5MN4A

S. aureus ftsz 12-316 f138a gdp open form (1fof)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSAEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title A Polymerization-Associated Structural Switch in FtsZ That Enables Treadmilling of Model Filaments.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 110
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5mn4A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5mn4A01
4FFBA 5EIBD 4EB6B 5FNVB 5MN4A 1TUBB 3HKEB 5EZYA 4ZI7A 5CB4B 5ITZB 4ZOLB 5J2UA 2BTQA 4TV8A 4U3JB 3N2GB 3VOBA 4O4LA 4O4JB 3RYHA 2R6R1 4EI8A 4O4HB 5GONB 5LOVA 4I55B 4O2BA 3CB2A 5M7EA 3WGNA 3E22A 5J2TA 5LA6A 5EYPA 4TV9B 5KMGA 3JALA 3M89A 1FFXA 3JAWB 4YJ3A 5EIBC 5JVDB 3JATB 1RQ2A 5JH7A 4IHJA 5KX5A 5JCOC 1TVKA 5JQGA 2Q1YA 4O2AB 1OFUA 3HKBB 1W581 3JAKA 4U39A 5LP6C 4DRXB 3RYCB 3HKCA 3N2KB 2VAWA 1W5BA 3JASB 4IIJA 3VOAA 4I4TB 4WBNB 1W5FA 3JARA 1SA0A 4HNAA 3UT5B 5IYZA 5LYJB 4I50B 4X20A 4X1YB 3RYFB 3WGKA 5CA1B 4F6RA 5C8YA 5MN5A 5LXTA 4LNUA 4X1KB 5JCOA 5BMVA 5J2UB 4TV8B 3WGLA 2BTOA 4EI7A 5CA0A 5LP6A 1RQ7A 3N2GA 3RYIB 1Z5WA 4YJ2A 3ZIDA 4EB6A 5FNVA 1TUBA 3HKEA 3HKDB 3JALB 5IJ0B 4YJ3B 2R751 4O4JA 4ZHQB 4IHJB 4X1IB 1JFFB 4O4HA 5GONA 3WGMA 4I55A 3VO8A 4EI9A 4DXDA 5IJ9B 4B45A 3ZBPA 2RHHA 4O4IB 5MN6A 4TV9A 4IIJB 4FFBB 5J2TB 5IYZB 5JVDA 3JATA 4TUYA 5EZYB 4ZI7B 2BTQB 4XCQA 4E6EA 3HKBA 2GVIA 4O4LB 3RYHB 1W59A 5LOVB 5BMVB 4DRXA 3RYCA 4O2BB 3N2KA 3JASA 1W5AA 3V3TA 4I4TA 5LYJA 3UT5A 2VAMA 3R4VA 3E22B 4X1YA 2VAPA 5LA6B 5EYPB 3RYFA 5CB4A 5ITZA 5CA1A 4ZOLA 5KMGB 4YJ2B 1FFXB 4U3JA 5JH7B 4X1KA 5KX5B 3VPAA 1TVKB 3C8LA 5JQGB 2XKAA 2XKBA 2RHLA 1FSZA 3JAKB 3RYIA 3HKCB 1RLUA 3JAWA 2RHOA 1SA0B 3JARB 4HNAB 4KWEA 2Q1XA 4X20B 2RHJA 3HKDA 4F6RB 5C8YB 5IJ0A 3RB8A 4O2AA 5LXTB 3VO9A 4LNUB 4B46A 4ZHQA 3ZBQA 4X1IA 1JFFA 4TUYB 3M8KA 3WGJA 2VXYA 5IJ9A 4WBNA 1Z5VA 4M8IA 5CA0B 4O4IA 5LP6B 4I50A 1W5EA
chains in the Genus database with same CATH superfamily
4WLNA 3NHBA 4Q4HA 5DKFA 5I48A 3ANTA 2BE9A 3HO1A 1ESMA 3RGGA 1FDVA 2GHTA 4TMTA 1DRJA 4I1YA 4PPFA 3MZ0A 4QU0A 4HUJA 1WXGA 4GE0A 4AKHA 4MRSA 2BM9A 1KQSF 2BCEA 3S81A 3B6NA 1S1MA 1JNYA 2CFSA 3PHHA 1BFKA 4JGIA 4OK3A 1L7MA 3V7EA 4RQUA 3HR8A 1YXMA 3QEMB 1IPFA 3AF2A 3K0EA 3IEVA 3GH1A 2ATIA 2HPAA 2PQMA 3LC0A 5CITA 3AF4A 5JC1A 1I3OA 1QHEA 2Y1LA 4Q6BA 1HT2E 1TNDA 3NRBA 5JNRA 3OT5A 3VRHA 1WWKA 2D5IA 3K1AA 4NRDA 4BNTA 2ZUCA 4YCCA 2R8OA 4K9SA 3FGOA 4P7GA 1X7YA 4ZVVA 5IAAA 4LRYA 2OCLA 4IICA 3P9SA 4RHEA 2UXCB 1DEKA 4NBLA 3AGPA 1JA0A 4BNMA 3KOXA 3SQDA 1Q2XA 5EJFA 3F7TA 4Q4AA 3TGWA 2YOFA 4Y6RA 3RW9A 2PS1A 2VK1A 3SHFA 3GFRA 3F3SA 3AVPA 1QE5A 1YZ3A 2O3QA 2YIDA 4LXHA 1SD5A 4KO2S 4C9BA 3OZSA 3TD4A 2WJYA 2OXFA 1IV2A 1ZSVA 3EY4A 4GO1A 1M1ZA 3WQHA 3GT3A 1YQGA 2YJTD 1A2QA 3N07A 3G8CA 2CNWA 4H0CA 1DIOB 3BKWA 2G80A 4RFVA 1QCCA 3WGUA 4B43A 3D2AA 4QECA 4ZAGA 3IOEA 1J2EA 1SUIA 2C9BA 2NTVA 4QYXA 2OL4A 5EP1A 3P2MA 1I7QB 3ROQA 3DTVD 1N25A 2NSDA 1W87A 3EBPA 5F7JA 1PVOA 1U11A 3SXJA 2RAVA 5IYZB 2ST1A 3ICOA 2A7XA 2O57A 2QKYA 1CETA 5A4KA 1ULUA 1A50B 3E3MA 3FCYA 3RSZA 4AQYB 1O3YA 2B78A 4ACAA 3G68A 3T9BA 5BN3B 1U3VA 3HABA 3I9LA 4YMTA 2FPGB 1MJGM 1T2FA 2X6QA 3KJFA 1XG5A 1YMUA 2J9YB 3ZKWA 4V2UA 1I33A 3IR9A 3RYFA 3ETNA 3OFKA 3KJQA 2ZYAA 1LPAB 1W19A 2UV8A 3IAM6 4KK3A 1KJWA 1UAYA 1CB7A 1I4TD 1XF9A 3BRWD 3P5SA 5AXCA 5AYVA 2N3ZA 5AUOB 2HJVA 2QAGB 3Q0IA 4JP2A 3L41A 1OOEA 1V3QE 1PZHA 2P6OA 1S2MA 3TPZA 4DQDA 4LDAA 4YDHB 5CA0F 3RPEA 3C85A 1N33B 1XEFA 4AC9A 3FHJA 4KYUA 2XD4A 4TZKA 5BWOA 4HNQA 1MB0A 4IO0A 4TTIA 5IANA 3I6BA 1WDTA 2PGLA 3C6YA 4TYNA 2E0IA 3OX2A 4JA2A 1LX7A 2A9OA 2XHZA 3L07A 4B46A 1N2CB 5ICCA 5TQVA 3U5TA 4C0WA 3N6RA 2AMJA 4XGRA 1W4LA 3MOGA 1EAYA 2FX3A 4QT0A 1WHTB 1L8QA 2VP0A 3KYCB 4KTVE 4KYTA 2P78A 5MGBA 4FYXA 1VQNF 1VPVA 4CKEB 1G64A 1E2UA 3GLVA 4WN9B 1GPNA 5JRJA 5K7SA 1NHGA 2GRJA 3F5DA 1P7YA 4EI8A 3UANA 3ZD7A 4LYAA 1E1NA 3EGXB 2EBFX 3QRWA 3G2KA 3E70C 1L8OA 3VSEA 2EAUA 2ODPA 2AC4A 1UKZA 2BKEA 4HMPA 4MJ7A 1VCMA 3JAWB 2BP7B 1H0KA 1K7CA 4BZXA 4P7BA 5E2IA 1DOZA 2AXQA 1AA6A 1UQUA 5AM0A 4NMMA 2BFOA 1UM8A 3KZOA 1X7XA 1EHIA 4S12A 5C35A 1B4DA 1QF7A 3PF9A 3VM6A 2P2DA 2X4IA 3HWSA 5ILGA 4Z1MD 3I83A 1HSOA 1RI2A 5FBRB 2Q3BA 1WUJS 4KXMA 1JEYB 2LBPA 1H1DA 4FLFA 3GQBA 4BQQA 2C9MA 3KZVA 1BHO1 2H4HA 3RIYA 3TNJA 1Y4DE 2H7YA 2G9QA 2W58A 2WYHA 3KX2A 2YNMD 4CG1A 2K1SA 1SPBS 3AP1A 3HCEA 2XOKD 3QEBZ 4B17A 4ME6A 5FUXA 2F43A 3BTVA 3H0EA 1L5VA 3FF4A 4N3CA 4XGQA 2Q7DA 2ZUTA 1KO4A 4PRLA 3T80A 2P40A 4RWEA 4YJFA 4BKRA 4K28A 2XRFA 3WTCA 2ACVA 4D96A 3N0RA 4C6HA 3FBAA 3G4SF 4QXRA 4KDEA 5AHRA 5ICFA 4DSTA 4DQLA 3VH1A 5F1KA 3ZDFA 4JYMA 1U9ZA 4KRGA 2IDZA 2VJBA 3PL5A 2XLCA 1BMTA 1D9ZA 3A06A 3B12A 3EHEA 3S68A 4TLMB 4EFNA 3FN4A 3IEUA 3LM8A 1U2TA 1L5HA 4MV7A 1TCUA 4I1IA 2NO7A 1R66A 3EQ7A 1H1LB 2WJJA 4E7OA 4AQDA 3L6UA 1CS0A 1TYDE 3X44A 4BNLA 1L4MA 4B71A 3ERCA 3LECA 3F0FA 4MW9A 2PCLA 3OKFA 4XLLA 3PITA 4MVJF 3ROPA 2IYSA 3D64A 3HKBA 2AOWA 4AROA 1RQPA 1ONOA 2UDPA 4UHEA 2D2VA 5A6SB 3UMBA 3T1YB 2BTEA 2ECKA 1CZNA 4IIUA 4LTMA 4UBOA 3WHIA 1H85A 5G02A 4Z99A 2GK3A 1PJAA 2QVYX 4XX0B 1ZMTA 3N2EA 2C07A 4K9RA 2PRIA 1RKXA 2YJGA 3I9V1 4TKVB 3S2EA 1JG4A 3CWZA 2AYZA 4UDNA 3VJKA 3AEXA 1HE4A 2ZIXB 3ZN2A 4ZCIA 5JATA 3CF2A 5ECDA 2WA2A 5H7XA 2UYQA 4J7CA 4ARVA 1QH1A 1S5PA 5B1EA 4U63A 4B76A 4CLDA 3EIWA 2ZGVA 5EGNA 2G77B 3I76A 3UFXA 2Q1XA 4RFLA 3PAFA 2HF8A 5EIFA 3K30A 1ZZEA 3JVHA 4ZT7A 2YVUA 2AA3A 1F4LA 2IW1A 3W2HA 2ET6A 3EYWA 3H9GA 1D2AA 3P94A 2XA9A 1NDUA 4KFRA 1FL9A 4JP3A 3NYRA 3TIIA 4WOKA 1D6SA 1Q21A 2V7GA 2H7VA 4B5KA 4IXTA 1L3IA 4D6YA 1C5KA 4EB6B 1XZNA 1K3TA 1NLZA 2GPWA 3B7PA 2WG0A 2NXNA 4JXJA 4LZLA 4WZBA 1WBBA 4RVOA 4TQUS 3RBAA 3L92A 4A03A 1FUUA 1IG0A 4E1AA 4U3JB 4XIGS 2AKYA 1SWVA 3PI7A 4TM7A 1R0RE 2GYYA 4RH0A 4BGDA 5KJCA 3I5MA 4XB6B 2PYIA 3A9WA 3FPAA 3L8YA 3MJVA 4C5CA 3R6GA 4IOLA 3U40A 1NJ2A 1DSSG 3I9KA 2C61A 1ZOLA 3N7AA 2ON6A 4YT8A 1OYVA 3WHLA 4U9HS 4MGZR 3EC1A 2JFNA 1ECCA 2DKNA 3WR5A 2XUIA 1UQTA 2YQ4A 3VBCA 5FTNA 1CY2A 3S1SA 1QR6A 4M9ZA 1SXQA 1GT91 4HGNA 3W8FA 3L9XA 4EPTA 4RAOA 3CC4F 1C1XB 3QYPA 4ZO9A 4B2YA 4AZSA 3ICWA 4G4IA 3DLTA 2D0OB 2OPBA 2ZPUA 5AVYA 1E2IA 1L4EA 3MW8A 3BMCB 1CY4A 3CCLF 1Z2EA 1DUVG 1V4VA 2RGYA 4O1MA 3AJEA 3CUYA 3CR7A 1E4YA 3QELA 5IK2A 1SZCA 5B12A 2VGMA 1R4MB 1FLAA 3ORYA 3DNPA 1S2OA 5IMSA 3HR7A 1N6OA 1Y1PA 3B9QA 5CDUA 1E96A 5D5HA 3ZUGA 4MV3A 1QVFF 1PJLA 1N0HA 5ESWA 3VZPA 1DG3A 3AETB 2ILTA 5DHRA 5KNBD 1Q14A 3EZFA 4BFVA 4L78A 1TQ2A 2IXGA 4RU1A 4XUDA 1L9XA 5KNBA 5DHPA 2HP0B 3HA2A 5E3HA 3KJKA 1P7ZA 4XKJA 2APJA 5FL7D 1RM4A 1NBEA 2C95A 2GKSA 2XTMA 4CTNA 1TYZA 2AOXA 1HYEA 3T5BA 1GZ5A 1T0UA 4W9MC 3GRAA 1BA2A 1M1YA 2VNJA 2VSQA 3FPHA 4HNHA 4UM7A 4EYOA 4PGAA 2JBAB 3NEPX 5T3UA 1LTKA 3U4QA 1X14A 2VT7A 3MFQA 1DFGA 3UATA 1WMAA 1MO3A 1P4SA 4LPSA 1QKKA 1TVCA 2ZUBA 3CF4G 3CRW1 3DMYA 3DR3A 3JTMA 3OTWA 2V59A 5K3SA 3GEMA 1EUZA 3CLSD 1X7HA 2P2NA 3U3XA 1EGQA 2HPVA 1YR8A 3LP6A 3DE6X 3JQ9C 1CZOA 4H3HB 2B8TA 4H4DA 1BFUA 1WULS 1ZINA 5FI3A 5FX2A 2PFSA 5JXWA 4RANA 2H9IA 2JLVA 1IY0A 2Z43A 1ZOIA 2X4LA 3JD2A 4XFKA 5G4KA 4A1OA 4HZUB 4DDWA 5JI3E 3GLFE 4RVUA 3E22B 1U31A 2YOHA 4MW2A 5GIPC 4WZAB 4WZ6A 3M6XA 2JF0A 3I1IA 3P10A 1B43A 1RYYA 3CSDA 3K3PA 3QMWA 5B3LA 4DPMA 4G25A 3QXJA 2WHYA 1MJNA 2PLRA 1W36C 1C7JA 4QSHA 1JVSA 1T4CB 3HRIA 3ESDA 5D7NA 2FZEA 1D07A 2HOQA 3TCKA 1J8YF 1H93A 4CQJA 2DERA 2GEDA 5JY6A 3OIFA 3PNOA 4KO1S 3WAKA 1Z8FA 1E1DA 1B8PA 1TGVA 3NHSA 1T0AA 4K3VA 4JNKA 4XJVA 3BSFA 4XD2A 3E9MA 1NOJA 4FYHA 3TLEA 4D46A 1XGKA 4J0DA 1GQ2A 4NYJQ 3UPUA 1ID8A 3EG5A 1LDNA 4FJ1A 5BVHA 4GR4A 3PTAA 1ISGA 1V11B 7REQB 3QXSA 3C6BA 2HCTA 1E9BA 1KYTA 4ID9A 4PX3A 1W5EA 1ZNYA 4N9QA 1DAPA 4PGFA 1UFOA 3TIVA 4EEZA 1OC2A 2F8LA 1UBLS 2QL5A 3REFA 1VL6A 5I5GA 3DO6A 4TXNA 3LCCA 2BHTA 1JSLA 3CE6A 4X62B 4MUMA 3GJRA 2NO1A 2G5TA 4E2YA 4UCWA 4ESOA 1ZQ9A 2ZJ8A 1KEKA 5C7YA 4EQZA 4MV6A 1Z28A 3FFBA 3M5CA 2C2GA 3I5UA 2QUKA 1I5EA 4LW8A 2QPAA 1RVV1 3KL4A 3SOZA 3B9PA 1SZQA 4G8CA 5L7TA 4QT4A 4IDQA 4RXMA 3AEUA 4R1UA 4AXXA 5IFKA 3MOIA 4JI8B 3ZV7A 3PNPA 1U3FA 4RELA 3Q72A 3ZR4B 2J9RA 1Q1BA 2AG6A 5GJCA 2PQ6A 4ASUD 3GLGB 1E98A 3V7YA 1T5BA 3TTSA 3FHLA 4V02A 1DJMA 4INPA 4N5LA 5I7OA 4I50B 1MX5A 1WHSB 3MUFA 1E3JA 1HWYA 3HB1A 3KBOA 1YK0A 3O82A 4I6GA 2NSLA 3ZU2A 3L7LA 2IV3A 2PUWA 3OPYA 1TXGA 2EZUA 3E35A 1DU4A 1ODEA 3IT2A 1EFTA 2WUDA 4ARCA 3D7SA 4QELA 3RT1A 2WFLA 3FSGA 5AVZA 1TC1A 1W88B 5EXEA 1M5RA 2EEZA 2PA0A 3VC3A 3TZCA 4FHFA 4YJ2A 2COUA 3AI2A 1CQJA 1GDDA 1A9TA 1SCBA 5EWRA 1V96A 2FSPA 3DXZA 3FOAA 4M0FA 2ZT8A 3QWHA 2O9JA 4PAQA 4JFRA 3K20A 4CIAA 2AMLA 5CJPA 3HY4A 4D26A 2O8FB 1YFLA 4ZHQB 2ACWA 3E3OA 4IUYA 1YZHA 2DULA 3O5AA 4RLSA 3GFOA 2EP8A 2AZ4A 1I6WA 2F3PA 4NJMB 5EGSA 3RLFA 2WM8A 1YH3A 3O3NB 1TI7A 5ELMA 3OQHA 1BH6A 4YY3B 3TTVA 4JYCA 2AK2A 4AIIA 1ADCA 4HLUC 4WUVA 1VHAA 4FFBB 1QOPB 2DUUA 2P9HA 2QTVB 2YRFA 2BJWA 3LDHA 3LXUX 2RJ3A 3VU9B 1X1DA 1HNXB 2CJYA 2H85A 4BO9A 4UUAA 3NHPA 4XDYA 1SN7A 4F2DA 2O5RA 1J9ZA 1M2OA 1JG6A 4BT5A 1FTNA 2EX1A 2OHOA 2PZAA 1RI1A 2ZK7A 3DOCA 4MKZA 5T57A 1NU8A 5EJ7A 1AO0A 1YV9A 3E5NA 3IKJA 4PPGA 3PG5A 1HURA 1UL1X 4X1YA 2O8DA 2XLBA 3SEFA 2WF7A 4BFWA 1G20A 5GINC 4CM1A 3NWPA 3B3JA 3ZTTA 2XT0A 3RHSA 3GV0A 4A82A 1TK3A 5B2EA 3JQ9A 4LYEA 4EMTA 3BKXA 2E82A 2FUKA 4FFPA 2XKAA 5FBHA 4AUEA 1HOTA 2R7NA 4EUKA 1PV2A 3AZOA 1PNOA 3FXAA 3MELA 2UXBB 2IELA 2W4MA 4REQB 5HP7A 3FKSA 3AY7A 1DJLA 3KTAA 4RPJA 5KAMA 3GXOA 3IV9A 5TGDA 2YHBA 1Q77A 3C98A 4GLLA 2NZXA 1RWMA 1WIWA 3F49S 2ZS7A 4L6CA 4MW7A 4CL3A 1ONNA 4KIUA 4HV4A 3F6YA 2QVBA 2OO5C 1BU8A 2J3JA 4AZTA 5JCPA 3KZMA 3SI7A 4JSRA 3NBAA 4DCGA 5A06A 5FP0A 1DIGA 4U8HA 1AQ6A 1XRSB 3K9BA 5FF9A 5JYBA 4FYIA 1JEQB 1FUEA 3DXFA 1MHPA 4QM6A 2JGDA 1E6KA 1CIVA 1PLLA 4W6QA 1RE0A 1GCOA 2DKOA 3IS3A 4MI6A 1KFEB 1E0JA 3SKVA 4F72A 1RJDA 3TZEA 1C3VA 1GLNA 3LQRA 3OQPA 3V4FA 5D86A 2G88A 5I7VA 1ZI9A 2XGOA 1J70A 1FMTA 3G88A 3Q8HA 1I1QB 5FPSA 4W8OA 2FPRA 4Q7LA 2YZGA 4YJ3A 1BDMA 1NVKA 2KSQA 3SR4A 2Z2KA 3U3RA 3TW6A 2R8RA 3FROA 2FSUA 3KKZA 4WFJA 2K5UA 2VHVA 3RKRA 3ZCPA 5JQGA 3BREA 5AW5A 1E7SA 1KQGA 5MFZA 1CUWA 2P0AA 2Y76A 4XGIA 3V8EA 2DR2A 2IYNA 3DEKA 1YD7A 4LVCA 4C30A 3UC5A 1J1IA 1KF0A 1AK2A 3EEBA 2MR5A 2A86A 3SBXA 1W2BF 1ODFA 5HILA 1KJ9A 2YHSA 4RQOA 4UCXA 1U3UA 1CU1A 3ZW8A 4N0DA 1DAOA 2V97A 2Z5GA 3VSCA 4AKEA 4ID3A 1F3LA 4K6HA 4WUTA 3E1GA 2QD5A 1M1NA 1HT0A 1H0SA 3HDJA 4IDGA 1GYRA 1A5TA 1AKNA 2F3UA 3W5AA 3E4DA 3TSWA 3LRXA 4LBWA 1U3PA 1PFYA 1WW3A 3GJ5A 4D80A 3EFOA 3PWSA 4Z53A 5IAKA 3K9WA 3QWAA 4KDFA 3UJNA 5IULC 3TD2A 3JYPA 4RW0A 3WGMA 1H65A 3ESXA 1N2OA 3IKMB 2ZB8A 2YQZA 1BSVA 4FCWA 4MAMA 3V7WA 4ATNA 4BMZA 4KWHA 5REQB 1U2QA 3HZRA 2PH5A 3I6YA 2O0MA 3PRKE 4HMOA 4BMVA 3DDCA 4BIIA 4PZAA 3WLSA 1FP1D 3LW8A 5D85A 3R7WA 5H8WA 1QX4A 1RRFA 3TJZA 1JF8A 3A6KA 3DFMA 5JAQA 1WSDA 3Q7TA 1XEWY 2ID4A 3C1OA 3REQA 5I7EA 1JNXX 3L18A 1WCXA 4YDQA 2KGWA 4NPHA 3NHKA 4N3BA 1JWAB 3ESZA 2FPUA 5DIZA 3UUGA 4MQFB 2J0QA 2VPQA 1I36A 4I4TA 3UT5A 5GAJA 2VUIB 2ZR0A 5E6SB 5KCZA 4HLUA 1P5HA 2I2CA 3F90A 4M2LA 2PUJA 4I1VA 3TMKA 2PX6A 4IJWA 4K8RB 3W4IA 3OPMA 1K6JA 2WUEA 5KSYA 2HU5A 1XYVA 1PZXA 2NG1A 4II3A 3AJAA 2B35A 4Z4CA 2IZ6A 2GEFA 4FWBA 4A0SA 3KO8A 4PLWA 3S0WA 3UYLA 5L40A 2HGSA 3RVRA 3TLYA 4E31A 2IX9A 4LFBB 1FTYA 2W98A 4C7OA 4JNCA 3CEAA 1IXSB 5AVJA 3PDHA 2M6KA 1FS5A 1T5OA 3NIGB 4ER6A 3HTNA 4H77A 5A71A 2OHVA 2VYVD 1Y42X 1DT3A 2DPHA 2O52A 5AHKA 1F2TA 3S28A 1M34A 3TZBA 4BPBA 4TL8A 5DMXA 3PX7A 1Z0UA 3FVWA 2VYVA 3BWVA 2VP5A 1UQRA 2O2CA 2Q3LA 3DAGA 5DHAA 4KKXB 3F9IA 4Q00A 1PUXA 4V3BA 3N2GB 4ZJPA 3R6LA 1E3IA 2ZJ0A 3CUWA 1Y48E 3UPDA 5CLHA 1QJCA 3IKLA 3Q5GA 4XIIA 3TQIA 3PDIA 3V55A 3WYGA 5DSZA 4KN8A 3E9YA 1ESNA 4O1HA 4O4JB 3RJ5A 3LT2A 2OO5A 2WR8A 3A9SA 1T1EA 3OC6A 4JJKA 1JFRA 4P36A 4B73A 3JTEA 4D9MA 1SQSA 3CX3A 3OUZA 2QI9F 4IOJA 3ZZMA 1J8VA 1GSOA 3DH0A 2XWSA 1IWBB 4V0QA 4P86A 1ZYUA 1C80A 2ZOVA 1L5OA 3MT8A 1LK5A 4FTWA 4WVFA 2BFCA 5LB2A 4UNSA 5BYBA 5JDIC 1VCNA 4CFSA 2JJ2A 1W7AA 3VMFB 4MMYB 1DJOA 1MXFA 1UMCB 3RC3A 3QEAZ 4D0LB 3FOWA 1NV9A 4JBGA 3C3PA 4QJ4A 4XDGA 3UKJA 3ZHBA 4PLYA 1K92A 2JCXA 4QM7A 4X8MA 4LV6A 3GAZA 3LRTA 1D4OA 3ZOKA 4CF4A 4ZHQF 2UUCB 4OFBA 2PU5A 3AFGA 1SOAA 3GHZA 2F1OA 4ZTUB 2KHZA 1P74A 1CULC 1C3OB 4YRFA 2ZI4A 1WXQA 1N3YA 4RIIA 2QP9X 4MB2A 3LKBA 1RXIA 2J32A 4YP6A 5AI4A 4UTVA 5FNVA 3JD0A 1ZKDA 2W8BC 2QTNA 4WDRA 5C5DA 5DYTA 1M8FA 3V8MA 1WMEA 2LBTA 3AUYA 3C3CA 1WPGA 1P72A 4W1RA 5DBOA 4ZEOA 5L8VA 4CR8A 3GLRA 1UBOS 2ZXUA 4DIUA 2VSNA 4F9TA 1KIAA 3A3YA 1EVEA 4QGAA 1VQMF 2FY8A 3C43A 3L8EA 1W44A 4NONA 4Q4HB 4YA6A 3TQSA 1P9NA 3EUAA 3GBSA 1QQBA 1EK2A 2RC6A 3IR6A 3R3YA 1IZ0A 1P6QA 1KOJA 1EHYA 2B20A 1FYXA 2W71A 1D2HA 3EVNA 4G84A 2XNDD 3G7NA 3WYFA 2PIAA 4YAOA 1GGMA 1YI8A 1TFUA 3L93A 1OTXA 2UVPA 3GCXA 2QP3A 5H68A 1P1IA 1C2YA 4HNTA 2AR0A 3MC1A 4QHSA 4ZHYB 2I1QA 2P4HX 2ADOA 2D8AA 2P7HA 3BQNB 4ALIA 6NULA 4ZOLA 4X5OA 3CVYA 1PRYA 1R9NA 2EFEB 3S5JA 3IO5A 3PGXA 4FM9A 2NZUG 3G0IA 4G0WA 5GADl 3RASA 1QF6A 5AW2A 2PEZA 4JVMA 3WMWA 2V7EA 1E61A 4NICA 5AVXA 3MIIA 4JVSB 3TECE 3JWJA 5EP3A 1GKIA 2GT1A 4KMOA 3WL4A 2IF0A 3QUSA 2OCBA 5JJBA 4G67A 5EJ8A 1X7YB 3NAGA 4GG1A 5DGHA 5ALJA 2Z1TA 1PGJA 2VQ6A 4NH4A 1U7OA 1KMNA 3FHCB 3HVHA 3MCUA 2Y0DA 4ND3A 1RNLA 1BDJA 1U80A 2XX3A 2ZANA 4GKBA 4Q47A 3USCS 4Q4AB 3ROGA 3HBNA 4JCCA 2ZSAA 1XVVA 4JIMA 4P7KA 4F3YA 1P18A 4IJ6A 4E33A 5I4CA 1I2BA 2FWJA 3EOZA 4YCNA 1SUCA 4BNWA 1B41A 2G40A 2QD2A 3LPMA 4U7PB 4AX4A 1NVMB 1CJKC 3HJCA 4E5NA 5AKLA 2JVJA 2VR1A 3VR4H 2LE0A 5CMLA 4BFXA 1QRDA 3HSSA 4EITA 1HE1C 1I6MA 4I9FA 4RDIA 5B2FA 1VQPF 3H8VA 3QXCA 3F7MA 4DCCA 4PN7A 4QG3A 5ALUA 1XIVA 5JT1A 1EKXA 1CEYA 2F3QA 3PQ3A 4I9UA 1AOXA 1MX9A 1D8AA 2XNCA 3CH7A 1SCKA 1ZCBA 3C6ZA 3OO1A 2HXSA 3K16A 2VXBA 4MIOA 4ODIA 4RF3A 3QW4B 1TADA 3DTVB 5EC8A 3PQDA 5JYDA 4QQKA 4W1PA 4BKUA 2PFKA 2ACEA 2OXRA 4MTCA 1BS9A 4LRXA 3THXA 1EDDA 3GAFA 3ONNA 1YCFA 5EKDA 2OFWA 4FFOA 3F2IA 1L4LA 1FDOA 5J4KA 5JXHA 3D3KA 3ZDXB 4L51A 3MBIA 4S24A 2YWCA 1R9GA 4ZVUA 3ZKWB 2VCYA 2ZE8A 3C5VA 4R54A 1IHUA 2AHOA 3SNKA 3RYFB 1A4UA 5A62A 5LPNA 2X2FA 1H9AA 1EWQA 1YJNF 1SH7A 3AWDA 4KTTE 1IEVA 5G0VA 5KHOC 4HGOA 5KTRA 4CL2A 3AEYA 5JDIA 2VQ3A 3OOJA 4ZEWA 2BZGA 2ZAYA 5FFMA 1QG0A 2FWRA 4UFNA 2P0YA 4MH0R 2ZVZA 1C2TA 1KNJA 3NDJA 4IF4A 4JN6B 3KEFA 4MVJM 2OV8A 2ZSBA 1ZGBA 3PEFA 3O2QB 2XKKA 1MCZA 2XUPA 3CKLA 5KU1A 1Z2OX 1FVFA 3WPWA 2H5JA 1IOLA 1OXXK 2ADMA 3COVA 2QUAA 3DOIA 3L1UA 3HB7A 2ZSIA 2W2KA 4M1KA 3N3AC 4FI3C 5JAMA 1S3FA 2WSLA 4R2MA 2YYSA 2Z0MA 3IRUA 4RHTA 1U8EA 2OFFA 3RS4A 2WTNA 4LWPA 3VC1A 3DA8A 2W6ZA 2O3RA 4P2BA 1OZFA 1I7LA 4YCAA 1RPNA 3E03A 2W8BA 2BD0A 3UKDA 3BK7A 2NAPA 2O2YA 3GGSA 1E2FA 2XY4A 1DQNA 4MDHA 1GKLA 1V5WA 5JS2A 3MMXA 1RHUA 2UUPA 3HZZA 4MKGA 3LPLA 5T4EA 5JEEA 2QU7A 4X97A 4NV1A 5JWHA 5I9LA 2JLUA 4BBJA 2VHXA 3T7KA 2GJKA 1DX6A 1UKVY 2BGMA 1VMIA 2RIRA 4X93A 3WA7A 3RVLA 2Z6UA 1EPUA 1FZTA 1QNLA 5LLDA 5DLEA 4AQ7A 4H3SA 2GJSA 1PHPA 2FP4A 2IXAA 2P1ZA 1B2RA 1TA0A 5IAEA 2Q1WA 4IMJB 4R8RA 2AMTA 4KQFA 2PZMA 3CX6A 4JHLA 1X7XB 1YDFA 5CM8B 1FYEA 5JG7A 4YXWD 2AFHE 2H1SA 2XQVA 3HVUA 2ZZMA 1SELA 4EH1A 4UAGA 2E21A 5B1SA 2MOKA 2BJHA 2JIRA 1WU7A 4TTJA 5E3IA 5CH5A 2AE2A 2JBWA 4O4JF 4I5GA 4WK2B 2AI1A 3GQBB 3SHVA 4C81A 2I29A 2W6QA 2GTHA 1PJCA 3M70A 4JLDA 2JHAA 2WWXA 4KQGA 4U02A 4UAUA 2GHRA 5JSKA 5C5IA 3WGJA 2H9AA 2EYUA 3A7EA 3OJXA 1Z39A 2P11A 4J6EA 2F43B 4KIWA 3ANYB 3FPEA 3NWOA 2P79A 4JOBA 1EX6A 3FKQA 3P20A 3W7VA 4YJFB 4WGGA 1BEZA 1C41A 4IQ8A 3KZCA 1EXWA 4C08A 1Q0LA 2JLAA 4YPFA 5AW6A 4M1EA 3ENQA 1ZW6A 1U8AA 2HF2A 1GG9A 4CMKA 5KU7A 2ZUFA 1HX7A 1WZUA 2OB1A 1K7YA 4MK4A 1FUYB 3UJPA 1CUFA 1JAIA 4M60A 4WXHA 3UV7A 3OBWA 3NP7A 1L5HB 2C1XA 2FE4A 2P4UA 1E1CB 1PVDA 2VT3A 2WU0A 4KK4A 1H8HA 4QBGB 5ED4A 3DW1X 2ONKA 2L2QA 1YR9A 3E82A 2NXWA 4PV7A 2YMPA 3HKBB 1YE3A 2D2FA 4HUTA 1SHTX 3UJBA 1K9MH 1ADJA 4YYEA 4KXLA 3WLAA 1N1DA 4PE5B 3K1TA 2PZJA 2BBSA 3E2IA 4IIJA 4IVRA 4RS3A 3TRDA 3IKTA 4YRQA 4TMYA 2DXIA 4JLAA 2O59A 2Q3HA 1M1UA 4RKRA 1P31A 2DHQA 4J91A 4ZXFA 3RT9A 2HN9A 3TLMA 4E12A 5AUPB 3I9FA 5AJUA 3FUXA 4ZWNA 3NNDA 1ZNZA 1GNPA 3UY4A 3UOAB 4D92A 5HY2A 1EINA 3DC7A 1Z4IA 4WBXC 5I7UA 2QWXA 3W1EA 3OW2F 4EI7A 1O5IA 2FPIA 1QH1B 1UDRA 2OB2A 3D8HA 4DLLA 4ZI2A 4G9BA 1XR3A 2WAYA 4CBVA 2XBUA 3QBTA 4L07A 5CNMA 5JANA 1B00A 4GGMX 2EBWA 4QVKA 1N8KA 1NKVA 1ICIA 2BGRA 3UFXB 4MR8A 1WXFA 2JCVA 3LPAA 5COAA 5HOQA 5CXUA 3FFWA 4P33A 3R8CA 1MVOA 4CYMA 4QDZA 3WXMA 4JJ6A 1F60A 4MP8A 5EMLA 1YDEA 1W52X 4JBNA 2YZ7A 4NBNA 4U2EA 5D51S 4EGAA 1A96A 4MV4A 2NNWB 2ZFUA 4NF2A 3NBYC 3M6MD 4ND7A 3S03A 2IITA 4FMBB 3O3OB 4I6EA 4KDRA 1M72A 2HP3A 5DK4A 1N6PA 5THQA 3WRYC 2UZ1B 3LVBA 5KO2A 2O07A 1WAMA 1OW3B 1W35A 2YIMA 1KETA 3CCQF 3DB1A 5ALNA 1P0MA 1ZX1A 3Q2KA 2QDKA 3T7JA 2B8WA 3WNQA 4ZU3A 2P69A 3KB2A 2Z1EA 2F62A 3FFXA 2CCKA 2IP1A 2IXDA 1F38A 1XZCA 1XKXA 1SC3A 3JU3A 4I2VA 4IMIB 4NFHA 4DWWA 3DMPA 4ZQGA 5C18A 1Q8RA 1Q7YH 1G7TA 4P4TA 1D1PA 1ZK3A 4L3VA 4P4NA 1U3GA 1UK7A 4PNZA 1ZOOA 3TVYA 2A4KA 5CB4A 2LCQA 4Z3OA 3TZHA 3N8IA 3EARA 2G1KA 1ZMBA 1FNKA 3C9SA 1RQNA 2FUG1 4N5MA 1UKYA 2EL9A 3IE2A 4TMZA 4UQPA 2Y2VA 2FPMA 4RDCA 3EULA 4QGBA 4RHXA 3E3NA 2A0UA 3P0EA 3NBUA 4G3XA 3SHWA 2PWYA 4HQ6A 2Z6VA 1K2WA 3FI9A 4H35A 4GKAA 3O8LA 3BGIA 1IRXA 4UVGA 3DHYA 3RC1A 1V8FA 3WMXA 4M8NE 5FFNA 1ZJ6A 2R44A 4OHCA 1QP8A 4H0FA 2IIVA 3O1IC 2ILVA 4O33A 5H5JA 5T6MA 5G3ZA 3QELB 5EPEA 4QEDA 4PVDA 4O2RA 4RTMA 1EWVA 1L9KA 4PG7A 5C3UA 2WFAA 2A5LA 1XTVA 2HC9A 4KRXA 1EZZA 3HFRA 5ARDA 5IN5A 2D5BA 4V0LA 2ZRQA 3MQWA 3N8KA 2A5FA 2PUHA 5AM4A 3QOXA 2BFDA 3FJ1A 2ZCJA 1ES9A 2F8SA 4XWOA 2H54A 5AW3A 1A9ZA 2QPLA 2OCYC 4WOCA 3KSUA 1QH0A 3I05A 1V1MA 1OZGA 2C20A 2OBYA 2R4TA 2WT9A 2JD0A 4GUDA 4OBWA 4R0VA 1EG7A 2P5YA 1M1YB 3LUKA 4P4SA 5JMOA 1B74A 1HMPA 1I4WA 3GJSA 1Q16A 1KJQA 1XZKA 4WFKA 2LNDA 3U4QB 2C0QA 4XVUA 2C8LA 1YHQF 4WKGA 3WBFA 5HRCA 4BQFA 4MEAA 4EARA 2HXGA 3CZ9A 1XVUA 3UHFA 1YA8A 1ZIXA 4NENA 2BUCA 1JGTA 1QVGF 3MLBA 3WFJA 4LYFA 1B16A 1C1HA 4PCUA 2XCSB 2FYTA 3SDZA 1MO2A 3ZIAD 1DDGA 4LDJA 3AESA 3ZX4A 3IBGA 4JEUA 2CFTA 5G4KB 1FRQA 4RUKA 3ZIAA 3TGLA 3DG9A 2AT1A 4HFNA 1PGOA 1NZDA 5LXTA 4LNAA 2JHFA 3SVZA 2DLDA 5AIBA 1KMIY 3LUFA 1VCOA 4DTIA 1TRHA 4Q1AA 1BWSA 3P96A 3GJZA 4TMWA 5AOCA 3RV3A 5DYWA 3WZMA 1GGFA 2OAGA 4FDTA 1QVAA 2OZLA 1Z07A 3N8HA 3PPWA 4IG9A 4C87A 1NW4A 3LGSA 4C06A 3ADOA 4AVYA 3H05A 4BE9A 5AVRA 2UKDA 5G40A 4BY9E 2GO7A 2P67A 4YP1A 3UVEA 4BV3A 3OCVA 4AULA 1S3SA 1T2AA 1G5HA 5BVHB 3DZCA 3QPUA 1N2BA 1Z4NA 3GLFA 3HJFA 3I5XA 2VSXA 4XIYA 1EVIA 3GK3A 3NHLA 4D81A 5HZMA 2YZMA 2GFIA 3IAHA 3M33A 2CN1A 1X1SA 1ZD9A 4HH1A 5DLYA 2BEUB 1HFWA 4JMPA 4BZZA 1B93A 1ADBA 3S4YA 4NU6A 1CHNA 1H5QA 2JKZA 3A1FA 2Q7XA 1Y8RB 4OMUA 3DOJA 4DE5A 1E6EA 4MHOA 3M84A 1W59A 3X1KA 4XR9A 4FEEA 1O9BA 1LBSA 2YR0A 1XCLA 3NPMA 5LZ7A 4B3CA 4XEUA 1EGAA 4M9SA 3SZLA 3WRYA 1DBWA 2BKXA 2EJCA 5DTMA 5ITZA 2Q6VA 3ZCVA 1V1RA 4R3UC 1D0SA 4EM6A 2VHUA 4ETIA 2ZJBA 1VQLF 2ZRDA 3QITA 3R76A 3I4LA 2HUNA 4MYRA 5YASA 4ITUA 1K06A 4TXHA 1XALA 3SOPA 5LMNB 4WESB 2P90A 3Q8WA 2X0FA 2C7GA 3A2MA 2WWRA 3WL3A 1U81A 5EG5A 4LZZA 5DNCA 2X1LA 3D5EA 3OCCA 1VE9A 3LQKA 5CBKA 2HDNB 1G60A 2C1ZA 3E8SA 1YDMA 5IJ0A 1GPLA 2JGKA 3HYRA 3NT5A 3PS9A 3QV1A 4Z0HO 3OPYB 1KR2A 3THRA 4F7WA 4NMHA 5HFAA 3CIOA 1XROA 2WFLB 3KKNA 5HGXA 3KV1A 1II9A 1E6MA 2HMAA 4L1KA 1JU4A 1O4WA 4LJSA 4R05A 1CQJB 3DMTC 3LFUA 4MWZA 4DC1A 4TYMA 4J0QA 4HFRA 1QONA 4PC7A 3BTOA 3FYHA 2ZT7A 4P4UA 2HRUA 3SJZA 1RI3A 2FFHA 4I8DA 3TINA 3E8XA 3ZE0B 3ZHSA 4UCFA 4WT7A 5L3RA 5KTPA 2E85A 3WS7A 2J3IA 4GQIA 3S6JA 2VUHB 3I12A 3EBLA 1XQXA 3INRA 4HMQA 4LY3A 3NHRA 2ZYIA 4BGIA 4JQCA 5TJ9A 4GLJA 2IHVA 2M6RA 3CG0A 5BPHA 5JAHA 2F9FA 4P5EA 5EB1B 2WD9A 3WAJA 4J1TC 4IQGA 1AE1A 1M2OB 4ZTZB 3LTNC 3D0OA 1C0PA 3CE9A 2C5LA 2GXQA 2JKYA 1JLMA 2ZWPA 4LZPA 4D74A 3D00A 1AZWA 3TL6A 4UFOA 3LO8A 4X1YB 4GPBA 1OX4A 5F52A 2WI8A 3FWPA 1G20B 1YRQA 1MEJA 2VIIA 4FZRA 1PT5A 4TSKA 5TS2A 4AYTA 3I55F 4G89A 2AN4A 5KSZA 4JBIA 1NF9A 3UBMA 2Q4RA 2Y6UA 5HEKA 1XL0A 5LMCA 2TMDA 4MW1A 3N75A 1Z73A 2GRUA 5CFLA 3GDWA 1DOAA 4LJLA 2EJWA 2GFQA 2OGTA 4IZHA 5KHAA 2MT9A 4LECA 4UUQA 4WY5A 1KTIA 3KTAB 2ZXFA 4BAGA 1NT2A 3GVIA 3C4VA 3I52A 1XAGA 1P4JA 1XLVA 1JI0A 2QRGA 2Z30A 3OESA 1KYXA 3TQOA 3PLAE 2Z5LA 3NPAA 5LIRA 1LD3A 1PEKE 3W6NA 1PR3A 4EYGA 3N2YA 1URPA 4S2EA 2XRZA 1YUMA 1FNDA 1YVDA 4TTAA 3KQVA 4ZO8A 4E5UA 1W36B 4G0OA 4BLPA 4JR1A 4ZZ3A 2REXB 5DWDA 2ZJYA 2PWBA 5DWQA 3W34A 3VC7A 1MC4A 4OKNA 3KFLA 4RA6A 4FXPA 1KRXA 3R0PA 2X58A 1QQ7A 1GTG1 1GG8A 1PX0A 1FS6A 1X1BA 3WLEA 4OLJA 1T6BY 1XTKA 3HCCA 1DUIA 2QW0X 4RENA 1TPZA 1Z4JA 2WE7A 4LI3X 3ZY5A 2HU2A 3Q9UA 4UM9D 5CDFE 4UE2A 1V26A 3BERA 2Q9UA 1A77A 1MJ5A 3E9RA 2DBRA 1LWNA 3RRXA 1PN3A 2NN3C 5C4GB 3RVPA 3SS8A 2ZAMA 3F67A 3J7AC 4ZAXA 4G4XA 1B1AA 1HDEA 1Z0ZA 4HFJA 4QA9A 5AIAA 1NN5A 3EVEA 1WCIA 4ML3A 1Y4UA 3O93A 1RC8A 1DDOA 2QTRA 3IHLA 1PGNA 1E3SA 5EKSA 5IC5A 3Q8KA 4JI2B 4PQFA 1D9XA 2ZTSA 5AI8A 3VGJA 4NY1A 5EAIA 5JQGB 1C9YA 4DQUA 2XXBA 2FMHA 3S2IA 2AOVA 5BQXA 2O8CB 1FFBA 1FA9A 1QCYA 3L7KA 2JFPA 1HNNA 2PRJA 3BWXA 3KU1A 4G9EA 4L4YA 4MV1A 1MVNA 4CQLA 3TKAA 1WQ4A 4DXAA 3X1XA 5GZ3A 2BC9A 3QVTA 1L5RA 2OT3B 2ZSDA 2HRYA 3RRNA 2OCPA 2GYWA 4LGVA 2GTIA 2KE5A 4AU1A 4FNMA 4OQPA 3ZHOA 2CSXA 4L27A 3ZBQA 4W5TA 4YS6A 1SKYB 3AWIA 1OAAA 3D81A 2IWRA 1HR0B 3AHDA 3G0GA 1T25A 1M75A 1LGYA 4MI3A 3RHTA 4CCWA 4O4IA 1M1NB 3FMVA 1JYFA 4CDRA 3P9QA 4ZHSA 5B64A 3UBTA 2CD9A 4M49A 3OCZA 5KJFA 1G9TA 1KO5A 3LZDA 1OPRA 3EFOB 4DY6A 4R7GA 3GCWA 9MHTA 3R3WA 3A04A 4F4IA 3MK31 5IBQA 4JBXA 4JKYA 4K7JA 1NRXA 1P7CA 1DQRA 4UTXA 5DHSA 1OUMA 3H6KA 3COZA 3FMOB 2O8EA 5AUQA 2IBTA 1TYCA 2ZIEA 5A7HA 2AX4A 4WLVA 3I37X 3U9LA 1STOA 3DMTA 4MR9B 1HUQA 1V5FA 1OLOA 1T9GR 1NE2A 2OXTA 3IMGA 3RE1A 5EIHA 3GOQA 1RR6A 5CYPA 3REQB 4B8WA 2KPOA 1YS6A 4OYYA 1VPDA 3TOXA 4B9EA 2I2DA 2ZDHA 3HM2A 4EG6A 4AECA 3FTEA 3UENA 3N0VA 4Z4HA 2R0QC 4I4TB 4JC4A 3UT5B 1ZFNA 4X9XA 2PTHA 5IPFA 2QENA 2HSWA 1JPUA 2GESA 1CY7A 1P19A 4UW9A 5BW6B 5ILOA 2AXPA 5MN5A 1UC9A 5BSMA 2PPLA 3HQ4O 2I7DA 3TD3A 3I61A 1NDHA 4CR7A 4J1TA 4MQLA 3E81A 3CVVA 5BSUA 1T10A 3EH1A 4AZVA 4KJZA 4OTZA 2A8YA 3HCWA 3LMKA 4UDXX 4JJZA 2RGXA 3W04A 1PYGA 4YUYA 3HDHA 4GI3A 1N7HA 4QOHA 2AIFA 4HEQA 3I4CA 1TGYA 4DIEA 1XRQA 4K8OA 4H1HA 3LNCA 2Y27A 5G4VC 3GGOA 1U5BA 1YR7A 2D2XA 1F2TB 2G04A 1M34B 2G9RA 3ND6A 3ODGA 4OHVA 4BDSA 2C5GA 4P7FA 1HXHA 4BX9A 4ZD6A 2R8EA 2JNBA 1DKUA 3ECAA 4Q4JA 5LYYA 1CVLA 4ZC1A 3QVLA 2A0XA 1IXKA 2O2GA 1NF3A 3D5QA 3KR0A 1SVMA 3QNMA 3B6ZA 4ABTA 1EESA 1F0YA 3PDIB 3RIMA 4F3KA 1ZIDA 3CYPB 2HX0A 4WL0A 4H4CA 4HJRA 1WJGA 4TKZA 4CM8B 3VDQA 1TJPB 3ESJA 1IY9A 1Z0SA 3L77A 3QP9A 3A1SA 1QKIA 3C70A 5IMBA 3CRNA 1SB8A 1N1EA 5HFJA 2OGSA 4CCAA 1GAXA 1A97A 3DAPA 5AJZA 4YJHA 3L79A 3GPCA 4TLLB 1ESZA 4D0NA 1JR3E 2BFCB 1T9BA 4ZKEA 4BT4A 3KFXA 1LK7A 3KKEA 3HC7A 1DWOA 3K70D 3EXFA 3W5BA 4MI9A 3T5GA 2O3SA 4WKPA 4BQSA 4DG9A 5JBQA 1DBFA 4D8UA 2ZZKA 1W4BA 4P4LA 2VHCA 4Z9XA 3HXOA 4OMDA 3J81M 3ITEA 1VYUA 2AF4C 2CNDA 2JRLA 3INYA 4LKRA 4R8SA 1WSBA 5FTKA 5FTLA 2H2WA 1X19A 3BCUA 3M9WA 4F3CA 1X9IA 3BH6A 4QFCA 4X0EA 3SFZA 4WBNA 1DKRA 3CG6A 1JEAA 1G41A 421PA 4IZ6A 1UT8A 1U02A 2VXOA 4GNRA 1TCAA 4RBNA 2FE1A 3ZP4A 4HGPA 2CLLB 2CLIB 4ZVMA 3V2HA 1XFAA 5FNVB 5E3JA 5DN6D 1F5SA 3QLEA 3K0FB 3ZK7A 3QOWA 4DG5A 2R1TA 2C83A 2JCBA 4GDFA 4O4LA 4A23A 2MYNA 4ER7A 2QRJA 5BSWA 3CSSA 2GH1A 1JHPA 2Z8YA 3DDZX 1Y9JA 3UJ8A 4BEVA 2X86A 3IR5A 3G1UA 1FF9A 1G6Q1 4J7XA 2DJIA 3QGMA 4JDPA 3NZEA 3E3LA 4I19A 3LF1A 5DYIA 1FQWA 3I8OA 4HN2A 2XUOA 4HEA1 4RNDB 5HE8A 3O92A 2HEIA 2ZTMA 3A32A 1P8JA 2Q1YA 2ZYSA 2B6NA 4BJ6A 3C7AA 1P9OA 2C4UA 2HSJA 1G6OA 2A1UA 4A92A 1XN4A 3R74A 5E2BA 1ID1A 2A78A 2AN3A 2UVPB 2WG1A 3DE0X 1E3MA 4MVJI 2OOKA 4JB0A 4KX3A 2WHXA 7ADHA 5JARA 4ZK7A 1GPYA 3GZTB 2BYTA 5EKXA 1CYEA 3QU4A 2AUNA 1CZLA 3NHMA 1H4TA 1Z37A 1FNCA 5DISB 1NBHA 3NASA 3I92A 4DR7B 1I2CA 1L5NA 5BMVA 5MDHA 4TQ9A 3VVCA 3N2IA 3TRHA 4TV8B 2TRSB 1VL8A 1AZTA 2G3YA 1WDMA 2DGDA 2FSHA 2YXNA 4KNWA 3VYUC 4RZ3A 3UAGA 2YJZA 4BZWA 1EVLA 1MUUA 4IWNA 5B55A 5LN1A 3C3JA 3CLUD 1WXEA 3IHTA 5AJTA 1R5JA 2FETA 1SC6A 2HCFA 2G9UA 2I67A 3FNQA 3LF2A 4MOWA 4JI3B 1Y9AA 1X8LA 1L3CA 1K7SN 4G5QA 2HLDD 4FHCA 4YAJA 3RSCA 1A9PA 3ZS9A 3CPJB 2CVZA 3PHCA 1A3CA 2DQSA 1Q12A 1POXA 4YRLA 3RC9A 3IKEA 2MR6A 3H4IA 5HKBA 3V8QA 5KYUB 4OHYA 4DJDC 4G0YA 4JT2A 4C3UA 1KJZA 3VDXA 4PN3A 3EZ9A 4I2NA 1H5NA 8AT1A 5JZOA 1JX6A 3ULKA 4ACBA 3TJMA 3R9XA 1U6KA 5IBRA 3VHXA 1TMYA 2O06A 2R5WA 1JQEA 2DFDA 4WCVA 4JWTA 4EYQA 1RYFA 5JQGF 1MLDA 2HAEA 2FJPA 4YLGA 5EZ5A 4LJRA 1N0UA 4F5WA 2NU9A 2WWGA 3I62A 5EWMB 4DWOA 4JXXA 4EJFA 2FAXA 1I4DD 1RPTA 5A4MS 3AXTA 3K92A 1K6XA 3D6NB 3FPCA 4IDPA 4D0SA 2Y6VA 3H2HA 1AV7A 2GPYA 3ANMA 3LY7A 4JZKA 4LG1A 2NUTA 1N6IA 1T2NA 4BEWA 5M2QA 3UWPA 1RXWA 4X94A 2B9VA 2K7ZA 2ECPA 4BT7A 4JUAA 3THXB 4JLSA 3VZCA 2G4LA 1D7AA 4AG6A 5DTQA 4DWVA 1I0LA 4WK0B 5LR6A 5JJIA 2OKGA 1LI7A 1Q3HA 2D1SA 1W0CA 4BVQA 4OBEA 4DEXA 621PA 5FOUA 1W1UA 4GP9A 4L9AA 5BWCA 1NA5A 1ZRNA 3GN1A 5FBVB 1TC2A 4GNKA 3AVVA 3L7BA 1U7WA 4R3WA 3CRVA 2FRDC 5IVKA 4AN0A 2XJ9A 3WGYA 1A5BB 3LQ1A 1E3TA 1X8JA 1NX9A 1I5OA 3MTDA 1UFYA 1E9AA 3D4LA 3WLHA 1XPOA 1Q2UA 1KZ1A 2J6IA 1GTL1 2IUFA 4NZ9A 2IUUA 4LYDA 2OAQ1 3K8ZA 4H7JA 4HDKB 3C1UA 2WRZA 3IP5A 1YULA 4FDLA 4RTKA 2F8TA 4YCLA 3HJNA 1F0KA 1UKAA 2LCIA 4NCHA 1JDBC 1PV4A 3UWMA 3D6VA 1P4HA 2OGZA 1GNVA 1A8PA 2AQIA 1DUSA 3U49A 4ZCQA 3VU1A 2P3OA 4OSEA 3M3DA 3T3MB 3ZBTA 5TMDA 1RWQA 1RWBA 3DD1A 3GZNA 2LZ0A 3NUGA 4G6ZA 4I4TF 5AK5A 1PZNA 3ANSA 2AG5A 3WGNA 5EIWA 1IVNA 1RI4A 1WXWA 3P9XA 2HBQA 1EB9A 1PS8A 4HXEB 2DPYA 3M4ZA 4RKEA 1XF1A 2W8BB 2JJYA 2CXXA 4WACA 1FK8A 1DKLA 2OKCA 5AICA 1R6BX 2CXSA 1QZTA 3HVJA 1QV7A 2BR3A 2O0JA 3O9MA 4NWOB 3DHNA 5CAEA 2E37A 3EW7A 1PWEA 1YRAA 2E18A 5JZBA 4R1TA 3OLCX 3B2QA 5D84A 4F93B 1SG9A 3GUUA 1A72A 1ZVMA 2VPYA 2JVIA 2DWUA 2FP4B 1LLFA 3EC7A 1WKVA 5TB5A 3W6OA 1HBJA 3RKSA 2QHXA 5ALOA 1IPEA 3ILVA 5B1HA 3VU0A 4F86A 1Z3CA 1ZH2A 2G8NA 1VLVA 3GRVA 3VPCA 5H16A 3RSOA 4CMBA 5F5NA 1UJNA 1S2LA 2L0XA 4N0EA 4AK9A 2A3NA 2C42A 4JBHA 1OFGA 6REQA 4IJQA 1OREA 5DOZA 3ZH9B 1LNSA 1GUZA 2WM2A 2J07A 2RB4A 2BMWA 2II6A 1E5TA 2NTJA 3A25A 3B6JA 4IXDA 3U0VA 2VTVA 1E60A 2GEUA 3UZUA 1CZUA 3NV7A 1U8UA 4M76B 2K4MA 5FORA 1L7OA 1XLUA 2PN1A 3QOFA 4IDNA 4QXMA 4M1MA 5FA5A 3C6QA 3L8CA 3ORHA 2IE8A 4MGYR 1SKAA 4LISA 2DKFA 4KC0A 2I7VA 3N58A 4KACA 1XJCA 4HAIA 1S01A 1GTVA 1PL7A 2XW6A 3PHGA 3NATA 4Q0MA 2I91A 4COOA 1DCFA 2QORA 3H17A 3I45A 4C1BA 1BXRA 1EUDA 3PCRB 1C7QA 1HQDA 3K9NA 1LK0A 2AFHA 4DRXA 4NNOA 2YMMA 1KMMA 4J0KA 1XTIA 4UEJA 2NYRA 4GPIB 1RAGA 4J9UE 1WV0A 3ZJVA 3NHFA 1MH1A 4IRXA 3J80A 2YJNA 2MU1A 3JQRA 4I5DA 4IMRA 1J39A 3TRKA 3JYQA 2C78A 1UDAA 3QFHA 3ZWKA 1TZMA 3R7LA 5BV0A 4MVXA 3ELBA 1T1RA 3SY8A 4IEFB 4ZQEA 4AMGA 1I3NA 4XUCA 3P4EA 1GCGA 3C8LA 3KR1A 1MDBA 4FOLA 4J9VA 2X9NA 4NJEB 1GTZA 4JUIA 1GY8A 2WICA 3A14A 3AXSA 4HXFB 4ISBA 2AKAB 5DM1A 4ZANA 1JQBA 1Z82A 4V0SA 3SQNA 2D0DA 2C8KA 2OOSA 3ZWOA 4RFSA 3WK9A 5FNVF 3VJMA 1LLCA 4PC2A 4BO7A 2H57A 1PZFA 1FBNA 2QTZA 5FEMA 1RHJA 4N47A 1LPOA 1RS0A 1UOPA 5HP4A 3QPCA 4FR5A 1C8LA 5CIQA 5IJAA 4IMPA 2Z6QA 4BIMA 2RD2A 5IAOA 3ELCA 2ZE5A 4NE9A 1M83A 4Y6GB 5CM9C 4LE0A 3TB4A 2AN5A 4N4AA 1SIOA 1L5GB 4H31A 2BW0A 2DE0X 2C1EA 3Q1LA 2P4SA 1JPNA 3BIFA 2FRDA 3PQEA 4QTUB 2HWYA 4MR8B 4Z3DA 5K0FA 4BGVA 4HWGA 4UM5A 2WV9A 1JSXA 1MR3F 1NXVA 4K1XA 4UU0A 5SICE 2YXZA 3NBFA 2IF2A 3EVAA 3NDIA 3QHPA 3GGDA 1UM9A 4JP1A 5F3RA 4PFKA 4BNIA 2XMZA 1YRLA 4N12A 4NX2A 1N4AA 3WGIA 3ICQB 3IPAA 4MP6A 4D3XA 4KWTA 4Y2JA 3QVKA 3LY5A 3H97A 2PLAA 4ZOLF 5KINB 3MXOA 4ARUA 1TLFA 2GCGA 2POCA 1RQ2A 1JAYA 1OF1A 3PNYA 1U7TA 3MAGA 5HDBB 3FWYA 3ZHVA 5LC1A 3BD7A 3H7IA 5KVQA 3TE7A 1KP9A 1ZL0A 5EN4A 4EG3A 3KQMA 4GP7A 3WB0A 2J30A 3CCRF 3LL4A 1LBTA 1CUBA 3FJOA 3L4BC 1X0XA 3PVSA 1O6CA 2JAQA 2PWAA 3KELA 5DO9A 1EFAA 3CRMA 2UUBB 1QAQA 4L8WB 3W9SA 3B3AA 1WU8A 3AF5A 2O0LA 2WU8A 5A7FA 2XBLA 3EY9A 3N2LA 2JDID 5FYQA 5E4TA 3Q15C 2OD2A 2HJRA 2YV1A 2YIVX 1DWPA 4N01A 4DBVO 1YJCA 5BNFA 1L7XA 3HL4A 4GC9A 2B9EA 2CMDA 2PH1A 5AKJA 2DOKA 3OZFA 4YHHB 1E0DA 2AVDA 1GTJ1 3LQQA 2GR9A 3L05A 4HWTA 4PLZA 4CM6A 3A1TA 3DLBA 3FMFA 3PPXA 3OJ0A 5EHZA 2QPTA 4JT8A 1REQA 1UXJA 5HY1A 3ELWA 4N03A 4Q12A 5BXQC 3ABRB 1PQUA 2FZ5A 2QMHA 1RAEA 1DQZA 5C7IO 4XEHA 2YZ2A 2R6CA 4UOZA 1J23A 1GCIA 1TUGA 3B48A 1DRKA 2EBUA 3ELDA 3R7NA 3RSGA 3ZBPA 1IOWA 3F46A 3JQPA 3TTXA 2IX3A 2Q5FA 1SQ6A 3CX8A 3OEED 1NAIA 1VIMA 3EJ6A 2ZUEA 5FUQA 3ZNNA 3GBVA 3SX4A 4ZDKA 2IXEA 4KIFA 5AVWA 1TJYA 1JVNA 4TUYA 1RJGA 2JA1A 1PEAA 4A0QA 3DPSA 4G4JA 4GVXA 3TM4A 2OBXA 1A2OA 2GVIA 1AXRA 1USKA 1AKYA 2NSJA 1GQFA 3KK0A 4HUQA 1CP2A 4MUJA 1JHUA 1J8DA 4P4SB 4ZV4A 2OSBA 3IOBA 4IVPA 3GC6A 5E9QA 1KGDA 1ZWLA 4PWZA 1Z47A 3LDGA 4BYMA 1RKQA 5C37A 3PGJA 4UKDA 2PHNA 2JKVA 2X1MA 4QC2A 3IYLW 2IYEA 1JBEA 1KK2A 1RE1A 4NENB 2O2DA 4UZEA 3W5IA 4CODB 3T1HB 1KC3A 4UTZA 1G1AA 3RVNA 4ES6A 2EATA 1SXIA 5AM5A 3WWEA 3I1JA 1IN7A 2GF2A 2J33A 5IBPA 3VMMA 4NNJA 3FTDA 2RAPA 5TMEA 1OTYA 2P8JA 1K8RA 3BDVA 3Q3EA 1XWIA 4PZZA 5CHYA 4EJMA 1A2BA 3DR5A 3MWDA 4QBIA 4BZQA 2HZBA 3A6DA 3I6MA 3OMWA 5CB0A 3JCZA 1VIAA 1QMPA 2NADA 3RVKA 4B4UA 5LXTB 1TL7C 4GZ6A 4MVCA 4CV0A 4HH0A 2PHZA 5D87A 2OUKA 4L8GA 2C3UA 5CNJA 1TMGE 2VXYA 4WKCA 3VH4A 7MDHA 5I47A 3T3NA 1GADO 3D7NA 4DMKA 1OGIA 4RIGA 3E05A 3UGQA 5JYCA 4LMBA 5DCYA 2OZLB 4KI7A 5JD4A 1NP6A 1ZBQA 1DX9A 3CGWA 3HZOA 3OAAA 3Q7EA 5FNZA 3ZHQA 1N2ZA 4YMUA 2UZIR 4WE3A 2OHHA 2W4IA 3MTGA 3WZ2A 4CQMD 3BJEA 1NWHA 1I3LA 3GT7A 4NCKA 5HNKA 5IUJC 2ZTVA 3UXEA 1NN0A 4HDQB 5CYOA 4CQMA 2V7VA 5JAPA 3GEPA 1IK6A 1QDLB 3PL1A 3GLFB 1E4OA 2XRMA 1I4OA 4QUDA 3R7BA 1A98A 1F2DA 4KQ9A 5DM70 3JCMM 3F6SA 3EGWA 4C89A 5T41A 4K1LA 4A2WA 3PC6A 3PLAC 1E1RA 3GTZA 2WMNB 4EDHA 2OECA 4BRSA 1N2IA 4BVTA 4ONEA 3HA3A 1S3IA 2PWPA 2VJLA 2IYUA 2ID8A 1EFVA 1SEVA 1E59A 2A1IA 5BRJA 1EE9A 1GZUA 1RRVA 1VQ9F 5EESA 4DA7A 5M29A 1W581 2XODA 1PT8A 3EK2A 3M3PA 4XWKA 3UMFA 2EVWX 4IUDS 4RHYA 5K0BA 2BUBA 4BY9D 3C3KA 3KIZA 2H18A 3K2XA 1EK6A 3KP1A 3MMNA 5T67A 2IOFK 4BO1A 4DADA 1DC8A 1F48A 1E2JA 1V2HE 2ZKIA 3ABQB 1KDZA 3DEFA 5EIOA 1N6KA 1R5OA 1V1RB 1E20A 3FBGA 1NN1A 1I94B 3B51X 3FRJA 1YL5A 3HSYA 3JY6A 1M8KA 5T4HA 1OWLA 2Z95A 4AO7A 4EKDA 2JLYA 3X1JA 4JI5B 2RGGA 3K5WA 5F7XA 1D2MA 3L0SA 3IALA 2OK8A 2QXUA 2YINC 1UIRA 3L6CA 3G9UA 2WYOA 3NFYA 2CHUA 1T3LA 1Y3BE 1HDYA 2N0SA 3GRYA 3L4BA 4MR7A 4N7JA 3RREA 1HZZC 3Q7SA 2FSFA 3IX7A 2P6RA 1TO6A 4PZLA 4BWVA 1CDDA 4H6VA 1W0JD 3BHIA 4QODA 3O2JA 5IJ0B 3IFSA 3B5EA 3VKGA 1Z6QA 3BX1A 3WQBA 1XJQA 2QROA 3UH0A 2GWRA 2P9JA 3QX8A 3L04A 1KDTA 4EL0A 4F4FA 4EF6A 2IWHA 3QUTA 1JWBB 3WAGA 3E9CA 1LFDB 3PD0A 2GS9A 3ESCA 2DFTA 4HXYA 5AI6A 4B79A 4CLHA 1NW8A 1F06A 1PBNA 4JA0A 5CB8A 5JMPA 4IH9A 4KOEC 1J2RA 3ZJ4A 3PP8A 2ISSD 2AOUA 5I3CA 4ICIA 3SBOA 3HY3A 4IIJF 5TPZD 2VRBA 1II0A 3D3NA 1J7JA 1U9IC 2WD7A 4U2BA 1U90A 3EG9A 5LYJA 2LDBA 5GOZA 2V5VA 1JPVA 1CUXA 2IHNA 5TPZA 2FEAA 5C53B 2D54A 3Q2OA 1H48A 3IULA 1YJXA 4PBSA 3FGZA 3IDZA 4RGBA 4EA7A 1KQOA 2V0NA 1YKFA 3JQDA 1OY1A 1EX1A 1KYYA 2G67A 1CQPA 1FRFS 2J9FA 1P2TA 1UT6A 5F5LA 1PTKA 5ELXA 4OMCA 5REQA 3FG9A 1C9EA 4JKOA 5A2QM 3OJFA 1Q91A 4MDFA 1M7GA 1A1VA 1ZEJA 1E2LA 1I4EB 1KVSA 1OX4B 3SFVA 1KVTA 4ND6A 4B31A 2CEAA 3NLLA 1EI9A 1T8TA 2Q49A 3OEHD 3OF3A 3PWTA 3V6MA 2J9GA 2PMBA 2V0CA 3D0RA 3OEHA 1D04A 2VA9A 5HA5A 3WIBA 4EHKA 3KUDA 5A5GA 3IQFA 4URHA 4YONB 3KPJA 2YS6A 2IKSA 1BD4A 5EUMA 2DYKA 3R3ZA 1IPAA 1B3BA 3PWKA 4LEIA 1BGVA 1FLDA 1KHHA 3D6HA 3EDYA 3KQLA 1HE8B 1E2BA 1IDN1 1YIAA 2Q21A 3JWPA 4KBYA 4RIFA 1RWNA 2JJMA 3DDNA 1H2EA 2WZBA 3H5IA 3KLMX 3H7AA 4ZOAA 3RFUA 2B7LA 2PJRA 2DETA 3L1JA 2G5CA 1UK6A 1XZQA 3PB3A 5CB4F 2MSEB 4G5OA 4MQ5A 4RA6B 3NIWA 2V54A 4B0PA 4RO0A 3UV3A 4EAAA 3UK6A 3ZD6A 1AVTA 4CM4A 2XNHA 3WQRA 5TLSA 5JH7A 3WQSB 2K87A 1JDPA 5A6VA 5ETJA 2QA4F 1OIVA 3V8BA 5A4JA 4TSFA 1MQ8B 2HADA 1R74A 2YJ5A 3U4GA 2VRCA 2K2QB 4G26A 5C9ZA 2R6ZA 4FSXA 4UM9B 2XGGA 4IXNA 4F8EA 1C3JA 2BCGY 3OQJA 3E9QA 4D8WA 1U1IA 1WCIB 13PKA 1FTWA 1OX5A 3R40A 5TGTA 2FZWA 1ZH8A 1Z68A 3BMNA 4W7SA 1MO4A 4O63O 1ACMA 4OO3A 3F5SA 3QKTA 4I66A 4JZYA 4URFA 1X7ZA 4S04A 1MU0A 1QGZA 1NT4A 1JKJA 3CHYA 3BK1A 1E8MA 3QVMA 4M8KA 4AJNA 3K4PA 2UYGA 1NXTA 3BRCA 4CQLB 4W9NC 2C9CA 3QTTA 3ILYA 3RRJA 1Z88A 3PDUA 3BD8A 5JNSA 5FHRA 2WUFA 2O7SA 2R87A 1ELOA 3W79A 4C01A 3ZE2B 3ZK9A 4TT3D 2ROQA 4QDKA 1M2VA 3TNFA 4YAGA 4YAUA 3EAGA 4QQNA 4D56A 4O4IB 1U4NA 3CKKA 1N2JA 4EW2A 3CZ4A 1HZZA 5EUCA 1YA4A 1P1FA 1SQFA 4X71A 2FMXA 3WJRA 4B4VA 3TFWA 4CTOA 1CHDA 2ZIGA 2FV8A 1J8QA 1MV5A 3AUJB 3NM6B 3PDCA 3BGSA 1H2AS 3NAZA 3QLJA 3W5DA 3ADDA 4LDPA 1M54A 1EFCA 1Y9ZA 3ND8A 5BN4A 4QDTA 2DPMA 1ZVVA 1DKPA 4FW8A 4PZ9A 3DZ8A 5GJVC 4DFDA 2O8EB 2UYJA 1OJ7A 3FOCA 2O2HA 2VP4A 3KQYA 1F7UA 1K5PA 1R6UA 4Q48A 5DNEA 5LXTF 1M8JA 3M1IA 3VTZA 4LF8B 3PC2A 3WNCA 1XTUA 1SUEA 3FVRA 1Z5OA 3VIUA 1NJ8A 1FFEA 2J5QA 1LTHR 1U40A 2GN0A 3OA0A 1YIDA 5DBEX 4G0VA 2W6MA 1DCKA 4G8DA 3ETCA 2OHXA 1NSTA 3FR7A 3LQYA 3S1AB 4BV8A 3KT8A 2B1GA 3QUWA 2PQ2A 4V38A 2V9CA 1B26A 1KKLA 2QVZX 1U9IA 3G2MA 4QL3A 2VDRB 3C3EA 2DPLA 3TRJA 4F60A 1YRYE 1YNOA 4QTXA 2NU7A 4GQAA 5LBUA 1AQUA 3RUCA 2GLTA 1L4GA 2FJUA 2WLTA 3ON1A 3L0PA 4I14A 3I2JA 2X22A 1H3NA 5JLAA 4K9LA 2GB4A 3P27A 4A8HA 1THMA 1KXJA 2Y1OA 4OQMA 1PK8A 4M9CA 1GPH1 1JQ3A 3ZOPA 3EDCA 1SKBA 2BMFA 3H4VA 1CRWG 2Y1CA 4QUHA 4H1VA 1W1IA 1VQOF 3A4TA 5A9TA 3U4HA 3HK2A 1E6UA 1XO1A 4WIAA 3WFIA 1OLXA 1V71A 4QNNA 1S8OA 1U8ZA 2R6JA 1L6IA 2HHAA 3KWLA 5ALWA 4C0QC 1ECJA 4ZI7A 3WRVA 4FZJA 1ZG3A 4EF4A 2NIPA 5JO0A 5A9SA 3D0KA 3EEOA 2H51A 4L76A 1JZSA 2GZAA 1U5BB 3H2SA 3OWOA 4MLCA 3DBHB 1ZA2A 4YP9A 2JCYA 1J1UA 3Q3GE 2VP9A 5JNTA 4INOA 3X2SA 1L7QA 2QMUA 1Y7TA 3GFBA 3II6X 2G0AA 4RVGA 3A7DA 1WKCA 2JIOA 3F1LA 4EGJA 5M34A 3IJRA 4QJIA 1TKRA 4Q4JB 3CH5A 1T4GA 2ZBQA 5DGDA 3UHAA 4Q7JB 3ZWXA 4IDAA 3PNVA 1XTBA 1ULZA 4PAWA 4D0RA 1X1TA 3B1JA 2ZI9A 4Y2TA 2Q6IA 4TKUA 4HQKA 3S2ZA 3NGXA 4HH3C 3ROXA 3CVWA 2VKQA 4GXNA 1KYIA 3NR2A 4DUYB 1FUIA 1ZDMA 4F71A 4DV5B 3B1VA 2XCTB 2WDPA 4L22A 2IUEA 1W57A 1OQAA 5BRNA 4MB6A 2C9DA 4KLAA 1H3EA 1Y6QA 2X42A 1L4HA 3SYNA 2ODAA 3I4FA 4XWTA 4CZ2A 2B2NA 2YY6A 4ZA2A 5HKKD 4YJHB 1PL6A 1YQ9A 4MWSA 4DR1B 2REBA 3OX1A 3TLZA 3NBMA 5FXMA 3NK7A 2FOXA 5HKKA 1QP0A 5TRTA 1TJ3A 2D1FA 3JRNA 4Q7KA 3RF6A 3EXFB 3KBBA 1ZM7A 2C8JA 4J2HA 4ON9A 5IEBA 3VAZA 1ZUD1 5LLTA 3HMKA 4H0NA 4FT2A 4OHBA 1KPHA 1MT0A 1K97A 1GHTA 3QXGA 4IHJB 4O4HA 2JD1A 1QV9A 1AN0A 2O5VA 3N59A 1T0BA 5DSXA 2WJIA 2CC2A 1XQYA 3AU9A 3PXBA 4W9NA 3L7CA 4B7ZA 2B3TA 1KSGA 3T3OA 4X3CA 1CR1A 1JR3D 4PW0A 5AVVA 1JDNA 1VB3A 2JK1A 1U6JA 3AZPA 5E1BA 3MJSA 2VYQA 1JR3A 1APBA 3UMMA 1UWVA 1IQ0A 2BCJQ 2IZ5A 5CM2Z 4OM7A 3QE3A 2J9ZB 3TFQA 3GD5A 4E6PA 4O4LB 3DCYA 3NEJA 3PGA1 1VQ8F 1EP9A 1RQLA 1ZD5A 2MYUA 2L17A 2PS0A 4Q18A 4QDJA 2AL7A 2JB9A 1GZ7A 3SIPA 3WYCA 5B6JA 4O8ZA 2RE8A 1NVAA 4L8YA 5EXPA 3IQXA 1GDHA 1XBIA 3OPNA 4M0UA 4QOFA 1Q74A 1VTKA 4QJ3A 1KZHA 4FONA 4CEHA 2KWIA 1IVYA 2RH8A 3TTUA 3LWBA 2WAOA 3OJEA 4LVOA 4PRYA 2FFQA 1XNHA 1N34B 4GEGA 2IEDA 2NZ8A 3KEQA 2CY0A 3KKQA 1YL6A 3MJFA 1ZCFA 2SKEA 3FYUC 1RYZA 2A1UB 3TYXA 2XSZD 3F0TA 2NXCA 3GHHA 1NUAA 4M1YA 1OCEA 3F4KA 4L50A 4L8LA 3DTYA 3L7IA 4YCSA 3CCJF 2QT9A 2IPLA 3BEOA 3G0OA 4FFDA 5AKGA 5JZSA 3KETA 2PG3A 1JG2A 4LVNA 5BSVA 1S6YA 3UW3A 2GFHA 1VQ7F 5LQUA 4BP3A 4V0RA 1JY8A 4D8VA 5BW5A 2FGJA 4NU0A 2PKQP 1KSHA 3FWHA 1BJKA 1LXCA 1Z7EA 1YITF 4FCTA 4WGFA 3RSQA 3WK4A 3PJRA 1AQYA 3F6RA 4PC1A 1MVLA 3RUPA 4D1YA 3FPIA 1EFRA 2Q6TA 4R41A 4YUVA 3QG5A 1NY6A 2CBXA 5FBWB 1SCAA 3KQUA 2XT9A 3EE6A 4ZVSA 3L46A 1FDWA 5F9MA 3L4EA 4KNYA 1Q1ZA 1R8JA 1K6IA 1D2CA 4FK8A 3RUEA 5CLFA 4DV0B 1AK1A 2QT1A 4Z2AA 5IFLA 5IKPA 1I2ZA 4KFSA 4QRDA 1NYTA 2AK3A 4WJKB 2QVLA 3CC2F 1A27A 1II8A 5LA6A 1TQ4A 5SZHB 2DAPA 5KMGA 1CUSA 2PX2A 3ZZNA 3KU4A 4C0BA 4ZODA 2C92A 5KZMB 1Y3FE 3VHXB 2P41A 5G41A 5DBFA 1AURA 3WK7A 4BYGA 4LFAB 2BFWA 5CGZA 1OFUA 4AT1A 1ORRA 4DV4B 3Q9SA 5LQMA 3H18A 4LK2A 3PENA 2Y71A 2VO1A 3AHFA 2P9FA 5LVAA 3BHJA 1XMVA 2R2GA 2H4ZA 2NUTB 1K8AH 3URKA 3T8YA 4YO8A 3WV5A 1WBJB 2JLXA 1VL1A 3R24A 2I4TA 4F6RA 2YDXA 4DLYA 2C5HA 4KFCA 4EKIA 5FUVA 1NW7A 1WPQA 3STVA 3DDOA 3AB8A 1NATA 1O0SA 4OQQA 3GHYA 2JFVA 4O4IF 1RW4A 3SC6A 4KSCA 3QPWA 1ZIOA 4BO5A 4D3DA 3E8MA 3HO6A 3PE6A 5AW4A 3CNLA 4E2XA 3PXEA 2IY9A 4JYBA 5E1DA 4BBZA 1TVMA 1U7PA 2ZI6A 1VOTA 1GL9B 2WIGA 1LH0A 3LYUA 5T5QA 1CX9B 5BURA 1P44A 3AUSA 3H4MA 4XX1A 3HJTA 1PYOA 5JPIA 3NVKI 2X15A 3R5JA 4BAUA 1EQUA 1O5OA 3DZBA 2ZAGA 4D4KA 1KQPA 2XNJA 3LVRE 3SN6A 4H6PA 2NMVA 2C59A 3N53A 2ATVA 1H2WA 1W4ZA 1WCYA 4IGFA 3OHMA 1YMQA 4R81A 4P81A 2KG4A 2GM4A 4X85A 3CXUA 1G9SA 4KH0A 2VDQB 4R4JA 2ZWAA 5L4SA 5CB6A 4KVZA 3ZCXA 5CBPA 4GIBA 3NAQA 4EJ2A 4QOIA 2I6FA 3GBPA 4YRKA 1MTZA 1QBGA 1JMYA 1QFZA 2HY7A 3AJ8A 5HUHA 3W05A 4G5GA 3GZNB 3EC2A 3HJRA 3MYYA 1NW5A 5IF3A 1X52A 1QYXA 2CVFA 3CXCF 2GERA 2GPSA 2TSYB 4M0CA 4TTSA 5CJ2A 5ECYA 4ZVPA 1AT1A 4XOUA 4F8JA 4YJKA 5IXSA 3D6AA 1HEYA 1W85A 4HXGA 1U99A 3KPYA 2QIOA 3QWBA 2YQ5A 1GUBA 1IQRA 2VTBA 3A28A 1CUDA 1W4CA 1RTKA 2H5EA 2PX5A 3IOMA 3LBHA 1JFSA 2BHNA 2V3CC 3ZC3A 1ZAKA 4ZICA 2RB9A 2Z4TA 3CW9A 5CAEB 1IN1A 3RFXA 3P7MA 4TMKA 1KK0A 3NK6A 2QVXX 2GJ9A 3Q88A 5K03A 1N5DA 2AMFA 2XRYA 2ZUVA 3KQHA 2R85A 4LJ9A 4RJLA 4FYMA 1Z75A 1Z0IA 1ODLA 2EFGA 1IXZA 3FYUA 3NO4A 2V0GA 5A9RA 1W2GA 4EY4A 2RKOA 2XYPA 1G18A 3EPLA 5CH8A 1R5BA 1SU4A 4BLOA 1D2RA 6REQB 4M55A 5JU6A 2Y4NA 3U48A 4LF9B 1EFLA 2ORYA 1ODCA 3E48A 3W0LB 3PYMA 2QJOA 2BRUC 3RTAA 5ECWA 5FL3A 1MB9A 3GH3A 3H1AA 4F06A 3VYUB 5BNWA 1XOIA 4KU4A 1X7PA 3FUCA 3KAPA 4JC0A 2IPAB 2HW8A 3ETJA 3CG4A 1YR2A 1X77A 2PRSA 1TYEB 3KE1A 1RQGA 3KPWA 1IN8A 1NMYA 5KX5A 1ZGJA 2G63A 3MHPA 3MJTA 3PFKA 5G0TA 1TKAA 2PM8A 2HRDA 5TS3A 2IVFA 3LYLA 3T1OA 1J0XO 1KO7A 2JGFA 1BXRB 1EUDB 5SZIA 3A9RA 1TECE 1XHOA 4DRXB 2AFHB 4QGGA 3NHWA 1PSDA 1JJVA 4QYTA 1X94A 2GPNA 2Q1SA 2OVBA 2R79A 4ZO6A 3WLOA 3N2NA 2WHEA 2OHGA 4ARBA 1AUVA 3FZEA 3ZCUA 4ALNA 3ZH2A 4B85A 3PGMA 3QYJA 4IHJF 4BFCA 3TPCA 1RWVA 3V7UA 1JD1A 3VHLB 1BVYF 3BIJA 2ZSEA 3CLRC 5DZSA 2VWQA 4WBNF 1HK7A 2OV6A 4LZAA 4OGLA 1TIKA 1VJGA 3RVQA 4CLXA 3M5PA 1HO3A 1NMZA 3I34X 3LHKA 4S1OA 3GAAA 5ITWA 2XBMA 3ER9A 3OKAA 3D6TB 2YX1A 4N5HX 2IS6A 3C5EA 2PLFA 1N7GA 1O94D 2C4MA 1FDSA 2IYOA 2ZSKA 2V7QD 4FMCB 5FD8A 3ST7A 3T41A 2PL3A 4O4LF 4ZPXA 2B2XA 4AUNA 4BVAA 3H1EA 2NW6A 1I0ZA 5JNLA 2NU6A 2VZEA 3LXRA 3JQCA 4RA9A 3DLCA 4EHDA 4ZGGA 5HKAA 1XQWA 3WZLA 2B3DA 1TW3A 4D79A 1IBKB 4I7EA 2VNHA 4FFWA 4MKRA 5KYKA 1DKNA 1XMPA 4QQ8A 2X1VA 1KAHA 1PKXA 1ULHA 4ESVA 2RK3A 2VF7A 1F14A 3EA5A 5KAPA 4E21A 1UM9B 1OBCA 2GBPA 2Z4RA 1K6MA 2CHVA 3NM4A 4UUPA 1PAUA 2QMZA 2D06A 4Q9JA 1KEEA 5DTIA 1L8AA 2F2TA 1LPBB 3DL0A 1RM3A 2GTPA 3ZGZA 1CQXA 2FEPA 5DM4A 5KOHA 5IT9A 3C7CB 3GGJA 1JDBB 4Y6OA 4XM1A 4DNFA 1R2QA 1AO3A 1LNZA 1XNGA 4OOFA 3TNYA 3Q87B 4QPJC 5F33A 3NYIA 1A04A 5KOJA 3SVTA 1U2PA 3AGKA 5FBKA 1DINA 3IIJA 3R6DA 3RRMA 4Q3BA 2CXTA 3QLTA 3G7UA 3O8DA 5AK4A 4H6WA 2PSDA 2NP6A 3RTEA 2C99A 4RNCA 1EJ6A 1M7BA 2VJMA 1H6CA 4PSVA 1IHDA 2F3SA 2VHTA 3AF3A 4R5HA 1U2RA 2QN8A 1V2GA 2FEMA 2WVHA 3IQWA 3OFSA 3VDMA 5GAPK 3QA3E 3QUQA 5LMZA 4ZHWA 2AZMA 3RIHA 1VECA 4IIVA 3AZQA 3C1TA 2YFYA 3IAS6 4B3XA 1BG6A 1BWRA 4DR5B 1WQ3A 2X2PA 1REQB 3WYEA 4F4UA 1EJ0A 4ZVNA 3RIEA 1NHWA 3ONEA 4ZJZA 1JEEA 2CMHA 4C4RA 5HJEA 1P0FA 5K51A 2GUWA 3K6SB 1NRJB 4JLJA 1EDEA 2A4MA 4UASA 1XMOB 3UAZA 4K6KA 4KFUA 2AC2A 4PWTA 2XUHA 3CTPA 3H04A 3F6CA 1EDBA 3OQMA 3A27A 1T4BA 4NU5A 4U5XA 4IFBA 4P3YA 2FSGA 3BHNA 1Q11A 3C3BA 3EQ2A 2YVLA 3O8QA 2P6PA 2VN8A 5EWLA 1YQUA 3DZFA 1GUFA 1TA9A 1ZLXA 2IHJA 3MRSA 3SHQA 3BL6A 3G82C 1SCNE 2BRUA 2P2CA 3K12A 1AZLA 1L5YA 2NV0A 4IJKA 4HUQB 4W5NA 1N8NA 1DVRA 1RYHA 3E15A 4MW4A 5CGQB 3KB1A 2UZ4A 1DAKA 3B6KA 1IIBA 2X14A 4Y18A 5CTJA 4AL4A 4ZT2A 2ENUA 1XHLA 2GF0A 3AOGA 1NFFA 2D3TA 4IIEA 1IEQA 2PSSA 2FWIA 3CCSF 1WD5A 3GUVA 1GRNA 4QOJA 4AF8A 4UTPA 4RCZA 5HK9A 1PJQA 3OTOB 3FD6A 1UPTA 2GAJA 1TK2A 4S2UA 5HBGA 2MHCA 4C1NA 4TS4A 3WTBA 5E6RA 2IZZA 3I3SR 5HF9A 2A30A 1O6FA 2EP5A 2PRZA 2ERXA 4YMLA 3D8RA 1EXNA 3OHSX 1WM1A 3T3IA 3AFMA 3PRHA 4HN9A 4BX0A 3CVXA 3WLMA 1OFUX 3G1TA 3IVAA 4F3RA 3EORA 1ISRA 2JAOA 1NNI1 3G8BA 3MWDB 3NOXA 4UXJA 4R9SA 4JEHA 2VHEA 4JS0A 3W3AH 2A0YA 1SJ9A 1YA6A 2PU7A 3VU3A 1YK1A 1IE3A 3NIFB 3D3WA 4HBGA 1G8SA 4PSDA 4URXR 1DC4A 3UTCA 4EHJA 4DEYA 2F55A 4R1NA 2J5XA 3HY6A 2CK3D 4IJ5A 4OF4A 3TVTA 3U3JA 4RV5A 1WNFA 5MHTA 3L3BA 3R8XA 2EFYA 3SS9X 5EB0A 1OGJA 3AC0A 1RQRA 2QYSA 2ZDGA 4ND5A 2CK3A 2ZRJA 4L95C 4ZO4A 4BNUA 3R75A 4GMGA 4Q1CA 1CP3A 4AW9A 3DYBA 2UZ0A 3EXAA 3R3SA 3S7ZA 1WUHS 3PJDA 5LKAA 2J4CA 4QU8A 4U6NA 5IXJA 1X92A 3ROEA 4CQMB 3ZU6A 4YJGA 1H42A 1N5IA 1YCDA 1YRHA 3HB0A 3H1PA 3QPVA 1P80A 5DNAA 1NQTA 1J8FA 4GD3Q 1Z6PA 2GVZC 4Y2RA 1L1QA 3LZCA 2G0TA 1NBME 4JR2A 1ZISA 2O14A 4RS4A 2QN1A 1XCJA 4IQ0A 1HDCA 3KVVA 3KUXA 1H2FA 2VEOA 1EFVB 1TAGA 4Y9TA 1VYHA 2AF3C 4PO9A 3SNHA 2SICE 4KBFA 3CLTD 4BO0A 2H1CA 1ABFA 1VBKA 1YBFA 2AX3A 2XADA 4JWKA 2EJBA 4N7MA 2E1PA 2X0EA 1EXDA 1G8JA 1RHKA 4TS9A 1SBIA 2FFJA 4FE7A 1YT5A 3F9CA 5K0TA 3SXPA 4IX1A 4O2AA 1S9DA 3NV9A 3PRYA 4FKBA 1QU3A 2QUHA 3QQ5A 2IH5A 1QP4A 4GT1A