3MDOA

Crystal structure of a putative phosphoribosylformylglycinamidine cyclo-ligase (bdi_2101) from parabacteroides distasonis atcc 8503 at 1.91 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
365
structure length
365
Chain Sequence
NIDKGIFPKAFCKIIPDILGGDPEYCNIMHADGAGTKSSLAYMYWKETGDLSVWKGIAQDALIMNIDDLLCVGAVDNILVSSTIGRNKLLVPGEVISAIINGTDELLAELREMGVGCYATGGETADVGDLVRTIIVDSTVTCRMKRSDVIDNKNIQGGDVIVGLASSGQATYEKEYNGGMGSNGLTSARHDVFSKYLAKKYPESYDAAVPKELVYSGGLKLTDKIEELGIDAGKMVLSPTRTYAPVIKVLLDKLRSQIHGMVHCSGGAQTKVMHFVENKRVTKDNLFPIPPLFRTIQEQSGTDWSEMYKVFNMGHRMEIYIAPEHAEEVIGISKSFGIDAQIVGFVEEADKNELIIESEKGRFTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative phosphoribosylformylglycinamidine cyclo-ligase (BDI_2101) from Parabacteroides distasonis ATCC 8503 at 1.91 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Ligase
molecule keywords Putative phosphoribosylformylglycinamidine cyclo-ligase
total genus 119
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 3mdoA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 3mdoA02
2Z1TA 3WJPA 1CLIA 3C9RA 2HRYA 3P4EA 2RB9A 3MCQA 3VYSC 3C9SA 3QTYA 2YYEA 2HS4A 2BTUA 3C9UA 2V9YA 3FD6A 3VIUA 3M84A 3KIZA 5AVMA 3U0OA 3VTIC 2Z01A 2Z1EA 3C9TA 2Z1FA 3VYUC 3D54A 3VYTC 2HRUA 3FD5A 2I6RA 3WJRA 3WJQA 1VQVA 2HS0A 2Z1UA 2ZAUA 3MDOA 1VK3A 2YXZA 2HS3A 2ZODA
chains in the Genus database with same CATH superfamily
1FFXA 1SA0B 1IV1A 4O2AB 1DT9A 3ZO8A 3KJKA 5GONB 3C9UA 3GHZA 3VO8A 2V9YA 3VIUA 1QD9A 4TZZA 1X7OA 2KTVA 1YIJF 1H48A 2Z01A 1TUBA 2LBXA 3MQWA 3OW2F 3RYIB 5HP8A 3CB2A 3S03A 4WBNB 4O4HB 5FNVB 5ITZB 3Q8HA 4BVRA 1XRGA 3I7TA 2I6DA 3RA6A 3S0HA 3JAWB 2LCAA 2ZODA 1W5BA 4LNUA 4FFBB 5GONA 5FLXM 2RHJA 4ZHQA 2UYKA 4RQOA 3RYCB 1NQ3A 3JARB 5HY0A 4DRXA 2QTPA 4IIJB 1K73H 3V7EA 1U3PA 2BTQB 1X7PA 4YJ3B 4EI7A 5EO3A 3JALA 1W2BF 3LYBA 3S0WA 3ZOPA 3JAWA 3MBMA 1H47A 3F0DA 4LNUB 3LWRC 4DXDA 2ZF8A 4U3JA 1KNKA 2Z1UA 5GANK 4X1IB 2H8CA 5KMGA 3ERNA 4TUYA 1Q86H 4EI9A 4O2BB 3UT5A 2CSLA 3IEQA 3CCQF 2BTUA 4X1KA 3I55F 3JASA 2HP3A 5CA1B 1XV2A 5AVMA 1GZ0A 3L7QA 4B45A 1TVKB 5ITZA 3CD6F 3HKCB 1UI9A 2HQSC 3CYQA 5KMGB 3F0FA 3JAKA 2QI2A 3UT5B 1VQ6F 5HY2A 3HKBB 3ZP7A 5HP7A 3BYQA 3N4ZA 5HXZA 5LP6B 3NVKE 3VOBA 1KD1H 5LA6A 3ESJA 2AIFA 1Z5VA 3JALB 3NK7A 4O4JB 3N2GB 3KIZA 1ODEA 5GAPK 2CW4A 3IKFA 1VQ5F 1RQ7A 1YQNA 4BT7A 4ZHWA 5EZYB 3LWQC 3RYFB 3WJRA 2YXZA 1VQNF 5IT9M 1Z5WA 4ERHA 1JN1A 1RLUA 2G9IA 5C8YA 4BVQA 2HP0B 4BT6A 5CA1A 2QA4F 1RA4A 2RHOA 1FFXB 3C9SA 2FGYA 3LMEA 3ON1A 5J2TB 5JQGA 3CPQA 5JVDA 1K8AH 3HWUA 4DRXB 4IIJA 5MN5A 5HY4A 1QAHA 2ZVZA 2CHTA 4C8EA 3N4YA 4F6RB 5LA6B 1XHOA 4YJ2A 2H8EA 1DBFA 4WBNA 3NVIB 1ONIA 5J2TA 2KGWA 3WGLA 5JQGB 3P4EA 3J7AR 3JCMM 3D00A 2JNBA 4I4TA 4BT4A 4BVTA 5IYZB 5J2UA 1VQ4F 3ZP4A 3RE3A 4ZOLB 1W5FA 3OONA 3RYCA 4I50B 1NMUB 2BO1A 3PAFA 1M1KH 3JARA 2QEXF 2B33A 1W581 3KHNA 2OTLF 1QVFF 4G4YA 1W57A 4B46A 3B6NA 4EB6B 1GX1A 3G4SF 1W55A 3K12A 2CHSA 3G71F 3MDOA 3I3FA 3E20B 1VQ7F 4U3JB 2OZBA 3M4SA 2RHHA 4XCQA 3VYSC 3RYHB 1YJWF 3J81M 3HJWC 2H6LA 5JCOC 5CB4B 4HNAA 3CCJF 3IKEA 4TV9A 1FNKA 1X52A 2CWJA 4G4ZA 2VAWA 4ZI7B 2KTUA 2LBTA 1SA0A 2N48A 1W42A 1JD1A 1YHQF 3E22A 3V3TA 2OTMA 3CCUF 3QHDA 1CLIA 1YGYA 3I56F 1TUBB 3HKEB 3RYIA 1JFFA 3FD6A 2Q1XA 2IAFA 3K14A 4NQ3A 5GIOC 3QUWA 3HKDA 3FFMA 1IPAA 2P6YA 1X25A 5FJ4C 3WPWA 4ZHVA 3CMEF 2FC3A 2ZOVA 3D01A 3S0YA 3EORA 3PLAC 4X20A 3MCQA 1KQSF 5IJ9A 5C8YB 5G4VC 3M1XA 5KX5A 4O2AA 3J80M 2LBWA 4ZOLA 2VXYA 5GIPC 4I50A 3JAKB 5CA0B 5IJ0A 1U43A 4G4XA 4O4JA 3LFOA 4I55A 2HRUA 4B5CA 3F6MA 1RLGA 1E7KA 4FFBA 2ZAUA 3O85A 4F6RA 3CCLF 3ELCA 4M8IA 2Z1TA 1VQ8F 2MQEA 2UYJA 3WPXA 1TVKA 3JATB 5KX5B 5MN6A 5HWEA 3CC4F 1H7MA 2IG8A 4IHJA 4TV8A 3R0PA 5CA0A 5JH7A 3VTIC 3WGMA 3CC7F 3LDTA 3K2XA 4E6EA 2PMPA 2HX0A 5MN4A 1GO0A 1W59A 2IQQA 2VAMA 2OTJF 2NMUA 3CYPB 3WJQA 1OFUA 5IJ9B 2HS0A 4EB6A 1Q81H 2HS3A 4BT5A 5JVDB 2HRYA 4X1IA 3RA5A 2DT4A 3CG6A 4TUYB 1QVGF 5EB1B 3E22B 3LWPC 3KJJA 4O4IA 4EI8A 1KC8H 1SZQA 3S02A 3LWVC 2EWCA 3TD4A 4B62A 3CCVF 3CPWF 2VAPA 1VHAA 2PHNA 1NJIH 3VYUC 3WGJA 4BW0B 3N2KB 1CK2A 4C82A 3FD5A 3HKBA 3K0TA 3P0ZA 1VQVA 2R751 2VGMA 4G88A 3WJPA 4O4LB 3C9RA 3IMPA 1RQ2A 5G4UC 2YYEA 2HS4A 1W3EX 2GLZA 3AGKA 1N8RH 1U40A 2UYNA 4O4HA 3M84A 5FNVA 2ZVYA 3NMUC 3N2GA 3P10A 4O2BA 2CZWA 5DCVA 3WXMB 2RHLA 2L26A 3G6EF 1S72F 4C8IA 1VQKF 5LOVB 1GO1A 1W41A 5EZYA 5LXTB 3JAMM 4I55B 5EIBD 5HXUA 3C8LA 3QTYA 2BTOA 3VI6A 4X20B 3VMFB 5EWRA 1IV3A 4C81A 5HY1A 3SIUA 3WGNA 3N2KA 3CCEF 2KG4A 4BVSA 4TV8B 2GZLA 2Z1FA 3JVHA 2Q1YA 2CVLA 4RHAA 4U39A 1UFYA 1T0AA 4X3MA 5EB0A 3MCAB 4R40B 5LXTA 1VQ9F 1PXWA 1VQMF 1R1MA 3D54A 1VQOF 1VH8A 4X1KB 3CCSF 3F0GA 3IEWA 1JFFB 2OHWA 5J2UB 5IYZA 4BY9D 3IR9A 1ZWZA 5JCOA 5CB4A 1YI2F 1Q7YH 4X3LA 3V4DA 3CXCF 1YJNF 3TD5A 3VCZA 3JATA 3CMAF 3HKCA 1FSZA 1Q82H 4X1YB 3E1YA 5EYPB 5LYJA 2UYPA 4LCKA 5LOVA 1Q8RA 4O4IB 1QU9A 4BT2A 3CCRF 1OAPA 3HTNA 5EIBC 1SDSA 1KNJA 3HKEA 3TD3A 1W40A 3FBAA 3VYTC 2WALA 2VGNA 1PF5A 1XBIA 4ZHQB 3DDNA 1VK3A 1M90H 1YJ9F 1FNJA 5LP6C 2RB9A 5BMVB 4X1YA 5EYPA 3RYFA 5LYJB 1JJ2F 4G4WA 4G4VA 4O4LA 1IV4A 1VQPF 3SIVA 4ZHYB 3OBWA 3OBYA 3U0OA 5A2QM 1K9MH 4ZI7A 4I4TB 2Z1EA 1T0KB 3HAXD 5GINC 2UYNB 2K1SA 1COMA 3FPIA 4IHJB 2HVYD 2HP0A 3DC2A 2DYYA 1J7HA 1YITF 2ALEA 1VQLF 2AMTA 5BMVA 4BT3A 4C8GA 3KE1A 5LP6A 3T80A 2F9ZC 4C4WC 5B8FA 3V7QA 3JASB 3LWOC 4NUTA 1JY8A 2GVIA 1IV2A 3S06A 4ZK7A 5IJ0B 2UZHA 2R6R1 1CN7A 3VOAA 2AIZP 4YJ2B 3HKDB 3WGKA 1W5AA 1W5EA 3C9TA 4KWEA 2W8BC 3RYHA 3GTZA 1U3LA 4YJ3A 2I6RA 3CCMF 4HNAB 3F0EA 4PWTA 4TV9B 5EAZA 5JH7B 3CC2F 3NK6A 3GYQA 4NWOB
chains in the Genus database with same CATH topology
2Z1TA 3WJPA 1CLIA 3C9RA 2HRYA 3P4EA 2RB9A 3MCQA 3VYSC 3C9SA 3QTYA 2YYEA 2HS4A 2BTUA 3C9UA 2V9YA 3FD6A 3VIUA 3M84A 3KIZA 5AVMA 3U0OA 3VTIC 2Z01A 2Z1EA 3C9TA 2Z1FA 3VYUC 3D54A 3VYTC 2HRUA 3FD5A 2I6RA 3WJRA 3WJQA 1VQVA 2HS0A 2Z1UA 2ZAUA 3MDOA 1VK3A 2YXZA 2HS3A 2ZODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1T A;  3WJP A;  1CLI A;  3C9R A;  2HRY A;  3P4E A;  2RB9 A;  3MCQ A;  3VYS C;  3C9S A;  3QTY A;  2YYE A;  2HS4 A;  2BTU A;  3C9U A;  2V9Y A;  3FD6 A;  3VIU A;  3M84 A;  3KIZ A;  5AVM A;  3U0O A;  3VTI C;  2Z01 A;  2Z1E A;  3C9T A;  2Z1F A;  3VYU C;  3D54 A;  3VYT C;  2HRU A;  3FD5 A;  2I6R A;  3WJR A;  3WJQ A;  1VQV A;  2HS0 A;  2Z1U A;  2ZAU A;  3MDO A;  1VK3 A;  2YXZ A;  2HS3 A;  2ZOD A; 
#chains in the Genus database with same CATH topology
 1FFX A;  1SA0 B;  1IV1 A;  4O2A B;  1DT9 A;  3ZO8 A;  3KJK A;  5GON B;  3C9U A;  3GHZ A;  3VO8 A;  2V9Y A;  3VIU A;  1QD9 A;  4TZZ A;  1X7O A;  2KTV A;  1YIJ F;  1H48 A;  2Z01 A;  1TUB A;  2LBX A;  3MQW A;  3OW2 F;  3RYI B;  5HP8 A;  3CB2 A;  3S03 A;  4WBN B;  4O4H B;  5FNV B;  5ITZ B;  3Q8H A;  4BVR A;  1XRG A;  3I7T A;  2I6D A;  3RA6 A;  3S0H A;  3JAW B;  2LCA A;  2ZOD A;  1W5B A;  4LNU A;  4FFB B;  5GON A;  5FLX M;  2RHJ A;  4ZHQ A;  2UYK A;  4RQO A;  3RYC B;  1NQ3 A;  3JAR B;  5HY0 A;  4DRX A;  2QTP A;  4IIJ B;  1K73 H;  3V7E A;  1U3P A;  2BTQ B;  1X7P A;  4YJ3 B;  4EI7 A;  5EO3 A;  3JAL A;  1W2B F;  3LYB A;  3S0W A;  3ZOP A;  3JAW A;  3MBM A;  1H47 A;  3F0D A;  4LNU B;  3LWR C;  4DXD A;  2ZF8 A;  4U3J A;  1KNK A;  2Z1U A;  5GAN K;  4X1I B;  2H8C A;  5KMG A;  3ERN A;  4TUY A;  1Q86 H;  4EI9 A;  4O2B B;  3UT5 A;  2CSL A;  3IEQ A;  3CCQ F;  2BTU A;  4X1K A;  3I55 F;  3JAS A;  2HP3 A;  5CA1 B;  1XV2 A;  5AVM A;  1GZ0 A;  3L7Q A;  4B45 A;  1TVK B;  5ITZ A;  3CD6 F;  3HKC B;  1UI9 A;  2HQS C;  3CYQ A;  5KMG B;  3F0F A;  3JAK A;  2QI2 A;  3UT5 B;  1VQ6 F;  5HY2 A;  3HKB B;  3ZP7 A;  5HP7 A;  3BYQ A;  3N4Z A;  5HXZ A;  5LP6 B;  3NVK E;  3VOB A;  1KD1 H;  5LA6 A;  3ESJ A;  2AIF A;  1Z5V A;  3JAL B;  3NK7 A;  4O4J B;  3N2G B;  3KIZ A;  1ODE A;  5GAP K;  2CW4 A;  3IKF A;  1VQ5 F;  1RQ7 A;  1YQN A;  4BT7 A;  4ZHW A;  5EZY B;  3LWQ C;  3RYF B;  3WJR A;  2YXZ A;  1VQN F;  5IT9 M;  1Z5W A;  4ERH A;  1JN1 A;  1RLU A;  2G9I A;  5C8Y A;  4BVQ A;  2HP0 B;  4BT6 A;  5CA1 A;  2QA4 F;  1RA4 A;  2RHO A;  1FFX B;  3C9S A;  2FGY A;  3LME A;  3ON1 A;  5J2T B;  5JQG A;  3CPQ A;  5JVD A;  1K8A H;  3HWU A;  4DRX B;  4IIJ A;  5MN5 A;  5HY4 A;  1QAH A;  2ZVZ A;  2CHT A;  4C8E A;  3N4Y A;  4F6R B;  5LA6 B;  1XHO A;  4YJ2 A;  2H8E A;  1DBF A;  4WBN A;  3NVI B;  1ONI A;  5J2T A;  2KGW A;  3WGL A;  5JQG B;  3P4E A;  3J7A R;  3JCM M;  3D00 A;  2JNB A;  4I4T A;  4BT4 A;  4BVT A;  5IYZ B;  5J2U A;  1VQ4 F;  3ZP4 A;  3RE3 A;  4ZOL B;  1W5F A;  3OON A;  3RYC A;  4I50 B;  1NMU B;  2BO1 A;  3PAF A;  1M1K H;  3JAR A;  2QEX F;  2B33 A;  1W58 1;  3KHN A;  2OTL F;  1QVF F;  4G4Y A;  1W57 A;  4B46 A;  3B6N A;  4EB6 B;  1GX1 A;  3G4S F;  1W55 A;  3K12 A;  2CHS A;  3G71 F;  3MDO A;  3I3F A;  3E20 B;  1VQ7 F;  4U3J B;  2OZB A;  3M4S A;  2RHH A;  4XCQ A;  3VYS C;  3RYH B;  1YJW F;  3J81 M;  3HJW C;  2H6L A;  5JCO C;  5CB4 B;  4HNA A;  3CCJ F;  3IKE A;  4TV9 A;  1FNK A;  1X52 A;  2CWJ A;  4G4Z A;  2VAW A;  4ZI7 B;  2KTU A;  2LBT A;  1SA0 A;  2N48 A;  1W42 A;  1JD1 A;  1YHQ F;  3E22 A;  3V3T A;  2OTM A;  3CCU F;  3QHD A;  1CLI A;  1YGY A;  3I56 F;  1TUB B;  3HKE B;  3RYI A;  1JFF A;  3FD6 A;  2Q1X A;  2IAF A;  3K14 A;  4NQ3 A;  5GIO C;  3QUW A;  3HKD A;  3FFM A;  1IPA A;  2P6Y A;  1X25 A;  5FJ4 C;  3WPW A;  4ZHV A;  3CME F;  2FC3 A;  2ZOV A;  3D01 A;  3S0Y A;  3EOR A;  3PLA C;  4X20 A;  3MCQ A;  1KQS F;  5IJ9 A;  5C8Y B;  5G4V C;  3M1X A;  5KX5 A;  4O2A A;  3J80 M;  2LBW A;  4ZOL A;  2VXY A;  5GIP C;  4I50 A;  3JAK B;  5CA0 B;  5IJ0 A;  1U43 A;  4G4X A;  4O4J A;  3LFO A;  4I55 A;  2HRU A;  4B5C A;  3F6M A;  1RLG A;  1E7K A;  4FFB A;  2ZAU A;  3O85 A;  4F6R A;  3CCL F;  3ELC A;  4M8I A;  2Z1T A;  1VQ8 F;  2MQE A;  2UYJ A;  3WPX A;  1TVK A;  3JAT B;  5KX5 B;  5MN6 A;  5HWE A;  3CC4 F;  1H7M A;  2IG8 A;  4IHJ A;  4TV8 A;  3R0P A;  5CA0 A;  5JH7 A;  3VTI C;  3WGM A;  3CC7 F;  3LDT A;  3K2X A;  4E6E A;  2PMP A;  2HX0 A;  5MN4 A;  1GO0 A;  1W59 A;  2IQQ A;  2VAM A;  2OTJ F;  2NMU A;  3CYP B;  3WJQ A;  1OFU A;  5IJ9 B;  2HS0 A;  4EB6 A;  1Q81 H;  2HS3 A;  4BT5 A;  5JVD B;  2HRY A;  4X1I A;  3RA5 A;  2DT4 A;  3CG6 A;  4TUY B;  1QVG F;  5EB1 B;  3E22 B;  3LWP C;  3KJJ A;  4O4I A;  4EI8 A;  1KC8 H;  1SZQ A;  3S02 A;  3LWV C;  2EWC A;  3TD4 A;  4B62 A;  3CCV F;  3CPW F;  2VAP A;  1VHA A;  2PHN A;  1NJI H;  3VYU C;  3WGJ A;  4BW0 B;  3N2K B;  1CK2 A;  4C82 A;  3FD5 A;  3HKB A;  3K0T A;  3P0Z A;  1VQV A;  2R75 1;  2VGM A;  4G88 A;  3WJP A;  4O4L B;  3C9R A;  3IMP A;  1RQ2 A;  5G4U C;  2YYE A;  2HS4 A;  1W3E X;  2GLZ A;  3AGK A;  1N8R H;  1U40 A;  2UYN A;  4O4H A;  3M84 A;  5FNV A;  2ZVY A;  3NMU C;  3N2G A;  3P10 A;  4O2B A;  2CZW A;  5DCV A;  3WXM B;  2RHL A;  2L26 A;  3G6E F;  1S72 F;  4C8I A;  1VQK F;  5LOV B;  1GO1 A;  1W41 A;  5EZY A;  5LXT B;  3JAM M;  4I55 B;  5EIB D;  5HXU A;  3C8L A;  3QTY A;  2BTO A;  3VI6 A;  4X20 B;  3VMF B;  5EWR A;  1IV3 A;  4C81 A;  5HY1 A;  3SIU A;  3WGN A;  3N2K A;  3CCE F;  2KG4 A;  4BVS A;  4TV8 B;  2GZL A;  2Z1F A;  3JVH A;  2Q1Y A;  2CVL A;  4RHA A;  4U39 A;  1UFY A;  1T0A A;  4X3M A;  5EB0 A;  3MCA B;  4R40 B;  5LXT A;  1VQ9 F;  1PXW A;  1VQM F;  1R1M A;  3D54 A;  1VQO F;  1VH8 A;  4X1K B;  3CCS F;  3F0G A;  3IEW A;  1JFF B;  2OHW A;  5J2U B;  5IYZ A;  4BY9 D;  3IR9 A;  1ZWZ A;  5JCO A;  5CB4 A;  1YI2 F;  1Q7Y H;  4X3L A;  3V4D A;  3CXC F;  1YJN F;  3TD5 A;  3VCZ A;  3JAT A;  3CMA F;  3HKC A;  1FSZ A;  1Q82 H;  4X1Y B;  3E1Y A;  5EYP B;  5LYJ A;  2UYP A;  4LCK A;  5LOV A;  1Q8R A;  4O4I B;  1QU9 A;  4BT2 A;  3CCR F;  1OAP A;  3HTN A;  5EIB C;  1SDS A;  1KNJ A;  3HKE A;  3TD3 A;  1W40 A;  3FBA A;  3VYT C;  2WAL A;  2VGN A;  1PF5 A;  1XBI A;  4ZHQ B;  3DDN A;  1VK3 A;  1M90 H;  1YJ9 F;  1FNJ A;  5LP6 C;  2RB9 A;  5BMV B;  4X1Y A;  5EYP A;  3RYF A;  5LYJ B;  1JJ2 F;  4G4W A;  4G4V A;  4O4L A;  1IV4 A;  1VQP F;  3SIV A;  4ZHY B;  3OBW A;  3OBY A;  3U0O A;  5A2Q M;  1K9M H;  4ZI7 A;  4I4T B;  2Z1E A;  1T0K B;  3HAX D;  5GIN C;  2UYN B;  2K1S A;  1COM A;  3FPI A;  4IHJ B;  2HVY D;  2HP0 A;  3DC2 A;  2DYY A;  1J7H A;  1YIT F;  2ALE A;  1VQL F;  2AMT A;  5BMV A;  4BT3 A;  4C8G A;  3KE1 A;  5LP6 A;  3T80 A;  2F9Z C;  4C4W C;  5B8F A;  3V7Q A;  3JAS B;  3LWO C;  4NUT A;  1JY8 A;  2GVI A;  1IV2 A;  3S06 A;  4ZK7 A;  5IJ0 B;  2UZH A;  2R6R 1;  1CN7 A;  3VOA A;  2AIZ P;  4YJ2 B;  3HKD B;  3WGK A;  1W5A A;  1W5E A;  3C9T A;  4KWE A;  2W8B C;  3RYH A;  3GTZ A;  1U3L A;  4YJ3 A;  2I6R A;  3CCM F;  4HNA B;  3F0E A;  4PWT A;  4TV9 B;  5EAZ A;  5JH7 B;  3CC2 F;  3NK6 A;  3GYQ A;  4NWO B; 
#chains in the Genus database with same CATH homology
 2Z1T A;  3WJP A;  1CLI A;  3C9R A;  2HRY A;  3P4E A;  2RB9 A;  3MCQ A;  3VYS C;  3C9S A;  3QTY A;  2YYE A;  2HS4 A;  2BTU A;  3C9U A;  2V9Y A;  3FD6 A;  3VIU A;  3M84 A;  3KIZ A;  5AVM A;  3U0O A;  3VTI C;  2Z01 A;  2Z1E A;  3C9T A;  2Z1F A;  3VYU C;  3D54 A;  3VYT C;  2HRU A;  3FD5 A;  2I6R A;  3WJR A;  3WJQ A;  1VQV A;  2HS0 A;  2Z1U A;  2ZAU A;  3MDO A;  1VK3 A;  2YXZ A;  2HS3 A;  2ZOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...