3MDOA

Crystal structure of a putative phosphoribosylformylglycinamidine cyclo-ligase (bdi_2101) from parabacteroides distasonis atcc 8503 at 1.91 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
365
structure length
365
Chain Sequence
NIDKGIFPKAFCKIIPDILGGDPEYCNIMHADGAGTKSSLAYMYWKETGDLSVWKGIAQDALIMNIDDLLCVGAVDNILVSSTIGRNKLLVPGEVISAIINGTDELLAELREMGVGCYATGGETADVGDLVRTIIVDSTVTCRMKRSDVIDNKNIQGGDVIVGLASSGQATYEKEYNGGMGSNGLTSARHDVFSKYLAKKYPESYDAAVPKELVYSGGLKLTDKIEELGIDAGKMVLSPTRTYAPVIKVLLDKLRSQIHGMVHCSGGAQTKVMHFVENKRVTKDNLFPIPPLFRTIQEQSGTDWSEMYKVFNMGHRMEIYIAPEHAEEVIGISKSFGIDAQIVGFVEEADKNELIIESEKGRFTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Putative phosphoribosylformylglycinamidine cyclo-ligase
publication title Crystal structure of a Putative phosphoribosylformylglycinamidine cyclo-ligase (BDI_2101) from Parabacteroides distasonis ATCC 8503 at 1.91 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 119
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 3mdoA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 3mdoA02
2Z01A 3VYSC 3FD5A 3FD6A 3VIUA 2HS0A 3C9TA 3P4EA 2Z1EA 3WJRA 2HS3A 2Z1UA 3QTYA 3WJPA 3WJQA 2HRYA 3MDOA 1VQVA 2BTUA 3KIZA 2Z1FA 2YYEA 3VTIC 3D54A 3C9UA 2HRUA 5AVMA 1CLIA 2YXZA 2V9YA 2ZAUA 3C9SA 3MCQA 2Z1TA 3M84A 3U0OA 2HS4A 3VYTC 1VK3A 3C9RA 2ZODA 2RB9A 2I6RA 3VYUC
chains in the Genus database with same CATH superfamily
5HY4A 3HKEA 5EZYA 3JATB 3JAKA 3VCZA 2ZVYA 5IJ0B 5JCOC 5CA0B 3VO8A 4X3MA 3S0YA 5B8FA 1W5FA 3MBMA 5J2UB 1KD1H 3LFOA 1QAHA 5LOVB 5LA6B 3HWUA 1YITF 5J2TB 1M1KH 3B6NA 1FFXA 3KHNA 3C9UA 2ZF8A 4O4IB 4U3JB 4NUTA 4ZOLA 3IEQA 3ZO8A 2LBTA 3HKDA 3S0HA 1Z5WA 1TVKA 2HP3A 4I4TA 2IQQA 1XBIA 5A2QM 2F9ZC 3M1XA 4U39A 3E1YA 3OW2F 1U43A 3FPIA 3WJPA 3CMEF 3VOBA 5MN5A 1X52A 1OAPA 4BT2A 5MN6A 3RYHA 2PHNA 5IYZA 1X7OA 2V9YA 4YJ3B 3I3FA 3IMPA 5KMGB 3D00A 4BVRA 3AGKA 3N2KB 2VGNA 5GINC 3HKBB 5EB1B 3WPWA 4EB6A 1T0KB 2CHSA 3C9TA 4I50B 4IHJB 2CHTA 4DRXB 2HS3A 3WXMB 3CC2F 4C82A 5HXZA 1X25A 2KTVA 1VQLF 5HY1A 2ALEA 1IV4A 4TV8B 1Q8RA 3LDTA 2VXYA 1PF5A 4B45A 1R1MA 2DYYA 1CN7A 3TD3A 4BT5A 3P0ZA 3NK6A 3VYTC 1JY8A 1M90H 4O4HB 4EI7A 5HWEA 3FBAA 5GIPC 3CPWF 4F6RB 3VYUC 4G4XA 3N4YA 1IV1A 4C4WC 3GHZA 3LMEA 1Q86H 1COMA 3RYCA 5BMVA 2H8EA 5LP6A 3ERNA 3WJQA 3I56F 4X1IA 5EYPB 1YIJF 1VQOF 3S06A 2RHOA 3DDNA 1IV3A 2VGMA 3N4ZA 4ZHVA 1KNJA 4LNUB 2VAPA 3LWOC 4RHAA 5JVDB 1Q7YH 4BT7A 1GO0A 2ZOVA 5JH7B 3JCMM 4ZI7A 3VYSC 5JQGA 1W5AA 1SA0B 3ON1A 1JD1A 1NMUB 3ZOPA 4BT3A 2Q1XA 4E6EA 3CD6F 3F0EA 3QTYA 4ZHQA 5HP7A 3K12A 4B5CA 2Q1YA 3JAWB 1VHAA 3F0FA 1XV2A 4O2AA 3RA6A 1W5BA 5FJ4C 2L26A 2RHLA 3NVKE 3WGKA 4ZHYB 1YHQF 3CB2A 5CA0A 2GZLA 2HX0A 3S0WA 3V4DA 2Z01A 3CPQA 4TUYA 3IKFA 5J2UA 3K2XA 3QHDA 3QUWA 4B46A 5LOVA 5LA6A 5GIOC 2LBWA 4IIJB 5J2TA 2H8CA 1U40A 4O4IA 4U3JA 2Z1UA 5FLXM 3Q8HA 3E22B 3G71F 1W5EA 4PWTA 3J81M 2BTQB 3JARB 4BVQA 1E7KA 3I55F 1TUBB 2ZAUA 3F0GA 1YGYA 2KGWA 2CZWA 1W42A 5IJ9B 4RQOA 3ESJA 1IPAA 4X20B 2G9IA 3D54A 1K73H 4FFBB 3FFMA 1GO1A 5LP6C 1KC8H 3JALB 3D01A 2UYNB 3WGNA 2CWJA 5CA1B 5FNVA 2FGYA 2I6DA 4G4YA 1RLGA 3S03A 3G6EF 5KMGA 3R0PA 2KTUA 2W8BC 4TV9B 3N2KA 3N2GB 1VQ7F 5EIBD 3HKBA 1QVFF 1RQ2A 1YI2F 2UZHA 1S72F 3HJWC 1JN1A 4I50A 3C9RA 1QVGF 4X1YB 4DRXA 4WBNB 1YJNF 2HP0B 1KNKA 2GVIA 5EWRA 2DT4A 4TV8A 1H48A 1K8AH 4X1KB 2QEXF 3CYQA 1VQ9F 1NJIH 4ZHWA 3CYPB 2R751 4O4HA 4F6RA 5HY0A 1W40A 3OBWA 2ZVZA 1U3PA 3VMFB 1VQKF 5KX5B 1W55A 3M4SA 5LYJB 4I55B 1VQPF 3K0TA 2MQEA 1NQ3A 5LXTB 2CSLA 3JASB 1SZQA 1JFFB 4EI9A 5EYPA 1RLUA 3GYQA 3ZP7A 4LCKA 3IR9A 2CW4A 4C8IA 5ITZA 2JNBA 4KWEA 3P4EA 5CB4B 3S02A 3RYIA 2LCAA 3CCVF 2BTOA 1YJWF 1W41A 4LNUA 4G4WA 3CCMF 2YYEA 3WGMA 2LBXA 5JVDA 5G4VC 5JH7A 4BW0B 3NK7A 2AMTA 3ELCA 4XCQA 2IAFA 3MCQA 3T80A 2HS4A 1SA0A 3RA5A 2KG4A 5C8YA 2RB9A 3ZP4A 3CCUF 2FC3A 5EAZA 3KE1A 5GONA 2RHJA 3JAWA 4O4LB 2HS0A 1YJ9F 2WALA 3CCSF 2IG8A 3LYBA 2R6R1 3RE3A 4YJ2B 3I7TA 2OZBA 4BVSA 3EORA 3C9SA 3WPXA 2UYKA 3C8LA 5HY2A 3J7AR 3JATA 1QD9A 3BYQA 4IIJA 4M8IA 3HTNA 3G4SF 4ZK7A 5IJ0A 4TZZA 5IT9M 3KJKA 1XRGA 3VTIC 1H47A 3FD5A 3LWQC 2OTMA 4O2BB 2VAWA 3NMUC 3CCQF 3CC4F 4ZI7B 1N8RH 5JQGB 4B62A 1TUBA 1RQ7A 4HNAB 3CXCF 1T0AA 1UI9A 3WGLA 3IEWA 2P6YA 5IJ9A 1W3EX 4X20A 2UYJA 3HKCB 2H6LA 4G4ZA 2PMPA 4FFBA 1X7PA 3JVHA 3JALA 3O85A 4R40B 1VK3A 1QU9A 3LWPC 3UT5B 2UYNA 3K14A 2B33A 2AIFA 5CA1A 3RYFB 1YQNA 1FSZA 5HXUA 3JAMM 1ONIA 4TV9A 3LWRC 3WJRA 4TUYB 4O4JB 3N2GA 1DBFA 3HKEB 5EZYB 2BTUA 1JJ2F 3JAKB 3KIZA 2K1SA 1FNKA 4YJ3A 3TD4A 3WGJA 2BO1A 2YXZA 4X1YA 4WBNA 1VQ6F 3OONA 2HP0A 1KQSF 1FFXB 4NWOB 4C8GA 1H7MA 5EO3A 4X1KA 3OBYA 4IHJA 2EWCA 4ZOLB 3FD6A 3HKDB 3VIUA 1TVKB 1CK2A 5MN4A 4I4TB 1ZWZA 3F0DA 3J80M 2HRYA 1DT9A 5KX5A 5LYJA 1XHOA 2Z1FA 1U3LA 2RHHA 4G88A 5HP8A 3TD5A 2QA4F 4I55A 4DXDA 4C8EA 5AVMA 5GAPK 5FNVB 1VQNF 3CCJF 5LXTA 3MCAB 3JASA 4NQ3A 3CCLF 1JFFA 3U0OA 1GX1A 1SDSA 3LWVC 5CB4A 4BVTA 2ZODA 3KJJA 1W581 3RYHB 3CMAF 5IYZB 2HVYD 4X3LA 3CCRF 5EB0A 1VQ4F 2Z1EA 3L7QA 2NMUA 4EB6B 1VQVA 2OTJF 5JCOA 1Q82H 3CCEF 3VI6A 2HQSC 2CVLA 3DC2A 1K9MH 1W2BF 4G4VA 3PLAC 4BT6A 5EIBC 1RA4A 1VH8A 4O4LA 1ODEA 1UFYA 2I6RA 3V7QA 1W57A 4EI8A 3MQWA 4YJ2A 1GZ0A 4BY9D 4BT4A 2OHWA 3E20B 5GANK 3P10A 1VQMF 3V7EA 5ITZB 2QTPA 3SIVA 3RYIB 3HAXD 1CLIA 3F6MA 3IKEA 5BMVB 3RYCB 5LP6B 5G4UC 4X1IB 4O2BA 4ERHA 3M84A 2OTLF 3PAFA 1PXWA 3VOAA 1VQ8F 3V3TA 1Q81H 2AIZP 3CG6A 4HNAA 3CC7F 1W59A 3E22A 5C8YB 2VAMA 3SIUA 2QI2A 3JARA 3HKCA 5GONB 3MDOA 2N48A 2GLZA 3UT5A 2HRUA 1J7HA 1FNJA 1OFUA 1VQ5F 4ZHQB 3RYFA 1Z5VA 1IV2A 2Z1TA 2UYPA 5DCVA 4O2AB 3GTZA 3NVIB 4O4JA 4C81A
chains in the Genus database with same CATH topology
2Z01A 3VYSC 3FD5A 3FD6A 3VIUA 2HS0A 3C9TA 3P4EA 2Z1EA 3WJRA 2HS3A 2Z1UA 3QTYA 3WJPA 3WJQA 2HRYA 3MDOA 1VQVA 2BTUA 3KIZA 2Z1FA 2YYEA 3VTIC 3D54A 3C9UA 2HRUA 5AVMA 1CLIA 2YXZA 2V9YA 2ZAUA 3C9SA 3MCQA 2Z1TA 3M84A 3U0OA 2HS4A 3VYTC 1VK3A 3C9RA 2ZODA 2RB9A 2I6RA 3VYUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z01 A;  3VYS C;  3FD5 A;  3FD6 A;  3VIU A;  2HS0 A;  3C9T A;  3P4E A;  2Z1E A;  3WJR A;  2HS3 A;  2Z1U A;  3QTY A;  3WJP A;  3WJQ A;  2HRY A;  3MDO A;  1VQV A;  2BTU A;  3KIZ A;  2Z1F A;  2YYE A;  3VTI C;  3D54 A;  3C9U A;  2HRU A;  5AVM A;  1CLI A;  2YXZ A;  2V9Y A;  2ZAU A;  3C9S A;  3MCQ A;  2Z1T A;  3M84 A;  3U0O A;  2HS4 A;  3VYT C;  1VK3 A;  3C9R A;  2ZOD A;  2RB9 A;  2I6R A;  3VYU C; 
#chains in the Genus database with same CATH topology
 5HY4 A;  3HKE A;  5EZY A;  3JAT B;  3JAK A;  3VCZ A;  2ZVY A;  5IJ0 B;  5JCO C;  5CA0 B;  3VO8 A;  4X3M A;  3S0Y A;  5B8F A;  1W5F A;  3MBM A;  5J2U B;  1KD1 H;  3LFO A;  1QAH A;  5LOV B;  5LA6 B;  3HWU A;  1YIT F;  5J2T B;  1M1K H;  3B6N A;  1FFX A;  3KHN A;  3C9U A;  2ZF8 A;  4O4I B;  4U3J B;  4NUT A;  4ZOL A;  3IEQ A;  3ZO8 A;  2LBT A;  3HKD A;  3S0H A;  1Z5W A;  1TVK A;  2HP3 A;  4I4T A;  2IQQ A;  1XBI A;  5A2Q M;  2F9Z C;  3M1X A;  4U39 A;  3E1Y A;  3OW2 F;  1U43 A;  3FPI A;  3WJP A;  3CME F;  3VOB A;  5MN5 A;  1X52 A;  1OAP A;  4BT2 A;  5MN6 A;  3RYH A;  2PHN A;  5IYZ A;  1X7O A;  2V9Y A;  4YJ3 B;  3I3F A;  3IMP A;  5KMG B;  3D00 A;  4BVR A;  3AGK A;  3N2K B;  2VGN A;  5GIN C;  3HKB B;  5EB1 B;  3WPW A;  4EB6 A;  1T0K B;  2CHS A;  3C9T A;  4I50 B;  4IHJ B;  2CHT A;  4DRX B;  2HS3 A;  3WXM B;  3CC2 F;  4C82 A;  5HXZ A;  1X25 A;  2KTV A;  1VQL F;  5HY1 A;  2ALE A;  1IV4 A;  4TV8 B;  1Q8R A;  3LDT A;  2VXY A;  1PF5 A;  4B45 A;  1R1M A;  2DYY A;  1CN7 A;  3TD3 A;  4BT5 A;  3P0Z A;  3NK6 A;  3VYT C;  1JY8 A;  1M90 H;  4O4H B;  4EI7 A;  5HWE A;  3FBA A;  5GIP C;  3CPW F;  4F6R B;  3VYU C;  4G4X A;  3N4Y A;  1IV1 A;  4C4W C;  3GHZ A;  3LME A;  1Q86 H;  1COM A;  3RYC A;  5BMV A;  2H8E A;  5LP6 A;  3ERN A;  3WJQ A;  3I56 F;  4X1I A;  5EYP B;  1YIJ F;  1VQO F;  3S06 A;  2RHO A;  3DDN A;  1IV3 A;  2VGM A;  3N4Z A;  4ZHV A;  1KNJ A;  4LNU B;  2VAP A;  3LWO C;  4RHA A;  5JVD B;  1Q7Y H;  4BT7 A;  1GO0 A;  2ZOV A;  5JH7 B;  3JCM M;  4ZI7 A;  3VYS C;  5JQG A;  1W5A A;  1SA0 B;  3ON1 A;  1JD1 A;  1NMU B;  3ZOP A;  4BT3 A;  2Q1X A;  4E6E A;  3CD6 F;  3F0E A;  3QTY A;  4ZHQ A;  5HP7 A;  3K12 A;  4B5C A;  2Q1Y A;  3JAW B;  1VHA A;  3F0F A;  1XV2 A;  4O2A A;  3RA6 A;  1W5B A;  5FJ4 C;  2L26 A;  2RHL A;  3NVK E;  3WGK A;  4ZHY B;  1YHQ F;  3CB2 A;  5CA0 A;  2GZL A;  2HX0 A;  3S0W A;  3V4D A;  2Z01 A;  3CPQ A;  4TUY A;  3IKF A;  5J2U A;  3K2X A;  3QHD A;  3QUW A;  4B46 A;  5LOV A;  5LA6 A;  5GIO C;  2LBW A;  4IIJ B;  5J2T A;  2H8C A;  1U40 A;  4O4I A;  4U3J A;  2Z1U A;  5FLX M;  3Q8H A;  3E22 B;  3G71 F;  1W5E A;  4PWT A;  3J81 M;  2BTQ B;  3JAR B;  4BVQ A;  1E7K A;  3I55 F;  1TUB B;  2ZAU A;  3F0G A;  1YGY A;  2KGW A;  2CZW A;  1W42 A;  5IJ9 B;  4RQO A;  3ESJ A;  1IPA A;  4X20 B;  2G9I A;  3D54 A;  1K73 H;  4FFB B;  3FFM A;  1GO1 A;  5LP6 C;  1KC8 H;  3JAL B;  3D01 A;  2UYN B;  3WGN A;  2CWJ A;  5CA1 B;  5FNV A;  2FGY A;  2I6D A;  4G4Y A;  1RLG A;  3S03 A;  3G6E F;  5KMG A;  3R0P A;  2KTU A;  2W8B C;  4TV9 B;  3N2K A;  3N2G B;  1VQ7 F;  5EIB D;  3HKB A;  1QVF F;  1RQ2 A;  1YI2 F;  2UZH A;  1S72 F;  3HJW C;  1JN1 A;  4I50 A;  3C9R A;  1QVG F;  4X1Y B;  4DRX A;  4WBN B;  1YJN F;  2HP0 B;  1KNK A;  2GVI A;  5EWR A;  2DT4 A;  4TV8 A;  1H48 A;  1K8A H;  4X1K B;  2QEX F;  3CYQ A;  1VQ9 F;  1NJI H;  4ZHW A;  3CYP B;  2R75 1;  4O4H A;  4F6R A;  5HY0 A;  1W40 A;  3OBW A;  2ZVZ A;  1U3P A;  3VMF B;  1VQK F;  5KX5 B;  1W55 A;  3M4S A;  5LYJ B;  4I55 B;  1VQP F;  3K0T A;  2MQE A;  1NQ3 A;  5LXT B;  2CSL A;  3JAS B;  1SZQ A;  1JFF B;  4EI9 A;  5EYP A;  1RLU A;  3GYQ A;  3ZP7 A;  4LCK A;  3IR9 A;  2CW4 A;  4C8I A;  5ITZ A;  2JNB A;  4KWE A;  3P4E A;  5CB4 B;  3S02 A;  3RYI A;  2LCA A;  3CCV F;  2BTO A;  1YJW F;  1W41 A;  4LNU A;  4G4W A;  3CCM F;  2YYE A;  3WGM A;  2LBX A;  5JVD A;  5G4V C;  5JH7 A;  4BW0 B;  3NK7 A;  2AMT A;  3ELC A;  4XCQ A;  2IAF A;  3MCQ A;  3T80 A;  2HS4 A;  1SA0 A;  3RA5 A;  2KG4 A;  5C8Y A;  2RB9 A;  3ZP4 A;  3CCU F;  2FC3 A;  5EAZ A;  3KE1 A;  5GON A;  2RHJ A;  3JAW A;  4O4L B;  2HS0 A;  1YJ9 F;  2WAL A;  3CCS F;  2IG8 A;  3LYB A;  2R6R 1;  3RE3 A;  4YJ2 B;  3I7T A;  2OZB A;  4BVS A;  3EOR A;  3C9S A;  3WPX A;  2UYK A;  3C8L A;  5HY2 A;  3J7A R;  3JAT A;  1QD9 A;  3BYQ A;  4IIJ A;  4M8I A;  3HTN A;  3G4S F;  4ZK7 A;  5IJ0 A;  4TZZ A;  5IT9 M;  3KJK A;  1XRG A;  3VTI C;  1H47 A;  3FD5 A;  3LWQ C;  2OTM A;  4O2B B;  2VAW A;  3NMU C;  3CCQ F;  3CC4 F;  4ZI7 B;  1N8R H;  5JQG B;  4B62 A;  1TUB A;  1RQ7 A;  4HNA B;  3CXC F;  1T0A A;  1UI9 A;  3WGL A;  3IEW A;  2P6Y A;  5IJ9 A;  1W3E X;  4X20 A;  2UYJ A;  3HKC B;  2H6L A;  4G4Z A;  2PMP A;  4FFB A;  1X7P A;  3JVH A;  3JAL A;  3O85 A;  4R40 B;  1VK3 A;  1QU9 A;  3LWP C;  3UT5 B;  2UYN A;  3K14 A;  2B33 A;  2AIF A;  5CA1 A;  3RYF B;  1YQN A;  1FSZ A;  5HXU A;  3JAM M;  1ONI A;  4TV9 A;  3LWR C;  3WJR A;  4TUY B;  4O4J B;  3N2G A;  1DBF A;  3HKE B;  5EZY B;  2BTU A;  1JJ2 F;  3JAK B;  3KIZ A;  2K1S A;  1FNK A;  4YJ3 A;  3TD4 A;  3WGJ A;  2BO1 A;  2YXZ A;  4X1Y A;  4WBN A;  1VQ6 F;  3OON A;  2HP0 A;  1KQS F;  1FFX B;  4NWO B;  4C8G A;  1H7M A;  5EO3 A;  4X1K A;  3OBY A;  4IHJ A;  2EWC A;  4ZOL B;  3FD6 A;  3HKD B;  3VIU A;  1TVK B;  1CK2 A;  5MN4 A;  4I4T B;  1ZWZ A;  3F0D A;  3J80 M;  2HRY A;  1DT9 A;  5KX5 A;  5LYJ A;  1XHO A;  2Z1F A;  1U3L A;  2RHH A;  4G88 A;  5HP8 A;  3TD5 A;  2QA4 F;  4I55 A;  4DXD A;  4C8E A;  5AVM A;  5GAP K;  5FNV B;  1VQN F;  3CCJ F;  5LXT A;  3MCA B;  3JAS A;  4NQ3 A;  3CCL F;  1JFF A;  3U0O A;  1GX1 A;  1SDS A;  3LWV C;  5CB4 A;  4BVT A;  2ZOD A;  3KJJ A;  1W58 1;  3RYH B;  3CMA F;  5IYZ B;  2HVY D;  4X3L A;  3CCR F;  5EB0 A;  1VQ4 F;  2Z1E A;  3L7Q A;  2NMU A;  4EB6 B;  1VQV A;  2OTJ F;  5JCO A;  1Q82 H;  3CCE F;  3VI6 A;  2HQS C;  2CVL A;  3DC2 A;  1K9M H;  1W2B F;  4G4V A;  3PLA C;  4BT6 A;  5EIB C;  1RA4 A;  1VH8 A;  4O4L A;  1ODE A;  1UFY A;  2I6R A;  3V7Q A;  1W57 A;  4EI8 A;  3MQW A;  4YJ2 A;  1GZ0 A;  4BY9 D;  4BT4 A;  2OHW A;  3E20 B;  5GAN K;  3P10 A;  1VQM F;  3V7E A;  5ITZ B;  2QTP A;  3SIV A;  3RYI B;  3HAX D;  1CLI A;  3F6M A;  3IKE A;  5BMV B;  3RYC B;  5LP6 B;  5G4U C;  4X1I B;  4O2B A;  4ERH A;  3M84 A;  2OTL F;  3PAF A;  1PXW A;  3VOA A;  1VQ8 F;  3V3T A;  1Q81 H;  2AIZ P;  3CG6 A;  4HNA A;  3CC7 F;  1W59 A;  3E22 A;  5C8Y B;  2VAM A;  3SIU A;  2QI2 A;  3JAR A;  3HKC A;  5GON B;  3MDO A;  2N48 A;  2GLZ A;  3UT5 A;  2HRU A;  1J7H A;  1FNJ A;  1OFU A;  1VQ5 F;  4ZHQ B;  3RYF A;  1Z5V A;  1IV2 A;  2Z1T A;  2UYP A;  5DCV A;  4O2A B;  3GTZ A;  3NVI B;  4O4J A;  4C81 A; 
#chains in the Genus database with same CATH homology
 2Z01 A;  3VYS C;  3FD5 A;  3FD6 A;  3VIU A;  2HS0 A;  3C9T A;  3P4E A;  2Z1E A;  3WJR A;  2HS3 A;  2Z1U A;  3QTY A;  3WJP A;  3WJQ A;  2HRY A;  3MDO A;  1VQV A;  2BTU A;  3KIZ A;  2Z1F A;  2YYE A;  3VTI C;  3D54 A;  3C9U A;  2HRU A;  5AVM A;  1CLI A;  2YXZ A;  2V9Y A;  2ZAU A;  3C9S A;  3MCQ A;  2Z1T A;  3M84 A;  3U0O A;  2HS4 A;  3VYT C;  1VK3 A;  3C9R A;  2ZOD A;  2RB9 A;  2I6R A;  3VYU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...