HPXB 4M49A 3KKMA 1HNZB 4QYWA 4U1RA 5FR2A 1C3XA 4CQJA 1DELA 1FYFA 2DR2A 1FB5A 1OBHA 4WIAA 3D4LA 3LVQE 3GUCA 4BJ5A 2PX6A 1RYYA 2MHCA 2NZXA 3DE4X 3JVUA 3LY5A 4JGIA 5H3LA 4EY3A 3ESRA 3KCNA 2ZREA 2JH8A 1XC7A 2QD1A 3GO4A 3H9JA 1KBOA 2CKDA 2E5WA 3JS5A 3T1TA 3L0OA 1FLAA 2RHOA 4KE6A 2J5RA 3ACBA 2VH1A 5EUBA 3LVBA 5CDYA 4DUYB 4B7CA 5CW1A 1F4LA 4V2UA 5DTQA 3QWIA 1S9HA 3X1KA 1NVEA 4D57A 1TK2A 1NIPA 1BMFD 3C5WP 2HJ9A 1J07A 1TB4A 3KUCA 1NW9B 1WNFA 1GKLA 2HZBA 1P2VA 3Q2IA 1Q3KA 1VXRA 3QBVA 4NUTA 4ARZB 3HU2A 4BNIA 1JY8A 4DCUA 1KETA 2ZSDA 3NMUF 3NPMA 8ATCA 1WDLA 3PLAE 1GPDG 2PJRA 2VPXA 4MHSA 3T7JA 1W5BA 2XVAA 4BXOA 1SVUA 1QGZA 1GGJA 2F1KA 1Y5IA 3QU4A 5I5GA 2HB6A 1QLWA 2C2XA 3H5NA 1Z34A 1KQOA 1YCGA 3HP4A 2JFPA 3R7LA 4DA6A 4JJ8A 5EPUA 4RZSA 1JR6A 5JUWA 3CCUF 3TRIA 3SY8A 4YAUA 3EMVA 3DHEA 3JAWB 3IV9A 2SKDA 1OWPA 3QE2A 3LLVA 2NSDA 4F2PA 5ALDA 5C2JB 1VCNA 4JLVA 1W1UA 2X7JA 3HUEA 1K7SN 4PO8A 3FBWA 1CR2A 3Q10A 1AUPA 1FK8A 3FJYA 1RYFA 3G85A 3F90A 1D2NA 1QHEA 3IE2A 4GU5A 1Y1KE 4AVYA 5JE8A 3TECE 3I5XA 4KPYA 1DDIA 5U9CA 3CO0S 4FFRA 4ENQA 1KEWA 1QTQA 2G63A 4B6FA 3CPEA 5AJUA 3RJMA 1YHZA 1GVNB 4EW1A 3I73A 5IAJA 1PU2A 3WYAA 4LI0A 4PV7A 2VF2A 4E4TA 4ZCMA 5LZ9A 2AG1A 4LQLA 3U3OA 1R4NA 4YJGB 4B3CA 2BF4A 2FRXA 5JS7A 1IN4A 4TM8A 3DFUA 2VYNA 4IWNA 2REXB 3SFTA 3RF6A 3ZDQA 3DEFA 2H5EA 4L4SA 2MR5A 1R0CA 4Q9IA 4D0GA 4X7PA 1C9JA 5FP0A 2VRCA 3WLLA 1IZYA 2CNKA 4ESHA 5I47A 2IXGA 1ZIDA 5HDBB 4JI6B 5JRJA 4RTKA 4N5IX 1ZEMA 2ERCA 2ZRLA 1WMDA 3SKXA 3ZR4B 3E7PA 3LT0A 3NH9A 3WZMA 3ZLBA 2PLRA 3F6RA 4L5JA 3QPWA 4LRSB 1GP2A 1N8RH 2R7LA 1OH5A 3KSDO 1BSVA 3A1DA 1XDBA 3S8YA 4KMMA 4G0YA 1R5NA 1XYYA 3KE1A 2VHJA 1N1EA 3LYLA 4Z2AA 1Y0BA 2JLCA 4WOPA 2DLNA 2IZ1A 2RK3A 2XQKA 3PC3A 3QUCA 2GEDA 1VKRA 2WIDA 3G0OA 3IAEA 3FTPA 5G4KB 3EZXA 3UK2A 3VDNB 1DCFA 1JEOA 3A36A 4QDXA 5LB2A 2EYQA 2JG3A 4FEYA 2UYHA 1L3IA 2IS6A 1SRRA 3AHGA 4YB8A 3FNHA 5I3CA 2WM2A 3FRHA 5LOVA 1P31A 1ZI6A 2I4IA 3KEQA 5JJIA 4GKVA 1QJ4A 3THOA 1MDFA 3ZU3A 3SAJA 3TJRA 4TS1A 1EFVA 2XR1A 1O3YA 3FB1A 3GPBA 3IBCA 5E6SA 3ECAA 5LMUB 4WK2B 1JXAA 1XZHA 3VH2A 1B3RA 2ERYA 2WOJA 3PVCA 2XNDA 3NYQA 4OG2A 1RIIA 5CJJA 5IAKA 2C9ZA 3OCJA 2O8DA 4S0ZA 3HJUA 3JTMA 3AVQA 4FI3F 4RZXA 1BS2A 1T9HA 5IAGA 1N6KA 3DZKA 4PZPA 2O4CA 3G7NA 3RC8A 2R6DA 3BH0A 3EFHA 1TVKA 2WHPA 4Y2QA 1N5KA 1NOKA 2A0FA 2Q0QA 1O0BA 5HBGA 1F4VA 3E2PA 2ZRJA 1W6RA 5LMCA 1JEJA 4JUIA 2QTRA 1SXJD 1CQPA 3ZWMA 5ADVA 2NO0A 2Q4TA 2VSFA 2ZAOA 3GPCA 1JR3A 4OHBA 2X0DA 4DNOA 4YMUA 5JD6A 5D6OA 4EGJA 4GAEA 2GK7A 1PFWA 1GPKA 3V8VA 2ZBEA 1ZHOA 4NMLA 3CTPA 3ZY4A 4TV9A 5EKSA 3V2GA 2PX2A 1PR9A 1U3TA 2ZIVB 2ZUCA 2GFQA 3AEKA 3GCGA 1BE1A 1XWWA 2ZAYA 2WM3A 2O9JA 3O0TA 2JFHA 2QTFA 1DC6A 2QVZX 2WABA 3UAVA 4B35A 3QKWA 4E13A 4RO0A 1IXRC 3G0DA 2BI7A 3NNSA 4YAKA 2I1VB 2B37A 3AZOA 3EW7A 4NARA 3JWHA 3CINA 4RMNA 2VDUE 3JQFC 4AUEA 2KGWA 1N6IA 1WVMA 3ZEIA 4HI0E 1Q86H 4PTYA 4TRNA 1B4DA 2WZDA 1TUBB 4G4ZA 1WCYA 1ZGGA 5FBLB 4DLVA 1ZD1A 4ACAA 3F6EX 1C1DA 2OC4A 1Y8AA 3BWMA 5MN5A 1HTBA 3GXBA 3JWIA 2DBRA 1ZL2A 2P9GA 3DW1X 4F2DA 4QVIA 1ADFA 1DP4A 6YASA 2F55A 2QRLA 4IIHA 4XD2A 2DEUA 2Q3MA 5B7QA 1SKBA 4RAOA 3NWJA 3FZYA 3JD3A 3ZHBA 2YNMD 4I99A 4KCGA 2FE4A 5LUBA 3KIPA 1XFDA 2NO4A 2FEAA 2RCNA 1O95A 4OLFA 4CL0A 1X9HA 3SOZA 1MRZA 2HH9A 1EFLA 5DGTA 1VKOA 2VF7A 5EWJA 3VPBA 3VYTB 5BP7A 1UI9A 4JXZA 5JEDA 5J4HA 1W57A 1I6LA 1IQPA 3HY4A 4O1IA 4X41A 3V4DA 5HG0A 1KDVA 4F46A 2AQ8A 2GKSA 1PG5A 5L3SA 2I7TA 9LDTA 1R15A 3F5QA 1GCOA 3MJCA 2AR7A 2VRWA 5CR9A 4HWRA 3JQAB 2DT8A 3EQZA 4GNRA 4A8JC 3D9QX 5K3BA 3VPAA 1AD2A 3DO6A 5ECGC 4ATNA 5C3UA 3Q1KA 3G6WA 3FTFA 1T35A 3NALA 2IOFK 3A37A 3VGPA 4DCNA 4XM0A 3X0DA 3FNEA 1GQQA 1T1GA 2QY6A 1T1SA 1Z6XA 3GJZA 4XD7A 4A73A 3OH8A 1YRYE 3HR8A 1R4NB 2FH5B 4LMAA 4KHPB 2QGZA 2SHKA 2F8SA 5ALQA 3V2UA 4IDBA 2NTEA 2QTVA 2QAGC 3ROPA 3VSBA 3HE3A 4UHBA 2MOKA 3P9IA 3TE6A 5SICE 3GNTA 4EECA 4LV6A 2YWJA 3VZCA 3VO8A 3V7UA 3WBKA 4YP6A 4DDTA 3LBFA 1PVVA 3OURA 5T8KA 4JZKA 3IE1A 4KE7A 1G98A 4TUYA 1QV9A 2OKCA 3PUYA 3DZCA 4IQFA 5DT9A 1Z83A 3FCSB 4ISCA 3EPLA 5DIZA 4KMRA 1MEJA 3RK1A 1WQ4A 3CU5A 2PN1A 1O96A 2FXVA 5A4FS 1CUVA 1ZESA 2HSWA 2KPOA 2P68A 2XB8A 3EASA 3P8ZA 4JT9A 2J9ZB 2F1RA 2JEYA 4MW1A 1KAMA 4Z4EA 4RCVA 1EK1A 5LOVB 5KTPA 1ZVQA 3BYQA 4OQYA 4LV5B 1IJFA 3MTEA 1CUHA 3Q15C 1P80A 3QA3E 5E6SB 4E51A 3B9QA 2G67A 4LSZA 1JQLB 1PW5A 1C2YA 1EINA 1RQNA 2H59A 2JBHA 2JC3A 4KRYA 2V3CC 4DUGD 5C1OA 4JLWA 2O8DB 3FD6A 2DWOA 2IW1A 2PCLA 3SSOA 2QMUA 1XR3A 1BRMA 4ITUA 2B34A 3NB0A 2H54A 4S1PA 3EIOA 3OE7A 5K8UA 1MZVA 1K8YB 2CJFA 3P0HA 4X97A 1A72A 4NSNA 4UNIA 5M04A 3PU6A 1TVKB 2COKA 2WHPB 3G6EF 4IWXA 5EE5B 2F90A 5BNTA 1YIOA 2SKCA 2ZIXA 3A2MA 4BNUA 3L0IB 3DVSX 3HXPA 3WL5A 1NVBA 3VV2A 1TYDE 4TLMB 4D4KA 4ENPA 4G1VA 4YGXB 1XU7A 3D6AA 2QTBA 3PR2B 4BZQA 1AQ6A 2IY9A 2Q62A 2XCRB 4TV8F 2HNAA 2OHJA 4YV1A 3M6WA 3SXJA 3CXCF 2JLRA 3B20A 1PT5A 5TVGA 5DOZA 2XE8A 2QENA 2YHSA 1J25A 1TVEA 3GAMA 4KH0A 1IUPA 4L85A 4WDRA 3WK7A 4CMKA 4TV9B 1T43A 3AEKB 3Q11A 3W6PA 1R6VA 1K6IA 4TLAA 4NATA 4D7AA 1RHJA 3FHOA 2VTVA 1ZMXA 4ZT3A 2YVKA 1JL3A 1VGQA 3QW4B 4AO8A 4XJXA 1DJQA 1FOEB 1E2PA 3GX1A 4G4IA 5G3YA 1R9MA 1VLHA 4I4IA 3ZI0A 4EL5A 3OD5A 1NY6A 1QVZA 5HHTA 2DPXA 3G1TA 1W2HA 1YD7A 2PT7A 1RI2A 1RI3A 1H2BA 3BYZA 5IF3A 2V7XA 2B36A 4GRDA 7ADHA 5IYZF 2CMGA 3TCKA 1WPGA 4Z8XA 2JNBA 1QG4A 1JKFA 3FPHA 1QHHA 3PD1A 2GJ9A 1ZMTA 1IHYA 1H22A 1UPXA 3GIWA 3IUQA 1WABA 3UN1A 1U2SA 3PQEA 4X71A 4CKEA 3WLSA 2KYRA 4EB6B 3PFKA 1AE1A 3WKBA 3WLFA 1N8NA 5DFAA 2BM9A 1U1EA 5EWJB 2QZ9A 4JY7A 1IN5A 3GLQA 2RHMA 4KPUA 5G4VC 4YJ2F 1JFLA 1K7FB 2EGGA 4UU7A 5AK3A 3RVSA 5IC4A 4RL4A 2C77A 2LCFA 3CEAA 4YDQA 4PLWA 3GD5A 3KWLA 4RDXA 2Z3ZA 3CCFA 4RDHA 5FTJA 1STOA 3NKLA 4JJGA 2PWPA 2D54A 1L8AA 2OMEA 2H2IA 1DJNA 1Q8RA 1B6RA 2F67A 1JLRA 2IODA 3OZDA 1NP3A 3NHKA 4Q3BA 5J1TB 4Z5XA 2W70A 3PNYA 3H75A 4X8OA 5AVKA 5BMOA 4L3WA 3TW4A 2OHFA 3I3FA 3COWA 2Q1XA 1ZN2A 2JIRA 3IT1A 3B48A 3GRAA 3LHSA 1GRRA 2ISCA 2P8JA 5B7NA 1MB3A 4PAMA 3SZUA 1I4LD 2O8NA 5EINA 4YX9A 1P7VA 3ZLVA 3CLKA 3S5JA 2QTVB 2AFIE 4ZVQA 2OYRA 3G88A 5ESXA 4IGFA 3CLTC 1L4NA 1SR8A 2FUG6 4I4TA 2ZSJA 3NGMA 2VQEB 1PFGA 2GM3A 3PUKA 3SYKA 3X1DA 5HUHA 1N8KA 2R11A 3TLGA 5CVJA 4C4RA 4N7JA 1NLUA 5TGZA 2QDKA 2HWWA 3DEKA 3EGOA 4Q00A 2WJJA 3S0JA 3L49A 3M2TA 1KSFX 2PMWB 3V34A 2ZG6A 4TUYB 3KV1A 5I9MA 1YB6A 2E87A 2RBKA 2GBFA 4FN4A 3GHHA 3LUAA 4PQGA 5E1BA 2C8JA 1GO1A 2YOGA 3U1BA 3OTWA 4QBGB 1B7GO 3B1XA 1SVWA 3NATA 1VQ5F 3SM3A 5AQ1A 2WJAA 5HKKA 3HFRA 1KC3A 5IS2A 2PUDA 3RTGA 4S35A 1O96B 3GN1A 2O0KA 1VLVA 3GDOA 4YFVA 2LPMA 4Z99A 1OKKD 4C2UA 1CD5A 4U8HA 1LBHA 5C4MA 1U3PA 2DX7A 4MRVA 1PQUA 3ZE1B 4BYMA 1XCOA 3M4ZA 3RIYA 2FG5A 5ESWA 1D1PA 1QYWA 3ZW9A 4ZT6A 2CXOA 2C7VA 4Z0PA 1QTRA 3D6HA 4MGZR 3K9CA 3R7FA 3ULKA 3L7YA 4BV9A 1JFTA 2JDID 4OXRA 3TZLA 1DIBA 3FDIA 5HP7A 1JFVA 2JHCA 4OXYA 1WPRA 1X2BA 2V3WA 2HDNB 2PEYA 2JFNA 3OT4A 3TN7A 1KDYA 1N32B 4QEDA 1P17A 3OD1A 3X1MA 1GCIA 1XG5A 2G80A 4BAZA 3VX4A 3MCWA 4BE9A 3K05A 5FI0B 1AN0A 4NFLA 4GNKA 1C8VB 2ZIXB 1NP7A 1BVUA 2RGBA 3EBOA 4AX4A 2PNFA 3L0ZA 4IDNA 5AI4A 5AW4A 4ZK7A 1K98A 2Z2YA 1IBMB 2WUGA 3DO5A 2XWBF 3B3AA 3L3BA 4HDCA 4WCDA 4AJNA 3OZGA 2BC9A 1KMMA 4YCNA 2YHAA 4DIDA 1TPYA 3DQQA 1UZLA 2HDOA 1T0PA 1OAAA 4LDPA 4NRDA 3GT3A 5F2KA 1ZNZA 2ZPUA 4KXNA 1X1TA 5FBZA 4YONB 3RB8A 4EUSA 3K7EA 4TL8A 5F9FA 2FW9A 1M6VA 1XRJA 1NJ2A 4GOLD 4QDKA 3OHPA 3Q0EA 4QOJA 3Q7EA 4B87A 3GPLA 2Z9DA 4MW5A 2YNMC 1MIOA 5CIQA 2GBGA 1FEZA 3QQ5A 1CY2A 3L4KA 1ID8A 3HHEA 3H6GA 4IDOA 1BHO1 5FUXA 1THTA 3R8XA 5BOSB 5JSZB 4JI2B 4IOJA 1EFPA 2KLBA 3FUCA 5JD3A 1XTPA 2OQ2A 4HZIA 4LPKA 3ORYA 1H0KA 4B5LA 3QWFA 4JYMA 2HQSC 2VSNA 3FPAA 3VZBA 1JWAB 3RC9A 1NQAO 2C2MA 1PHRA 2XCOA 1A7UA 3DVLA 1V1RA 3C87A 3LWPC 2XMRA 5FNZA 4K9MA 3SYLA 1NVKA 2ZI3A 3HTXA 1QHHB 5IC6A 1HDIA 1XTJA 1ZJ6A 1DVRA 1YDHA 2FR0A 4QU5A 4CCSA 2ZRIA 5IU6A 3K9LA 2WJZB 2FHSA 3EEOA 4Y18A 4JUAA 4F4FA 5ED0A 1RRKA 3Q6NA 3AG5A 3D3WA 3R0QA 1Z2AA 2HCJB 3E81A 5F9HA 2HY7A 5EGNA 1PTJA 1RM5A 1US8A 5EIFA 4KPUB 2VP5A 2XB4A 4OQEA 4XX1A 3HKEA 1RLUA 2G3YA 2WHQA 1CRLA 1ZGJA 5F98A 1VZ3A 1RSZA 3EXIA 4OQMA 3MBIA 1VG1A 5ADWA 5ESRA 2Y92A 2JZCA 3H8WA 4PCLA 4BNNA 1ISHA 4CLEA 3ZVRA 4E3WA 1Q92A 1UBLS 2Q29A 3DFFA 2GMWA 4TMKA 1SG6A 3B9BA 3L4BC 4JT4A 5LLTA 2ORYA 1OYOA 1I3OA 4Y1GA 1FFXA 1XN1A 3H5LA 4NXMB 1NVMB 2VSXA 3ORHA 3W5IA 3RHSA 1H94A 1LJ8A 2OXTA 5TMPA 5E2IA 1YI8A 3NWOA 3R75A 2WU0A 5HE9A 1TKCA 4E5VA 4BASA 4FCWA 4WDQA 4RMHA 3M3DA 3AOEC 2ACEA 3D7KA 1E1DA 1UCFA 1W5SA 2PH5A 8ABPA 3A2KA 1Q12A 4UVHA 1Z8DA 4EFKA 4YP0A 4KP7A 2OOKA 2YRFA 4UEJA 4UFPA 2D7CA 1JDUA 2OC9A 4YMVA 1SOWA 4OM7A 5B4UA 4EA6A 1XVTA 2Z4RA 3ICOA 4GMDA 1KGSA 4GMHA 1J90A 4W5WA 1TM5E 3S2YA 1I01A 4B2YA 4QPZA 2OGUA 3H97A 1N0WA 3ISJA 2CXRA 3KEFA 4GX5A 3A58B 4OB7A 2XBMA 3HV0A 2Q5HA 5DM4A 3GLUA 3ZZ1A 4DQVA 1NLYA 5KWVA 4QULA 4UXJA 1DQZA 1SU4A 4B46A 3UHFA 2VNSA 3U4IA 1P2TA 3ZY2A 1M6YA 4YLEA 1B8VA 2QTCA 2W58A 1OA1A 3L18A 4WOBA 4WRRA 3PNBA 1DBIA 1NKSA 1UXJA 2O2IA 1IEXA 3NHLA 2NQTA 4M2LA 4A27A 4ZCTA 4QM7A 1IXZA 5MN4A 1QH8A 2PMKA 5AHRA 3TEFA 1JLKA 1MW9X 2IPXA 1QVVA 5AM4A 1JQBA 1KR5A 1HDRA 3U7JA 1W94A 2AT1A 2RHTA 1HH4A 1ISMA 1SY7A 3PR3A 5LZ7A 4PCAA 3JR7A 3AUKA 3ROZA 1Q57A 1TE2A 4FHDA 3Q8XB 1IJBA 1M2NA 3PA6A 3ORQA 3ZU4A 3SEAA 2JJ1A 5A4JA 2ZRQA 1GUDA 3VR2D 2NV6A 3C3BA 3GLIE 4FYKA 3W8EA 4F6RA 1TCAA 1D1QA 2YQZA 1ZHFA 3ROMA 1N2SA 3ILHA 5KSOA 1IHPA 3BK1A 1XF1A 4YV2A 4DE5A 3FUVA 1GR1A 1WP9A 2ZBPA 4HWPA 4BDSA 2X9VA 2L17A 3OCCA 4I5EA 4LWOA 4X8LA 1ODEA 4WXMA 4I5IA 4LIPD 5DO9A 4QG3A 5BQOA 2OCLA 4B85A 3CUEF 1W34A 3DMTA 1G5PA 4ZVOA 2WDZA 4ZYUA 2PFSA 5C8DA 1WKBA 2XAAA 3HYLA 4FDTA 1SUFA 1Y81A 2WVJA 3L6RA 4LDQA 5C5IA 4BGIA 4MO2A 4A2QA 3LFUA 2ZWPA 2LVBA 2HM7A 1FS5A 3SX2A 3DT9A 1LFDB 1VKZA 4OYHA 2BGLA 5BVGA 4C3ZA 1H8HD 3FUUA 1YQUA 1ND6A 4M86A 1HF3A 1OHHD 1U65A 3NCHA 3QOWA 3DDSA 2IPMA 4FJ0A 3P0ZA 3AFMA 5D87A 3EPHA 3PNSA 1M6VB 1G6OA 3DMFA 1GYPA 2YWGA 3TTWA 1I2BA 5AWFC 1L5LA 3T34A 4K3UA 3GWGA 1ECLA 1BWQA 2C96A 3VH1A 1ZN9A 1ZN7A 4U00A 4HVLA 3Q0TA 3GFSA 5B36A 1DUVG 2Q0SA 4CG1A 3E9EA 4KEAA 4ZHQA 3EC7A 3TL3A 2W37A 3CUWA 5BV1A 4Q7LA 2ZITA 1G8AA 4QHSA 1QRDA 3WJQA 1OOEA 4KLZA 3BWEA 5GAPK 2DKNA 2O2XA 3CH4B 3ZDBA 1RQGA 2Y1KA 4WKOA 1V1RB 2QI2A 3OCVA 3B13B 4LMPA 3KD3A 5IVIA 3WRYC 4PAQA 3DPIA 1A2KC 4ZKDA 3DTYA 2E37A 2WAMA 1QX4A 4OQPA 3UC5A 4WJZA 1M83A 1ZRSA 3KPYA 1Q81H 4CIWA 1JKXA 2GTPA 5JSHA 1CF2O 3D3WB 4XFKA 4CUZA 1RXSA 5BYAA 2ZBUA 3AHFA 1F8GA 1K7YA 2INGX 1US8B 3PGA1 4A7PA 2P0AA 1W55A 3HKEB 2TMKA 1UK6A 2AGVA 3EXIB 3NW9A 3KHSA 1H85A 3QVLA 2XQJA 4R16A 4E94A 1ABFA 4ALIA 4U7DA 5CVEA 1XROA 3SMQA 3DMHA 3ZDCA 1C0EA 1ONPA 3IPRA 1EDDA 1Q7GA 4RBNA 4B6SA 1DKNA 1JXMA 3F3KA 1OWMA 3IT3A 4GLBA 2I71A 5BWMA 3BL8A 4D9IA 3WYEA 2ZYSA 3A9CA 2OCGA 1FFXB 3HJNA 4P4GA 2WQZA 3QBDA 1BDIA 1J7HA 1E6MA 1XWFA 3FKJA 4LYAA 4MCIA 3AV0B 3FY4A 4MV5A 2O6LA 4WSOA 4YREA 4BGDA 2FX5A 2WSSD 2FW8A 5LP6C 2B2XA 1PV2A 2FKAA 2NNLD 2XUZA 4MJLA 4N3AA 4HLUA 3OLYA 1VBKA 4QYXA 2VQSA 4JP1A 2D1SA 3PEYA 2YV4A 4NAUA 3RAPR 4K6GA 4GWKA 3C4QA 4KWHA 3ZP7A 1NLMA 3UB2A 4LK3A 1B00A 3GJQA 5F7ZA 3HDYA 2FVYA 4WCFC 4CIXA 3AGQA 4BFUA 3CO5A 1C4XA 5ERXA 4EY4A 2FGKA 2HHCA 2YQ4A 3F7OA 5BUCA 1VE1A 4GECA 4CIBA 3OZRA 3M9LA 3PNPA 5EZ6B 1AGPA 1FS4A 4BFSA 1AKVA 1L4GA 2DUNA 2K6GA 2GHRA 2DR3A 3NHYA 4UVEA 3QZUA 1YFKA 4Y6SA 4R3WA 5LQRA 3KO8A 4BUJA 4XQ0A 4QDOA 2REQA 3NKVA 4ZJYA 3VISA 3W5HA 1DQPA 1UJMA 4YPFA 2RG7A 3FE2A 2AE1A 1IWBB 3OU7A 3QBEA 4I50F 1LDNA 2V96A 4L28A 4K2HA 5FOSA 4DIMA 1QRUA 1QH8B 3IERA 4JSTA 2JKVA 2JAWA 4GDMA 4MUGA 4AIRA 4CMHA 2COEA 621PA 3NVIB 2AW5A 2EBFX 4ZEXA 1KYIA 4RACA 3KQHA 2C0QA 3OICA 5I48A 1ZK0A 3B7GA 2OSVA 2D1TA 2RHGB 1M73E 3CPSA 1ODKA 3GP3A 3PCXA 4FBGA 2XNSA 3IUBA 4W1QA 4EMUA 5HNKA 8AT1A 1QQTA 3AEUB 3RU7A 4WNCA 3T41A 4WXYB 4DHWA 1VOTA 2IPLA 5B3JC 3FOEC 1UZUA 4F6RB 1W0CA 3PUWA 1HORA 2VWQA 3WTCA 1E2BA 2EV9A 2HW8A 4IMPA 4O4HA 3NVKE 1MB4A 2F9ZC 1YK1A 2P30A 4LNHA 4OJYA 1UPTA 4MI3A 1PWXA 5F78A 5B4VA 3OQMA 3ESYA 3RE1A 2VBFA 2X6QA 4CN9A 4RD3A 3RKSA 2D1YA 3FYUA 2OV6A 1EM8A 1VIYA 5A7HA 3UJ9A 3L7NA 3DBLA 1XTSA 1J4AA 4JD5A 2DRIA 1DEHA 4L5BA 3EMBA 4MK4A 4O4JF 4U2KA 1GKUB 2FEPA 2IITA 2HBRA 4PY2A 4URUR 3CT4A 1WSBA 4QUJA 5HCIA 2A3RA 1E3IA 2GD6A 5B1HA 1Y1SA 1YR9A 2GZDA 2HCFA 2QZSA 3UJAA 2HK8A 1CUYA 1I7LA 4WKPA 4UHJA 4CPDA 3RRBA 4KIFA 2GB4A 2JJ2D 1SEPA 4IMRA 3SYTA 2C9DA 2ZJ3A 3CVYA 3U5ZB 5CCEA 4IZOA 1DTEA 1QFXA 2VZEA 3DVRX 1EHIA 1SXHA 3R6GA 4PXYA 5CK4A 2LBWA 1GD1O 2GPSA 2OV2A 4FUQA 4L8GA 3AILA 4DJFC 1U0RA 1WKVA 3UKJA 4H59A 1UMBA 4G5RA 4YI5A 4JLOA 3SQDA 4OP3A 1TLTA 1R6BX 2ENWA 4JI1B 4P7KA 2JCSA 3D01A 5FL3A 4PS0A 4ZHQB 3S27A 5DIFA 4NQRA 2CL6X 1FJGB 5KX5F 3TVTA 5K01A 1KJZA 1GZ0A 1XZIA 4PIPA 4CTOA 3LK7A 5K3FA 4Z4CA 1FP4A 4BP9A 4D82A 4RM3A 1WIWA 1FNJA 3WIOA 4BLQA 3RRYA 4HGYA 3JSXA 2HLHA 1WR8A 1G5IA 2XUHA 1B1CA 3OSZA 4M7PA 4WZZA 3WGIA 2QMZA 3H7IA 1ZCFA 3ZZMA 5IHXA 3QLJA 3D0QA 2B4TO 3FH0A 5AW7A 5JYBA 3UPUA 4N18A 2QYTA 2FN4A 4XLZA 5H82A 4GD3Q 1J97A 1S8NA 3AUJB 3KQWA 1EUYA 2W8BA 5IM4A 4QOSA 4IZHA 5ALJA 1K06A 4NBVA 3K5HA 2CFRA 3LT2A 1XMQB 2ES4A 4B3IA 4Z86A 2P11A 2AYXA 4AT1A 5EGSA 2ORIA 3USES 1ZL0A 3OQIA 3PSAA 2XPCA 1B14A 3T5GA 1A7AA 1Z8NA 4HT3B 2V98A 2OXIA 5A5DA 2G9UA 5FA6A 1UC8A 4NPHA 1EGAA 1K7CA 3WLNA 3A0UA 4DDMA 3ZJVA 4D9FA 1GR0A 3DNPA 1U9YA 2ORVA 2VUHB 3GGGA 1BHQ1 5DX8A 4LXQA 4G4VA 4QDJA 2H17A 4FP9A 4EY6A 4QHYA 4NLLA 4QGGA 2V8BA 2Q3EA 4EX6A 1U40A 4P7JA 3D6TB 2A58A 3LUPA 1U8AA 1E9CA 4R0NA 3K4PA 1E8MA 4MO9A 1WTCA 1VSVA 4H1VA 3B7WA 4L3OA 5EY5B 4QQKA 1O9BA 2FPXA 3KLNA 2WIFA 4FD3A 5CPFA 3EEIA 4YJFA 1GTMA 1EDOA 5JECA 1ZVMA 2OFOA 4RORA 4PPNA 2O1WA 3G2OA 3H4MA 1S5PA 2QZZA 2Q3DA 6ADHA 1TYZA 3G9ZA 4NI5A 5T4BA 2N48A 3IJEB 2BUCA 5LR6A 1GU1A 5TJ9A 3C3YA 4Q3DA 5L6LB 2FQQA 1M3SA 3AERA 1LPPA 3I0ZA 4MXDA 4TT3D 1JFSA 1A1VA 2REQB 3T52A 3MCAB 1U0GA 4JI8B 1M1ZA 3ZGOA 2N3ZA 3MRVA 4QYIA 2A33A 2C5BA 1GZ4A 2OGWA 3P9YA 3H1GA 1NF9A 3FMVA 3OESA 4D96A 1Z4QA 3GBPA 2HYDA 4JP5A 4W1PA 1KJJA 2PUEA 2BFBB 3RO7A 3REOA 3AVYA 4F9GA 2BBTA 3S2GA 4LGVA 2IG8A 4AWBA 1PKXA 4ILKA 5KUTA 4AROA 1IB6A 2GZAA 4JB3A 4RETA 1F8FA 1C5KA 2OORA 3WE7A 1XT6A 2OM6A 3K8QA 4JJ4A 4KC0A 1QGOA 1ZI9A 2IOQA 3DOJA 4K6KA 4MW6A 1IPHA 5JAZA 4GYJA 3RVNA 3REGA 3UT6A 4G2NA 2GF9A 2HS4A 2QYHA 1U28C 1HDCA 3CF2A 2BW0A 2EJWA 2FUEA 1TXGA 1AU9A 3GJ4A 2Q3BA 3CB2A 4EENA 1B0ZA 2Q2VA 2X42A 2C8VA 3MUFA 4EPWA 3FYUB 4I7EA 1EM8B 4O0LA 3EPKA 3DBLB 3U2QA 2CK3D 4G4WA 2YL2A 3IO3A 1S72F 5D3KA 4AKIA 2X2PA 1PW7A 2BONA 3HEBA 5DF1A 3BA1A 5GADl 1I30A 1QRAA 2GEKA 2RAUA 1TK3A 4ME6A 1HK7A 3BRWD 4BY9D 1FRNA 3USCS 4CBVA 2I4LA 3HUTA 1PDWA 1QZZA 1H9CA 1EIZA 2FPSA 4PHHA 5MHTA 2P4EA 3FHTA 3PD0A 3WGVA 2HRYA 4FZJA 4EHJA 3R76A 1DO0A 2LD4A 2ZB2A 2YRWA 1JMKC 2WLSA 2NUAA 1VM6A 3AY3A 3PD7A 1GUBA 4BRSA 2A7XA 4I5GA 2H31A 4NZNA 3C39A 3ND5A 4QFDA 3HJWC 1GZ5A 1PUJA 2QYSA 1KJQA 2FZLA 3SVZA 4D02A 1QP4A 2G0NA 4J16A 1PYDA 1F5NA 4LX0A 2ADOA 2R66A 2DSTA 3MCZA 4NJEB 1Z7GA 5BSRA 1FFDA 2VJNA 2A30A 4RE5A 1S0UA 1NI5A 2ZYTX 3PB3A 4O08A 2UVPA 4BU0A 3VKFA 3WQQA 5GQSA 4A6PA 2AV6A 3SM9A 1NUQA 3SYNA 4LVCA 4DJJA 4PSCA 5K3FB 1GFIA 3AONB 4O8ZA 1DAGA 3EC2A 2ARKA 1TJPB 2NAFA 5CNIA 5FT9A 5LDGA 5JZ9A 1V2HE 1W2BF 1S1CA 1Q1ZA 1AF4A 4DNXA 5EIWA 1LVUA 5GP1A 3WYCA 3CLRD 3D3JA 2AN4A 1OFVA 2XE6A 2P1ZA 5FWNA 4HAYA 4N5NA 1O5TA 3B5EA 3FD8A 2G9NA 2ZRNA 1E3QA 3SP1A 4TKMA 1T4MA 3VZSA 4U2CA 3WI7A 4MHOA 4WXPA 3W2EA 1T6YA 3OBBA 3V4PB 1HDZA 3GWZA 3V4VB 3P0FA 4JHXA 4XOUA 1JU4A 1ODJA 2AJLI 4NFSA 3OQIB 1XU4A 2CZQA 3KAPA 3T7TA 1R8SA 4KR9A 3I04M 5IASA 1QQ7A 1RRVA 1LBEA 2ONKA 3FETA 4J1TA 1O1YA 1OI3A 2B3TA 1VL0A 4OVKA 1I3LA 4QUGA 4Q01A 4ZK6A 1V4NA 3ZOKA 4YXFA 2C84A 3GZJA 4TVKA 5EJEA 5ELLA 2H2WA 5FH9A 3DYIA 4LYFA 2RHWA 3GI1A 4RXTA 4UC0A 4P9NA 5EZYF 4W5TA 4HDAA 4GPAA 1TO6A 5JS1A 2Z1TA 1Z4OA 2AE2A 2AN1A 3LPDA 4TKUA 4ZA2A 5INTA 4YJFB 2WTXA 3QGMA 4QX6A 5IVDA 5IVPA 2I2DA 2WMYA 2ZKIA 1TKAA 3LVRE 2KE5A 2EFHB 1I4WA 4J0JA 2ADMA 3W2IA 4GKJB 1OTYA 4CCYA 2NVUA 2FZEA 4WXHA 5K4AA 1E6WA 3R5JA 3O6VA 4ZAYA 1M1XB 1QVGF 2CYAA 1L7XA 3MBKA 1L5NA 2QRVB 3FR7A 3QSGA 3BJRA 2JLVA 2H11A 5DTJA 1IY0A 3EUAA 3M5CA 3OQPA 1VP9A 1GPYA 1AVTA 2ACWA 3A7DA 3PPYA 2EFGA 4R8MA 4WZBA 3AERB 4HGQA 3SNKA 5KWIA 3BQ9A 3K6SA 3BF7A 3CCRF 3I9MA 2V0NA 3QU5A 1X1RA 2QPAA 5EC8A 1SHZA 3B82A 2W6CX 4QNNA 5ERGB 3WL8A 1UJCA 1D5CA 4FYWA 4MRPA 4M8LA 2GZSA 2Q7OE 2VPQA 3I45A 3A7EA 1OXSC 1DO2A 1XMVA 3IBGA 3TQFA 2XVYA 3AJAA 1Z0KA 1ISPA 3ROQA 3IEPA 2PVSA 3GF4A 1X77A 4FX2A 4LZOA 1DQYA 1EHYA 3TW6A 5KJCA 5IMSA 2O8BA 3KR1A 3K20A 3KL2A 2G9VA 2P2LA 3E2MA 4CW7A 1L7QA 3UA4A 1C7IA 1KMHA 3ELYA 4NONA 2I2XB 3LBAA 4MRMA 1UBKS 4R3UC 4I55F 4ZO4A 4GLJA 1EFAA 1APBA 2EBWA 2CLEB 4MRAA 3ETDA 3B1KA 2XHZA 4ITVA 5DMXA 3Q8LA 1D2AA 2MJLA 4MDHA 3G0HA 5CVCA 4J0GA 2OPHA 1CEXA 3O9VA 5AKIA 2AYYA 5BSHA 3QXGA 2OFXA 3U3KA 2CLIB 4YP7A 5JG7A 2W2XA 2W6JD 3D6VA 5J2UF 2V9CA 3FHLA 3LP6A 3OLCX 3OZCA 1AKMA 4KFUA 3EFBA 4V38A 3NBMA 3ICPA 5HGXA 4BO8A 1XK6A 4L8VA 2O8CA 4RVOA 3NT5A 4RK6A 3PQ2A 1ZJZA 5TXGA 1XZJA 3U7RA 1MPTA 4AY4A 3UJNA 2FZKA 2NUAB 1CEYA 5AVQA 2JHPA 1PV4A 4AQDA 3VKWA 1XSEA 1VPDA 3EY4A 1W8IA 2G4CA 3QRWA 4HUQA 2BMWA 2F3TA 3RKRA 4CR6A 5KTKA 4Z4IA 2MSEB 5EUMA 9MHTA 2AJTA 2WJWA 4AG6A 3RYTC 5IKPA 1KGDA 2DJIA 4PGMA 3R5HA 2JGNA 1IEQA 1M5RA 2AX4A 4EGCB 1GCUA 4Z9AA 3RYHA 4P3YA 3IL2A 3VNBA 2X2EA 3AUXA 1SXPA 4BKUA 1R0YA 2UVPB 1XHLA 3QOYA 5J40A 3GLSA 4BLTA 2YWFA 3IHTA 4L9SA 4YRNA 2X0RA 4R7GA 5EAZA 1DT3A 1KOJA 1GAWA 1JYEA 3EOAI 3RTCA 5IC5A 1FYEA 2GRJA 2OBBA 2YY5A 2Z5VA 1OWOA 1HLGA 1OPRA 3FZGA 2JCVA 4C0JA 3NHSA 1MN6A 4BV3A 1R74A 3GNQA 5EE0A 1RMQA 4HX9A 3ZBPA 1F0NA 1H5UA 5HZHA 2C1ZA 4DB4A 2XJ9A 1EK0A 3C24A 3VAYA 4EHKA 6CHYA 2YC4C 3Q2OA 1Z4JA 4PZUA 3U3ZA 5EKXA 4MWBA 1QDLB 1T9GS 2WC1A 3F0GA 3GUZA 2C9OA 1N33B 3ZCRA 1DXHA 5JO0A 2C29D 5SY4A 4WN9B 1FXUA 1NQTA 3IA2A 2KHZA 2HZ7A 4JX9A 4ETIA 3PYLA 5AW0A 2Y1DA 3HXKA 1LK0A 1MB2A 4HXGA 1F1JA 2WWXA 1DO8A 4C4OA 3JQCA 5F2NA 5TQ2A 3OO0A 1ZGZA 3FMOB 3JZAA 4AX8A 4C7VA 3RROA 3PV0A 1KZ7B 2ZJOA 5AKZA 1CC1S 3LQ4A 3EMKA 2WA1A 1H4VB 3F78A 4C0QC 1S2IA 2PGAA 2ZJAA 3C3MA 1YKGA 3MJRA 4RWZA 1F2VA 2C4TA 1NVUQ 4DW8A 1U99A 2E48A 2J09A 2ZRHA 3U17A 1WZ2A 2AVDA 4R69A 4TWJA 2P69A 4JCCA 5B1DA 3MYRA 1XQXA 4CCYB 3AESA 4BWFB 4TV8A 2O0MA 1M2WA 2G82A 3EQ6A 1ZHHA 2VDWA 2JRCA 4DKXA 2C54A 2BM8A 2GBLC 2M98A 1HLFA 2V5VA 3KU4A 3FVTA 4GOKA 4OKSA 5F5LA 1RR6A 3SE7A 3WLMA 4EOGA 1RKXA 2JVJA 2CBZA 2X3FA 5CFRA 3ZWWA 5LQCA 1WLYA 1QRTA 3K6SB 1UDWA 2FP3A 2XW6A 1GYRA 3I1YA 3IAUA 3ZDRA 3LO5A 1VHDA 2F7SA 2HQOA 3OIDA 1NVFA 5G0VA 3ZIDA 2C4KA 3ABQB 2OBLA 3OY7A 4IEEA 4C0LA 3WXBA 2NV0A 4GP7A 2EERA 1QRSA 4HQKA 4F45A 1E3DA 2EFDB 1PFVA 3OOHA 4CGYA 4DGQA 2B99A 5J4KA 2GNPA 2WWGA 5LBIA 3GG9A 1GZ6A 1QAOA 3CNOA 3GJRA 2ZRAA 4LZNA 4C3VA 1GEEA 4YAJA 4GI1A 5L3QA 5IYZA 3CCLF 3BB1A 4E88A 1YA6A 1MRSA 1CZHA 1X9IA 2AQHA 1EWTA 3TQRA 3MMZA 4AN0A 1LK5A 2TECE 5E3IA 2LZ0A 3WBBA 2OAP1 3PLRA 1HFWA 1RWWA 2O8BB 4U8GA 3SR0A 4RNCA 2CJYA 4UULA 3LQFA 5CT9A 3ZHSA 1T0AA 1E5XA 4MRMB 1ZJ5A 1QCDA 2OFPA 2Z4TA 4RW0A 4D9GA 5B4TA 1YITF 3VR3A 3DLAA 4YJ2A 4H1WA 3OZSA 2P35A 2O7RA 3B2QA 3QYFA 4EVIA 1K9VF 3QFRA 3LMKA 1SQGA 2GRUA 2DMRA 2IYWA 3CRZA 4MEAA 4Z3OA 1I9GA 3WSTA 3MSXA 4BVFA 3UUGA 1FTGA 1X7PA 3UPDA 4LFAB 4PC7A 1SH7A 2UUBB 1W46A 4J43A 4DIEA 3G1UA 1PSZA 3SZOA 3VHQA 1U9IA 4LRXA 2O8CB 2A0XA 2FSIA 3T80A 3MTQA 3CKMA 1YZ3A 2K2QB 3UW3A 4HMQA 5JHGB 4IFTA 4TTRA 2H08A 4EPTA 1OH7A 1E2QA 1UPCA 4KNVA 2IELA 3LLUA 3P0JA 5CMLA 1KBZA 1CG6A 4GZ5A 3JZFA 3PQ5A 4HUQB 3ZOPA 2WHXA 3PXBA 3U40A 2LGJA 4DLPA 3GT7A 4MVCA 2D0PB 3HI4A 3KPJA 4FFWA 4NYJR 3CLRC 3RYHB 2BISA 4HQNA 3TNLA 2Z1NA 2MWMA 2R7NA 1QSGA 3TB6A 4ARVA 4DCGA 3RAFC 4OHYA 4ZQGA 2F1HA 2JHAA 3WNZA 2QT0A 2P3OA 3B3QA 4AG5A 3WGQA 2NZUG 2YN4A 4EB0A 1BFKA 2NVOA 2QPTA 1RRGA 4MJ7A 2P77A 1WJGA 1RNLA 1B74A 1PLJA 4AICA 2GYUA 1EWKA 3MT8A 3R7WA 3ELCA 4P4TA 4C7JA 3BT7A 3L7QA 5I9IA 2YWXA 4ASUA 5FCDA 1XVAA 4MHTA 3AMVA 2ZM5A 1EFDN 3EIUA 3LECA 5AM1A 1UMCA 4OHMA 1XJ5A 2ZR8A 5EMMA 2NU8A 2OHHA 5F7OA 1ZJ4A 4OQFA 4KWTA 4S0XA 4KQWA 2CDRA 3VC7A 5IJ0A 1D04A 2FAXA 5C52B 3HWUA 1TUEA 3KU1A 1IM5A 4ZEOA 1VQ9F 2WU3A 3BS4A 1ATIA 1H8EA 2V7GA 3AM1A 4WNYA 3QG1A 1T8RA 4XI9A 1RLJA 1JN1A 2XSZA 3S28A 1G5QA 2VK2A 2EOAA 2WTBA 4M9UA 5FULA 1LSOA 2HJHA 3GFTA 2OQVA 2CLDX 2TRSB 3H83A 1L4EA 5CYGA 3VC2A 4P7GA 1JR2A 2YVQA 1Y89A 2BGTA 4BX2A 1EDEA 3HCWA 4ADSG 1JI3A 2WNHA 2IY7A 3LWVC 1VJGA 3FFWA 2WZBA 5DGHA 5TQ2B 4XB1A 4TKVA 3IESA 5HCUA 2HHJA 1R3UA 2F8TA 4QJ4A 3FKQA 1X7WA 4PLYA 4PRKA 2NP6A 1UKAA 3GMIA 3LBHA 3NONA 1L8XA 1FS6A 1QGUA 1N2XA 4LA4A 4DMFA 1KI3A 4ZYLA 3ZWPA 3Q12A 5JAHA 1BEUB 1T5OA 1T0KB 2J46A 2B1RA 2ZJ1A 2YJ6A 1AKYA 2ZYIA 3K0KA 4TOIA 4WUVA 4WWHA 4ZARA 5GIPE 2GPJA 3HDVA 1KERA 1YAJA 1Z15A 1UBTS 2F9LA 4TV8B 3AESB 1XJ0A 2CJXA 3I12A 4QTZA 4JQZA 4MW4A 1K63A 3S7ZA 2C97A 3H7AA 2QUJA 3AYXB 4B4UA 2Q9BA 2VHUA 5JC8A 1GQFA 4EQ6A 3ETCA 1JUDA 4IJ6A 4JQYA 4XGQA 5DLQC 3CLUD 4YIKA 4JDPA 1R1DA 4K9PA 3K2QA 5K8IA 3WJRA 5JFOA 1FFYA 4JEIA 3SVLA 2ODAA 1G1MA 2WALA 2IDKA 3CVOA 4ERHA 4J29A 5KWSA 3WNDA 2FGJA 4DPMA 2I87A 4C8GA 3UBTA 1RKVA 3DTVA 2VQFB 5KOJA 1Y4UA 4A8HA 4MCJA 3TM5A 4OXNA 1RWQA 3DBOB 4O8CA 1WG8A 1OJ7A 2YXBA 4D6XA 5IYZB 1SU6A 2DQSA 4L8YA 5EKDA 1Z26A 1V1JA 1O58A 3AR2A 4OQDA 2AX3A 1MF7A 2E21A 2LDXA 1T2EA 1P62B 1KJ9A 3EAFA 4HRYA 4PX9A 3VI4B 3VVBA 4FX5A 4LF4B 2V7UA 3ZE7A 1AA9A 4QPJC 5GVSA 3T7IA 2HYIC 2NP7A 3GIDA 2QGFA 2F8MA 2FP4A 13PKA 1KEZA 4NG5A 3GW8A 1P4SA 3OIFA 4U39A 3QPAA 3B6MA 3ZHZA 3TLMA 1H9BA 3AM5A 1AK2A 3U4HA 1CIVA 2PX5A 2DKOA 4YJ2B 1DI0A 2VHXA 2L18A 4TL7A 5D51S 4B3TB 4EK9A 1R6AA 1KZ1A 2QA4F 2R0QC 4G25A 1KY2A 3C3KA 3HG7A 3AG6A 1U6JA 5JFTA 1E3WA 4A0QA 1JZSA 1RQLA 4F0JA 4I3FA 2HXGA 1ZGAA 3E5MA 1UDBA 3EH1A 4AWXA 2YVLA 4D9BA 2IP2A 1O9HA 2NG1A 1NT2A 1XZQA 2H48A 3LOQA 1TCVA 1T5LA 5K8VA 3N4YA 1M75A 4BNMA 3NP9A 2BSXA 1GRNA 5J4VA 1FCJA 2R00C 3ZVKA 2G25A 3FDJA 1PWYE 4TX1A 2QD4A 1KZ4A 3BORA 3LFHA 3I72A 3KUUA 3GHYA 2BJVA 2VDPB 1B6SA 1WXQA 2AKAB 4EW6A 2C2GA 2VYND 2B7BA 5DSTA 3FWPA 3DOOA 3GLKA 2PAAA 4L1KA 4KAXA 1NXPA 3S1LA 1NBME 4H6PA 3ZXYA 2BEKA 3LHIA 3T3OA 2C78A 4D6YA 3BC1A 1U2DA 4RHEA 1IBSA 2QHXA 2C82A 2ZUSA 3VAZA 2IT1A 1JZTA 1X8XA 3OT1B 3QNMA 3R20A 4XB6B 3HCPA 2ZYAA 4P93A 4AZTA 1LRJA 5HBRA 3QLVC 4EJSA 1KYXA 3HCRA 5TQVA 3FWHA 5D3MA 5BMVF 3TZCA 3V7QA 2CD9A 2J87A 1Q0PA 2XYVA 3PPIA 3HCEA 3FHJA 4IDGA 3TQCA 1T4BA 4OAPA 4D74A 3DR5A 3P9RA 3ZS9A 2G4VA 3ZVNA 2NU8B 4PICA 4IUBS 2CLFB 2FMIA 1VBMA 5C81A 3SIRA 2JLXA 3BKWA 4JJKA 3ST7A 4LRWA 5IJ0B 1JJAA 4I81A 2ICAA 2IRWA 3KOUA 1JIJA 3AVVA 2Y2UA 1L5FA 1QKIA 1ICEA 2NUPA 4L5YA 4CR7A 3NRJA 1DXQA 1E92A 4H7IA 4MWZA 4KN6A 1CV2A 1OXXK 3DTNA 2RJNA 3IFSA 2GXSA 3RAJA 3HEMA 3RS2A 1XV2A 1VGRA 2ISSD 3EOZA 2YWRA 4JYPA 2Q4DA 4MYDA 2XNDD 4O5AA 4OI4A 4R81A 3CSSA 4XVCA 2V6BA 2X86A 3HVKA 3R8FA 4EFNA 1FUIA 1JILA 1LPBB 1FMCA 1SCDA 2P62A 1Q7EA 3A32A 4TKVB 1RPNA 4Z1OA 5D2CA 1X7WB 2OGZA 2G77B 2ECPA 4GKAA 4ILEA 1G2IA 3K0CA 5JYCA 4OQNA 3FPGA 4YI3A 1EB8A 1LI7A 5CTAA 1G8JA 1TMKA 2WA2A 4RPHA 2UYNA 1KOFA 2Y1FA 1B16A 1CUBA 1V96A 1ZRMA 1VE3A 1VL8A 2D62A 2PLFA 2ST1A 2Y1GA 4M8NE 2ZDQA 3NIDB 4JU8A 1W76A 1P2UA 1DQSA 1TQ2A 2WAYA 4WOCA 5CBPB 1JR3D 5LMNB 4XH9B 1V37A 3ZDDA 1XEWY 2OD9A 3B2EA 2OG1A 3LX6A 3N6XA 4Y2UA 3R6TA 3UZUA 3O95A 3OLVA 2UZIR 4R3NA 4BT7A 3VBCA 1HNXB 1S1MA 1XEAA 2IV2X 4EQ6B 3GUVA 2G88A 1C0IA 2PXHA 5G1NA 1RXVA 4WVLA 2IVFA 1E3EA 2VK1A 2ZULA 4ENRA 5TIIA 1VL6A 1H3FA 4RTPA 1QAHA 1M2HA 1RFGE 1ULBA 2X8LA 3C7KA 4GR4A 3TX6A 2CVPA 1IAVA 1YKFA 3D8TA 1TMOA 3O4FA 4JZYA 1XHFA 3N0RA 3UHPA 5KOJB 2ZWIA 3M6XA 2MT9A 5H3CA 4BLOA 2IYFA 2CJWA 3I2GA 3PC6A 4E11A 4XUGB 5DH9A 1RDFA 3WIEA 3A1EA 4EHAA 1J00A 2ZIWB 5ALOA 2E55A 4H0FA 2IX9A 4HNQA 3L1KA 1GKIA 4KLCA 1T5HX 4QDUA 3KQTA 4E33A 5IZCA 3NOXA 5T4HA 2VQDA 2ZIEA 5BW6B 5GZ6A 3DWFA 3EWAA 1ZSNA 2QUHA 2FP4B 2ZAIA 4C8IA 4RMGA 1TK9A 4P22A 2WPDA 2XODA 2OFWA 1R18A 2PBFA 2QW0X 2GAFA 1CRZA 4YVFA 2V7QD 5KVAA 4X45A 3QMWA 1IONA 3ERNA 1SHKA 1JFRA 5IANA 4IFBA 1U63A 3L6CA 4G1FA 1E3WB 2F3SA 4ZAGA 4RLFA 1X7GA 1PGQA 1XDUA 2AJDA 1ZU4A 3DZDA 1KEVA 1JDSA 1XCGB 3D7LA 4TMWA 4TXLA 3RKUA 5CCDA 1O77A 1S7GA 4XWYA 4HJXA 5I6DA 1BMDA 2HMSA 1HE5A 1YJ8A 3RC7A 1A9ZA 3T1VA 3DXXA 3P26A 3BJIC 2O6HA 3H99A 5BSEA 3RS3A 1Q7TA 5BV8A 5HQTA 1D0VA 3MGGA 4AUMA 1L4MA 4PFKA 4E31A 4JIGA 2P4SA 3H2BA 4I9NA 2ZRBA 1EJ0A 5ICMA 4BATA 4BFYA 2IHJA 4LZJA 5F5NA 2HO4A 1L4KA 2FEXA 1A9TA 3IDAA 1G21A 4XD7D 1NW7A 1V7PC 2R8XA 3BRSA 3RD5A 1Y1TA 3QVTA 3AHDA 3ZW8A 1XZLA 4BBJA 2IH2A 3VHRA 2WF8A 5IZ4A 5BWBA 4MVJP 3IMFA 4KOAA 1WDWB 3NHMA 4Q1CA 4R2XA 4DLWA 4IIGA 5FNVF 3BUSA 3AZQA 4E14A 2ZXFA 4IPTA 1QQAA 3EIWA 2A8YA 5I3ZA 2N1BA 4EJ6A 1CCWA 1DKUA 3GRVA 1MAHA 3O2SB 4G01B 4EJSB 1G7RA 5D5PA 2Z2JA 5D3MB 3BL6A 1W9HA 3TFOA 2AMLA 5T4FA 4I50A 3OZ7A 1UFQA 1R4ZA 2VUTA 5EZQA 1CRPA 1KJ8A 3DQPA 4OBWA 1MG5A 4NCJA 5JS6A 1HLDA 1RRFA 1YR7A 4P4SA 3R3HA 1DFIA 4X7MA 3M6LA 2NZ2A 4Q7QA 3HH8A 1YZUA 4NK5A 3K09C 4B8WA 3QNUA 1SFRA 1T15A 1ZG3A 1ZXXA 3KJZA 1ORHA 5GOTA 5LBTA 1H47A 3U6BA 1LCIA 1CZRA 5FTWA 5L9AA 2EDCA 3SG0A 2FDRA 2NUPB 3NRCA 5A5FA 1EWQA 2B78A 3V1NA 5F5XA 2IBSA 1XJQA 2E4UA 3ZU5A 2D5CA 1KMNA 1NTOA 4CI0B 2UUOA 1YB7A 4ZN6A 2ZBDA 3AJRA 3QX7A 3LYHA 1CDEA 3H4IA 3OPXA 3F2IA 2WU8A 3LSTA 4ESVA 3U7GA 4D9JA 2B83A 5DWDA 4QNRA 5DKFA 3OE7D 5SZKB 1KD1H 3N2EA 4O4JA 2ZUEA 1DZIA 2WYUA 4QQRA 1VPLA 1NSFA 2A5YB 2JFYA 3FLAA 3LPNA 4J6EA 3HCNA 2UYNB 3K4QA 3TSAA 3UF0A 4ER0A 4B79A 2PO5A 2WMOB 3RYCB 4TVOA 3VU3A 2EWCA 4I36A 1O08A 3AINA 2FWMX 4G0QA 4MI6A 4X62B 4RU1A 1KDPA 4TLEA 4TT8A 1BQEA 3RIEA 3N39C 1FJXA 3VDRA 1ORDA 3PJGA 1HE1C 1OFUA 1UJ2A 3Q98A 1W5TA 4LGCA 1XTRA 3DHNA 3EFOA 2C2OA 5K6AC 4IHQA 3K9HA 5BQ3A 2CKMA 4HMPA 2R25B 5JSYA 2JAPA 4FKZA 2A7QA 3R0IA 1IZ7A 4HCJA 2O2SA 5ALUA 1TEHA 3T9FA 1T2DA 4ZO9A 5DM0A 3T3DA 1OE0A 4WK0B 2JLYA 1A7JA 5B1YA 3HYCA 4GH5A 5A0TA 4NFYA 3JWEA 2XRZA 2WQ6A 4IGAA 3MMSA 2OCKA 3H18A 2HP3A 2XWSA 4KDEA 3L8HA 2BFEA 2XZLA 3GJ0A 3EG9A 5CNJA 3EHDA 4ICIA 5FTMA 5CB8A 1VI2A 4V1CA 1EUQA 1LNZA 521PA 2CJWB 4BX9A 5KX5A 3M81A 2C07A 2HNBA 3B60A 4HB2A 3DHWC 1N6LA 2P6UA 5AHOA 3RSQA 2O5VA 1QOQB 1N7GA 3T8YA 2XYPA 1RPZA 2BO1A 3O1HB 5TE9A 1VP3A 2RBGA 2IK8A 3EFEA 4J3FA 4URFA 3CIFA 1T3LA 2AMYA 1FDOA 3ABSB 2YJ4A 2R47A 2A5GA 1I7NA 4CQMD 1QH1A 1SBTA 2HK6A 3UMRA 2WHYA 3NHRA 3JYPA 3S2UA 3SZGA 1M66A 2JLQA 5REQB 3UC9A 3BHMA 2WMDA 1PJ8A 4RSRA 3QVWA 5HK8A 1IJEA 3E15A 3ZGLA 4ARUA 1QR6A 2Q4RA 3BXPA 4ZOEA 3WLOA 5FYDA 4LBYA 1C8LA 1E2GA 3RU2A 3EZ6A 3AKEA 4J0HA 4MV3A 3G0CA 3UYLA 3DOIA 1V6SA 5DZSA 5LQUA 1IBRA 2GZRA 4B84A 4EW2A 4L50A 1GT91 4D8XA 1NVGA 4IIJA 1A2BA 2OXRA 2QN2A 1KMQA 4CEIA 5BO5A 1K9MH 4OYLA 3RV3A 5FLKA 2TMYA 2YYZA 5CVUA 3CQ9A 1CZOA 3GZTB 4ZVSA 4HDOB 2QT9A 5I7AA 1FRVA 1Z7EA 3ON1A 2B30A 5TEWA 4D41A 1NYQA 3DKKA 1FNBA 3M8KA 2XCSB 4K0RA 1GQ2A 3PGMA 1X0XA 3PGVA 2G9RA 1G21B 2A4KA 2OLKA 5HTOA 5LDHA 3GQBA 1F3OA 4HO1X 2DGDA 2XMGA 4DILA 1ODIA 3CMAF 1BZYA 5F3RA 2EATA 1G7SA 3LX5A 2B4KA 4UBNA 3VO9A 1NF2A 4J4HA 4QLAA 2YJNA 2CUKA 4QPNA 4F8YA 1GNTA 2QZJA 3ZHTA 1JG1A 5KNCH 1UBRS 2Q1UA 2VHQA 2YHBA 4YRLA 3RK4A 5C51B 2BJHA 5EHQA 2BBOA 2AB0A 2QT1A 1XD2A 2X3YA 5DCYA 3BGWA 4FSXA 3W5BA 4EBBA 4C2TA 4QAJA 4JUDX 1CIPA 1RXWA 5EEHA 4J9UE 5AOCA 3T15A 3IP3A 1LI4A 1M7BA 1L5HA 3U9TA 1VYTA 2II6A 4I50B 3GCXA 2HJWA 4PLCA 3HBAA 4TWZA 4TLBA 4DLTA 3CF0A 4X00A 2J32A 3TUJC 4QVKA 2GUWA 3LOPA 3CLSD 3DMGA 1LNQA 3WLQA 4P4SB 3FSGA 2HU8A 2G28A 2QUIA 1U3FA 4ZVPA 4NCBA 4FDAA 5FRDA 3WL7A 1OAKA 4LWQA 3PKZA 4ZCIA 2B98A 2EKQA 2VT2A 2ZWAA 1K92A 2QB5A 3MTIA 3OX3A 2PS9A 4HGRA 1Z4KA 1HZJA 1ZXLA 1CJVC 2EC5A 3EPPA 3A6LA 4EI7A 2EQAA 2FFBA 3V32A 3WDKA 3R0PA 2KSQA 4LFCB 1DQRA 4OP2A 4FWIB 4LSMA 1M76A 4IH4A 1T25A 3THYB 4Z2YA 3L7BA 3H16A 1ZQ1A 4NY1A 2H4ZA 3IVAA 1TLLA 1TMGE 2YIJA 4K86A 5EA2A 1M34A 2AS0A 3A8TA 1G6HA 3FLMA 4O4JB 4URHA 4MLPA 4FHZA 5C53B 4R8VA 4FGLA 4NYIR 2O7VA 3CISA 1AS0A 1GNPA 4LHZA 4X7BA 1GPBA 3E7WA 2YX1A 3IOBA 4OJTA 2QE7D 3F3YA 1MAAA 3CYPB 1WDMA 2XOEA 3CN9A 3OJXA 4N3GA 2PVCA 3LCVB 5AVSA 2WM8A 4RADA 2NPIA 3QLUC 3DQZA 3MWEA 4BS9A 4V3CA 1E5DA 4BNJA 3E35A 3ZE9A 4AJPA 2CEKA 2ZCUA 2ZVQX 3K92A 3UENA 1QG0A 2FSFA 1L5MA 3U37A 3HUUA 3C8ZA 1P6XA 1FL9A 1YJWF 4WZAE 5DCUA 4A8TA 5JSUA 3O8RA 5AK0A 2H8CA 2BFEB 2PWAA 4DCSA 3JY6A 2G6BA 2GCIA 1N2EA 3EG9B 4Y0VA 1P1RA 4A6DA 3D64A 3INNA 4LJ4A 5EPEA 5C1BA 4V1CB 1A9RA 2X8JA 3N8KA 2JJMA 4REMA 2JAUA 5KX5B 1J7JA 4MRRA 4EEXA 1DG9A 1LX6A 1EFRA 1NC3A 2BM0A 3KSRA 1V2GA 4J4TA 1MJGM 1L5WA 1U2GA 9GPBA 4O2RA 2IYNA 4ECAA 3DAFA 3Q88A 5DCWA 2XWJI 2H18A 5F2OA 3ONVA 2VHCA 1ZO8A 3DV0A 4R8SA 2PQMA 1B1AA 1XAIA 2CDNA 4OQXA 4MWGA 3RRMA 1N5MA 3SC4A 3VU9A 1XTQA 1YCDA 2V7PA 3KDAA 5CT4A 3WG9A 4ESEA 1YRHA 3E53A 3WISA 1B0AA 3WP0A 1OBVA 5F3WB 2C2HA 4L9AA 4BY9E 2NW6A 4JBYA 4K87A 4PANA 4CMJA 2CCKA 1OLXA 2R4QA 2XADA 3PTLA 4N7BA 3JRXA 3JYLA 1SCJA 2QD2A 3ZO8A 2Q6TA 2WSYB 4TLLB 5BT8A 4CEIB 4UATA 3IIKA 4BCDA 1L2TA 4AMYA 1CEEA 1ZVKA 1BIFA 1GNRA 2ZAUA 3LF2A 2JLBA 5KCMA 4FYHA 3I23A 4UBJA 1IOZA 1HURA 4QFCA 1JSRA 2UVQA 5EZYA 3H1EA 3W1VA 1IBKB 5CB4F 4HDSA 5KKAA 5CDSA 5TPWB 2C4VA 1VBNA 5FWXA 1BKYA 1RHMA 3GLGA 4Q4JA 3A1SA 3OP1A 4TWAA 1XVIA 1OASA 3Q40A 3H8VA 3VYUC 1FDSA 1DAOA 2FR8A 2QJWA 3ZEAA 3RQIA 2OVBA 3UAGA 1L6IA 3K0SA 2PRIA 3TNYA 2Z01A 4UHHA 3WK6A 4R6WA 2YJ3A 3B3GA 1T2FA 1X14A 2HK9A 3IT0A 4W7HA 1LI5A 2BFWA 2PD6A 3H5OA 1XD2B 1LDGA 4JGGA 4MULA 4BVTA 3NLLA 3GRYA 1KBQA 4ND8A 1IV1A 1Z5VA 2FPGA 3SZRA 1V9CA 3FNFA 4RY8A 4F4IA 2W93A 4DR2B 1BS1A 4LBWA 3UGKA 2CSXA 2L69A 2JI7A 1L5HB 4Q12A 1OH6A 4IXNA 4U9IS 2P4UA 3OKPA 1FJ2A 1MXHA 1QH9A 3OIWA 3WNVA 4G4JA 1VHQA 4A0GA 5K3DA 2ZJ2A 5CJ2A 1JPVA 2HL6A 4ZIRA 1E9SA 2IUFA 3RVOA 3BIXA 4BC0A 4X66B 3D54A 1KY5A 4JR1A 1AV7A 1QBGA 2CFOA 2EGHA 2ZODA 1FW6A 3JRWA 2ZVZA 1FTNA 1Q0TA 4PLHA 1XZMA 2UUCB 2R44A 3O26A 1POWA 4ZVKA 1J1IA 3BGIA 5F76A 3PDJA 4E46A 2ETVA 2XT0A 2LRHA 4KYTA 1O94A 4J76A 2EX1A 5DBHX 2FPKA 1SQFA 4N5LA 4I55A 2W2KA 1YE8A 2JCXA 1ZRNA 4HG2A 1U7HA 4KR0A 4OI2A 1I2AA 2QN9A 3SDZA 2VAMA 2ASVA 2P8SA 3UMSA 4J49A 1ZAYA 1M34B 2NYAA 1E1RA 2QMOA 4C4WC 3EEFA 4K9SA 1A69A 1OZFA 4I6GA 3M82A 3UJDA 2WFLB 3O1IC 1XLVA 3A1UA 1KH2A 3MIZA 1DE0A 1PIWA 1SPXA 5J2UA 3S99A 3IAFA 3IURA 4EPXA 4C0SA 1V8PA 4Q7JB 4KDRA 4UPVA 3V6MA 1W52X 3I8SA 5C8VA 4HB4A 4FW8A 4DJEC 2X23A 3HRHA 4Z1MA 1SIOA 5A3QA 5HKAA 4YASA 3N2GA 3LWOC 1QYVA 2GNAA 4G65A 4LOLA 4TMTA 5EMNA 2FN7A 3LWBA 3WTBA 4LXXA 3V4OA 3WQHA 3NFRA 3DBVO 3PFHA 3MWEB 3ZV6A 3PX7A 1S7CA 5KC8A 3U09A 5LIRA 4HSEA 2E4ZA 2KX7A 2QW1A 5AVYA 2UXBB 1SWWA 3JVIA 4N0MA 2P90A 4GOJA 1BX0A 3GRUA 5CURA 5ENZA 1AUOA 3BTUA 5ELXA 3DKPA 5K2OA 1PNRA 3I3OA 2BI8A 1CLIA 1RAFA 4BX0A 1LQTA 4QXQA 3SEZA 2BFDA 3H1BA 2W6IA 5K99A 5JZBA 2R4UA 2X8JB 4MKFA 3ABOB 5GINC 3ROKA 5KWJA 4JVMA 2CZGA 3NYWA 4GBED 2OV3A 4XVQA 1IIBA 1BXGA 1OT5A 5B7PA 5C8ZA 1TA4A 1YQTA 4R2LA 2PUVA 4DWJA 5LWQA 3LHFA 3DV0B 2RGYA 4FR0A 3NM5A 2PANA 2VUUA 3GEMA 4G23A 1SBNE 4ND1A 3ZWCA 2PUAA 1U8EA 4PZEA 2LIPA 4DBZA 1CJCA 2F1IA 4I1PA 1RI4A 1XZAA 3H1PA 2GPWA 3NC1C 3QKRA 4LN1A 1P7ZA 1WCIA 3BPSA 1EE9A 1IM2A 2J3LA 2RGNA 4WY2A 2Q8PA 4LE1A 5LLSA 5I7VA 4WZ6A 2JVIA 3O21A 1PD1A 1D6JA 3VPHA 1O97D 2P9HA 1OLXB 2QMHA 1YVUA 2GAJA 4TM7A 2B94A 1PG0A 1Q1BA 3G79A 3HLYA 1NR1A 3SSNA 3T4PA 2EAUA 2HPZA 3AVPA 4IYRA 2V03A 4L73A 3L2OB 4R7TA 2GPNA 3QVMA 1Q20A 1NQ3A 4Q9DA 1ZI8A 2PLAA 2YWCA 1A8QA 1KC1A 5EZYB 5K3CA 5JIBA 1MC4A 4QYSA 2XIJA 4HDSB 2HSZA 4W5NA 1M2EA 1A4RA 2BLNA 1PDOA 2RHCA 3NWBA 2C92A 4TMYA 5JJKA 1SOUA 4KKVA 5EVCA 3ESQA 1Z4MA 3QEOA 1KPIA 4UEQA 5FWXB 5HUQA 4N5MA 2YZ7A 5AW9A 4JUFA 3GLGB 4Q4JB 4RHXA 1EX6A 1E5QA 3ABRB 3MINA 3R5FA 5LDDC 2R60A 5BPHA 1DG3A 2RI6A 4YFYA 4OLAA 2W7TA 4M1OA 5FTLA 3ITEA 4ZC1A 3UK7A 5UKDA 1SCKA 3ENNA