3MDOA

Crystal structure of a putative phosphoribosylformylglycinamidine cyclo-ligase (bdi_2101) from parabacteroides distasonis atcc 8503 at 1.91 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
365
structure length
365
Chain Sequence
NIDKGIFPKAFCKIIPDILGGDPEYCNIMHADGAGTKSSLAYMYWKETGDLSVWKGIAQDALIMNIDDLLCVGAVDNILVSSTIGRNKLLVPGEVISAIINGTDELLAELREMGVGCYATGGETADVGDLVRTIIVDSTVTCRMKRSDVIDNKNIQGGDVIVGLASSGQATYEKEYNGGMGSNGLTSARHDVFSKYLAKKYPESYDAAVPKELVYSGGLKLTDKIEELGIDAGKMVLSPTRTYAPVIKVLLDKLRSQIHGMVHCSGGAQTKVMHFVENKRVTKDNLFPIPPLFRTIQEQSGTDWSEMYKVFNMGHRMEIYIAPEHAEEVIGISKSFGIDAQIVGFVEEADKNELIIESEKGRFTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phosphoribosylformylglycinamidine cyclo-ligase
publication title Crystal structure of a Putative phosphoribosylformylglycinamidine cyclo-ligase (BDI_2101) from Parabacteroides distasonis ATCC 8503 at 1.91 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Ligase
total genus 119
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 3mdoA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 3mdoA02
2HRUA 3C9SA 3MCQA 2Z1UA 3VYTC 2Z1TA 2HS4A 2BTUA 1VK3A 3P4EA 2I6RA 2Z1FA 2RB9A 2V9YA 3WJQA 2HS0A 3WJRA 2YYEA 3KIZA 2ZODA 1CLIA 1VQVA 2HS3A 3VIUA 3U0OA 3C9TA 5AVMA 2Z01A 3C9UA 2HRYA 3M84A 3WJPA 3QTYA 2Z1EA 2ZAUA 3VYUC 3D54A 3FD5A 2YXZA 3FD6A 3C9RA 3MDOA 3VTIC 3VYSC
chains in the Genus database with same CATH superfamily
4ZI7A 2KTVA 5JH7A 4B46A 3ESJA 4I55A 3JCMM 2Z1UA 5GINC 2B33A 2PHNA 3C8LA 3LMEA 3VO8A 1VQ5F 3Q8HA 2CHTA 4G4YA 1W59A 3ZOPA 3HKBB 3CCLF 4LCKA 2V9YA 3VOAA 1YJNF 1K8AH 3I3FA 2LBTA 5CB4B 1GO0A 5EZYA 5J2UB 5JQGB 3CCUF 2LBXA 2EWCA 4BY9D 2UYPA 2H8CA 2VAWA 4U39A 3CD6F 1QAHA 3LDTA 4TV8B 3VYUC 3TD3A 3CCSF 1RA4A 2IG8A 3FD5A 3E22B 3SIVA 3GYQA 5LYJB 1T0AA 2F9ZC 3CCJF 1JJ2F 4LNUB 2AMTA 4ERHA 3ZP7A 1NQ3A 1DT9A 1COMA 1IV4A 1YQNA 2Z1FA 5EIBD 3F0EA 2P6YA 1X25A 5GANK 1TUBB 3WPWA 3RYCB 3VIUA 5GAPK 1H7MA 1VQPF 3JALB 3I7TA 3RYIA 4I50B 3VMFB 2IAFA 2Q1YA 1U40A 3OBWA 4F6RB 5JVDA 1U43A 1W55A 3O85A 3LWVC 4EB6A 5IJ0A 1X7OA 3CCQF 3KJJA 4IHJB 4YJ3A 4YJ2A 1YJWF 2ZVZA 2LBWA 1GX1A 4B45A 4C8IA 3CCEF 1ODEA 5ITZB 1X7PA 1FFXB 2KTUA 3CPQA 1UI9A 3JVHA 5EYPA 5FJ4C 4O4LA 5EB1B 1YJ9F 2HX0A 5EWRA 2OTJF 3E1YA 3JAKB 2CHSA 4I4TA 4X1YB 1VHAA 3VTIC 4RHAA 3QHDA 3PAFA 3LWPC 3S06A 2UYKA 4KWEA 1RQ7A 3RYHA 3LYBA 5CA0B 1X52A 2DT4A 1VQ8F 1VQMF 2OTLF 4U3JB 3AGKA 5GONB 2FGYA 4X3LA 2I6RA 3CC2F 4ZOLA 3ON1A 5HY4A 1VQVA 3CCVF 2BTOA 4TV9B 3HKCA 4WBNB 2UZHA 2DYYA 3HKDA 4X1KB 2VAMA 3N2GB 1KD1H 1CN7A 3G6EF 3ELCA 2GVIA 2VXYA 5FLXM 4R40B 1XBIA 2RHHA 3CYQA 3T80A 4I55B 3UT5A 4X1IB 4E6EA 4HNAA 2BTUA 1N8RH 3ZP4A 1IV1A 4DRXA 3RYFA 4EI7A 3HJWC 3KE1A 4ZK7A 3IMPA 2ZVYA 5IJ9B 3S0HA 1SA0A 2WALA 5FNVB 2VGNA 1VH8A 4TUYA 5EO3A 5JCOC 3G4SF 1IV2A 3CMEF 1GO1A 3NK6A 5IYZA 3JARA 1K73H 3IEWA 1M1KH 2HP3A 1TVKB 2MQEA 1VQ7F 2HS4A 5LOVA 4NWOB 1PXWA 3J80M 4X20B 4O2AA 3CC7F 1XHOA 4ZHWA 3WJQA 2VGMA 2G9IA 3WJRA 2KG4A 4O4IB 4X3MA 1Z5VA 3HKEA 3TD4A 5LA6A 1QVGF 4O2BA 3SIUA 3N4YA 1E7KA 3N2KB 5MN6A 2UYNA 2CVLA 1SDSA 1ONIA 5LXTA 3QUWA 1FNKA 2GLZA 4ZHQA 3WGKA 5KMGB 2OTMA 3LWOC 3C9SA 1Q82H 3MCQA 1DBFA 3CPWF 2FC3A 3JASB 3K0TA 5BMVA 3L7QA 5KX5A 4O4JB 3JAWA 3OONA 4BT4A 5EYPB 3CB2A 4O4LB 3VOBA 1W41A 5AVMA 2OZBA 4FFBA 4I4TB 3P0ZA 5HY0A 3VYSC 3P10A 1T0KB 3LFOA 5EB0A 4BW0B 2RHOA 1YITF 3HKBA 3JAMM 5EAZA 1FSZA 1XRGA 1OFUA 2OHWA 3CG6A 4ZOLB 4BT6A 1KNKA 5CB4A 5J2UA 5JQGA 3ERNA 4G4VA 5C8YB 3VCZA 3KHNA 3HKCB 3HWUA 3S0WA 2BO1A 5J2TB 3J81M 3C9TA 3K14A 4TV8A 3JATB 1JD1A 4RQOA 3E22A 2ZAUA 4G88A 5MN4A 5LYJA 3FD6A 3CXCF 2ALEA 1QU9A 4C81A 4LNUA 2HP0B 3V4DA 1IPAA 1VQ6F 1PF5A 3UT5B 1VK3A 1U3LA 3K12A 2QA4F 5LP6B 3RA6A 3LWRC 3CC4F 1TUBA 4ZHVA 3RYCA 2VAPA 3S0YA 4O4HB 1YI2F 3CMAF 4I50A 3WJPA 3C9UA 3M84A 4F6RA 3WGJA 2NMUA 1VQ4F 5HP8A 3WPXA 3WXMB 3FPIA 1NMUB 3CCMF 1W40A 4B5CA 5MN5A 5IYZB 3FFMA 1QD9A 2IQQA 4ZI7B 5JH7B 1KC8H 4IHJA 4EI8A 4BT3A 1KQSF 3PLAC 3M4SA 2R6R1 1SZQA 3S03A 3V7EA 1VQKF 4O2AB 1IV3A 3F0GA 2HS0A 3RE3A 1U3PA 5ITZA 4EI9A 2HQSC 2ZODA 2PMPA 4BT2A 2H6LA 2BTQB 4DXDA 5EZYB 3U0OA 3JAKA 4NQ3A 1Z5WA 2QEXF 4X1YA 2JNBA 3F6MA 4G4WA 1M90H 3LWQC 1OAPA 5CA0A 3NK7A 4M8IA 5JCOA 1QVFF 1JN1A 5GIOC 4U3JA 1W5BA 3FBAA 3WGNA 5GONA 1Q81H 2K1SA 3WGMA 1W57A 4TV9A 3OBYA 4IIJA 4BT7A 1Q86H 4WBNA 2I6DA 3S02A 2LCAA 3IR9A 4X1KA 5HY2A 3QTYA 3N2GA 3RYIB 2ZF8A 5JVDB 2YXZA 1W5EA 4X1IA 3CCRF 3BYQA 4EB6B 5CA1A 5IJ0B 1GZ0A 3K2XA 4YJ2B 4YJ3B 1JY8A 2RHLA 2RB9A 4BT5A 4ZHYB 2ZOVA 5G4VC 5IJ9A 1RQ2A 1VQOF 2UYJA 5FNVA 4TZZA 3OW2F 1W42A 1RLGA 1YIJF 3D01A 3E20B 1JFFA 3DC2A 1H48A 2Z01A 2N48A 2R751 2HVYD 2KGWA 3N4ZA 3C9RA 4BVRA 3IEQA 3KJKA 3V7QA 1TVKA 3DDNA 3RYHB 4G4XA 4X20A 2AIZP 5HP7A 2QTPA 5IT9M 1VQNF 3J7AR 3G71F 3EORA 4O4IA 2YYEA 4C82A 1YGYA 3N2KA 2CZWA 4C8EA 2GZLA 3HKDB 3M1XA 1FNJA 5KMGA 3HAXD 2HRUA 3R0PA 1W3EX 2Z1TA 3ZO8A 3JASA 2QI2A 3P4EA 4HNAB 3V3TA 1VQ9F 4O4JA 4DRXB 3RYFB 3KIZA 3RA5A 3IKEA 1CLIA 5B8FA 3JALA 3TD5A 1SA0B 1XV2A 1K9MH 1Q7YH 2CWJA 4TUYB 1W581 3NMUC 4C4WC 5GIPC 2H8EA 3CYPB 2Q1XA 2RHJA 3F0FA 3JARB 3I56F 3WGLA 5LOVB 4BVSA 1CK2A 5HY1A 3NVKE 1FFXA 5C8YA 1W5AA 5J2TA 4IIJB 4XCQA 1Q8RA 3HKEB 5LA6B 3JATA 1H47A 3MCAB 4O2BB 4NUTA 2UYNB 1S72F 3D54A 1KNJA 3MDOA 1W5FA 5EIBC 4BVTA 4C8GA 5LXTB 3D00A 1ZWZA 2HP0A 3MBMA 4ZHQB 1J7HA 1RLUA 5LP6C 5HXZA 1VQLF 3B6NA 3MQWA 3VYTC 3I55F 5CA1B 1W2BF 3NVIB 1NJIH 5LP6A 2CSLA 1UFYA 4G4ZA 1YHQF 3VI6A 4PWTA 5BMVB 4B62A 4O4HA 5KX5B 5G4UC 2HS3A 3GHZA 3JAWB 3IKFA 2W8BC 3F0DA 5HXUA 4BVQA 1JFFB 2HRYA 1R1MA 5DCVA 2Z1EA 5A2QM 2L26A 4FFBB 3HTNA 3GTZA 2CW4A 2AIFA 5HWEA
chains in the Genus database with same CATH topology
2HRUA 3C9SA 3MCQA 2Z1UA 3VYTC 2Z1TA 2HS4A 2BTUA 1VK3A 3P4EA 2I6RA 2Z1FA 2RB9A 2V9YA 3WJQA 2HS0A 3WJRA 2YYEA 3KIZA 2ZODA 1CLIA 1VQVA 2HS3A 3VIUA 3U0OA 3C9TA 5AVMA 2Z01A 3C9UA 2HRYA 3M84A 3WJPA 3QTYA 2Z1EA 2ZAUA 3VYUC 3D54A 3FD5A 2YXZA 3FD6A 3C9RA 3MDOA 3VTIC 3VYSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRU A;  3C9S A;  3MCQ A;  2Z1U A;  3VYT C;  2Z1T A;  2HS4 A;  2BTU A;  1VK3 A;  3P4E A;  2I6R A;  2Z1F A;  2RB9 A;  2V9Y A;  3WJQ A;  2HS0 A;  3WJR A;  2YYE A;  3KIZ A;  2ZOD A;  1CLI A;  1VQV A;  2HS3 A;  3VIU A;  3U0O A;  3C9T A;  5AVM A;  2Z01 A;  3C9U A;  2HRY A;  3M84 A;  3WJP A;  3QTY A;  2Z1E A;  2ZAU A;  3VYU C;  3D54 A;  3FD5 A;  2YXZ A;  3FD6 A;  3C9R A;  3MDO A;  3VTI C;  3VYS C; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  2KTV A;  5JH7 A;  4B46 A;  3ESJ A;  4I55 A;  3JCM M;  2Z1U A;  5GIN C;  2B33 A;  2PHN A;  3C8L A;  3LME A;  3VO8 A;  1VQ5 F;  3Q8H A;  2CHT A;  4G4Y A;  1W59 A;  3ZOP A;  3HKB B;  3CCL F;  4LCK A;  2V9Y A;  3VOA A;  1YJN F;  1K8A H;  3I3F A;  2LBT A;  5CB4 B;  1GO0 A;  5EZY A;  5J2U B;  5JQG B;  3CCU F;  2LBX A;  2EWC A;  4BY9 D;  2UYP A;  2H8C A;  2VAW A;  4U39 A;  3CD6 F;  1QAH A;  3LDT A;  4TV8 B;  3VYU C;  3TD3 A;  3CCS F;  1RA4 A;  2IG8 A;  3FD5 A;  3E22 B;  3SIV A;  3GYQ A;  5LYJ B;  1T0A A;  2F9Z C;  3CCJ F;  1JJ2 F;  4LNU B;  2AMT A;  4ERH A;  3ZP7 A;  1NQ3 A;  1DT9 A;  1COM A;  1IV4 A;  1YQN A;  2Z1F A;  5EIB D;  3F0E A;  2P6Y A;  1X25 A;  5GAN K;  1TUB B;  3WPW A;  3RYC B;  3VIU A;  5GAP K;  1H7M A;  1VQP F;  3JAL B;  3I7T A;  3RYI A;  4I50 B;  3VMF B;  2IAF A;  2Q1Y A;  1U40 A;  3OBW A;  4F6R B;  5JVD A;  1U43 A;  1W55 A;  3O85 A;  3LWV C;  4EB6 A;  5IJ0 A;  1X7O A;  3CCQ F;  3KJJ A;  4IHJ B;  4YJ3 A;  4YJ2 A;  1YJW F;  2ZVZ A;  2LBW A;  1GX1 A;  4B45 A;  4C8I A;  3CCE F;  1ODE A;  5ITZ B;  1X7P A;  1FFX B;  2KTU A;  3CPQ A;  1UI9 A;  3JVH A;  5EYP A;  5FJ4 C;  4O4L A;  5EB1 B;  1YJ9 F;  2HX0 A;  5EWR A;  2OTJ F;  3E1Y A;  3JAK B;  2CHS A;  4I4T A;  4X1Y B;  1VHA A;  3VTI C;  4RHA A;  3QHD A;  3PAF A;  3LWP C;  3S06 A;  2UYK A;  4KWE A;  1RQ7 A;  3RYH A;  3LYB A;  5CA0 B;  1X52 A;  2DT4 A;  1VQ8 F;  1VQM F;  2OTL F;  4U3J B;  3AGK A;  5GON B;  2FGY A;  4X3L A;  2I6R A;  3CC2 F;  4ZOL A;  3ON1 A;  5HY4 A;  1VQV A;  3CCV F;  2BTO A;  4TV9 B;  3HKC A;  4WBN B;  2UZH A;  2DYY A;  3HKD A;  4X1K B;  2VAM A;  3N2G B;  1KD1 H;  1CN7 A;  3G6E F;  3ELC A;  2GVI A;  2VXY A;  5FLX M;  4R40 B;  1XBI A;  2RHH A;  3CYQ A;  3T80 A;  4I55 B;  3UT5 A;  4X1I B;  4E6E A;  4HNA A;  2BTU A;  1N8R H;  3ZP4 A;  1IV1 A;  4DRX A;  3RYF A;  4EI7 A;  3HJW C;  3KE1 A;  4ZK7 A;  3IMP A;  2ZVY A;  5IJ9 B;  3S0H A;  1SA0 A;  2WAL A;  5FNV B;  2VGN A;  1VH8 A;  4TUY A;  5EO3 A;  5JCO C;  3G4S F;  1IV2 A;  3CME F;  1GO1 A;  3NK6 A;  5IYZ A;  3JAR A;  1K73 H;  3IEW A;  1M1K H;  2HP3 A;  1TVK B;  2MQE A;  1VQ7 F;  2HS4 A;  5LOV A;  4NWO B;  1PXW A;  3J80 M;  4X20 B;  4O2A A;  3CC7 F;  1XHO A;  4ZHW A;  3WJQ A;  2VGM A;  2G9I A;  3WJR A;  2KG4 A;  4O4I B;  4X3M A;  1Z5V A;  3HKE A;  3TD4 A;  5LA6 A;  1QVG F;  4O2B A;  3SIU A;  3N4Y A;  1E7K A;  3N2K B;  5MN6 A;  2UYN A;  2CVL A;  1SDS A;  1ONI A;  5LXT A;  3QUW A;  1FNK A;  2GLZ A;  4ZHQ A;  3WGK A;  5KMG B;  2OTM A;  3LWO C;  3C9S A;  1Q82 H;  3MCQ A;  1DBF A;  3CPW F;  2FC3 A;  3JAS B;  3K0T A;  5BMV A;  3L7Q A;  5KX5 A;  4O4J B;  3JAW A;  3OON A;  4BT4 A;  5EYP B;  3CB2 A;  4O4L B;  3VOB A;  1W41 A;  5AVM A;  2OZB A;  4FFB A;  4I4T B;  3P0Z A;  5HY0 A;  3VYS C;  3P10 A;  1T0K B;  3LFO A;  5EB0 A;  4BW0 B;  2RHO A;  1YIT F;  3HKB A;  3JAM M;  5EAZ A;  1FSZ A;  1XRG A;  1OFU A;  2OHW A;  3CG6 A;  4ZOL B;  4BT6 A;  1KNK A;  5CB4 A;  5J2U A;  5JQG A;  3ERN A;  4G4V A;  5C8Y B;  3VCZ A;  3KHN A;  3HKC B;  3HWU A;  3S0W A;  2BO1 A;  5J2T B;  3J81 M;  3C9T A;  3K14 A;  4TV8 A;  3JAT B;  1JD1 A;  4RQO A;  3E22 A;  2ZAU A;  4G88 A;  5MN4 A;  5LYJ A;  3FD6 A;  3CXC F;  2ALE A;  1QU9 A;  4C81 A;  4LNU A;  2HP0 B;  3V4D A;  1IPA A;  1VQ6 F;  1PF5 A;  3UT5 B;  1VK3 A;  1U3L A;  3K12 A;  2QA4 F;  5LP6 B;  3RA6 A;  3LWR C;  3CC4 F;  1TUB A;  4ZHV A;  3RYC A;  2VAP A;  3S0Y A;  4O4H B;  1YI2 F;  3CMA F;  4I50 A;  3WJP A;  3C9U A;  3M84 A;  4F6R A;  3WGJ A;  2NMU A;  1VQ4 F;  5HP8 A;  3WPX A;  3WXM B;  3FPI A;  1NMU B;  3CCM F;  1W40 A;  4B5C A;  5MN5 A;  5IYZ B;  3FFM A;  1QD9 A;  2IQQ A;  4ZI7 B;  5JH7 B;  1KC8 H;  4IHJ A;  4EI8 A;  4BT3 A;  1KQS F;  3PLA C;  3M4S A;  2R6R 1;  1SZQ A;  3S03 A;  3V7E A;  1VQK F;  4O2A B;  1IV3 A;  3F0G A;  2HS0 A;  3RE3 A;  1U3P A;  5ITZ A;  4EI9 A;  2HQS C;  2ZOD A;  2PMP A;  4BT2 A;  2H6L A;  2BTQ B;  4DXD A;  5EZY B;  3U0O A;  3JAK A;  4NQ3 A;  1Z5W A;  2QEX F;  4X1Y A;  2JNB A;  3F6M A;  4G4W A;  1M90 H;  3LWQ C;  1OAP A;  5CA0 A;  3NK7 A;  4M8I A;  5JCO A;  1QVF F;  1JN1 A;  5GIO C;  4U3J A;  1W5B A;  3FBA A;  3WGN A;  5GON A;  1Q81 H;  2K1S A;  3WGM A;  1W57 A;  4TV9 A;  3OBY A;  4IIJ A;  4BT7 A;  1Q86 H;  4WBN A;  2I6D A;  3S02 A;  2LCA A;  3IR9 A;  4X1K A;  5HY2 A;  3QTY A;  3N2G A;  3RYI B;  2ZF8 A;  5JVD B;  2YXZ A;  1W5E A;  4X1I A;  3CCR F;  3BYQ A;  4EB6 B;  5CA1 A;  5IJ0 B;  1GZ0 A;  3K2X A;  4YJ2 B;  4YJ3 B;  1JY8 A;  2RHL A;  2RB9 A;  4BT5 A;  4ZHY B;  2ZOV A;  5G4V C;  5IJ9 A;  1RQ2 A;  1VQO F;  2UYJ A;  5FNV A;  4TZZ A;  3OW2 F;  1W42 A;  1RLG A;  1YIJ F;  3D01 A;  3E20 B;  1JFF A;  3DC2 A;  1H48 A;  2Z01 A;  2N48 A;  2R75 1;  2HVY D;  2KGW A;  3N4Z A;  3C9R A;  4BVR A;  3IEQ A;  3KJK A;  3V7Q A;  1TVK A;  3DDN A;  3RYH B;  4G4X A;  4X20 A;  2AIZ P;  5HP7 A;  2QTP A;  5IT9 M;  1VQN F;  3J7A R;  3G71 F;  3EOR A;  4O4I A;  2YYE A;  4C82 A;  1YGY A;  3N2K A;  2CZW A;  4C8E A;  2GZL A;  3HKD B;  3M1X A;  1FNJ A;  5KMG A;  3HAX D;  2HRU A;  3R0P A;  1W3E X;  2Z1T A;  3ZO8 A;  3JAS A;  2QI2 A;  3P4E A;  4HNA B;  3V3T A;  1VQ9 F;  4O4J A;  4DRX B;  3RYF B;  3KIZ A;  3RA5 A;  3IKE A;  1CLI A;  5B8F A;  3JAL A;  3TD5 A;  1SA0 B;  1XV2 A;  1K9M H;  1Q7Y H;  2CWJ A;  4TUY B;  1W58 1;  3NMU C;  4C4W C;  5GIP C;  2H8E A;  3CYP B;  2Q1X A;  2RHJ A;  3F0F A;  3JAR B;  3I56 F;  3WGL A;  5LOV B;  4BVS A;  1CK2 A;  5HY1 A;  3NVK E;  1FFX A;  5C8Y A;  1W5A A;  5J2T A;  4IIJ B;  4XCQ A;  1Q8R A;  3HKE B;  5LA6 B;  3JAT A;  1H47 A;  3MCA B;  4O2B B;  4NUT A;  2UYN B;  1S72 F;  3D54 A;  1KNJ A;  3MDO A;  1W5F A;  5EIB C;  4BVT A;  4C8G A;  5LXT B;  3D00 A;  1ZWZ A;  2HP0 A;  3MBM A;  4ZHQ B;  1J7H A;  1RLU A;  5LP6 C;  5HXZ A;  1VQL F;  3B6N A;  3MQW A;  3VYT C;  3I55 F;  5CA1 B;  1W2B F;  3NVI B;  1NJI H;  5LP6 A;  2CSL A;  1UFY A;  4G4Z A;  1YHQ F;  3VI6 A;  4PWT A;  5BMV B;  4B62 A;  4O4H A;  5KX5 B;  5G4U C;  2HS3 A;  3GHZ A;  3JAW B;  3IKF A;  2W8B C;  3F0D A;  5HXU A;  4BVQ A;  1JFF B;  2HRY A;  1R1M A;  5DCV A;  2Z1E A;  5A2Q M;  2L26 A;  4FFB B;  3HTN A;  3GTZ A;  2CW4 A;  2AIF A;  5HWE A; 
#chains in the Genus database with same CATH homology
 2HRU A;  3C9S A;  3MCQ A;  2Z1U A;  3VYT C;  2Z1T A;  2HS4 A;  2BTU A;  1VK3 A;  3P4E A;  2I6R A;  2Z1F A;  2RB9 A;  2V9Y A;  3WJQ A;  2HS0 A;  3WJR A;  2YYE A;  3KIZ A;  2ZOD A;  1CLI A;  1VQV A;  2HS3 A;  3VIU A;  3U0O A;  3C9T A;  5AVM A;  2Z01 A;  3C9U A;  2HRY A;  3M84 A;  3WJP A;  3QTY A;  2Z1E A;  2ZAU A;  3VYU C;  3D54 A;  3FD5 A;  2YXZ A;  3FD6 A;  3C9R A;  3MDO A;  3VTI C;  3VYS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...