5MN4A

S. aureus ftsz 12-316 f138a gdp open form (1fof)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSAEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cell division protein FtsZ
publication title A Polymerization-Associated Structural Switch in FtsZ That Enables Treadmilling of Model Filaments.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 110
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5mn4A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5mn4A01
5CA0A 1Z5WA 3HKBB 3WGNA 1W5BA 4O4HA 5MN4A 5JQGA 3JATA 3WGKA 4IIJB 5LXTB 2Q1XA 1W59A 5IJ0A 2XKAA 4YJ3A 5EIBD 1W5FA 4WBNB 3RYCB 3JAKA 2RHHA 3JARA 4WBNA 3RYCA 4B45A 3UT5B 5IYZA 4I4TB 3R4VA 3RYHA 3HKEA 3UT5A 5EYPB 4IHJB 4TUYB 3VO8A 4B46A 5CA1A 4YJ2A 1FFXA 4O2AB 4DXDA 4TUYA 4TV9B 1FSZA 3N2KA 4O4JA 1JFFB 4X1YA 5MN5A 4O4LB 4X1IA 4ZI7B 3E22B 4KWEA 2VAPA 5LP6C 5JCOC 4M8IA 5J2TB 3HKBA 4I55B 4U39A 1SA0B 3JALB 4IIJA 2R751 5EZYB 5C8YB 5LXTA 3C8LA 1TVKB 5C8YA 4F6RB 2XKBA 3VO9A 5BMVB 4O4IB 3ZIDA 3WGJA 2BTOA 5BMVA 3ZBPA 4ZOLB 4I4TA 4FFBB 2VXYA 4TV8B 5EYPA 2R6R1 4IHJA 3CB2A 3RYFB 3JASB 4O2AA 3JAWB 4TV9A 4EB6B 2BTQB 2VAWA 3JASA 2VAMA 4LNUB 1JFFA 5IJ9B 1TUBB 4X20B 5LOVB 5LP6B 2BTQA 4O4LA 4ZI7A 5FNVB 3VOBA 2Q1YA 4EI7A 3E22A 4X20A 3M8KA 5LP6A 5JCOA 5J2TA 3HKDB 2RHLA 2RHJA 4I55A 5JH7B 4X1KB 1SA0A 3JALA 2GVIA 3WGLA 4ZHQB 4O2BB 4DRXB 5EZYA 5J2UB 5MN6A 4I50B 5KMGB 4ZHQA 1TVKA 1RLUA 5J2UA 4F6RA 5ITZB 4U3JB 3HKCB 5JVDB 5KX5B 3M89A 1Z5VA 3VOAA 1W5AA 5LYJB 3V3TA 4HNAB 5ITZA 4O4IA 3VPAA 5CA0B 3JATB 4ZOLA 3N2GB 3ZBQA 3WGMA 4FFBA 4TV8A 4EI8A 4XCQA 5CB4B 3N2GA 3RYFA 1W581 5CB4A 3JAWA 4EB6A 5IJ0B 4YJ3B 4LNUA 5IJ9A 1TUBA 1RQ7A 5LOVA 3JAKB 5FNVA 3JARB 2RHOA 4EI9A 5IYZB 3HKDA 3RYIB 4E6EA 5JH7A 4X1KA 3HKEB 4YJ2B 3RYHB 3RYIA 5CA1B 5M7EA 1FFXB 4O2BA 5GONB 4DRXA 3RB8A 4I50A 5KMGA 1RQ2A 5LA6B 3N2KB 4O4JB 5GONA 4U3JA 3HKCA 4X1YB 5LA6A 5EIBC 4X1IB 5JVDA 5LYJA 5KX5A 4HNAA 1W5EA 4O4HB 1OFUA 5JQGB
chains in the Genus database with same CATH superfamily
4B3JA 4BN0A 3CUEF 5ALHA 1BDHA 2WV7A 4GL2A 3NEPX 4WOJA 3C7DB 4REOA 4U9HS 5HF8A 1TZCA 4R98A 3VGJA 1AKTA 3HL0A 4NRDA 2GPJA 4P3NA 2B4QA 5SY9A 1T34A 2HSZA 3QKUA 4D9EA 2DPHA 1CIPA 2OOSA 1I13A 4NARA 2N46A 2JGIA 4AJ4A 2ZCVA 2YJZA 3WHPA 1L9XA 3MRVA 2GLUA 2VHUA 3OLYA 2HIAA 3KEQA 2IEZA 4PU0A 4UXHA 3GZ4A 3ZOPA 1J06A 4LE0A 4IQFA 3U7JA 4JQOA 3QVMA 3R3JA 4L50A 4GSYA 5EXTA 2EBWA 4M55A 1M1KH 1KDYA 2HEIA 1ADGA 2ZPUA 4DLVA 4B2YA 1UBKS 4Y2TA 3RIEA 4JMLA 1JFFB 3F1LA 4HRYA 4WPGA 4ZCTA 1T5IA 2Q6OA 3LHKA 4QQFA 2V59A 4TL9A 1SDSA 1MVLA 1VCIA 5HY2A 1KXJA 3CCVF 1WQ4A 1LQ2A 3DMTC 3GN2A 4M1EA 4QBIA 1PI3A 2A9PA 1M5UA 2REXB 1XLVA 3CZQA 1GN8A 3HUFA 4M1KA 5CTAA 2PUBA 2VI5A 2F4VB 1A7JA 1KYZA 3KJQA 3RU2A 3EQ8A 1ODKA 3I5XA 1Y3BE 2HHJA 4P4NA 4HY3A 2JAUA 4B3FX 3KQHA 3DO5A 1QFZA 1U1IA 3TW8A 3ITEA 1N5OX 6Q21A 5IKPA 1MNAA 4YCLA 3SN6A 1RXEA 3KQNA 5LZ9A 1NW8A 2IY7A 3DG9A 5BSVA 4Z4IA 1CZNA 1D1SA 3SFZA 5AXBA 3AF4A 2BAGA 3R7LA 3UC5A 5A06A 1U7WA 1LQUA 1TEXA 1C9KA 1VB3A 2RGNC 2V0NA 3COZA 1DX6A 3HCFA 3IHLA 1IM8A 3ETGA 1RC1A 1NUTA 1JSCA 2G17A 2QD3A 2QP9X 3HU3A 5BSFA 1NJGA 3LQ2A 3GIWA 3JR7A 1EDOA 3HY3A 4JLNA 1KI8A 2C9OA 3LQ1A 3O1HB 4E5DA 1W9HA 5EWLA 1MTZA 3H1EA 3T7CA 5IG2A 3LCRA 2H1OA 3QTTA 3BDVA 3L4JA 1E7YA 1GVNB 1QFXA 5JZVA 5EIAA 1YK1A 4Z9AA 4YR9A 4W5OA 1E9EA 2GM3A 1P1FA 2H4HA 3N6RA 2CVQA 1NR1A 3L2OB 2EFDB 5KHOC 1YU6A 4RA6B 1ECGA 3KE9A 3K0AB 3NVMB 1NV8A 3QU5A 4N01A 3UKOA 3OF3A 3MM4A 3BQMB 3JQ8A 5ALUA 3W4JA 3G88A 3KSAC 3KHSA 1X94A 3IPYA 1CN7A 4MQ5A 4CM1A 1YJCA 3FCUB 1XT6A 4P7KA 2OD2A 3OPYI 1J42A 3WLJA 3DV9A 3ZIUA 4ZJPA 3IIMA 4BLWA 3KYDA 1J07A 2VPQA 3T5TA 4AKEA 3HBAA 5BOSA 1R50A 1LDBA 4R1MA 1AQJA 1B6SA 3GJTA 5A5FA 5BSKA 5EZYF 4EG8A 3LECA 1GKIA 3UATA 5JAQA 2O2IA 2C3OA 1KFKB 1MC1A 3D7RA 4KO4S 3CX6A 3IX7A 4YI3A 5IKXA 1VMDA 3UFBA 3M9XA 1JS1X 2IOHA 3OA0A 3RSSA 4FHZA 1ZWKA 2CVHA 4S1WA 2Z95A 3G6KA 4MR9A 4ACAA 3G2HA 1PT7A 1VXOA 3IJ5A 3BSFA 1XRQA 4MB2A 3UHJA 1H48A 1JQ3A 2QMUA 3DKIA 2OY0A 4HBZA 4KPUB 1TM2A 3GY0A 4LV5B 4PIVA 1KBQA 5I7EA 1DV1A 1NONA 4ZHYB 2JAHA 3V4ZA 3GJ8A 3SYMA 1ZVQA 4B3TB 1W5EA 2BUBA 4RXMA 4JVMA 2HHCA 1Y3AA 5JO9A 3AZOA 1FDIA 3UCFA 1A98A 2ZIZA 5KSZA 1N4DA 3CWZA 2VA9A 3MINA 5EIOA 1BS1A 2NUPA 1SCUA 1LXCA 1QLHA 5KPDA 1R9GA 4UOEA 4WV3A 2GZRA 2Y76A 1E8DA 1XXHE 5IJ0A 1YL6A 1H1LB 1UT8A 2G4LA 2F3PA 3GEEA 3ZXXA 1IIRA 4BMYA 1LD3A 2G08A 4NDNE 5L7YA 1OT3A 3RS7A 4HJXA 3FPLA 2CHUA 2FKNA 2IZ0A 1L3CA 4IZHA 4LPSA 3RSGA 2OTCA 4CIBA 4KWIA 3LT1A 3V2UA 3W3AD 4UUMA 4EATA 1JI0A 3SBOA 3HWWA 3RQIA 2DX7A 2QDXA 3F3KA 5K8JB 3CVOA 5GANK 5DK6A 3IT3A 5ESXA 5DI3B 3FWKA 4HXFB 2BM1A 4DDVA 1KORA 5C5DA 1OB5A 1ECCA 2HEGA 5JAHA 4J29A 2WSIA 3HEAA 4XAQA 5JS8A 2KS6A 1N3LA 2L18A 1I3LA 3HN6A 3AHJA 1WWKA 1W94A 2GPBA 3OMWA 4GX5A 2ZRQA 1UDXA 3MBOA 1JT2A 4M9UA 4PSCA 2AYXA 4GNRA 1XTTA 4LHEA 4EPXA 5C81A 4C4RA 1I30A 4FX2A 1K8XB 2YYZA 2Q4OA 1RHRA 1S3GA 4OM7A 3RRNA 3W4KA 3RVPA 4GMHA 2GN4A 2NXEA 1ODTC 1N25A 3WGHA 3P45A 1L5HB 4BGDA 4FNMA 3C14C 4AMGA 1JJBA 1SG9A 3TLBA 4ENUA 4TWRA 3CCSF 3ADOA 4PO3X 2F9MA 2NZWA 2VUSA 5HF6A 4EKEA 1LKZA 1UK7A 5J9FA 1YE8A 2K5UA 1GZUA 4R5HA 4TZKA 4X64B 1T0JB 4TLEA 3D2LA 2W6MA 1SK8A 1EBBA 4IF6A 2WE7A 1BCRA 5DWQA 1NYRA 1T91A 3OQHA 1BOOA 3H9EO 4FN4A 5COAA 3ICEA 1NUSA 3UOGA 5BYAA 1IQRA 3AM4A 4ZDIA 1VDMA 1PSZA 1N5DA 3B6IA 4KXFB 3ID6C 1Y3CE 4QFBA 3OP4A 3W06A 2AK2A 2Y4OA 3CINA 1U3GA 4YPOA 2XYQA 3D5EA 2EKDA 2ENWA 5CFNA 4W8HA 3EN0A 3V42A 4AZ0B 3CPQA 4P3KA 2OXEA 2EIXA 4MAAA 3ZR4B 3HI4A 2SECE 1P0PA 4I55F 1QGUA 2WIBA 1JP7A 3GP5A 3DDSA 1OTYA 1JLLB 4EB8A 2IBSA 2XOKA 4Z0PA 3SR0A 2WT4A 4KYVA 3TOVA 5FA5A 4IDEA 1CVRA 2HDHA 1NQ3A 2QZSA 3NHWA 4IDGA 3RFVA 2P62A 4RYDA 1V9CA 4PIMA 5DX1A 5IYZB 1C8VB 4U7TB 3V8PA 1NSTA 3CJRA 3V1TC 3MG9A 4BNKA 4QUDA 2PZKA 5KYKA 5E6RA 3NOOA 2RK6A 4R68A 3M6IA 4HUJA 5BNIA 1UAYA 3W2EA 1DJOA 4B83A 5GJBA 2ZJ3A 4WKGA 5LM3A 5D3ZA 2VTBB 4OI0A 3DMGA 1L9KA 4CZ2A 1JEOA 4GWGA 1E5VA 2IZ1A 2F1OA 3AOGA 3FKSD 3WA7A 2Y1GA 1AK9A 1SC1A 1SU4A 4F9TA 2EJCA 3IVAA 3IPCA 4A10A 2FK8A 2P9TA 2YXLA 3K73O 4OGLA 4B3CA 1PZXA 4PHFA 2ZZKA 4D02A 3U7IA 2NN3C 5I8WA 2HLHA 3WLLA 1CERA 2OORA 2IHBA 3N0XA 1E1RD 4QXPA 1JG2A 3DWFA 5EJMA 2I6SA 4EX7A 3BE6A 1YDFA 2OHXA 4FGWA 3IUMA 3VH4A 2OECA 4M1ZA 4MDFA 1GQQA 3R7AA 3PGKA 4BMSA 1P44A 1RI4A 4D0RA 4QUJA 3E0XA 1U0JA 1CY8A 3AJ8A 3MW8A 1PR9A 4JUDX 1WPRA 4D9CA 4CIWA 1W0KD 1JAXA 3M6MD 3CNNA 3F6BX 3DC2A 2W6ZA 5EL0A 2KX7A 3I6ZA 3CCCA 3JZFA 1TXGA 3DV2A 2B6NA 3K8ZA 1G2QA 5AHRA 5E7JA 4IWXA 3LXRA 1I4EB 3DV0A 1B42A 4YT5A 3SHVA 2AX4A 4EBFA 1C7QA 4O8CA 1QKJA 3T1VA 5JXIA 4L9RA 4EG6A 4ENQA 3C6MA 4L3VA 1OD6A 3M4NA 5KZMB 4G88A 1NRXA 1T10A 3MUNA 4AI6A 3OZEA 2VOEA 4JYCA 4MVJA 4YN3A 3IUYA 3RUDA 3T5PA 4Y0AA 3EQ2A 3QOYA 4C0JA 1QHYA 4JP1A 3H1BA 2RI6A 1OZHA 4Q4AA 4M49A 4R1NA 4AZSA 4NZPA 3D7NA 8ABPA 4F86A 3LMKA 1XLTC 3NBZC 5KOJA 1ML3A 2RAPA 3RYTC 2JHCA 2IUEA 3PE4A 3DOFA 4GLOA 1FNKA 4YEDA 5ECGC 4MLZA 3NP9A 4NBLA 5AXCA 3VNSA 4F5DA 5EHXA 3R7SA 2ZUWA 4ROTA 1O4WA 3RK4A 3NH9A 3D8RA 4Q5IA 1SZQA 4Q9DA 3Q3EA 1E1YA 2C78A 4QSHA 1YB6A 1IV1A 2R8OA 3L7IA 4Q47A 1M34A 5ALWA 1J8FA 3LGSA 4FE3A 4H4DA 2BEVB 1ZK4A 3JY6A 4BGVA 2WWYA 2AG5A 1ZM4A 1EDBA 4RHEA 5IK2A 2YCBA 3ANNA 5EIFA 3D8SA 5EJAA 2X9QA 4IH1A 3IB6A 1X3SA 1K68A 4MUAA 1QU9A 2JPDA 3G2MA 1RZVA 2O8DA 3H7IA 3RIHA 3ZNNA 1XMQB 4LJ9A 2D1SA 1TEHA 1ENOA 1KO1A 1IM5A 1KI6B 4GPD1 1JQLB 1ZGCA 4J3JA 4TRNA 4RTMA 1EP9A 1FP2A 3LQYA 1DNPA 2HZBA 4EOGA 3RE3A 1X7YB 5NULA 1ISJA 1X7GA 2JAXA 1JWLA 2PMEA 1VMAA 3MS4A 1UEXC 2YVUA 1E2UA 1C7JA 2N47A 1AXEA 4KRGA 4OYHA 1P7CA 5JBIA 3MEQA 3UWSA 3C9RA 1P39A 2Z8YA 5T4HA 3RYHB 5HHTA 3N9IA 4BNIA 4ZMBA 2FF5A 3EQZA 1QYRA 1N0WA 5CVUA 1XD9A 1TF5A 3GVXA 5T64A 3UV6A 2D2FA 2VP2A 2YRXA 1QX3A 1W30A 4FC6A 1TO6A 4A26A 5CJJA 4H7KA 5C3UA 2ZVJA 2YICA 1RJDA 3O9ZA 3EG5A 4ZCLA 3H83A 4QGBA 3RD5A 1THMA 4P38A 2Q5HA 1UDCA 3S0WA 2R87A 2PUTA 2ZB4A 2ZSDA 1EFCA 4J8PA 1MR3F 1CEYA 1OXUA 5LXTB 3K1AA 3LC2O 4QQRA 3E5MA 4S0ZA 2QYSA 2BDTA 3S2ZA 1W93A 4OL9A 3BTUA 3TLXA 1KQPA 2XCSB 4GZ5A 3BILA 5KX5F 3PKZA 1KEKA 2PJDA 1QHIA 1B3BA 4MZDA 1Z2PX 3H1TA 5KQSA 1BXKA 2UVPB 2XRMA 3O8OB 4XQCA 4DARA 4EQZA 3SU8A 3VO8A 1BFDA 4MKZA 4MWOA 3LLUA 1KNQA 3GNLA 4KYUA 3RFUA 4RPGA 3PXGA 3KUXA 3AEQA 3MWDB 5AK0A 4ZODA 1Z2OX 4JDPA 4J94A 4N3CA 1UBSB 1ZMTA 2EKBA 4IIFA 4OX9Y 4LHWA 2HK6A 3SC2A 2CLFB 1RZRA 3IEVA 1EEHA 1U90A 1LUAA 1E7SA 2QP4A 3NUGA 2C20A 3BWCA 3H7AA 2QL9A 4NLLA 2V7EA 3CX7A 5A3QA 2GBCA 4LXIA 1O5TA 4WQMA 1Y7TA 4FB5A 2EQAA 1XDDA 4G1VA 1I10A 4G63A 3ZLBA 4BFCA 5LDHA 1Y7PA 4HFJA 4GXNA 5BT8A 3UCEA 4UBNA 5H8WA 1M5TA 4OM8A 5KQRA 4IJ5A 3LLVA 5HX7A 3G6EF 3C39A 3HMKA 2C99A 5J1TB 1E96A 4NJEB 1HNNA 4NBNA 4IHJA 5DN9A 4D4LA 3PNOA 4DT1B 1Z0SA 2MYNA 3A9SA 1B0AA 2FGYA 1C9MA 1E0JA 2I7XA 1EP3B 1F6BA 2WF6A 1WNTA 3DWGA 3KSUA 2J9ZB 1WHTA 2XCOA 1Z83A 2BP7A 2XNHA 3QVUA 4HLUA 4O1IA 1CUSA 3GLHE 2YW9A 4YBRA 1D9ZA 5BSWA 2AOTA 3V46A 2O59A 1J4AA 2HCRA 4DA8A 1JTEA 3FRHA 2AMVA 1RHUA 2HA3A 2J41A 5J4VA 3U0BA 1S2DA 1ZWLA 5DNYB 2ZDGA 1X0VA 4YRTA 2QSYA 1EX9A 5K2MA 3RBVA 1YNSA 4EB0A 2CNLA 1JN1A 1OB2A 4GI2A 1ODJA 2EJUA 4TSFA 2FZGA 1OFGA 1PFKA 1ZHHA 2FJPA 3PYMA 4LYEA 4W1RA 3K30A 3ZGXA 5KTMA 1HUQA 2VCYA 4M0KA 3OT4A 2E18A 3K71B 3OZVA 1EU1A 3TZBA 1C0KA 1NW3A 3GFPA 2HJWA 3JVIA 2IXEA 4YV0A 2Y9MB 4MJ7A 1DQRA 1U2ZA 2P8JA 2AMTA 1QBKC 1T6XA 4OYLA 5AWFC 3UWPA 5HKLA 4TWZA 1RQ7A 4DBVO 3T34A 3LZ6A 1TUIA 3F98A 1EK0A 3PITA 4DLWA 4OXRA 5DZSA 1DOZA 1KU6A 4NZYA 5BWOA 2CXNA 1QHFA 4DL9A 3IDQA 3E9ZA 2O2XA 2FFRA 1FVOA 3S4YA 3VHRA 4NHOA 1G9XA 3I5MA 1VHWA 3O85A 4MIKA 4D98A 3GG2A 1YI8A 4Q39A 5GONB 1D6JA 1YCFA 3RAFC 3JW8A 3JYPA 1H0KA 2QR3A 2NSYA 5CFOA 2DERA 3K9QO 3O8LA 4NZOA 2RGAA 1VQOF 4BNUA 1CJKC 3GB9A 1Z63A 1I2DA 2DKNA 2X8JB 2RGUA 5EJIA 5KNLA 2H92A 1BG6A 2HS3A 2X77A 2WJYA 2I7CA 2JNWA 4P7JA 1CETA 3CHYA 3L7OA 1M7BA 3CLSD 2I1QA 4Q34A 1PNOA 2OFPA 2QY6A 3H3JA 1GSHA 5D5HA 3U19A 2LGJA 2OD9A 3AETB 1EVQA 2X9LA 3OWXA 4I9UA 5LQMA 3PPYA 1XK7A 2Q1XA 4L9AA 5KTKA 3ABOB 5FUMA 5EIBD 1GTJ1 2Z1TA 3CNEA 4FGJA 1SVIA 2BKEA 1MO6A 5EP1A 1B7GO 5AW5A 3UJDA 4B3BA 4E5MA 3N28A 3LV8A 4FT4A 1PS9A 1D07A 2D8AA 3NTXA 5IJAA 4TKZA 2XT9A 1UPCA 3NZEA 1JH8A 3AU8A 2ALEA 4M6WB 2YNMC 4FN5A 3S0JA 4BO9A 4BX2A 3HKEA 4LVNA 1MOQA 1HBJA 4M0MA 3ILHA 5B1HA 4F21A 3CG0A 3INNA 2IF0A 3QHPA 4KIJA 4I8XA 2XV1A 3U49A 4AWBA 4RTNA 4JIMA 2GCOB 4CEIB 2RHCA 1WVIA 2H16A 3IAM1 3L43A 3O92A 3OBIA 3TMKA 2F4NA 3WIEA 4KWCA 3WYAA 4R2IA 4JAVC 5P8WA 3DLHA 4D2IA 5J2TB 1D2GA 1LVHA 2DUUA 2GCPA 2JFBA 2CLDX 4GD3Q 1X1RA 2ORYA 4WCVA 1Q0RA 1J21A 5CCBA 1LJ8A 1ZFNA 4BB6A 4HG2A 5JAOA 2ISSD 5DT2A 4P92A 1T25A 1L5QA 5E7IA 3CB4A 1ESZA 1U7UA 1MX1A 2P90A 3X1JA 4LBZA 1NNI1 5KIAA 2E4XA 2BMWA 4FBMA 3IMPA 2QW0X 2WFLA 3ZI0A 1CE8B 4F96A 4DHWA 2WG2A 3BM5A 2ZI9A 2JA2A 2AZTA 2NTNA 5KI6A 5BQFA 2C2YA 4IKEA 4B47A 4EQ6B 1Z37A 3AI1A 2FGJA 2ZATA 3I2YX 3LRXA 4RELA 3D6AA 3NO4A 1WF3A 3GUHA 4DFDA 1W0CA 2EG5A 4O63O 4P2GA 5JZSA 4RTLA 1CUAA 3A2LA 4HQRA 5CYGA 3EIXA 4QPJC 3GHYA 1Y82A 3ZS8A 2FC3A 1OLUA 1RWOA 2FWIA 4CQLA 1QYIA 1UBHS 5F1KA 5BNTA 2W2QA 2XOKD 4TTAA 5KYVA 3EK2A 1M76A 4MA5A 2OK7A 1CWUA 3CGWA 2MSCB 1WHSB 2WA2A 3M49A 2GK3A 2PZFA 1TUGA 1CS0B 2FX2A 2G09A 3UJ8A 4AG6A 1JXOA 1SBNE 4GKKB 1U7XA 4YAEA 1NI4A 1W75A 4KIUA 2FMTA 3T3EA 1Q7YH 1ACLA 2CUZA 2XTAA 4U6NA 3UH0A 3V4FA 3WL7A 1O08A 1M1YA 1VRWA 3FOAA 3BK7A 3RAPR 3R9KA 3VIUA 1NOJA 5EINA 2O0HA 1YB2A 4MYHA 1J25A 3ZPXA 1OIXA 4OAPA 2WINI 1KR2A 1P5FA 2PUHA 3KKNA 4IOKA 3H4IA 4KQJA 4WXHA 5G4KA 2XGSA 3UBMA 16PKA 1N8TA 3ESBA 5JALA 1TCVA 1FFXB 3PC3A 5E9JA 1PL7A 3GJ5A 5L4NA 4PLHA 1QE0A 1FW8A 1XWFA 2EGUA 2ZJYA 4BDSA 2Q29A 2C2KA 5EHIA 3L4BC 3SNKA 3P20A 2KLHA 4R2MA 4RHYA 5FBLB 3TSWA 3BCUA 3GUUA 3JCZA 2IPMA 1WQ3A 3G85A 5G3ZA 1EG2A 5HTOA 1X38A 1TM5E 3ETLA 1O3YA 1AKVA 2PFSA 1EZZA 3SEZA 4ZZIA 3HQ4O 3AI3A 1AGNA 3LU1A 4JEUA 1SVLA 2B5VA 3D9QX 3EUFA 5JH7F 1M9NA 4RSHA 1ISHA 4UMEA 1YS4A 2BLLA 2ZB8A 3VR1A 4I50F 2AN3A 2GZ3A 2HD4A 4R2LA 3W5UA 1TM4E 4UCQA 1R1MA 5CLGA 1E2LA 3WJ2A 2EC5A 3TPFA 5MFZA 5CVDA 1KMHB 3IEPA 4Z1MA 1T9DA 2PU7A 1MV5A 2Q3LA 3FYTA 3BWYA 1OGIA 2WT9A 4PAWA 3SYKA 5HKKA 5JNLA 3GI1A 1SCJA 3D8HA 2C9MA 2VP4A 3GDOA 4MVJD 4IXDA 5KYNA 2Q7XA 3R6LA 2OUIA 4ND5A 3V8RA 3ZLTA 4EUFA 2X23A 5A3RA 4AM8A 5KKNB 4ZTBA 1NF8A 1WPXA 1LV8A 1L5WA 3U3JA 4NSNA 3WISA 3UN1A 1A9XB 2BGJA 1Y5NA 4KXUA 3ZU6A 3JV7A 1WETA 5DGHA 4PXAA 1FQWA 3NDRA 4GS5A 3O2NA 4IHKA 1MUUA 2QOEA 4D1YA 4F3RA 5HP7A 4PZ0A 4I1UA 1YFJA 2QPTA 3MUOA 1A96A 1FL9A 2PL5A 3DQQA 4G5OA 3F4KA 3W3ZB 2DH6A 1Z3CA 1DP4A 3P0HA 3AESB 4TL6A 2H6EA 1RIIA 2CXSA 2QX6A 3E2PA 3ICCA 4NEGA 1GU7A 1NC1A 1W46A 3BB4A 3RS9A 3T3PB 4RSGA 5IK2D 4OGGA 1RLTA 1MU0A 2E4ZA 4LSGA 1I3KA 3N53A 3ZNOA 4AO7A 2W2PA 4BKOA 1D2CA 4HN2A 4BVHA 2D0PB 1EX6A 5KCMA 2O14A 3E2IA 5EWMA 2E87A 4PGFA 3ZE1B 2LKCA 3P2EA 4BNJA 3O9MA 5JWHA 1CCWA 2GDZA 2M6RA 2C4VA 4RMHA 1YVPA 2KE5A 4CODB 2ID7A 4FE4A 2R5NA 4XM0A 5EUCA 3JALA 3R8CA 1DQZA 2M1XA 4B2IA 4G5GA 2GEKA 3ZTYA 5AUPB 2LR0A 1KGSA 3AQIA 3GXOA 3N75A 1TVKA 3VX3A 1QTRA 1EB8A 2HBQA 2WTEA 3QV2A 4ONEA 3HKCB 1DFHA 1GTMA 3L8GA 4LOIA 4MI9A 4B7XA 1S2NA 1AIPA 2JLXA 1OAKA 6AT1A 2Q62A 4KXVA 1SQFA 3DEIA 2ES4A 1T43A 1LSUA 1WQ1R 3SHFA 1V47A 4JH0A 4Z6KA 1ZN7A 3RK0A 4RD0A 3HBFA 2D4AA 1ZD3A 4ZKEA 5DLQC 3LNTA 2GN9A 2F3SA 4LQLA 4BGUA 1QO9A 5I7HA 1NASA 2CV2A 1ZC4A 1G5HA 4HT3B 1P31A 3W2TA 3P52A 3ND6A 3L01A 4HEQA 5B1IA 4F46A 1JHPA 4Y2YA 3C9TA 3TUZC 5TMPA 2P6OA 2EKPA 3BGSA 1VA4A 3TSAA 1M8FA 5BO5A 4ENTA 2DHCA 5EJ8A 1BXZA 1JHUA 2CDAA 2VHZA 2J07A 4FEAA 4Z0NA 3G8BA 1MEOA 3N2KB 2AHRA 1P7YA 4FHGA 4BNZA 1UC4B 5E9QA 4L6IA 1RCTE 4CL0A 4YRAA 1M2FA 3GRKA 4EMSA 1DEAA 5IN4A 5KQMA 4XVQA 2BZ1A 4NZZA 3DWEX 2O57A 1VYUA 3JATA 3JCMM 1FVHA 4BFZA 3J80M 5HFNA 4AY2A 4YMUA 1AF4A 1ZISA 4DC0A 5K20A 1EFAA 4QASA 2ADFA 1VHJA 3WLSA 3NLLA 1NG1A 3PGJA 1CQJB 3M4JA 1XROA 3MGBA 1HTBA 1OE0A 2ZUUA 4HAYA 4JJZA 5TT1A 4UJ3A 1Y8AA 3HM9A 5K8TA 1UP6A 1RZRD 2Z6VA 4UDYX 2J0VA 1J90A 2PGOA 2W93A 3C3YA 3JTMA 1QHXA 4DV1B 2W4QA 3N0TA 3G0DA 5C8VA 1I6MA 2J0UA 3WYGA 5C5EA 5DHFA 1LFDB 3WPWA 1NN3A 4MULA 1UKVY 1OYYA 2WWTA 4BE7B 1PKXA 1UK6A 4QVIA 3KZOA 4A8JC 3NUZA 3ZW9A 2JKYA 1I2BA 1PUXA 3I6YA 5E3IA 3DSRA 2EP7A 2VYCA 3JYNA 3ITKA 4GX1A 4NU8X 2BELA 3C3DA 3VNRA 4G5FA 4YP9A 1HYEA 2NO7A 2IL1A 3C8HA 3IERA 2B5OA 4HO1X 4DYHA 4D3ZA 2X5XA 2Y0PA 4BX3A 5EZYB 5AOVA 3A4VA 3V4PB 1L7NA 2O2HA 3MJCA 1NU6A 1VMIA 1Z68A 1EBFA 3KAPA 1Z29A 2FNAA 3MC1A 1KY3A 4DLKA 4O1MA 2OWEA 4O4JF 5DOZA 5G4UC 1O97D 2PSEA 1ENPA 2YV4A 1XZBA 1ZNWA 3WGJA 3IR5A 5AKYA 3STTA 1X1DA 5AH0A 4GZLA 3UO8B 3H5LA 4NJOA 2JJ1A 1C9NA 4H3HB 4RIGA 4M1WA 4ZDWA 1PZHA 4ZAWA 5ALQA 3D4NA 4NE7A 2JCYA 4QUAA 1QS0B 4CR6A 4DLYA 5B1SA 3DAGA 4ESEA 1E2BA 4BPRA 4CM4A 1I2ZA 2FPWA 1P0QA 4OYYA 3TQTA 1J0DA 5EMNA 2CV0A 1M2VA 3G02A 1BZYA 4H31A 4PYLA 4CIVA 2XTMA 3QKRA 5HQJA 3ELUA 3KL4A 1WU7A 4JT4A 4P3XA 1HQKA 1SZPA 1NQAO 2ST1A 3FYUA 2QL7A 3R5KA 1V8OA 3W5VA 2PX2A 3P1JA 4JK3A 1WBDA 3SJUA 1SUCA 3SG0A 2DQ4A 4UEKA 5GWXA 3UK0A 4QO7A 1KZ6A 2OQ2A 2FFQA 3TVYA 3ZX5A 4AYWA 4OLAA 1CK2A 4ZAXA 4DS3A 2X1VA 3GFVA 3E1GA 1VPDA 3NHMA 4A2CA 1ZRMA 4POOA 3QUTA 3GP8A 5LUAA 2C5FA 2IEGA 3WI7A 3ND5A 4KX3A 4JA2A 1IWBB 2WD9A 3RS8A 1PKEA 1E3EA 4KE6A 2EYUA 3KXPA 3DDCA 3NH6A 4JCOA 2UVDA 4JROA 1NAHA 5DTRA 2WR8A 5A4JA 5TDHA 1ITZA 3GJ4A 5FNVA 1UKCA 3QWHA 4CL2A 1DBFA 4U2KA 5JEEA 3JPWA 1YQQA 1DC8A 3B1KA 4M1YA 4AD8A 2YZGA 3GBVA 3U37A 2A67A 2KMLA 3ICOA 5D7BA 3P9QA 3W5JA 1GG5A 1YTUA 4LQDA 4WZBE 3QWFA 4PX2A 3W77A 3IQEA 1GPYA 2ZRGA 3IR7A 5IKMA 2VDJA 4U3JA 5U4QA 2PUAA 4OHVA 2OOKA 4KK3A 5C4GB 4B48A 1KNJA 1VH8A 4HMQA 3AINA 4OJMX 5ERGB 4QL3A 4KXNA 3X1MA 2PXXA 3C98A 1ORWA 1V6AA 2OPBA 3U9TA 1KI3A 3VC3A 1FDTA 1GT91 4JP8A 3R3VA 1LNSA 1UDBA 2OAP1 4FUTA 3OZ7A 4CIAA 2B1IA 5JJ5A 3K0SA 3LL4A 2WIDA 3RASA 2V4UA 1MJFA 5ALVA 4BU1A 4V1CA 2B1JA 4RD1A 1YRYE 4B32A 4G1MB 5F1OA 2VAVA 3DT8A 2RAUA 2FA9A 2CL6X 4RV9A 3T3IA 4NCHA 3WKCA 3PU6A 2VJDA 4ND1A 4PC1A 1FVXA 1I1QB 4AN4A 1Q2XA 3EORA 3TAUA 3MVEA 4YROA 3G5UA 4OJKA 3ER8A 1GCAA 3ZVNA 2HA2A 4NMMA 4EUSA 4DQLA 3GARA 3H2ZA 5F3DA 5H7XA 3ESJA 1MG0A 1GA1A 3PUVA 4K6FA 2UUBB 1SXJE 3KJKA 2KPOA 3FTQA 3BKXA 1DB3A 4QKQA 1MORA 1E1MA 3ZGLA 1APBA 1XQVA 1G8YA 1W49A 3WNCA 5AVSA 4FFRA 5TGDA 3FKQA 4I55B 5KC9A 3K53A 1SA0B 1BWQA 2D8MA 3UAZA 2QRUA 4H7HA 4KLZA 2VH2A 3IOMA 4AWXA 4OQFA 1POXA 4OHKA 3RAGA 1TYZA 1XJQA 1GA6A 2ZRHA 1YS9A 1GGMA 1OQAA 2OC4A 1I1OA 1CUFA 1ZA2A 3BL5A 3NHJA 3J81M 3R5FA 4QOIA 5ECDA 5G3YA 3DZKA 1DQSA 4AKGA 2Q3BA 1N8KA 1YDEA 3LY7A 2IUTA 1DI0A 3HN7A 4RV5A 4RAQA 5ALEA 1NDUA 4BNHA 2FPIA 5BV2P 1HQCA 1MG5A 4FFWA 1EE2A 3LNCA 1OC2A 2XUQA 4M7RA 3HZHA 3EVBA 4EGAA 2GX6A 1A9ZA 2NUAA 2YW2A 3N5KA 2IYNA 1QJ4A 2GA8A 4GPIB 5KYGA 4LRSB 4YUXA 5CEEA 4MNTA 3N87A 1H8HA 1DL5A 1IMJA 1ZK0A 2BR3A 2EW2A 4PAQA 5KYWA 4E31A 1USKA 1W36B 4N5MA 1XXHA 3VYRB 3SJZA 5LNK6 5K3BA 2DBRA 3EGWA 3RT7A 4BNMA 3STYA 2BWJA 1AU9A 4NYJQ 2JCXA 3GEPA 1IU9A 1NN5A 4HAUA 4M1TA 4PC6A 5B12A 5CTJA 4F12A 3HCOA 5EMJA 4UHDA 3UJ6A 1L5RA 4I46A 4LCEA 1RMTA 1OJ7A 1QC5A 2YS6A 3ZV6A 5AW1A 3HAXD 4ZT4A 5LPNA 3IRVA 1F7VA 5GP1A 1FLAA 5LJIA 1RPZA 2LTAA 2XUAA 1F5NA 4YRNA 3HABA 4MEBA 2HS0A 4OXXA 1A5ZA 1C9JA 4AX8A 2PUGA 3LUBA 4PWZA 821PA 1W581 1NHGA 3SIRA 4ZHSA 5CB4A 1ZNXA 4P5EA 1XZDA 3MILA 3NAZA 4ABTA 3OY2A 4B4UA 5AVMA 1UJBA 5I7FA 3EFHA 1U11A 1D4OA 1I1HA 3K5IA 2ZR8A 3WX0A 4TYNA 3IEIA 2EJVA 4L2IA 1GZVA 1TU3A 4EHLA 4B6SA 3OQIA 3EPLA 4UW9A 3KBOA 4ZP1A 4FJ1A 1G5QA 1KKUA 1F6DA 1G6HA 1WXXA 1XZMA 2HV9A 4MX8A 4PC2A 2V9PA 3SXUA 2BY4A 4IIDA 3C1UA 4MRSA 4Z51A 1TTTA 3HO1A 4TLCA 3O7MA 5CB6A 1TI7A 4AY5A 2YIVX 2COKA 4Q4HB 1QU2A 3B51X 5JCZA 4ZQHA 3DBHB 5L3ZA 3ZU5A 3FTFA 1ZPDA 5IRCD 5FH9A 3Q5GA 1U8XX 1RBMA 3DHWC 1RWVA 4Q24A 4LGYA 3VBEA 1UPAA 3WQHA 4BNDA 3DVAA 3K70D 5HKKD 1IEXA 3GLGE 1G7RA 3LVRE 2Z1MA 1ZU4A 2J3IA 4JY7A 1SIWA 1L7BA 1U94A 2AQ8A 3JQGA 3FNHA 4AMZA 4UATA 2FPPB 1TTPB 2E89A 5BSMA 4PFKA 1L4UA 1PL6A 4MJLA 1IBCA 2C4TA 2XF2A 3BFPA 1H2EA 1P61B 4M0DA 1QKIA 4FCCA 1KSJA 4A2QA 4IDAA 4AVYA 4FILA 4M9SA 1TLFA 2QJTA 2GGSA 4B3RB 2YINC 3RDPA 4BT6A 2J3EA 2P2LA 3WMGA 1DG1G 3UMYA 1IQUA 1OGJA 1WXDA 3CSUA 1DE0A 3H13A 2NU9B 3U4GA 1BJKA 1LI7A 5GOTA 2BFBA 3CD6F 1JSLA 2C2OA 4M8IA 1UODA 5EO3A 1SR8A 3RS5A 3SIVA 2C82A 2VDMB 4NQRA 4MDHA 2JCSA 4LFAB 2GCEA 2L0XA 4Q7QA 4RY0A 2M6KA 3N05A 1RYDA 3FNFA 2Q5EA 1E9RA 3K9LA 4RQTA 4BZZA 1GQ2A 2XKBA 4YUZA 4UNPA 3TD2A 4C4PA 3B89A 1M8PA 5SZHB 2WUEA 1I3CA 2AE2A 2KTUA 1YQUA 1S2GA 1MZVA 2VJMA 3M4ZA 5IAGA 3V4VB 4M0UA 3CC2F 3CH5A 2ZVYA 2EF1A 2OCBA 4HS9A 2IV3A 1FDOA 4QOEA 3TCNA 5DCUA 4P53A 1GFZA 4Q7KA 4UQPA 4DV0B 4NONA 1IZYA 3F3YA 3LYHA 4W1PA 3Q40A 4KXYA 3C9SA 3C6KA 1Y8QA 1ZJ5A 3QTBA 1CSEE 4Q1BA 2JAPA 1X7XA 2PRJA 1AD2A 4GP9A 2IU6A 2OV6A 4I5FA 2VTKA 1IEVA 2A5FA 2UXCB 3ODPA 1CJMA 1D2HA 1EFVB 1RI1A 2O1EA 8AT1A 2R66A 1SZCA 4N3AA 4EAQA 1U5CA 3RODA 2P77A 4QPCA 2YOGA 3KT8A 1AM4D 1VLJA 2OBXA 4FLMA 4UFPA 1Z35A 1KEEB 4P34A 1WY7A 5C31A 3M5PA 4JL8A 3OD5A 3E70C 5KX5B 1D5WA 1VP9A 3NKLA 4HDRB 2A0UA 2C8KA 2XOXA 4ALLA 4NCBA 1HEYA 2BC9A 4UULA 4DOMA 1J1IA 2CE2X 2RI1A 2P8SA 5LZ4A 3R44A 4TSRA 1G4AE 5F52A 4NBKA 4JX8A 4HXEB 2R1ZA 2AJLI 2FUCA 2HF9A 3RJTA 4YIHA 4NS4A 3L6EA 3EXHC 4JT2A 1DEXA 1Q21A 4EY7A 3OE1A 3SJBA 2XB2A 4FHFA 5JI3E 5L7WA 3CU5A 3CWCA 1ZH4A 1GNRA 4FIDA 4R6XA 9LDBA 2ZJ6A 5AD1A 5IBCA 2YY5A 1W52X 4TXHA 2X4GA 3DMDA 4URYR 1EEXB 5KTNA 3CKMA 3D3WB 3Q12A 5FBQB 4YV1A 1N8SA 1X1CA 2PYDA 2PY6A 4L95C 1O2DA 1T26A 4DC9A 1BVUA 1TEVA 1HI9A 4CLOA 3L0OA 2A0YA 4H7FA 1GPKA 4RD4A 1LJUA 5LQSA 3VC1A 2HWYA 1FFWA 1COWD 4ZGWA 5JAIA 3AR6A 2BFOA 2CLOB 1G5TA 2HMTA 2B2CA 1E64A 2IXDA 3EY9A 4HK4A 1KBOA 4PTLA 1C0PA 5F4BA 5CT8A 4PCVA 5FWYA 1XLTA 2H5LA 4J1QA 4XWAA 1ONBA 1M0SA 4IR7A 3U7RA 2NUTA 4PE5B 1Y4ZA 4DC1A 2OP0A 1EK1A 1RZ3A 1YB5A 5FOQA 2IUFA 3HFRA 5E7QA 1ONIA 4NQ3A 3BA1A 1ZONA 2BGUA 5JTUA 1XEXB 2FSUA 3I12A 3K15A 1XTBA 3NT2A 4CI0B 1SG6A 3K5WA 3RSZA 3UT5B 1N6KA 1C1DB 1PNVA 2JBHA 4PZPA 2OCGA 3SR3A 3T5AA 1K7SN 1S3FA 1MOZA 4Q9KA 3NKFA 3TAHA 1WM1A 3FFTA 3LX8A 3Q87B 4BN4A 3L5OA 4FNAA 4NY1A 3S06A 2GPNA 3UB4A 3G7NA 2OQIA 5MN5A 1T0HB 2WJZB 3DDUA 1B2LA 1NUUA 3IRUA 4WXPA 4BKQA 3W3AH 3DDNA 4AFNA 2CUNA 3EEYA 2FLKA 5JNRA 3ZE9A 4FFMA 1UT6A 1SKAA 4LCJA 3SP1A 1K5DA 2ZWOA 3ELYA 3TLJA 4G56A 2AC7A 1TAQA 4HQ6A 2NG1A 1B23P 4CQJA 3EOBI 4EVSA 1LVUA 4RLQA 3GDHA 5T4BA 2YDXA 1BVHA 4R05A 1D3AA 1IBSA 1HZJA 3Q10A 4EYEA 2J85A 5CU7A 5DNVA 2YFQA 5EXEA 3Q3GE 5EY5B 3ZXSA 2J4FA 3SY8A 1C29B 1JHOA 1H94A 3H8JA 3SQMA 3HJGA 2I91A 5BUSA 1W8DA 4AURA 2PQMA 1AOXA 2NXCA 2X42A 1CHDA 3CB2A 2O0KA 4BRWA 5ICCA 4XUEA 4ZV9A 1RLGA 1HPLA 1XPJA 4F4UA 3RRMA 1T2NA 2OB2A 2G04A 3AHDA 3TF5A 4MVJF 5CURA 1OMOA 4HWTA 5DM60 1XKLA 4PBSA 1X3LA 2XMQA 3F5MA 4M2LA 3SICE 3MGAA 4OU4A 3U16A 1WDWB 3EXEB 2QZ9A 1LPPA 1ZP6A 4KPYA 3QTLA 4WIAA 2W0MA 1I6LA 1UBMS 2JLWA 4C8EA 2REQB 2RIPA 1ZU5A 3D1LA 2X0IA 4CR7A 2MMCA 1PHPA 1R88A 2H3HA 2V3VA 3BGIA 4L74A 1YWGO 1YU9A 3SJAA 2HNKA 1T9ZA 1QHSA 5JJIA 3IP1A 2CY0A 2PKXA 3BF8A 4S24A 4ETMA 2DYKA 2PYIA 3LA8A 4UMDA 4O33A 1CUUA 1F8UA 2CHEA 1KVUA 3UXHA 1CZKA 4BX0A 3Q72A 4EARA 4HTFB 2WWXA 5BYBA 3DA8A 2F67A 2P9FA 4JSRA 4LY9A 4AJ1A 1F2DA 2A5GA 1U9IA 1A82A 2E0IA 2PZEA 2UZ0A 3H5OA 2UYJA 1S96A 3OQVA 4JOQA 1P8JA 4YP7A 2PVPA 2QM7A 4BMOB 1UXIA 2AZXA 1OCEA 3CR8A 3OM1A 4BRZA 1K5PA 4Y1RA 1SH7A 1ULZA 2A5LA 1VCHA 2OENG 3ZTTA 1EFTA 3VNVA 2BEKA 2RHOA 3PXXA 4ZVMA 5J4LA 3IP9A 5KNDH 5I7WA 4OFXA 4BJ1A 1ZJ4A 2ZIEA 4BQIA 1QVRA 1GZ7A 1PUJA 1S2IA 1W29A 4E2XA 1LW7A 3RYIA 4K26A 4H7IA 5E1DA 1ODEA 5FR1A 3VDXA 3V7UA 2B99A 2V65A 5IBPA 4DWJA 3EDYA 5EG5A 5TQJA 1ZUNB 4C5BA 1U65A 4N54A 4UU1A 3BB1A 5JSFA 1YDGA 1S9DA 1JLKA 2K7FA 1RI3A 5C9ZA 3AF0A 3OT1B 2IZOA 4IO0A 3QELB 2O5RA 5T4EA 2WF7A 2AX3A 4KMRA 3GLHA 1YVDA 3VYTB 3I9MA 3BQ9A 3OG9A 1T3LA 1YR1A 1QCZA 1EJ6A 2H5EA 3BSWA 3CRRA 4XOIA 2AN9A 1PQ4A 4WCFB 5DDIP 2XA1A 3OEHD 1O94A 3QF4A 4LQCA 4XX1A 2N9UA 4B74A 1T6BY 1AKWA 3BIWA 4G24A 1I3OA 4Z54A 2VHVA 5GGYA 2HIGA 3NBQA 3BC1A 4G4SO 2X15A 4TT3A 4EI2A 2REOA 5HRUA 4TUYB 1I2CA 2R11A 5AVRA 2GSWA 5U9CA 1C4XA 1KWKA 2PGIA 1KRWA 1KZ1A 4ZI3A 2JD1A 2OVBA 3DE6X 1VLLA 3P9IA 3U3MA 3IP7A 1ZLYA 3MTBA 1M83A 4MQUA 1TKRA 4XYMA 1DAPA 2BE9A 2ZTUA 3TECE 1XCMA 3B6JA 3NV7A 4Z86A 3ZLVA 2DPXA 4BXOB 3HACA 4HGOA 1UJMA 1B26A 1E61A 4RFVA 1VYTA 1N5LA 3X1WA 3FNBA 3HE3A 1H8HD 3OECA 2YVQA 4K2HA 4PYIA 3VVBA 1LDMA 2QA5A 5J63A 3CVJA 1E2MA 1QDEA 2VUIB 1ZN8A 4QM6A 2CVFA 4F3TA 1MNQA 1FU7A 1IQ0A 3A31A 2GPYA 4GT1A 3F71A 1MJGM 2HX0A 3ESYA 3ML1A 4X95A 3WZLA 2QVYX 1X25A 2VXCA 4CCYB 4Z1OA 3ND9A 1JRLA 4PYOA 1ZGJA 3DAPA 4ECAA 4EI7A 1JVSA 1TGVA 4P31A 4UVIA 1QGOA 1WSWA 3WGZA 5IZCC 5DGXA 3ZG6A 1ZCBA 5K2OA 4AY4A 3HVIA 4YAIA 5JH7B 3KJJA 3MA0A 5LZ7A 1TT5A 1V5GA 4D0SA 2GZSA 3KXKA 5A1TA 3JZAA 4I50B 4IHJF 3AUFA 4INPA 3C7CB 1A8PA 1VKNA 2QX8A 3EF3A 3O82A 4MVWA 3G79A 4IV0A 4NYIQ 4E7OA 5CG2A 1R0YA 3HPRA 1KOFA 4PW0A 2E4UA 2YRFA 3I28A 4MK4A 1Z2CA 2YNMA 2W37A 1YFLA 5BW6B 1PTJC 1K75A 2P6PA 3L8ZA 3RWBA 4RW0A 1O5OA 5A2QM 2Q4EA 3RJ5A 5DMXA 1T1IA 3STWA 2HV8A 1JAZA 4O29A 4BTEA 5MGNA 5T67A 1WUIS 1YC5A 5KDDA 1UJNA 1USGA 1X13A 2CXXA 1GY8A 3A4NA 2ZBGA 3A1CA 2EFHB 3OCJA 4Q9JA 1FP6A 3CV3A 4B35A 3DPUA 3ENZA 2ZAIA 4WDQA 1UZNA 4JI4B 2H2DA 1MCZA 1VE1A 4CU5A 1QV6A 3NOQA 3RKRA 3I04M 4KGZA 3W1VA 1PR3A 1XZKA 3CH7A 3COSA 4ZRNA 1OZFA 1YZ3A 2PS9A 3DF7A 3NGLA 3WJRA 3G5AA 1SU6A 4XIGS 1QIKA 1BDMA 4X6YA 1JG1A 1QZ3A 4N8DA 1M6EX 4URWR 1P0CA 1SC3A 1U1FA 3IUQA 1R74A 4QGFA 2ZWPA 3BFKA 2HQBA 3FOWA 4ZPXA 5GM2A 2Z1FA 1H1DA 1L7PA 1ECBA 1TZJA 3VKFA 1RQXA 2TS1A 2OLEA 6REQA 5J4HA 2C2HA 2JASA 2NXJA 4J16A 5H3CA 5A71A 2YVAA 3RI3A 3FUCA 2IH2A 1YRHA 4MV9A 4Z3DA 2QRZA 4KC0A 4M0PA 4LHYA 4QTXA 1P2BA 5H3LA 2HBRA 4KMSA 621PA 1WULS 5DHPA 3SJCA 2XYRA 3KOMA 4HQOA 5ELMA 3GIDA 3ISJA 4DMGA 6LDHA 3JARA 1H4SA 2F8SA 4GGOA 4RV4A 3DEAA 1V37A 2EHJA 3C2QA 1WIWA 2YJGA 3RK1A 1S2LA 3THYB 3QWBA 2X7XA 2I8AA 1T9GS 2GNAA 3LPMA 4G4JA 4JEMA 4DXDA 2AV6A 4R8RA 5K0GA 5TRTA 5JC8A 2FP4B 3OQMA 3A6HA 5LZ8A 4B7CA 1U43A 1LB1B 2FI1A 5CFMA 4OBWA 3L46A 1JFRA 3V34A 2OHHA 1MD9A 1X1BA 3ZY5A 3DOHA 1G4HA 3HJRA 4FEYA 3U40A 3VU9B 3IBGA 1NVDA 2I2XB 3U4QB 1EVLA 4P4TA 2QRVA 1LBHA 2QGFA 4EUNA 2A86A 4FFLA 2XJ9A 2PZAA 3KUCA 2QIPA 4Q9HA 1XAIA 2CLIB 2OXTA 1CC1S 2PUVA 3KM0A 3WYEA 2J9RA 4D8XA 1J2RA 2WP8J 1FMJA 1VKZA 1BS9A 3D4OA 4RK5A 4XCXA 3UXYA 3VYSB 2XZOA 4I4TA 4L4UA 1XMSA 3U4HA 4L4XA 1SQGA 4MQEA 2ODNA 5D51S 2YRWA 4OH7A 3D1VA 2A9KA 4IIVA 2CD9A 4B4VA 1OKKA 2C59A 3SJ7A 1NLMA 1EUYA 3FIUA 5K05A 4MB6A 2HWWA 3DZBA 5L3SA 2H6LA 2PIAA 3JQDA 1R0SA 1WS6A 3I53A 2IEYA 4HZGA 4CE6A 1LY1A 1ORVA 3IOYA 4ZO7A 2C9ZA 3UTDA 4GDFA 3UJPA 1C81A 1H3NA 1ZVMA 1DPFA 1CRZA 3C8MA 2B30A 3KEFA 3L79A 3FVQA 3AONB 4D4KA 1WMAA 2CBGA 1P7WA 2VWGA 4X62B 5DRYA 2XD4A 4M1QA 3CNHA 2P4UA 3QOXA 3D7MA 5F51A 1PNTA 3CXRA 2CZGA 2O1XA 3KE8A 3NUQA 4P7BA 4B6OA 1G3UA 2BMEA 4DLAA 1XVIA 2A1UA 3FR8A 1DKMA 3IUNA 2O7VA 1GZ3A 3OPVA 2I99A 2XEXA 3GLVA 3VPHA 1QLWA 2HBZA 3GZNA 4YAOA 1NPYA 3KPYA 1JHQA 1U2QA 2JIBA 3G71F 3UCXA 4FD3A 4E2FA 4P84A 2ET6A 2CNNA 3PI6A 4C0BA 3BGOS 2DHQA 4DEYA 4C3UA 1JG6A 3PCXA 3SE0A 5JWRA 3TCKA 2CFSA 1DTWA 5AM3A 3LBIA 4HDKA 3W5BA 1IBRA 1ADFA 1NUPA 2NQ2C 4LI0A 3V7QA 4BYMA 2K4MA 1VB5A 1Y63A 2Q5FA 2E49A 5JYBA 1RADA 2XADA 1E5QA 2UYNB 2X14A 3S27A 4ZZ0A 2PL3A 4DMLA 3E03A 5A6SB 5KVAA 4O4JB 4Z7JA 2H8EA 2VWPA 1JB1A 1VQPF 1LLCA 2JANA 3NNDA 4I3FA 2R4QA 3LD9A 2QN6A 1GV1A 2L42A 1EUDA 4JC8A 4KFRA 4MGHA 4AS2A 4B82A 1K3TA 5M29A 3ZXUB 1ZVVA 3Q8WA 2FYTA 3GLTA 4LJKA 2GZLA 2PWAA 1ISMA 4WESA 1AQ6A 3QX8A 3JQFA 4EZIA 2J4CA 2G40A 2P75A 4UNIA 3WWEA 3SVLA 1MJ5A 4RZUA 1YJXA 4YUWA 2FKAA 2IWHA 4MV6A 5IEBA 4JEIA 1NKSA 2QDKA 4HTAA 4LMAA 2ROQA 1JVBA 1XV5A 4LJSA 3S2IA 4EGSA 4EKYA 2QBYB 1Y4UA 2PR7A 1XRGA 1LPMA 4RVOA 2VJBA 1Z0DA 2C92A 5CA1A 3CLHA 1G9TA 2GBLC 2ID9A 3UMSA 3OIDA 1BNCA 3CBQA 4RFSA 3ZBTA 4QYWA 5HRCA 1WXWA 2J08A 3AIIA 3U80A 4DIDA 4KZPA 3G4SF 2XRFA 2J4DA 4QQKA 1JN0A 1P1BA 3G0OA 1STOA 2XTNA 1K6JA 4QUKA 5BR1A 4M22A 3S7ZA 4XLTA 1GQOA 3FDZA 2I1WA 2C2MA 2QNIA 3B9PA 2A0FA 4OFBA 4EG5A 3COVA 1PS0A 4LXQA 1TFUA 2OHVA 1AX9A 4MUNA 2QX7A 3F5SA 2RKOA 4MYTA 3FFXA 4XQGA 5HBRA 4YYZA 4NU0A 1EM6A 4JGGA 3K0FA 4RF4A 2PGJA 1LF0A 2B4YA 2GBFA 4H15A 3CG4A 4P4LA 4QRDA 2IQIA 1RJFA 1FCJA 3PQEA 2G5PA 2HNAA 4RD6A 5E0KB 3C5VA 5D87A 4R0MA 3F9RA 5KSYA 3IMGA 3HJCA 3UENA 2HC9A 3TOCA 4EKDA 4HADA 4DIFA 1SUSA 2VDRB 3EC7A 1OA1A 1T5BA 5L95A 2D1RA 2WNHA 2HYDA 2FR8A 2K2WA 1TYCA 3WL5A 1P4AA 4KIGA 4CMEC 4KR2A 3KOUA 4J1SA 5A4FS 4CKWB 3LPAA 2AJ8A 5HKOA 1C9YA 2PEYA 3H3FA 1TW2A 2FQXA 3IFSA 1FBTA 1FUKA 5GPBA 3D59A 5BWLA 2I9PA 1Q1BA 1SVMA 3J80A 4U63A 1TD9A 4LDNA 1YAHA 3HCWA 4FDAA 5JY1A 4E5SA 2H7YA 4ZHQA 1YJWF 4MQMA 5B6PA 2RONA 5THKA 2PMKA 1L1RA 3H87A 3FDJA 4K6MA 1Z0UA 4E32A 4Y6SA 4YCDA 4KVGA 1NHWA 2VF4X 2VPZA 3A1VA 1N3BA 5LBIA 3TWOA 4MUXA 3PRHA 2D06A 2FW9A 1QG0A 2VPYA 3N2GB 1T4GA 3O93A 4KQ1A 1PEAA 3EZLA 3UPDA 3AP2A 5HTKA 3STVA 2EVWX 1VTKA 3TG2A 4C9BA 1IN5A 3BRCA 3D3QA 4X71A 3UUGA 5H70A 2FFBA 1X7PA 3ZWBA 4LNUA 1P80A 2BFFB 2WVAA 4Q93A 1KERA 3TSOA 5LOVA 3KR0A 4E1BA 2JNBA 4PNEA 1TMOA 1YRAA 3MAAC 3I2GA 4BP3A 3KDAA 3EZNA 1C1HA 4RZXA 4MQBA 3FLAA 3LHFA 4ILKA 4O1HA 4YJGA 2ZRKA 2R7NA 5LWHA 3M81A 3HEMA 3QHAA 3WHKA 3G89A 2CV1A 1FJXA 2CZQA 2JI6A 3AUSA 3W2GA 2IUUA 3CFYA 1PQYA 1O94D 4ZK7A 4BVTA 1YJNF 1SFRA 1WR8A 2IYQA 3BK2A 3CGGA 3OM9A 3C0KA 1FP4A 1V6SA 1ORRA 3I72A 3PUJA 1QWSA 3T7SA 2QTRA 2QRLA 1ND5A 3Q0IA 3PLNA 2QMQA 4TWAA 2QVCA 3AILA 4L5AA 4TT3D 2JFFA 5JS2A 2FPSA 1A77A 4MQLA 5CIQA 4ESVA 2W4MA 3NBYC 1N1MA 2CHGA 4WZZA 3RC8A 1A4UA 2R4TA 3CW9A 3OSZA 3VR3A 1YL5A 3RC9A 5B1EA 3P97A 5DMHA 1NP6A 3TNLA 2EW1A 3TW8B 2P3SA 4MEJA 4WBNB 3O3OB 4U8HA 4E08A 4EGCB 3O4JA 2CCJA 4GX0A 4A03A 4BCCA 3LFOA 5ESWA 3R09A 4Q15A 4G5HA 3YASA 1RXUA 3B8HA 5C5IA 3TG8A 4PRLA 3D0KA 3BYZA 1E98A 3EXG1 4C3VA 1V7CA 4P82A 2G25A 3QPUA 3EB9A 4X1YA 1DEKA 2GPAA 3LUJA 2DRIA 4EF4A 2CWJA 1I8TA 1VG0B 3DE2X 3NG1A 1XZJA 1XG5A 2OR3A 3CCBA 1OPRA 2DVMA 2PJZA 1NULA 3BH6A 4OSEA 4G2TA 1ISFA 1LF5A 2OZEA 3E05A 5ICSA 1H6DA 5DBIA 3OEYA 2QRKA 3TLAA 5BSUA 1IB0A 2E37A 5JUWA 2GAJA 2Q7OE 3PIRA 3UMGA 1R6VA 2F1HA 3I0MA 3JQ8B 4M88A 1ZMBA 4CN9A 3RV4A 1CQIB 5HWSA 2RCYA 2AZ4A 3L92A 3EAQA 1VE7A 3PHIA 2GBIA 4JLUA 1D7OA 1OASA 4WZBA 2DSNA 4LRXA 3LWQC 3SF8A 2PUFA 4H2DA 4GW3A 1WXFA 1YI1A 1I2AA 3IMFA 3QMVA 3AX6A 4G9EA 5BOSB 2ZAGA 1NW5A 3P7MA 2MYTA 3UJ3X 4WLEA 4DVJA 5TB5A 2H9IA 2TECE 3JWGA 1I3NA 3ASYA 4BCBA 1K73H 5JC1A 2FW8A 3WDSA 4CUZA 3CPWF 1T8SA 3I52A 1SWWA 2YNMD 4MKHA 4CJXA 2BGKA 3DE1X 3PC7A 5KWEA 1D0IA 1Z12A 3K9FC 2R5WA 1NZFA 4MR9B 1VBNA 2QTHA 1HA3A 2V7VA 1X1EA 2A0XA 4WTOA 4DCJA 1CB7A 3LFHA 5AM5A 4HYTA 3DHEA 1FYVA 1PX2A 2WUFA 2AIFA 5DI9A 5JBQA 2DG2A 3D4IA 5A5VA 4O4IA 1ODIA 1LI4A 2Y1OA 5E0OA 2R4UA 1JNXX 5EQFA 5FUYA 1X1TA 2N1MA 3BIFA 1ZIDA 2CF6A 4AJKA 1E0KA 3NFRA 2JJYA 3IXMA 3ZHUA 5IW8A 4F5EA 1EDDA 5T4FA 2Z4SA 1QH8A 1EA7A 1SXJA 2ZANA 1JVNA 1A27A 3JAWA 1JR3A 2J5KA 2H2AA 2X5OA 5IJ0B 2GF9A 4BC0A 3PEWA 3RIYA 1Y3FE 4QJ4A 5LYYA 2CUKA 2R7AA 2ZAYA 1ZGZA 5AVKA 1QHNA 2JCBA 2W71A 3CTPA 4JMPA 4IX9A 4D8UA 4B31A 1KFJB 3VHQA 1V11A 3HFGA 5ENVA 4P86A 2J5BA 4QFDA 1U2RA 2GXSA 5CCEA 3KIZA 4HCJA 4QGAA 4CN8A 2FK7A 3GBPA 4FP9A 4OB8A 3PV0A 1JGTA 3J81A 4B7UA 5M5BA 2OUKA 1H42A 4N39A 5KQLA 1KEEA 1R0KA 5FNVF 3GG9A 4NH0A 3OOSA 4CQMA 1HKUA 4Q3OA 2H65A 4Y6PA 5ICFA 2JATA 3VQTA 2NGRA 3UQZA 3G2IA 2IIQA 1XN1A 3ANSA 2R8YA 3VSAA 2ATVA 3H4TA 3L0DA 4YMGA 2PS1A 5ALIA 2B8TA 5JCJA 1HDEA 4UBMA 3C3XA 3X1ZA 1E4VA 1OSNA 4MS3B 4DLRA 1NUQA 4XDZA 4FWBA 3A1EA 1FSZA 2PX0A 4PPNA 3WRXC 4F5ZA 1A71A 4NPCA 1P91A 3WFIA 4MI3A 4UFOA 2PO5A 1T8UA 4D41A 3ADBA 3IL2A 4LRQA 3FMIA 3EHEA 1PXWA 3IAUA 3L1HA 1F4VA 1K5GA 3LW8A 4PLTA 4YRKA 3QY9A 1XZCA 3QEMA 3QVTA 2NXNA 5ALRA 4H27A 1ZCFA 5HZHA 1HRKA 3DGEC 2AL7A 3NBMA 2QJOA 1BQ3A 5D3MA 5EWJB 1W7AA 1OKKD 5D86A 4BVAA 2HBYA 4L75A 2VBIA 5DBEX 3HY6A 1VLMA 1BO6A 5IT5A 1ZDMA 3CX4A 3FYDA 4JITA 4FDMA 1D1TA 2ZIAA 2NLOA 2P0EA 3B2EA 5CJ2A 4YP6A 3S81A 1P2VA 2XUPA 5WRFA 1TQ6A 2FEOA 3HGQA 5JD3A 5TMEA 4BFYA 4CCAA 5DSZA 4FQ7A 1GPLA 2BSAA 1YDMA 3LQRA 3EIQA 1RRCA 4II7A 3JASB 2P6YA 4DG9A 2IIVA 4PNHA 1HZZC 2MYPA 4BBZA 3F0EA 2HA5A 5EPEA 3VHXA 4P80A 4D3SA 2GBPA 1DLIA 2CHVA 4JLVA 2Z83A 1QIDA 3GLGA 1J20A 1EUCB 3IKEA 2QUAA 3IQWA 4JP5A 2MCFA 2GVNA 2A88A 1MA0A 2CL0X 4H6VA 3LUFA 1P7ZA 3NHZA 3MJEA 3R8FA 1E3JA 2BD0A 1Y9DA 2FUG6 2CXTA 4KVAA 1YKSA 3HYLA 3RRFA 4PTZA 3K0BA 4YMWA 4JVNA 3LDHA 4P4GA 1G60A 4YLEA 3K0AA 1U28A 3TXXA 1NNUA 4RXUA 1YD7A 2Z5LA 4TTVA 1ZOPA 2FRXA 2VGNA 4QDUA 3TZEA 2OZLB 3B13B 2CF5A 3EC1A 1VJRA 3OFSA 2IYYA 2IYUA 2XLCA 3ESQA 3IEKA 1DG9A 1G17A 1H2RS 3WOVA 3QJ5A 4G23A 1YR8A 1KH3A 1SULA 2AQHA 1CUBA 1QVAA 1X8LA 1SQ6A 1Y1QA 2SKEA 3AUXA 2DP4E 3CLTD 1U8EA 1Y9JA 3K0CA 2IPLA 4WD3A 3SBDA 3WLHA 1FRVA 4YXWD 5LJLA 3KTAB 5TQ2A 3BA6A 3NWJA 4UOQA 1R9JA 3KB1A 1CPYA 1W4LA 5EUQB 4Y1GA 1YONA 2O2YA 3MQ4A 5DX0A 2O8BA 4FBGA 2BGRA 2I6XA 2PCLA 2YHIB 5DW3A 3UK2A 1OZ0A 4L07A 1C30A 4HAZA 3ROQA 3WLPA 2ZYGA 1P2TA 1IUPA 4GRAA 5CB4F 4S12A 3FVVA 3BH0A 7AT1A 4ICIA 1HYHA 2I6QA 3OU7A 4LI3X 2O50A 4ASUA 3VO9A 2F43A 1XO1A 1XP5A 1MVNA 4O25A 2QR2A 5GVSA 5BSGA 2Y1CA 3EDRA 4YASA 4KUHA 5K3EA 1E7RA 5DBHX 3KRTA 1IBMB 3ANMA 4MTCA 1P9WA 1AKMA 4FYKA 5IWCA 3P4EA 4TRRA 1T6NA 4JKOA 3SFTA 2E5WA 2Q3JA 3AHGA 3FGZA 4WOPA 1RWWA 5A3JA 1A97A 1VE5A 1ZJ6A 2WDPA 3VI4B 2I7DA 3HM2A 3ZE8A 3B48A 2ZBUA 1BMQA 3EPKA 4LZAA 1U3FA 1Z0JA 3PHBE 2NVBA 3MMXA 2HQOA 3R24A 3KQTA 1UP4A 5F5LA 1L7VC 4TTSA 5E3HA 4OL0A 4DA7A 2KM1A 3JYOA 5KOJB 1H0SA 4LC0A 2O1SA 2A4KA 2DUMA 3OCXA 4RTPA 3LDGA 4D8WA 4AICA 4Q3EA 2AMLA 1QU3A 3PSAA 4R84A 4PYRA 4WINA 1X77A 5FRDA 3RSQA 1KSHA 3BD7A 1QK3A 5DI3A 2VQ3A 2DJIA 2Y1XA 2Q5CA 3KCNA 1M8JA 1M34B 3IDFA 3JSAA 3PQCA 5FKJA 5B2ZA 1JDPA 3ZY4A 4F8EA 4ZTUB 3BORA 4KBYA 2VYFA 3AXSA 2FP3A 2IZ7A 4D4GA 1QVVA 4JBLA 4LECA 2XDQA 4KQ9A 1PJQA 2YMMA 5A0FA 4IAOA 1EXDA 4JLSA 3BULA 3I56F 1UL1X 2FH5B 4J75A 4UPEA 3QF7A 1U40A 2OV2A 3F67A 4DKXA 1HDOA 3BD8A 2IBTA 4KFCA 1RWQA 1W5SA 4MA4A 3IJPA 5IAOA 3PHGA 3SSOA 2QV7A 3PAFA 3DYVA 3NWBA 1I51A 2YY6A 2JFZA 4O2AA 2CJFA 3KSZO 4ZWNA 4XPIA 3ZHBA 3OESA 3LKZA 1VGQA 4B3XA 5I7VA 3T9BA 4HEA1 2G67A 3CUSA 4UHJA 3V4SA 4K3VA 2Y71A 1UPFA 2GPTA 3FWZA 3K1YA 3O8NA 2H9YA 1J2EA 3NK7A 2YASA 2VK1A 3PNVA 3PR2B 5IM4F 2GRAA 2AXNA 1YMUA 1ZNQO 5FJIA 4U7DA 3ILVA 2R6ZA 3BHIA 1CZLA 4WI1A 1I7LA 3T1TA 4ML3A 3A06A 1E6CA 4J0IA 3TL2A 4CMBA 2Z8XA 4KAFA 4REQB 4UTZA 3QTYA 2ZIUB 5FTLA 3COJA 2EU8A 1GQYA 1Z39A 4JJEA 1GL6A 3PQ3A 4LK2A 2GHQA 1ID8A 3MZ0A 3CUVA 4HB4A 3ZHVA 4Q05A 5E4TA 4PGHA 5EHQA 2HP0A 5IVPA 2MSEB 1MTOA 1Q0QA 3KFVA 4FDTA 4QXOA 1ZW1A 5ALGA 1DKRA 1PL8A 1YRWA 2YN0A 2XNDA 5AOAA 4V39A 5DCYA 3NTVA 1UWLA 3AFIA 3BL6A 1EI9A 3I3OA 3UWOA 1IJBA 5DASA 3GD5A 3VNAA 3LOQA 2B98A 2UYGA 3PE6A 2BIFA 4RZSA 4RDXA 3GGDA 5K6RA 5MGBA 2QTBA 4XJXA 1SC4A 3VR3D 1Q1EA 2PD4A 1DC5A 1GO1A 2JFGA 3IALA 4GM1A 2ZETA 3AEQB 3B60A 4ARUA 1JY8A 1GYRA 4C4ZA 5KOYA 3B6ZA 4BKRA 4ARAA 3AM5A 1LPOA 5F78A 4ZFNA 1IK4A 1QQ6A 5IAKA 1N5IA 1LSSA 4M8KA 3SC2B 1S89A 5IXJA 4DLBA 1COZA 1X0XA 5HNKA 4C7VA 2BFCA 3L6UA 4UZEA 1SUAA 4Z0TA 1G8AA 4S1VA 4QG7A 4XEUA 5FIUA 5HCIA 3ROMA 1Q16A 1JPNA 2AA3A 3DCNA 3X0DA 1HNWB 2HCBA 4B34A 5A5DA 5BV8A 3ETHA 2EBHX 3JWJA 4YTEA 5GJVC 5EMHA 1KIMA 2HMAA 3I09A 4RSMA 4I7EA 3WRYA 1UDAA 2ZOVA 4MIOA 2BF7A 2GEBA 1F2TB 1ZI6A 2G28A 4IHJB 2CNWA 2GHIA 3BQNB 4E51A 4CKZA 2AJCA 1NVVQ 4L4RA 4ARCA 1ECPA 3FCCA 1ZITA 3INTA 3IUSA 3KYJB 4OLJA 2IYPA 5E6SB 1WHTB 1UAAA 4GR4A 4OU5A 3TZLA 4GBMA 3KKEA 1FZTA 1CD5A 1JT9A 1VL6A 1QHEA 3IIEA 4KP7A 4DA4A 2AOTB 3GGSA 4FZ3A 4YDRA 4A7PA 2LIPA 4L3WA 4D44A 2O07A 3PHJA 3PDUA 4KDFA 1A7UA 4XEHA 4AJNA 221PA 3KALA 4P08A 3QZUA 1QV7A 3CTMA 4WFJA 3T12A 4BWYA 1ZD8A 4CKCA 2MIIA 5FADA 5EUBA 1LV7A 5HCNA 1LTQA 2QPLA 3LUCA 2AZMA 5H80A 4BATA 2IP4A 1ICEA 3MT0A 4C29A 5JY6A 3U7GA 1EXWA 2BJWA 2P40A 3AR4A 3W8DA 1QRUA 1LTHR 3B5JA 1SBHA 3BXZA 1RI2A 1Z18A 2XTZA 4IJWA 4PPQA 2Y66A 4OPMA 4IJMA 2AS0A 4NS1A 4BLUA 2XQVA 2RK3A 4PLVA 4BLRA 1H6BA 5T6BA 2EL7A 1YQDA 2XUHA 2ZXEA 5DFAA 1OYOA 1PUIA 2NIPA 3GVIA 3OQJA 4RPHA 3UNXA 3WG9A 4RPKA 3WL4A 3M8KA 4EPVA 4GVLA 5BN3A 5JPCA 3CXCF 4Q4LA 4QNRA 3OLQA 1X86B 3WGUA 3DBVO 2YYSA 4O6VA 1OXSC 3I5AA 3FBGA 4LE1A 3VJKA 5AICA 1SXJD 1GOTA 1A04A 1Q1GA 3DEYX 3PUYA 3T99A 4BTLA 3I9JA 4K6KA 2X41A 2XVMA 5FORA 3UJAA 2WFMA 3R6GA 4L73A 4C30A 5AW7A 2ZQ5A 3UB2A 1Z0KA 3W6PA 1P7VA 1K86A 1UIRA 5BVHA 1QP8A 2Q6TA 4H17A 3VC7A 5JXWA 3BJEA 3KV1A 3ZTWA 2E4WA 2NO0A 1QIEA 5LL6P 3CC4F 2AMFA 5G41A 3VH3A 3E4DA 4EYKA 1IB6A 1HDGO 2P2DA 2LCAA 1A8IA 2ZR7A 3TNYA 2GQ0A 3GJ3A 2GF0A 4YRBA 5KUTA 1DKOA 4O8ZA 5KCZA 2NVOA 2UU9B 4CEHB 1G6Q1 4KQEA 2L69A 2JFYA 2OZBA 1XVAA 4MSUA 3K0TA 4A5OA 1SURA 1BTOA 2RGCA 4BX8A 3HKEB 2IS6A 1FB5A 2P7HA 2CZWA 3PEVA 2J0EA 2QLNA 4GU5A 1OWNA 1U5AA 3N8IA 3HXOA 4RGQA 4WAUA 1NMZA 1ZCAA 1NJFA 4DSZA 1NSFA 2C5AA 5EHZA 3S2EA 1YZVA 1E6KA 1NVUQ 1G2OA 2FEWB 1OXKB 1DWPA 2QUIA 4HDMA 4IZIA 4CM5A 4KO3S 1Z0IA 3HJAA 5JCJD 1C9EA 3WWYA 5KJ1A 3CLVA 3F49S 1K89A 4LRTB 1AGYA 1Q17A 4HVTA 1Z7EA 3P9RA 4P36A 3SZLA 4JXXA 1LVGA 1MJGA 3E7PA 5COBA 1ZH8A 4P2BA 1SB9A 3NORA 5DM2A 2ACKA 2OGSA 1F3LA 2ZUDA 2IEAA 1UT5A 1PDOA 2YJ4A 4FQ5A 3RJ9A 4XD7A 2OHJA 3D4PA 5T3UA 2NV2B 1Y6RA 1PR2A 4N0DA 3UHOA 5IZCA 4KRFA 3BRSA 4POAA 4PRYA 3FTEA 1OHHA 2WFLB 1C3XA 2QMOA 4L8VA 4AROA 1WZUA 3TCXB 4PRKA 2AI3A 1R6UA 4PYNA 1QOZA 2BMVA 2P5YA 2PV7A 4Q1DA 2IWRA 4WSOA 1O03A 3REQA 3A9RA 1XDSA 1G2PA 4NTZA 1C5KA 5CVJA 3ZEAA 2WW8A 3PHCA 4OQYA 4RFLA 5I7OA 3QP9A 1K63A 13PKA 1VIVA 3S7TA 2BSXA 2PTHA 4F06A 5KREA 3TRHA 2O2ZA 4XARA 3TKYA 2JFUA 1XHLA 5CYOA 5A6VA 4AKHA 5KQGA 4AP5A 4KLRA 5DKFA 4PONA 1O57A 3ED5A 1NXTA 3GGGA 3ZO8A 4K28A 1QRAA 4I99A 4G2NA 1SIBE 2Z5GA 1OLUB 3RUFA 4YRDA 2QRMA 1Z4MA 5A2QA 2PBRA 4CQLB 2DPYA 3DYBA 3HO6A 3LZDA 4GAEA 3D6NB 5IAJA 4UOZA 1Z22A 3CRW1 5AW9A 3T5CA 5L4SA 4MKIA 4XZ3A 1FX0B 2EX1A 3ADDA 3KPJA 2NPFA 3KQKA 1ZH2A 1ZGBA 2O7QA 1NI4B 3W2HA 3A2NA 3B20A 2PMDA 4ZCMA 5G2OA 1O0SA 2P78A 2X5KO 1XZGA 1JPUA 2Z98A 1M1YB 3QVJA 4IJKA 3TXYA 5CX1A 1Y6FA 2I22A 2PGDA 4UBJA 3D0OA 4R1PA 1UBOS 4DT1A 3L9XA 2BRUC 3RIMA 1D6SA 1FPMA 4CMKA 3NBFA 4OP2A 3I9OA 3KZCA 3L41A 1AZSC 3PTAA 1DTEA 4JLAA 2JFHA 4M9XA 4G5YA 5HQ3A 3RAEC 5DYYA 4ZJUA 1U0LA 2ESRA 3JQBC 3VU3A 1OX4A 3DDWA 3QX9A 4YV2A 1BMDA 1XQXA 2Q0XA 3S55A 4YCBA 2TMKA 4CLHA 3WLAA 2QI9C 1OBCA 4K03A 1E94E 1YA8A 3ZWCA 5JDCC 1JIXA 3VYVA 3QE9Y 2C7QA 2ZUVA 1EWTA 3CLUD 1W5AA 4FX5A 3H18A 2YHSA 4KV9A 5IM5A 1QUEA 3VYWA 3SZ3A 1MEEA 2OGZA 4OCZA 4B7ZA 1UBGA 2J0SA 3N2IA 4D25A 2X6TA 3KP1A 1GKYA 3PGXA 1AVTA 4RULA 1XHOA 4L8FA 2DUJA 4M9QA 4NVRA 2C5HA 4L78A 1PZEA 2YUIA 5FO1A 3T0GA 3JVUA 1ZCJA 1KI4A 5BSTA 4GG1A 2MDTA 4GUAA 4P83A 1M0EA 1XUOA 1VKRA 3SZOA 3NMUC 2XEDA 4ASUD 1NY6A 4PRZA 4PQFA 4RAOA 3NJRA 3HZOA 4JV5B 1K2VN 1V41E 3EPHA 4CI9A 1FFBA 5CLLA 5JFGA 4IEFB 4H4EA 3C9UA 1IC6A 2ZSFA 1YR6A 2B8NA 4OMUA 2PZLA 4HWGA 1LFAA 2ZJ2A 4TLBA 5B30A 1H2WA 3KBBA 3HY4A 5GONA 3FH0A 3OD1A 3DJYA 3SC3A 2C7PA 4X93A 3RSCA 3OTQA 4Y2SA 3WBFA 4K5QA 4E3ZA 5AKHA 5CA0A 3D6UA 1IOLA 1KDZA 4MVCA 2WJAA 1N77A 4OXIA 2P9GA 2JBAA 3JD0A 3OJCA 5BP7A 1YSCA 3LT0A 3T94A 3E1KA 4KZKA 1Q86H 2B8WA 3ILXA 5L6LB 2W7TA 3FETA 4RM3A 1WB5A 3C5EA 3SLKA 1GJRA 4Y67A 5IAEA 4D57A 1X42A 2HF8A 5EGNA 4MOWA 1OXMA 1EVJA 1YIOA 4KQIA 2X6RA 1F8GA 2I76A 3PNBA 2RHHA 4MWTA 3UAVA 4DSOA 1FIUA 2Q1UA 2V7PA 3AB7A 1Q77A 1TF2A 1XK6A 4TWIA 4WZ6A 1FUIA 2IKSA 3DL2A 4QFCA 1F8FA 4C4SA 5F9FA 1SXQA 2C07A 1OUMA 5T8KC 4MMYB 1AZWA 1KOJA 1I7SB 2J45A 1GXSB 2QQGA 1UEJA 3LKBA 2W42A 4KO8A 3HYNA 1U98A 1WXGA 4OATA 5EWMB 3ASZA 2BEWA 2IEBA 1UMBA 2PZGA 4GOOD 4CEIA 1F0PA 3CIOA 3O26A 2FZ4A 2FSFA 2N0SA 3B5EA 4UUPA 2ZG6A 3D2CA 3KWMA 2X0EA 5EVCA 4CIXA 1U6KA 1Y3IA 3U3DA 1I0ZA 1HETA 1N0UA 5JEDA 5BURA 3JALB 4R2KA 3CCUF 1GEEA 4PAGA 2FN8A 3SSNA 3N4YA 1E7KA 1S72F 1R8YA 3GLRA 2BYTA 1AV6A 3BCSA 1KRXA 1V4VA 1TVKB 1CDDA 2O3UA 5LFAA 4QDTA 4PC7A 1UZLA 4NG4A 1JW9B 3TPZA 1JQJC 2WHEA 3NXSA 3BFXA 2I80A 4NYIR 2QS9A 4ZXFA 3G1TA 3H2JA 4FU0A 4KQMA 4BY9E 1I0LA 5AKGA 3VYUB 4PFJA 4PNPA 2WD8A 3H84A 3QI7A 2V45A 3MMPA 4FOLA 5I6DA 2O4CA 2YVKA 2OO7A 2PBFA 1VJ1A 1YVUA 4B44A 4HGZA 1Z4OA 5JWOA 2D54A 4OA5A 4OXQA 4FI3C 4TV9A 4TL7A 2PT7A 4X54A 2QE6A 1SG0A 3WO1A 3ZGOA 1RYZA 2JW5A 4ZI7A 1C4OA 2PZBA 5LD2C 5EXDA 4Z4FA 3A8TA 4HVLA 1U3TA 4ZVOA 5F2EA 2MINA 4TKLA 3VTFA 1FLNA 4I4TF 3CCEF 1JMYA 1AKQA 2ZGVA 2I54A 3K9WA 3OFVA 4RNCA 3VV3A 3WLKX 1EKXA 4X41A 5BWBA 4MPDA 1H23A 2XNDD 1ESMA 4RVSA 5K09A 4QJ3A 1WD5A 3L7CA 4NL4H 3LK6A 1O95A 3KKLA 1QXSA 3MWYW 5DHSA 2ISCA 5C8XA 1R0BA 1WHSA 3UK7A 3U0OA 1GPUA 2C5EA 7REQA 3JATB 1CS0A 4XVRA 1C14A 3Q9SA 2JGLA 5CLJA 1YZFA 3WNDA 1G41A 2FR1A 1PZMA 1BH6A 1IY1A 2GYVA 2WWFA 3A7DA 2V0CA 3O74A 2XF8A 4RS3A 4X8LA 4JDUA 3MQFA 1J0BA 2P79A 3ZD7A 3E3NA 1J0CA 3FHCB 1HFKA 1M74A 5DHAA 3N6XA 3AFGA 3JPYA 5H1YA 2ODQA 1AV7A 2QMZA 2Q8PA 2N42A 2IHUA 2CVPA 2J3LA 2WTBA 3C85A 4L5IA 4RESA 5H3HA 1Y8RA 2LWIA 3PXUA 3ONFA 4K81B 5F7JA 2XVXA 1SHZA 4FOSA 4BV8A 3EPJA 1Q7BA 4LXHA 1L8XA 2ZT7A 4XB1A 5G0WA 4BKPA 4TN5A 3KO8A 1K6IA 1NVBA 1L4HA 4ZQBA 4G37A 1RAGA 4DR5B 3MD0A 5A2GA 1XYVA 3LWNA 4I6GA 2PH3A 4PX9A 1DWQA 2Q3FA 1DT3A 2ATCA 1HFJA 1KYXA 2CNWD 4M37A 3HYCA 1QZUA 4MO2A 1CUCA 5E95A 3CKLA 3U4AA 4LDRA 5CBPA 4EYOA 1R2QA 4NK4A 5K03A 1XCLA 3S68A 5EKSA 1KOGA 3L7DA 3NFYA 1E79D 4JNKA 4DY6A 2ZIVB 2G9ZA 5G0SA 4D26A 3AU9A 2W43A 3U1TA 4DRZA 1DC7A 1GT6A 3DFMA 2YKGA 2PLWA 3WB1A 3A1NA 1U3UA 1TIBA 1B6RA 3X1YA 1KMHA 4HLNA 3O3MB 3Q41A 1SGWA 4WNYA 4WUVA 1DT9A 1WMFA 3PQ8A 1UFKA 3QLTA 1KTIA 3TSCA 4CM4B 1W47A 1FS5A 3INYA 4W5HA 3S8YA 1B3RA 1LBEA 3BH7A 3AR5A 3ZDFA 1QKKA 5CVEA 2ZITA 1D6NA 3QKRB 4W5QA 4ER7A 3HJWC 1E8NA 3RIGA 4IGEA 4ZGGA 1XI2A 3LC1O 2VDKB 5BSEA 5KKCA 3FYUB 3ZWKA 2PM8A 4M4SA 3EZYA 2YFYA 4Y6QA 1VQ8F 1EVZA 1YCGA 5FLXA 1DLJA 2EERA 2FZKA 5C52B 1CRWG 5CA1F 4BVSA 1KNXA 1ECLA 4W6ZA 2YHAA 3PC8A 2F9FA 3FOCA 4MO9A 4QQNA 5LA6F 1DMSA 3RC7A 3I1IA 3PQDA 3ZZUA 4EY5A 1GKUB 1CZOA 3EIEA 8ADHA 4YYEA 4P6VF 4RKWA 1U7ZA 2AC2A 3BREA 3M6LA 4KMMA 4ZGBA 4UDOA 4JCCA 3TUJC 3IKFA 4U5QA 5EERA 1A2KC 4DJTA 1NMEA 3U6KA 1QF6A 5IMBA 5JMWA 5EA2A 2BTQB 6NULA 3E9CA 4ZTZB 1AUXA 4PX5A 3TI9A 5JD5A 2QZPA 4RE5A 3DT9A 5FNVB 2R00C 1HF3A 1X8JA 3MXTA 1PV2A 1CR0A 2H2FA 3SDZA 1ZA1A 4MS4A 2ZI4A 2RHLA 4CTOA 3B85A 5EJ2A 3B38A 3GPDG 2TMDA 1P1CA 2GO1A 3OTWA 5FA8A 1WVMA 4QGHA 4RCYA 3TH5A 3C24A 7YASA 4C0LA 1BKSB 3A04A 4M46A 4U3JB 3D3KA 1G66A 3EGCA 2QTWB 2W6IA 4ZCQA 3BG5A 3TX2A 1V8FA 3SD7A 5TY0A 1R18A 5HGXA 2PZ8A 4JT8A 3E18A 1VL8A 2CC2A 4GBJA 1UXJA 5CNMA 4OVKA 5A3SA 1CVIA 5JXJA 2V55B 2VRBA 5KJEA 3Q6IA 1NF2A 4PCUA 2D62A 5NLLA 1LWOA 4XM2A 4Z49A 3MWLA 1JDSA 5C8YF 3ZWXA 1KR5A 1LPSA 1RJWA 2HL6A 1YQWA 3ANTA 5AW6A 4V1CB 5EQTA 3V6MA 1RDFA 1YMQA 2H2WA 4QRIA 1X9GA 2F3TA 1XCBA 1I36A 4F3YA 1I4DD 1DAFA 3DZDA 1DV2A 1JDJA 2RJ3A 3V48A 1M54A 4IUBS 2EWCA 3I5YA 4R3UC 4XD7D 3PUHA 2UXBB 4M9CA 1SB8A 1CNMA 3R7BA 4KR9A 1K4YA 4C0SA 2ZU0C 4M99A 1JZSA 2O52A 1OHHD 5HKBA 1U1DA 1TO1E 1H22A 4LMRA 4Q4DA 5LOVF 3AJEA 1UAGA 4RADA 4C7MA 3JAMM 2VKQA 1Z2AA 1CYDA 3KJGA 1ABEA 4DJJA 3AR8A 1NBIA 3ZGZA 1D04A 3DZGA 4MYRA 4B84A 3GPLA 1T2CA 3THXA 4PANA 1XMJA 3VISA 5IFLA 1P2FA 1NX9A 1ZVKA 3L7MA 4P93A 3FOBA 1JJ2F 1CLE