4HNAB

Kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
431
structure length
431
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
molecule tags Motor protein
source organism Artificial gene
publication title Structure of a kinesin-tubulin complex and implications for kinesin motility.
pubmed doi rcsb
total genus 172
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hnaB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4hnaB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4hnaB01
4IIJA 5LYJB 4EI9A 4X1YA 3JASA 1TUBA 4EB6B 2GVIA 2BTOA 3RYCB 4DXDA 4IIJB 4YJ2B 3C8LA 5IJ9A 4I50A 4X1KB 5MN5A 3JAKB 5KX5B 4WBNB 3WGMA 5IJ0A 3RB8A 2BTQB 4TUYA 4X1KA 5LP6C 2VXYA 5GONB 2BTQA 4TUYB 1RQ7A 2RHJA 3VOBA 3HKBA 5CA0A 4ZI7A 3JAKA 3HKDA 1FFXB 4WBNA 5KX5A 4O4HA 3HKBB 5CA0B 1TVKA 3HKCA 1W5EA 3JALA 5GONA 3WGJA 3RYCA 4O2AA 3WGKA 3HKDB 4XCQA 4O4JB 5JQGB 4KWEA 4B45A 4O2AB 4F6RB 1JFFB 2XKAA 3JALB 1SA0A 5FNVA 5JQGA 5IJ0B 3JATB 5EZYA 3VO9A 1W5AA 2RHOA 5JH7B 1TUBB 4EB6A 3JATA 1TVKB 4ZI7B 3WGNA 4HNAB 5LXTB 1SA0B 5FNVB 4O2BA 2VAMA 2XKBA 3VOAA 4YJ3B 4O2BB 4DRXA 4YJ3A 4O4JA 5CB4A 3M8KA 5LP6A 1FFXA 5EYPB 1OFUA 4O4HB 5CB4B 5LP6B 5EZYB 4EI7A 5C8YA 4I4TB 2R6R1 5J2TA 1Z5WA 3RYIB 4TV8B 4TV9B 2VAPA 4EI8A 4F6RA 4ZOLB 4I4TA 4X20B 2R751 5JCOC 3M89A 3RYIA 5JH7A 3N2GA 3HKEA 4U3JB 1W5FA 1W5BA 3R4VA 4HNAA 4ZOLA 5LXTA 4X20A 3N2GB 3JARA 1Z5VA 5BMVB 1RQ2A 5J2TB 4O4IB 4DRXB 3ZBQA 5M7EA 4TV8A 4TV9A 5IYZA 3E22A 5EIBC 3WGLA 3RYHA 5EYPA 4LNUA 4M8IA 3E22B 2RHHA 4FFBA 5C8YB 3ZIDA 5JCOA 5JVDB 4LNUB 5LA6A 3UT5A 4IHJA 4X1IA 1RLUA 2Q1YA 3CB2A 5ITZA 2Q1XA 3JARB 3V3TA 3RYFB 5ITZB 5JVDA 3VPAA 1W581 5EIBD 5CA1B 4IHJB 4X1IB 3JASB 3ZBPA 5CA1A 4YJ2A 5IYZB 3HKEB 4U3JA 4ZHQB 3RYFA 3RYHB 5LOVA 5J2UB 3JAWB 1FSZA 5BMVA 1W59A 5LOVB 4O4LA 5LA6B 3JAWA 3UT5B 4O4IA 4ZHQA 4O4LB 2VAWA 4U39A 3VO8A 5J2UA 4I55A 5IJ9B 3N2KB 4I50B 5KMGB 4FFBB 3N2KA 5KMGA 5MN6A 5LYJA 4X1YB 5MN4A 4I55B 4E6EA 2RHLA 1JFFA 4B46A 3HKCB
chains in the Genus database with same CATH superfamily
3LLSA 2HDWA 3RSSA 4GR5A 4QG7A 4M54A 2V3CC 4F92B 4NP6A 4RZXA 3V8MA 1UBRS 2ZU6A 4QPKA 2C4NA 4FLUA 1ESCA 3IXQA 4OREX 1XZDA 1JG3A 5ELXA 1QC5B 3MAQA 4I6JA 4AY4A 2HU8A 3HI6A 4NZYA 3C5CA 4YV2A 1E9AA 2ZYTX 3T1YB 4Z86A 4RTQA 1KA9H 2D2IA 4KWCA 2JBHA 1WLYA 1GILA 2YIAA 2ZYHA 3P0FA 4IUCS 2VZLA 3MGKA 1V8DA 1WZEA 3KYDA 5FBKA 2HMWA 5A5EA 1GTVA 1S01A 2RJ3A 2VF5X 3K5IA 1G2IA 2IW3A 3KELA 3MAJA 5SV2A 4KR9A 5DE3A 3NR7A 1QCCA 1II0A 2C96A 5D7NA 4RWUA 2V7GA 3E9RA 2LW1A 4O29A 1RYBA 2B2CA 2CNDA 3WOVA 3KVVA 1Y76A 3OTGA 5EXTA 3EW9A 4HB3A 1XNRO 1F2VA 1YB1A 5H3LA 4YDSA 4RCVA 1Q0UA 1NTRA 4YP5A 3P0EA 2JGIA 5U4XA 2C7PA 1EZVH 4A82A 1GFZA 1R0LA 1ECLA 5AK5A 1YZKA 2PI4A 5JCZA 2PCLA 4I2NA 4QT4A 4YAKA 1GNQA 3GCDA 2PYZA 4Z2WA 1P31A 3K73O 5J2TF 5L40A 5CD1A 3Q9LA 4DV7O 4OB7A 5TPZD 4DQ0A 2KTVA 3HCEA 1ZJ4A 3N2ZB 3OESA 2QRPA 2WD8A 1U7ZA 2J5BA 1NBOA 2DUUA 5BXYA 2LZ0A 3RTAA 2LXNA 2NX2A 4PZEA 3ENZA 5BSTA 1A7UA 3LQ4A 4DMHA 2HBRA 4F8EA 2O8CB 2AZ0A 1JR4A 1UZAA 4G85A 1N57A 3KXKA 2IK8A 2K2QB 4PM4A 3ZRVA 5HDBB 5A3RA 2VTBB 1Q7TA 2H8PC 5C5EA 3P7MA 2NUTA 3HCWA 4OB8A 2E4VA 2H16A 2H4HA 3OTHA 3VQYA 1PDVA 4R83A 1KJZA 4WVLA 5K51A 4D3ZA 1JBEA 3RFUA 5B4TA 1D2RA 4G26A 1SZPA 1JJIA 5IM4F 3KSZO 3TG2A 2HK6A 1GQSA 2DQ0A 2BSXA 3ZXXA 1ZD3A 4DILA 1JAYA 2FQQA 5KTRA 2CGNA 1BT8A 2PJUA 1TAHA 1W9HA 4HQ0A 5BWNA 3LM8A 4QPCA 1YMVA 1RACA 4OHUA 5KYWB 3KT8A 3FNRA 4X1IA 4GWLA 1RD4A 3T5PA 3DV0A 2H9AA 2W0FC 2PH1A 4HNHA 1LVHA 3UAWA 2A9PA 3L79A 4GM0A 4MQLA 1BWSA 1Z83A 1E9BA 3LQ1A 2ZI4A 3OA0A 4RPJA 2EZTA 1FPQA 2VTBA 1I4WA 1AS2A 3S2UA 1Z39A 1T8WA 5EXSA 2CB0A 3QU4A 2GBGA 1USIA 3STHA 4F84A 3QO5A 10MHA 1X6VA 2CHFA 3GGSA 4ROTA 3VM6A 5ALFA 2JK0A 3VJKA 4BWFB 1Y6QA 2ZITA 5KPDA 1Q3TA 3PU6A 4DMLA 3IULA 4ZT3A 4ZU1X 5I47A 4ID3A 3CWCA 1YB4A 2R48A 4P2ZA 2VATA 2XTNA 3ESXA 4J3NA 4NESA 5EFOA 2QAGA 1DAHA 4I50B 3BRWA 3HZOA 3GG2A 1ADYA 3I05A 1CDEA 1DBQA 1WSAA 2MIIA 3TOVA 3VPSA 1P9WA 4I9QA 4MVOA 1NU1H 2XNCA 3ND9A 5KS2A 2XAUA 4X41A 1WB8A 3WYFA 3WQBA 4E09A 2BMAA 1SXJA 3CA8A 3FUUA 4MKGA 5HRAA 1BU5A 2R7AA 1UM9B 5I7SA 2FW0A 1DE0A 2QD3A 4F8YA 3K92A 3UN1A 2HOQA 4LVCA 4BLRA 5K99A 3U7RA 4F85A 1XRNA 2YNMC 1SU6A 2A5JA 3D3QA 2B9EA 1ZEJA 4JMPA 2PI5A 2GCPA 4OXSA 4KDFA 5CP8A 5K0GA 4UVIA 1RP1A 2X0EA 4RXMA 4PBTA 3ZVKA 2P2SA 1H9AA 3NWEA 5CA0A 4DK0A 4UFZA 1AQYA 2JGDB 3JWJA 1FFXB 4JHLA 4MEBA 4U2BA 2F9LA 1NVGA 2FR8C 1SVSA 1HPLA 4HTFB 3HJBA 3AP3A 2FGJA 4H27A 4JU9A 1IJKA 5DLYA 4RO2A 1I2BA 2AQ8A 4IRXA 5B1BC 1KS9A 5G4LA 5HIJA 1NU8A 1P9RA 1XU9A 2DN9A 5JQGB 1CRWG 3CM0A 4HDRB 4W99A 4YRFA 3COJA 4Y6GB 1SKQA 1RQRA 1SH7A 4LK2A 1YR8A 4XCVA 3ND6A 2UVQA 5C3MA 1NAIA 4RD2A 4MHTA 1KARA 4FYWA 1ZN9A 1UM8A 4HNAB 4YCCA 5F64A 1D2GA 4CMEC 3H65A 1L1RA 2OL4A 1PLLA 5T3YA 2W2KA 4P7BA 4P2BA 1WL8A 4NB5A 2IVFA 2GT1A 1OHHG 1HE3A 2PY6A 4Q15A 2XVMA 1H8EG 4WY2A 4ZIRB 1FS5A 3M5CA 4HDSA 1ZRMA 4BLTA 3LP5A 3H1HH 1ZUHA 1ZXBA 3GLFB 4KE9A 1WEHA 1V7CA 4UVBA 4UEQA 3PUZA 4BLUA 3ENVA 3AVQA 4BNVA 3A70A 3TLEA 4IXWA 4E5DA 1JHYA 4PI2A 3QEAZ 3BABA 3QX3A 2R3SA 3I5MA 3GUYA 5G1OA 2IWRA 2VDRB 3NETA 2OIEA 1WA8B 5A9GA 4G5FA 5EKUA 5TPWA 5JRZA 4PA9A 3DEFA 5CBFA 3S40A 4EDFA 2ECFA 4TXJA 3UCSC 3NWPA 4FFRA 3PZBA 1QH1B 4V1CI 1OWPA 5L3EA 1TM7E 1BX0A 3L9WA 3W2GA 4YCNA 4R6XA 4DC0A 4GMKA 4DCGA 4KFUA 4MR9A 4ND3A 3RR2A 2Y0BA 2PS9A 5F7XA 4MRPA 2HVYD 2NO1A 3LZ6A 4HADA 2LNDA 1R8SA 1T25A 2YXPX 3QMWA 4QARA 5AXBA 4GX2A 4MLDA 4ARZA 3HN7A 1IBKB 5C8YF 2F1RA 2OD7A 1U4NA 1LLFA 3GWKC 2YXBA 4DR2O 3H0CA 3CE2A 2HF7A 3R6TA 4DIUA 2DYYA 2ST1A 1M6VA 4D25A 4HDAA 3L7BA 2MYNA 4JYPA 3C5VA 2GSWA 3PE3A 3JWIA 4BEJA 1Q1BA 2CCKA 3V4DA 1E3SA 2B37A 3KKKA 4NJMA 3C1OA 3M4NA 1IZ8A 1ZC4A 4M99A 3MTJA 2YFYA 4IV0A 4URZR 3KSMA 4K5QA 1I7PA 3I4CA 4BKPA 3VOUA 1AQUA 1X87A 3AWDA 3PSAA 1NQ3A 1XLTA 4DABA 4GDFA 2VYFA 2WP8J 4QQ8A 3C6YA 3VTZA 4B3SO 4EG8A 2WHEA 2YJ3A 2NGRA 1TL7C 2JJ1G 3IV7A 2OPHA 1SBCA 2CUKA 3HB9A 5D5HA 4D81A 2HXSA 3OZWA 1L8OA 2Q8NA 3LNNA 4FM9A 4W4LA 4HQ6A 5DEOA 2QJRA 1MJGM 3CVJA 3TRHA 2YY7A 3W8DA 5EJ6A 1XTSA 1ETUA 5EXXA 3K05A 1MV5A 1JJAA 3A3KA 3O9VA 4X61A 2EW8A 2Z2JA 3ITNA 4J94A 4PO3X 5JG7A 2JGNA 1U8CB 2WOJA 4NPCA 2V9YA 2WJIA 4MDYA 3QPVA 4BNZA 5GIPC 4YUXA 3B3FA 1HXHA 4JR1A 3VJRA 4QXMA 1JS1X 2FZLA 4E13A 3M5WA 2OTLF 3C24A 3IELA 3GHYA 4LGMA 5AJUA 1WVGA 2C7GA 2INGX 3AI3A 1TECE 3LKDA 4IGIA 1WKVA 4RHEA 2XF2A 3DMTC 3SE7A 2QQ5A 2KSQA 1N6NA 1NVKA 2WIDA 4HDKA 4I36A 4CC5A 3VC7A 2O5RA 4MIOA 3U0OA 2QT1A 2FR0A 3MUEA 1YFJA 1S0VA 3OOJA 4NPHA 2AI1A 3USCS 1V8ZA 4WV3A 2C42A 2ZR0A 4E2ZA 5HJ2A 1QR9A 4E4EA 2GPYA 2C9MA 2IEBA 4X93A 3UK2A 2ACKA 2GM4A 3ZX6A 2DBYA 3TL6A 1TKCA 1I0LA 2XBLA 3PEFA 3UEOA 5K2MA 3EGXB 2PZKA 1XZIA 3EVCA 4D3YA 4EYKA 2K5UA 2XVZA 4BMPB 3QI7A 1ZTEA 1AGYA 3UJHA 1W0KD 3E9NA 2BSQA 1C14A 3R44A 1V6SA 1IV1A 1VZ3A 2O2IA 5FI1B 3RROA 1YJCA 2JJ1A 4HZGA 5DXJA 3W5SA 2W6JG 5KJ6A 3NVAA 1X80B 5G4KA 1B6RA 3AM3A 4EATA 3DEZA 1I3KA 4TTIA 4Z9AA 4PGHA 5FWAA 3ZWCA 4E21A 4GDMA 4MGKR 3CE9A 2UXCB 5L95A 4TMKA 3HJWC 4LY0A 2GA9A 2HJSA 3AMVA 2VJLA 3HUEA 2HWYA 2AD1A 3K1JA 3FFXA 4NZMA 1W5BA 1RBYA 3OPQA 4IHKA 4CKZA 1GO0A 1NMEA 1PT7A 1OQAA 2A9OA 3LWBA 4IIHA 4PQFA 4RGVA 5TDHA 3CLSC 1TYBE 3GLIB 3GFSA 2Z6VA 1NP3A 4D98A 1FFYA 5HCUA 1PEDA 1BN6A 5IYZA 1ZCJA 2NUPA 3N5CA 3FVWA 3QEMA 1TZCA 4PTLA 2XQFA 5B66Z 1LUAA 1ISHA 4JODA 5KKCA 4IFIA 3DQPA 1XJQA 3P4XA 3VSDA 2FI1A 2HQBA 2IYFA 2VDWB 4DCJA 2BM0A 3WNZA 4QSHA 5B6PA 2NNUA 5G4UC 3GPCA 3HBLA 4OAQA 1R5BA 2DECA 2BLNA 1SRQA 3K0BA 4GICA 4RIGA 3SX2A 1EQUA 3V8RA 2ZJ8A 3MPUA 4C14A 3FVTA 4DV3O 3A2FA 2ZF8A 4HKTA 5ALKA 3U44B 4WIAA 3AVPA 3K4HA 3BZWA 2YC4C 4K9NA 5F7ZA 1HDIA 3KFLA 3UATA 1AHHA 2EWVA 2WWIA 1XN1A 3QF4B 5AI0A 4UTRA 2GK6A 3HO8A 3TOZA 1U7HA 3I28A 1LK5A 4OK3A 3KR0A 2EX1A 1FP4A 1Y9DA 4Q1CA 4XIJA 2E74B 1CQIB 1MRNA 1HTBA 3QA9A 4M7PA 3T5TA 1GTL1 3KT6A 1JSZA 3TW4A 4O4LB 2OZBA 1N34O 4R2LA 2QYSA 1M2VB 2QY9A 1AKYA 3DONA 3ERNA 4MI6A 3UV7A 4Q3BA 4Z0NA 2BFAA 4E1VA 2IJIA 1GOTA 5ALHA 5DM6V 5I9BA 4PBRA 1Z8DA 4EHDA 1AX9A 1E7KA 1S2NA 4YMLA 3T7KA 3SG0A 4O4HF 2DT8A 3EZYA 3X2EA 1RJDA 2OY0A 1MO5A 1WD7A 2FK7A 3A9SA 4P0QB 1R6NA 2B1GA 3FA2A 2QA4F 4CM5A 1FRVA 2WWVD 1YDFA 3FPBA 3GHZA 5FA6A 3F4LA 4ND5A 2F8SA 3PLAE 1CJBA 3KJIA 4FHDA 3OCYA 2FDXA 1RXYA 5AJWA 1IDSA 4U7OA 2MSLA 3GUZA 4WMLA 3TWOA 4CW7A 4MVJP 2VDOB 4C81A 1ORRA 4D2IA 4QVIA 1RQ7A 1QCEA 1A9TA 4IDQA 4QDOA 3LDEA 3DSQA 1FDTA 2BMJA 3I8XA 4MQMA 2PGIA 5EJEA 2CNKA 3IV6A 1UMKA 1ZNXA 3ILYA 4R50A 2Z9CA 5KREA 5JATA 5I3ZA 4RKFA 1MV8A 3N8KA 4WCFB 3Q7TA 4AZTA 5CG1A 1V8PA 3P9IA 4QOIA 5AI4A 5K2OA 2REXB 4KE8A 4BPRA 1USKA 2XMZA 4MYDA 3K9NA 5C35A 2A7QA 2IKSA 4LYJA 2PL1A 2R2GA 3U7GA 4L5CA 3R7LA 2PZFA 4C7JA 3DLBA 4MWSA 3THXA 3L0YA 1QIMA 2Y66A 4KYUA 1TEXA 5HOEA 3L0BA 4TLLB 3T8YA 4DT1B 3UG7A 1KMHB 2DOKA 1JJBA 4IKOA 3I0NA 4LTDA 1U2ZA 2Q6KA 3OD5A 4XQ0A 3ZGZA 4R1TA 2ZJ4A 4QDUA 4FLVA 3VOSA 1ORIA 3IDQA 5E8JA 1UOOA 1OPRA 3KQYA 1NYLA 2IXTA 5DLEA 2Q9BA 4FIPC 1AC5A 2D4AA 2P6UA 2WILA 2VPYA 4R4JA 4B3DA 3QPBA 1Z5WA 4ZKEA 3HLKA 1R9GA 2UVPA 5EEGA 4PHTA 3I3OA 1NDQA 1TVMA 1PU2A 4IHJF 3K4PA 3LC2O 1G4HA 2FTKE 5CNIA 2IT1A 1KHHA 2KB1A 4WGFA 5FUVA 3VV2A 1EVEA 3EG9B 1GKFA 4Y98A 1G3QA 1RHQA 1R15A 2EIKB 4HT3B 3HN2A 1T1RA 2XTZA 4MARA 4XR4A 4F60A 1BXRA 1QD9A 2WIJA 3BE6A 2AQIA 2FB9A 4S3MA 1DB3A 1L7PA 1DTEA 1GZ4A 1F0NA 1PR2A 4QECA 2X4LA 3BJIC 5JEEA 4F5DA 2I91A 3COVA 3K9SA 3KT0A 4GOND 3R0IA 1WS6A 3ZMTA 4UTVA 1XTIA 1AGRA 4A8JA 2X6AA 4E2WA 2VPPA 3I9V1 2YWEA 3DT9A 1LI4A 2RCNA 5ITZA 3H75A 3IPRA 3F67A 2CYCA 3AJEA 4IV8A 4X84A 1DAPA 3UXYA 1R6KA 3BHPA 1NW9B 3R9XA 1DC3A 2I2DA 1V8FA 4RMHA 2W2NA 4YDQA 4RQBA 3SD7A 2QT0A 2G4VA 2UYNB 2G88A 3HKEB 3TZLA 2HV8A 3QTYA 2VF2A 4L6AA 3ABKC 4WZAE 1G41A 2E9SA 3B8EA 3JV7A 4FR0A 3RIHA 3AQIA 3O8CA 1HMYA 1RLTA 3BK1A 3T12A 2XX3A 1JALA 3F6CA 4JLWA 1P2DA 2X9QA 5DCYA 1MGOA 4WFGA 4Z9BA 3WTBA 1Z08A 1PCXA 3WAKA 4QWMA 5FD8A 5AUNB 4BPBA 3Q12A 4EGQA 3IAHA 4R2HA 1C3XA 1XTJA 5F5NA 3Q5EA 1B3RA 2OFPA 2VEDA 1UKEA 1TYAE 2WR8A 1DDGA 2JI4A 3CNOA 3DMTA 2XAJA 4BTLA 3I6ZA 4GWKA 4CL2A 5IP5A 3MMSA 4GUDA 1B2RA 1TQ4A 4XGIA 2ZVQX 3WOHA 3G2IA 4RFSA 3DXZA 3ISJA 3O8NA 4TZ6A 4ESEA 1YMUA 2O0KA 3LSQA 2YYAA 2AJLI 3ZD8A 3S06A 1C30A 4DR2B 2OIGA 1Z07A 3FPEA 2GHIA 2OTLV 3OQIB 4JOQA 5JXWA 4MPTA 2OO5C 2YDYA 2YS8A 1RVDA 3S27A 4QHSA 1NZ6A 4BY9D 2XMSA 4LY3A 4IJVA 4KGXA 4MO2A 2NPFA 3W5DA 2LQTA 1IWBB 4CF7A 1UPCA 2VP0A 2G1JA 4TUYA 3KPVA 4LBEC 2JL1A 2RAUA 4CIVA 1LPAB 4CMHA 1WNSA 3O4VA 1EKXA 1UDXA 2HPVA 3ZZMA 4DC1A 4V1CA 1KRXA 4Q5IA 3QNWA 4OLHA 4GC5A 1YS1X 1IEVA 2UYGA 3DTVB 1EK1A 2V9PA 1KVSA 2Z1NA 2FSFA 2YJNA 3OIYA 1ULAA 2RHMA 4DCNA 1GRCA 2CVQA 2ZJ0A 3SIXA 4BDSA 2JCGA 2C9BA 2PUCA 3NR2A 2VRWA 4FGSA 1W40A 4G1BA 4F5ZA 3T7DA 3RRBA 5HSGA 4L8LA 5EC1C 1XRLA 5FYQA 3W3AH 4U6QA 5CEFA 4D44A 1MJNA 1GGJA 1NU6A 3CX3A 2WDZA 4FSDA 1KH2A 4XWAA 3GRZA 3P2JA 5ILGA 2FN8A 1DPGA 1EFHA 1XKQA 1YVPA 1J70A 5G1NA 2YYEA 1QP0A 1M3SA 1QG4A 2GKGA 4AS2A 4ZREA 2Y0DA 1AS0A 3EZGA 1H2NA 1JDTA 1IRXA 2D1QA 2H7YA 2QU8A 2QROA 1Q19A 3GBVA 4C3VA 2QOEA 1RM3A 4M6WA 2RJNA 3SC2B 3U4CA 1POWA 5EZYB 1ZGBA 1JX9A 2NNWB 3WHPA 2PFSA 1SQSA 3ZI0A 3TGPA 2F1IA 1C2TA 1BE8A 1EWRA 1OCZB 4IFTA 4DV3B 2AFIB 1NBMA 1EE2A 4PA4A 1GG9A 1JILA 4XD2A 5TE9A 4DLYA 1VL2A 3UK1A 4EECA 4XVQA 4KQJA 1RQLA 1QR6A 4BMDA 1M33A 1YCHA 3E27A 3E9ZA 2ALJA 2W6OA 2P6MA 3R4VA 1J49A 1X74A 4MS2A 4K86A 1FUUA 2HJ9A 1O6CA 5JSZB 4KMMA 4BCBA 1DK1A 4IEIA 4EG6A 2EFJA 1TAGA 1RWKA 5G0SA 3SYTA 2ZKIA 3TSWA 1D07A 3CLHA 2V7VA 1X7HA 3WG9A 3WGTA 2HI0A 2PV7A 1PSWA 1E6KA 2XJ9A 3O2QB 4TSRA 5EZ6B 4ENPA 5A04A 1U94A 1Z6TA 5IE9A 2QD1A 1JN1A 4BWAA 2COKA 2VJOA 4QO7A 2ID4A 4LJ8A 5K0FA 2WF8A 3MWDA 3LO5A 3OETA 1MNAA 3RVKA 4EWLA 2DF8A 3FD8A 2LD4A 1G1XB 3J81M 2KB0A 1MA1A 4OUDA 1Y8ZA 4QXOA 4XM0A 1NQTA 4F2HA 4N9QA 1H0KA 4QPZA 5ISMA 3TIXB 3T80A 4RAIA 3D54A 1ADCA 4REMA 3TLAA 1JJ2F 1DS6A 3FKQA 3ESQA 5F4ZA 1BDHA 1ZUNA 1A76A 4LR3A 2OYQA 4NV3A 5IT0A 3L4BC 4DDKA 4UCOA 1WP8A 4X65O 4IVRA 1YRLA 1E79G 3JVUA 1X7XB 4NYIQ 2VNKA 2HA0A 2Z98A 3OF3A 3ISVA 1XZCA 4KC0A 2RGNA 4REQA 1MRSA 3UMJA 3W9UA 4B6FA 1YRWA 3ZWPA 2OORA 4TTPA 4ZHQA 1FP7A 1OYOA 3OEEA 5AKZA 2BJHA 3TKAA 4AF8A 4P31A 1Q3EA 3JSXA 3KRTA 3FBAA 3ZKWA 4JI2B 1RFLA 2OT3B 3MWDB 5CR9A 1ZBDA 3Q0TA 1NM5A 3DWFA 4G23A 4QDJA 4Y1RA 3T54A 1N2HA 4RPIA 4CL0A 1AH2A 2P1DA 1PS8A 4MVYA 4W6QA 3O2JA 5CT6A 5AVRA 3PG5A 5A5DA 4XWKA 3C9SA 3O8QB 1NBMG 5LYJB 3ONNA 4TYYA 5BOVA 3FKSA 4JJGA 5GTHZ 2CLIB 2GCOA 2AG6A 3G3EA 4N12A 1FNMA 3H9GA 3HLTA 1Q44A 5G1PA 4C0XA 5KX5B 4IDEA 2NV0A 3T9BA 1BE0A 1B0PA 1OLXB 1S89A 2BUCA 2JIQA 1ZJ5A 4QTTB 4ES6A 2CFSA 1BOOA 2WJZB 3LPMA 1T2FA 4CEJB 1ZWZA 5F12A 4KGVA 4GC9A 1P6XA 2AQHA 4OHCA 2GBCA 1OJHA 1E7MA 1S2IA 3GJ6A 1RWWA 2XYPA 4JC8A 3UMBA 2ZTUA 4KIWA 4FYMA 4LZZA 3U56A 3ZQ6A 4YJ2F 3KBOA 1KYOF 1O97C 3NAMA 3PKZA 1BQEA 1Y74B 1PF7E 1Z0SA 5E4YA 4CS3A 2FY8A 2G76A 1WB9A 4XE5A 4DYLA 3WRWA 1JQBA 1HURA 3C1TA 4RPKA 3VYUC 3WB2A 1Z6ZA 1I4OA 4L50A 2ZR8A 5F1KA 4AMZA 3GLHA 4KLNA 1PSZA 2CSXA 4DLLA 4EJMA 3AK1A 1GNRA 1EFPB 1P60A 1Q50A 2IUFA 4H35A 1JE1A 1U2PA 4FMDB 4JDUA 1JPNA 1KZ6A 5AYVA 1OJLA 2CHUA 2PFKA 3V6MA 4CT4B 3KLMX 4BNFA 2ZBPA 1FUYB 4L6IA 4PLHA 2B3TA 3CPSA 1QX4A 2BFNA 2BEWA 1V11B 2O2XA 2Q3MA 2BMEA 5D1NA 3ST7A 1M2WA 4YHHB 3DC7A 4C20A 1E7WA 3IKVA 1YHQV 4HHEA 4WBSA 4CM9A 3KKNA 4UOEA 4U5XA 1LPSA 3PTZA 4D3FA 2C4TA 3O84A 3RW9A 3I9JA 3LNCA 1SK9A 1JQJC 4NBTA 5CLFA 4HFMA 4EFEA 3RNLA 4MQ4A 3RWRD 1DARA 1AGPA 4G89A 1JQDA 3PDUA 3QBDA 3TTTA 4LSWA 1ECFA 1WF3A 2WWFA 5MDHA 3A4VA 4X20B 3DO6A 3FR7A 3OE1A 1R8JA 2A14A 3AINA 4PO9A 3ITKA 5FAXA 2RE8A 3JQGA 4JITA 4A2WA 1QFSA 3U7IA 5JUWA 3EDYA 4ESVA 3L8DA 4YP1A 3QKRB 3VI3B 1XFDA 2GLTA 3O4GA 2IS1A 4W82A 4LMRA 4U2EA 2ZR3A 2FSGA 2XSZA 5EMHA 3ZPXA 5BNIA 1MVOA 4QYMA 3FUCA 3CF0A 1RJGA 5HE8A 1Y1LA 5TC4A 4FONA 3T5DA 3TX6A 4FYPA 3RA5A 5EYPA 3R24A 1V5EA 2DX7A 3D3WB 4P92A 4R2MA 4WNAA 1QIFA 5DYWA 2JGLA 4BJ1A 5CLJA 4PGAA 3BHJA 2ZJ2A 3DFZA 1ZW1A 1XLTC 3T0FA 4Z4GA 3E3LA 2FX2A 2ITDC 1KYXA 2FU5C 2IEAA 3AOEC 3U0ZA 1YZHA 2PWYA 3CSSA 1IBLO 2NZJA 5EA2A 2H1IA 5K3CA 2BTEA 1GQYA 1IHDA 1UOPA 2ZPUA 3KSUA 4PYRA 4ZARA 2P67A 3ZHXA 2AR9A 2J3HA 4F45A 3B13B 2BDUA 4K03A 5JO9A 1V47A 3A25A 3E83A 3KDSE 2OM6A 1RKQA 3BCRA 2FZVA 2QRJA 3CJTA 4RF5A 2DGDA 4RK6A 1F1JA 2AZ2A 1GSIA 2H7XA 2YW9A 1RPZA 3R9IA 2PUWA 1PNMA 4UDNA 1MX9A 1JJ7A 3BH0A 1CY1A 3ESDA 1PS0A 4HGOA 3UO3A 4LI3X 1HLPA 1VQ7V 3ZZ1A 5K8VA 4KR3A 1U11A 3I2HA 5IUKC 5H81A 2JLSA 1KYZA 4R8CA 1DDOA 1Z2DA 5DM1A 1E2IA 1IBRA 1OR8A 2DRIA 2GKOA 3IURA 5HF9A 3ZTYA 2M1XA 2XHBA 3G0OA 3OIVA 3PNVA 2VJAA 4HMOA 4MITA 1XD8A 3CUUA 1TT5A 5DB4A 4UB6Z 3IP7A 4BWYA 5DHFA 5BSVA 2EJBA 3BIWA 3OURA 4E2YA 4TVOA 1E0KA 2C2GA 4JJEA 3STTA 3E18A 1HH4A 3VR3D 1ZKDA 5DULA 3MJHA 4G9GA 3G6BA 4AKTA 3PDJA 3ABMB 1DCMA 4URWR 1SRYA 1H47A 2P91A 3A1SA 4C4ZA 1APBA 5K20A 5H6RA 3TD4A 3CTMA 4QULA 4NATA 3QWIA 4RTNA 1AI6A 4I50A 2K9PA 1N6RA 1LWOA 1YZBA 2H1RA 2J9RA 3KCQA 4JELA 1FTYA 1SG0A 1YBAA 1N2CB 3CLRC 4UNPA 5T67A 2YRWA 1YFZA 2IQQA 4NOJA 3TE7A 4B80A 3ND5A 3PE4A 3A31A 2DPYA 4DR1O 3CPQA 1CQJA 221PA 2GN9A 2SNIE 4PFQA 5KVVA 2QWPB 3FOAA 5EE9A 5KSPA 3PPYA 3QTLA 3AK3A 1WLEA 1ZOLA 4GSLA 2ALEA 2ZJ6A 2I6FA 3DOCA 3QPDA 4KREA 1MT0A 1TPYA 3ABOB 3HYNA 4XB6B 5ALXA 5BWCA 2WHPA 1FF9A 3GJZA 1K4KA 3PHHA 3GGPA 1V16A 3G2KA 3GUVA 1TT7A 4JJZA 3CKYA 4I1IA 1I0IA 1H1LA 3ADDA 2GN1A 3ETGA 4B7AA 3O1IC 3PRJA 4LH7A 1WULS 2C07A 4YLGA 4EA8A 5EB1B 5B1BB 4HWTA 4O59O 1QUEA 4RDXA 4PONA 4WW0A 1TQHA 3GGCA 4P3YA 3AJ8A 3E1GA 4YUVA 4FDUA 4FN5A 4DANA 2O2JA 3M49A 4MLPA 4OQEA 3T1HO 2W5UA 4O4HB 4I1YA 1JU3A 4KVZA 5E3JA 5MFPA 2TMYA 2JD2A 4QLAA 2R6R1 1SQGA 2OG2A 1DIBA 3EJWA 3LPCA 1GZSA 4TN5A 5K6RA 3C9UA 5CFPA 2CNLA 1GO2A 3LWVC 1V3TA 3R6GA 2DERA 2BFMA 3NW9A 3U3JA 3QE9Y 1GEGA 3KWLA 3LK6A 2DXIA 1PNLA 1BKDR 1KERA 2GLZA 1RWQA 1UFVA 4RVDA 3TXAA 4O4IF 2Q0XA 1LJUA 3G9QA 2UXBO 4DADA 2YZKA 3GYBA 4ZODA 3RAFC 3BAZA 13PKA 3PFFA 4DMMA 1OC4A 2A88A 2HO5A 3KTAA 3LRPA 1RHKA 3GP5A 5DNAA 4BGIA 2BDEA 5LN1A 3CCBA 1GG5A 3RRZA 1FUKA 1PYOA 3GLSA 4JB0A 1SXJD 2C54A 4M21A 1FFHA 3BH7A 3W3AD 4YVFA 4D8UA 3MT7A 4HTAA 5IF9A 2EARA 1JNYA 1D5CA 2QAGB 4H6PA 3X2FA 3IEPA 2JK1A 3DBRB 4I55F 3MB8A 3PQ3A 1ORWA 1CYDA 2E21A 2R4UA 2VHQA 4TV9F 2YN4A 3CJQA 3PX2A 2AUNA 1TZMA 2OFXA 2AXTZ 2I6DA 2XBUA 3TR5A 3T7TA 2PG3A 1ZW6A 4X8AA 1N9GA 1EZJA 1RQPA 1WR8A 3I5AA 2PZAA 3L5KA 5DRTA 3AG7A 4YQZA 3JQ7B 3GUCA 4GR9A 4I14A 1PVOA 5ESXA 5LC1A 3HU3A 3T7RA 1ODJA 1PGJA 4MGHA 3O75A 4P58A 1W75A 1ODSA 3MJTA 2IXAA 3I76A 4ZO7A 4DMGA 2P2ZA 2LTAA 2WTUA 4RMIA 3RYFA 4C43A 2WF5A 3ESAA 2AN1A 2I87A 4DY6A 1QFZA 3GLHE 4JGSA 5HZMA 2CL7X 1UEXC 1O5TA 1M9NA 2IYYA 4CMIA 4X24A 3OUTA 1BFDA 3KT3A 3KSDO 1Z62A 4Q12A 4BEBA 2G25A 3DDNA 4DR7B 3CUWA 4TPKA 3GGJA 2HS3A 4LRSB 5KA5A 2GVNA 5KNBD 1NASA 2WHQA 3FOEC 1EJBA 1M6VB 2Q2WA 5B1NA 5JYBA 4FFBB 3KAPA 2ZI6A 4H7IA 1XZMA 3CZ5A 4WN9B 1G4AE 2F59A 2IOYA 4OQPA 1DFGA 5EUQB 1ZK0A 3G02A 3TTVA 3WGQA 4EJSB 5IUNC 1AE1A 3S3XA 1QFJA 1Y8RA 3TQSA 2F55A 3ZRXA 3CX6A 3R5FA 3VYUB 2WYHA 4JQZA 1Z38A 3I9KA 1QOPB 3N2NA 3BC1A 3BWVA 4LJKA 1N3BA 1U3TA 3SKXA 3F98A 2X0DA 3SDLA 4LRYA 2YOHA 3OMAB 2GPNA 3C2QA 3RB8A 4HAWA 2BELA 2VA8A 1E1MA 3BIOA 1WHTB 1YXBA 4G67A 4RU1A 3AW8A 4YLEA 4CMIB 2Q7GA 2WWRA 3CG0A 3TSOA 1C41A 2P9QA 2QYOA 1R0WA 4M8LA 3RBVA 4KOAA 4WY8A 1GTRA 2V8BA 1LI5A 1YK0A 3QYJA 4NQRA 1GZVA 4AUNA 5GONA 3TB6A 4EF5A 5IT5A 4JB2A 5IU6A 2GN6A 4OKSA 3VH3A 1TFRA 1GV0A 1RDFA 2W11A 3S03A 1ZH4A 4V39A 4EJSA 2AV6A 1OFVA 3GDHA 4O2RA 1QIKA 1O2DA 1ZK2A 2ZW9A 2HSEA 3BD6A 3HZRA 4UHJA 3NM5A 3O4JA 2J7PA 5F77A 4FFVA 2NYAA 2ZYUX 4B71A 2EP8A 4YQYA 1E69A 2JARA 4J80A 4FOLA 1EVIA 4F3KA 3ZVLA 1H2GA 1BX1A 4PC7A 3OP4A 3ZNNA 2ZUEA 4N41A 1B8PA 3DE3X 1FPOA 1Q43A 1ZLZA 3IKMB 4R9RA 5ALLA 2B4TO 1CHDA 1KMQA 3U4MA 2CXTA 3II6X 3K1TA 2YHIA 3MWEA 3PI7A 4OA5A 5REQB 1D2CA 3RTEA 2Z3ZA 3IVAA 4CE6A 3UMYA 5CNMA 1VBKA 4FLYA 3V42A 1I1OA 2CB9A 4LQ4A 2YZ2A 3Q5DA 4NG5A 4EYEA 3ZZNA 4EVQA 1EVQA 2XUZA 3AJDA 3PIRA 3BA6A 4F4JA 2AS0A 1J1UA 3RJTA 4H0LB 2E5FA 4IFBA 4BN0A 2BPOA 3E9EA 2ABWA 3BFXA 3EFBA 5HKLA 4C8IA 1OXBB 1OAKA 2DBRA 3UJDA 5GOZA 4ZDKA 3PL5A 1SZTA 1MH9A 1L1QA 3B6IA 2AEMA 1O96B 1X25A 3FYUB 3RK4A 1IXBA 1JA8A 3K9QO 3L18A 5A4IS 1TW3A 4PPNA 5TNXA 1YF2A 1P18A 2ADFA 1RXEA 1UMCA 2Y1XA 1LDBA 2Z4TA 1YJBA 5D3ZA 3WLOA 4UTZA 5BMOA 4NQ3A 5CM8B 1WN7A 2D74A 3EIXA 3FVVA 4AN4A 5K8CA 4NZNA 3CGGA 1M66A 5CFRA 1JXQA 2B8NA 4RQTA 2CTRA 2TMDA 2ZANA 4B4VA 5C8YB 5J3JA 1WEKA 4KO3S 2DWUA 3S2EA 1L4HA 4RLQA 3TGLA 3EPLA 4BW5A 1UINA 1DT5A 2FKXA 1OLUA 2X41A 3CC4V 1NMYA 1K06A 2ZSKA 3KYIB 4JLUA 4EELA 2P3LA 1ONNA 2FA9A 3ESYA 3DWIA 3NVMB 4FDAA 5E9QA 3TR6A 3DAOA 1IE3A 1Q92A 1ZVQA 2A8YA 3Q3VA 1NKDA 1U2RA 5KHJA 2HK7A 4E4YA 1WHSB 1LTHR 3QA3E 4TX1A 1DCKA 3ADOA 2E5LO 4RPHA 2ZLBA 3AJAA 4O2LA 1DGSA 4BT6A 1GRRA 1SVIA 2GVZC 4MEAA 4OPHA 1LK7A 1XDCA 1H38A 2P8SA 2QPLA 4LBWA 5C2JB 4OQMA 2AUTA 1RM5A 4KDEA 3U3MA 5CHYA 2RGXA 4KXLA 4EF4A 2Y1EA 4PU0A 4R7CA 4FPXA 2B92A 4GBGA 5GMOA 2RGEA 4RJJA 1JZSA 3SYLA 4F4CA 3F6MA 1M2EA 5KVAA 4XGQA 3NWOA 2A1IA 2AJCA 1MT3A 1T0UA 5E9WA 3VAAA 1SQXH 3H8SA 3PEWA 1OLUB 4KNYA 1F51A 3C9RA 4OH7A 4WSOA 4GX1A 1NXPA 1HG0A 1XALA 2Z8YA 2FUCA 3PR3A 3VTKA 2WD7A 3JQQA 1OH5A 2G7MC 1OZAA 4WOCA 3V7WA 2CTQA 5LQDA 5IAKA 4ZTZB 1DJQA 3N7TA 5TQ2B 4YV0A 5I7WA 4Y6SA 1VPEA 1KF0A 3DOHA 3OONA 4HZUA 5IABA 4LW8A 1AP5A 3ASUA 3GJ3A 4CKBB 3GAFA 2JATA 4R1QA 1RS0A 3QXSA 2FUNB 1OHHD 3ABZA 2BTQA 5DN6D 3U19A 1DQNA 4HGRA 2ENUA 5IM5A 2OP0A 3JAKA 3V8VA 4ZO6A 1I3LA 2GJAA 2IRWA 3OCXA 3A9CA 3PDCA 4LXGA 3HKBB 1C0EA 2WM9B 2HEPA 2C2KA 4N0DA 4EB8A 2CUGA 2W2MA 2YY6A 1K8ZB 5BYAA 5HFMA 4GX0A 1PGQA 3ABIA 2YL2A 4G5GA 4CLDA 5HYVA 1Y3AA 2Y8EA 1DRVA 1VIVA 2J08A 2FGYA 2QVBA 2F93B 4RK1A 1K0FA 1IC6A 4Y2GA 3LL4A 3MDSA 2VP6A 4YIHA 3ZNQA 2C9CA 4QJFB 1XEWY 2G70A 3GIDA 1MU0A 2I66A 2R2AA 2WD7B 3LYUA 4RETA 1SZXA 4GLOA 4UDOA 3SHTA 3T3DA 3WJ1A 3FB6C 1ST2A 1PYGA 5LU9A 2OGUA 1PZNA 1RWVA 3RT7A 2A0KA 2A30A 3BQNB 5JYCA 4PSCA 4TKVA 3CZMA 1XR3A 2J9GA 2JRIA 1ZD9A 5ADVA 3UGJA 3F7NA 5DX0A 5EP3A 1SU4A 4Q02A 5IHPA 1Y6ZA 3TDKA 3M99B 3JD1A 1O6ZA 3D54D 5LP6B 2ZBFA 2DMXA 4B2YA 3AG1C 4UV9A 2JGRA 3NFYA 4ENQA 2FUKA 4UNQA 5CDGA 2QRGA 3DF9A 3DYVA 4TTJA 1UMCB 3UMSA 2CZWA 1GPH1 5JCXA 4M0FA 3L6OO 4PDMA 4DR5O 2IPNA 5CLQA 1ZOIA 2QRZA 3KJZA 3QNUA 3UMFA 1M0EA 2QWOB 3I6QA 4GZRB 2HXYA 2CV0A 3PFBA 3WRYC 4AUKA 1M73E 3NK7A 2VTVA 4LTNA 5CLIA 1DT9A 2X0LA 2ZRNA 1Z22A 3ENKA 3D8RA 2PGOA 4C4AA 2E4UA 5LUAA 4IGFA 3MBIA 1PNQA 2JC3A 1PR9A 3H4VA 5FFFA 2HLDG 4D6TH 2W58A 1KPHA 1AHNA 4XZ3A 3UO8B 3MJDA 3WGLA 1M2VA 2APJA 3HY3A 2ZATA 1W4CA 2AJ8A 4MUHA 4D4JA 1Q1GA 2CVFA 4JYYA 4K9PA 3RVSA 3LVRE 1X19A 2QKYA 3KV1A 2Q0QA 3M5PA 2AA3A 4NCBA 4NE2A 2O5CA 1CRPA 2ZT7A 1UBUS 1QMPA 2CFIA 2NSDA 1R4NA 1N2ZA 2BM1A 2UUBB 2UZ1B 1NW4A 3FJYA 4N3CA 2EJUA 4BNJA 3U3DA 4OG2A 2R8EA 5FXMA 2FMTA 5EIBD 4AQYB 2JVJA 1NVDA 4UAUA 3MGAA 3KKPA 4XWWA 2OBYA 1R6XA 3WNCA 1ZCFA 4I1SA 5AW4A 2XMDA 4MWTA 4IF4A 4U2GA 3W5UA 2HHAA 4IW3B 3I72A 3WYCA 2OCIA 1TQ2A 3C1AA 1DMSA 2BSKA 1MAHA 3ZW7A 4Z1OA 2GEDA 4CM8B 4TROA 3ORQA 2PKQP 3RWBA 2IY8A 5BWBA 3OOWA 3HDHA 4TMZA 4X0EA 2BFWA 3X1KA 4AF7A 1BXGA 2RH9B 4J9ZB 3BYQA 1U6IA 2QM3A 4LKOA 4OYLA 5AKGA 4EG4A 5I9MA 4BB5A 3D8SA 4PHZA 2QP3A 1J9EA 2VDVE 3PC7A 4IPTA 1ECCA 4MV7A 4C0JA 3R9XB 4LSGA 4UEKA 4BVFA 2AK2A 1S5LZ 3DCJA 4QOFA 1R74A 3W2FA 4LAFA 4IO0A 4MWOA 3T5BA 1KJJA 3RVJA 1UKCA 2UZ1A 3BIFA 3E70C 3K6SB 3O4IA 4B46A 2ZETA 2IYRA 4XYEA 4BNDA 1STOA 4RMGA 4IIJA 5LL6P 5ERYA 3WNDA 5U4QA 3ZP4A 4QE7A 3AKYA 3V3KA 4B85A 2OCPA 2ODNA 4IJ5A 1UDBA 2WTNA 4Z4EA 1Q0SA 3ERCA 1F51E 2P8JA 4ZICA 3ZBHA 1TADA 3X2SA 3CEPB 4EZIA 1FU4A 2A0LA 4QODA 3FF1A 1OW3B 4YS6A 3SM3A 3FZEA 1KAEA 3HMQA 4TQGA 2YBEA 1KFBB 2UAGA 1CC1S 4RFSB 5KX5A 1D0VA 2IP1A 3S1LA 1T35A 2W2OA 4Z9XA 5AUQA 2BKXA 4RE5A 3WZMA 3DTUB 1PJ3A 4BAUA 3IDOA 4ACAA 3L04A 2ATXA 1BG6A 2CXPA 1FIUA 1N2XA 3FYCA 3PQ4A 4GOMD 1F7YA 2F48A 5FJIA 3UW3A 4DR4B 4FHEA 3MM4A 5DBFA 4BBJA 5KTMA 3LX8A 5KHLB 1R10A 2H0RA 3BA1A 3FOWA 3MHPA 5GZ6A 2Y27A 4OEHA 3CNEA 1VJDA 2NVUA 3Q85A 5KSOA 3U61B 2AMFA 1IZZA 2QG6A 4U00A 1BJRE 2YI8A 3LHDA 3NTRA 4OBXA 1ZGGA 3I5DA 4RHTA 2DR0A 2XGOA 2QEQA 3VBBA 1E1CA 2QF7A 3KYCA 3LUAA 1V5IA 4YJ3A 1EGHA 2AN4A 4GI2A 1O6BA 2Q3EA 3CLKA 4C4PA 3CD6V 1EG2A 3AEXA 4TSKA 3D3IA 4A8JB 2L6LA 1GRJA 3FNEA 1GTOA 2M6LA 3PHCA 3OTFA 1KK1A 3DZBA 4M7OA 3WTCA 5TB5A 2YS7A 2LCFA 3EAGA 4QXQA 4MKHA 1N92A 4N5DA 5DX8A 7ADHA 3R5HA 2XI4A 1U8TA 5HKOA 2OHIA 2Q6VA 3UJCA 2BBTA 4RGBA 1M1NA 4I9GA 3CPWF 1CEEA 4QD3A 4INOA 1HT1E 1Q17A 3RT1A 3VPHA 2NZUG 3HKEA 2OAEA 1ZNWA 3PEEA 3L6BA 1H2SB 4EKWA 3PUYA 4QGFA 1GKLA 1QR2A 1JA0A 4NZOA 3VDRA 2WI8A 1KY2A 1ZD5A 3VR6D 2DJIA 1NNEA 2CXHA 3NDJA 1E1CB 4G97A 3IC7A 3KEMA 3NHZA 4J0KA 5KCMA 3CVWA 2JZNA 3TW8B 5LBQA 2WWYA 2X8JA 1JHOA 4Y18A 1PK7A 2O0LA 4M0LA 5CDUA 4LISA 1M57B 1CULC 2BEJA 1C4WA 4LFBO 4G5HA 3E3AA 4PRYA 1OBCA 4U2DA 4AJOA 4ZMRA 3JYLA 5F5XA 2DWDC 4CIBA 1JY8A 2PPVA 1GVNB 2ZG6A 2IHNA 3CH4B 3H8WA 1ECGA 1CB7A 4PC6A 1I4TD 1KJYA 3BTSA 1QZ3A 1DIRA 1EGQA 3DZFA 4QBGB 2VF7A 4A0QA 4ASUA 2LGJA 2OCLA 2ATCA 4D0RA 1HE8B 5A3JA 4KP4A 3BVPA 4C29A 4Z6KA 2PBFA 1M6HA 3K6SA 1TJNA 4FR5A 1AY0A 2WLIB 2JHGA 1YKGA 3AGQA 4BYGA 2WT9A 4B3CA 3EEYA 3JD2A 3KWMA 4UBOA 5I4KA 4ZYUA 2C82A 5KOJA 1QAQA 1Q11A 3PI6A 1YJ8A 1SVMA 1HYQA 3K35A 1JEDA 1WP9A 5IJ9B 4HRAA 4JZGA 3L0CA 3JYOA 3WBFA 4KLRA 4ODIA 4MQFA 3UHJA 3EAQA 3PXEA 4JT2A 3BMQA 3KLNA 4PGFA 5MN4A 3B77A 2EHJA 1I5RA 2RHLA 2QNIA 1KK3A 4PZYA 5TVKA 5T4BA 3M2PA 4Y30A 4MJ7A 4BYMA 2UZ4A 5JAZA 3PKIA 1BJKA 4J0CA 3WB9A 4RULA 1UWCA 4OHOA 5HA5A 4R7GA 4W9NC 1OREA 4DUZO 2B69A 4K9DA 4ZV9A 2XAFA 3WIEA 3LUBA 4S1OA 1E1QD 1VQKV 2GOYA 3OKAA 3AGKA 3ZV3A 3ADBA 2F8TA 1LTQA 2H0QA 2J5KA 2PKEA 2Z04A 5EIWA 1PO7A 2VTKA 2L42A 3FB4A 2GB4A 3AEKA 4PAOA 3CXCF 4L4YA 2F64A 2GFQA 5C52B 3J80A 1VPDA 1RAEA 4DUGA 3O8QA 1WUHS 2WY2D 4ZCMA 3MINA 3WAGA 1V1RB 5C1BA 2VHJA 1NJSA 2VJNA 3ZU2A 4HDRA 1U0LA 4S24A 4NE7A 3UCXA 1RABA 3IPLA 1TLTA 5K3FB 1PKEA 1WXHA 1E6MA 4HNGA 4PS0A 2ZRIA 1HYHA 1V4NA 2PBRA 4N7BA 3OLZA 1EXMA 3N7UA 4ILKA 1CVIA 1D5NA 2P7IA 2WSIA 1QFMA 4ZDWA 1K8AW 3E9YA 1I94O 2V4DA 4FSHA 4E11A 1TU0A 2C9DA 2ZI7A 3CCMV 1J7HA 1GPJA 1OA1A 4F5EA 4BT5A 4PANA 4UBMA 1RI5A 2PX0A 6PFKA 4CR6A 1O4WA 3B2EA 5HY4A 4MV1A 3F47A 1I9GA 5FR2A 3QMPA 3UPDA 4ER3A 1OX4B 3S8MA 4P6VF 3HBNA 1SQBH 3W0LB 4EM6A 2JBWA 3B60A 3I6YA 5DISB 5IFKA 3F9IA 1ZL8A 3L07A 1WMDA 4ND6A 4RFLA 2P4HX 3SSOA 1AKMA 3TUIC 1FD9A 4G0NA 5HQ3A 3CC4F 2C3OA 2V4UA 1VQ1A 8MHTA 3CCRV 3O4FA 4WL0A 5LKAA 1WUJS 1P0QA 3E3OA 4PHHA 3SLGA 4NKGB 4MA0A 3NI2A 4NLLA 2B3DA 2B30A 3MF4A 4BXOA 2GPWA 3DE4X 1BEZA 1M6WA 4DCCA 3UBTA 1VQ8V 3NYIA 3TQQA 4D46A 4EKYA 1KBHA 3H8VA 3QLVC 2JJMA 4UV8A 1RRVA 2Z56A 3C6QA 3P1JA 3D8BA 16PKA 1Z2CA 2NZXA 4Y7CA 2QM0A 1ZY2A 2OGSA 3GWOA 2R66A 2FN9A 1ZNZA 4E5UA 3PR2B 3BD9A 4ARZB 4JVSB 4MRMA 2B8JA 3C16C 1QBGA 4JQOA 3UOGA 2XNDG 4QGAA 4UNRA 3L6CA 3RUEA 3ZWWA 4JI7B 3TCKA 1NXSA 1Z34A 2DYRC 1FFGA 2QE7A 3CFYA 2IHJA 3IUNA 2ZE6A 1AM4D 2ZRKA 2Q29A 4LVOA 4G4XA 1W6UA 2J3MA 1JDVA 2GYYA 2SKCA 5ES3A 5CXQA 4DJEC 4V0NA 2D5CA 1I14A 3ZQ4A 3GVMA 1K3FA 3VYSC 1QBKC 1VSVA 2K87A 3G7NA 3LGSA 4LXYA 4M49A 3IAAA 4F4IA 1UK6A 4AYXA 1T4CA 2I54A 1VIAA 1Y9JA 6GPBA 2EIJC 1G0OA 3D3WA 4P4SA 2H4YA 4GLXA 3LOPA 2DQSA 3H5RA 5A5GA 2DR2A 4LYAA 1SEPA 4FZ3A 1H4TA 4R31A 2GSMB 3K04A 3ZCUA 4UVAA 4WCDA 4X1OA 1V8OA 2XB8A 4RD6A 3ZOPA 1SN7A 4KFMA 4LRTB 1IJEA 3UM9A 1YIOA 4Z1MD 2HV9A 5IDXA 3TMKA 1UC5B 3VPGA 2QRVA 5ECWA 1CQXA 3FPKA 3N2KA 3HPQA 3IQFA 4IDDA 4QOGA 3VVCA 3ZDQA 3O8RA 1OVMA 4KITB 5KVCA 2BGIA 3CZQA 3GXBA 2AG8A 1OH6A 1J99A 3R0XA 4EUEA 1Y34E 1PRYA 2VSFA 3Q6IA 4QUHA 1Z73A 1QNMA 4GM1A 3V4SA 5CLGA 3N58A 4LOKA 1C7IA 3LBFA 4RD4A 4D0GA 4MK4A 3BWEA 4NDZA 3T94A 2YWDA 1O5OA 1PJBA 2TMGA 3DHNA 2G80A 3OZVA 1W29A 2HT6A 2B6NA 3PVCA 4IIYA 1CNMA 5I5EA 1CQWA 5KNLA 4CGYA 1QDLB 3ETQA 1E8DA 4MMZB 1IXKA 4FYVA 3RGGA 5IASA 1UKAA 2PL9A 1UK8A 4MVJA 1X7OA 4HEJA 2QW1A 2WFZA 2W6NA 2E0IA 3FMGA 5FCDA 1ZAYA 2BP7B 3HB3B 1W2GA 4BAZA 2CT8A 1PJ2A 2GRUA 2OUKA 1L0LH 2YH2A 1I13A 3UFBA 3KQVA 3K6JA 4BNUA 5M34A 3DE2X 2FG6C 1CW2B 5ESWA 1ILEA 1J9ZA 1VDMA 4DHWA 3E89A 1EK5A 4LHXA 2QYTA 1ZMXA 4ETWA 5ESRA 4C3ZA 2NU8B 2GZMA 4AI6A 1YR7A 3NBZC 1R8QA 2X7HA 4B79A 3IMGA 3Q4HB 4ETMA 1Z0AA 2YQ4A 1D6NA 4OXQA 1A95A 2VBIA 1QZXA 3SPJA 4JI4B 5AVTA 2Q7DA 1CZUA 3I12A 4O2BB 3P97A 4JTCB 3MT8A 3V1LA 5B30A 1KVTA 1RAFA 1W5TA 4ZOBA 3RIEA 3EQZA 1PUJA 3E7WA 5EYPB 2FPGA 3FZQA 3MD0A 3ASYA 4JYZA 2QGFA 3UA4A 5YASA 3UJ7A 4W5NA 2FFJA 1HDCA 1G16A 1H1LB 3EXAA 4DMRA 3VHLB 3OU2A 2JFNA 1WKBA 1J0DA 3AHDA 2QTSA 2C5EA 4H7HA 4JY7A 4M9SA 1S3GA 1U1FA 1YDXA 1IIRA 2P4EA 3PFIA 3V1NA 4WXMA 3D5QA 2H57A 1Z25A 2C4MA 2FZWA 2KS6A 2N46A 1H2XA 2AFHA 1X7GA 2DFKB 3AETA 2NU8A 3THSA 3D6AA 5F51A 3UQZA 2AOVA 1JDBC 2ZBGA 4IX9A 5TMBA 4IJ6A 1ODFA 4CUZA 2BFCB 2OCDA 1J25A 5JD5A 1P5RA 3GFPA 3D81A 2Q0SA 4F12A 5CGQB 4ZRMA 5CMLA 4O02B 1KIFA 4QSMA 5CFLA 1D6MA 3OCVA 5IMBA 4HBNA 1RQXA 2QMYA 2FPPA 5HUHA 2E4YA 1GA1A 2A9HA 5HP7A 1SG9A 2VC2B 4EYGA 3ZTTA 1TTTA 1P8AA 4UUQA 3HLYA 5JZVA 1HA3A 4MWBA 3LSTA 3DXFA 3LSYA 4YBRA 3OFVA 2J9FB 2Y69B 2RGRA 2JGKA 4KQ2A 1GR1A 3DL2A 1HTWA 3DR5A 3DVAB 3Q8MA 3P52A 1P9NA 1KSHA 3QF4A 3FCXA 1G19A 1A4UA 2PRJA 3BD7A 4TWIA 3OGIB 3ME5A 4R1UA 4JI0B 2XUJA 3T5MA 1FSZA 2R6GA 2VLBA 3LHSA 1X86B 4UBLA 3SYAA 4XX1A 1PNRA 1QU9A 1H2MA 5T57A 1D7AA 3AJ9A 3TEJA 3EIOA 3KB2A 4WE3A 1WHSA 1N9GB 1NN1A 3OFNG 2QK4A 2WABA 1X9IA 5B3SB 1WLSA 4RJIA 3VR2A 4JI1B 1BO6A 5KJCA 4DN6A 4D9BA 1OZ0A 3K5OA 5DLPA 4P2GA 3F7VC 1KBZA 1SQPH 3UK0A 2LFSA 1X1BA 4Z2AA 3T9AA 1VLHA 4MQBA 1VQLF 1TA4A 2IGBA 2QBYB 2GEFA 4DL9A 2XCOA 1O94A 1RHRA 1ORQC 1WAMA 4KP7A 2YEVA 2OWDA 1VBMA 3AOEA 3IVXA 2E3CA 1Z12A 1CEZA 2UVDA 2IU3A 1C7FA 2AR0A 2VLIA 4S35A 4DM4A 1W3EX 5BSKA 1NP7A 2W9XA 2FPIA 4KYTA 2H18A 4A2PA 4YT2A 3HS3A 3WMGA 3I56F 3TDMA 4ND4A 1RZ3A 3WWDA 3H18A 3H2HA 4TMWA 5FPRA 1XUOA 4ZYYA 4ZI7A 5JCJA 5E7JA 4O4HA 4B3TO 4LF7O 3OEWA 4R98A 5HXAA 4ZHWA 2OV2A 3EYAA 4YRDA 1YRBA 3E48A 1ISIA 1HDEA 3GRVA 1ZI8A 3PJFA 2G9IA 4J7ZA 3C3EA 3OUFA 3S3WA 2ZOVA 1KC3A 2FQWA 2G3YA 2B9VA 3NTXA 3ZHSA 1XZNA 3M6FA 3E8MA 3T9CA 5M5BA 3OLYA 4DVGA 1R4MB 4E70A 1OB5A 1Z2GA 4ZJPA 5LU8A 1CNEA 3GJ8A 3KU1A 1XAGA 1Y89A 1BL8A 4J0DA 4C7KA 2P65A 5TEWA 2IZOA 2FN3A 3WIUA 1GU1A 3NXSA 1AB3A 3IXMA 4CQLA 1AT1A 1G21B 2PGDA 4KNVA 2P9JA 3O6VA 4O33A 5JNVA 5HP4A 1YS4A 4MYHA 3MOSA 1JLLB 1U9CA 2P5YA 2QR5A 3K0FA 4V0ME 1K4MA 3ZY6A 2PUEA 1LZLA 1ZC3A 2A67A 4AY3A 3UY4A 4NV1A 3BFPA 3LNTA 3VYRB 4CKEB 4BFCA 1D4OA 1G3MA 4MICA 2IW1A 1YVEI 4QFBA 3K79A 1U9IC 5E8RA 2IDJA 1AI7A 1I33A 2XMBA 5F1OA 2QXTA 4RH0A 4BNXA 2JI6A 1EHIA 2W71A 1FVXA 5AVQA 2FLWA 3CCSV 4HXYA 5JH7A 1VQMV 1UKVY 1Z6PA 5F7JA 4G65A 1QIIA 1A5TA 5BN5B 2C9YA 3U7QB 4ER6A 1B8OA 1F12A 2Q9LA 3HN6A 3JQAD 3FSGD 1QM5A 4IG9A 4BRZA 4E6PA 4YBZA 4PZCA 3OZSA 4XJTA 4ARSA 4C5AA 4ZHQF 3QVWA 5JYDA 4A0HA 5LMUO 1GAXA 4NYIR 1NVFA 3GVCA 3EGVA 4UTPA 1AMUA 2CV1A 1CUDA 1UBLS 5EHGA 1RJWA 5BR8B 3W04A 4M8IA 3ANTA 1U6KA 5ENDA 1JPVA 4Y2VA 5ARDA 2B7CA 2VT7A 4B3MB 3IAS6 5C1OA 2Y1LA 3THYA 1E98A 2BOBC 3FYTA 4CCSA 4ZZ2A 3SJAA 3KO8A 3IOYA 3RU3A 3DYIA 1NBMD 1PFKA 1WU8A 2JFUA 1TB4A 1Z0FA 3EVDA 4JMLA 4JLJA 2HYIC 1RZRA 4RY8A 4X00A 5BWOA 2CDNA 5CFMA 1XYYA 2RIPA 2EINB 2NSLA 1L7VC 1FXVA 4PS1A 4R01A 4L08A 2GM3A 3DZHA 4J75A 4RSRA 4CEHB 1KC8H 3B38A 3RFXA 3WBKA 1XHEA 2R6JA 1SHUX 5ECGC 1PBTA 3ZWXA 3C43A 1MO2A 5IZ4A 4UBJA 4NBRA 1H6CA 4RVUA 1ADFA 3E7FA 5HW0A 1OXUA 1QU7A 3WG7B 2BGUA 3G9UA 4ONEA 3W1VA 3DJFA 2MYUA 4NDAA 3THYB 5CT5A 2OB2A 3A28A 3V2GA 1U1EA 1AJNA 2FTKA 1KPIA 4TMTA 4TT3G 4JHXA 4MW2A 5JARA 1BVHA 4YRLA 4JA2A 2AXQA 1S6YA 3IVCA 1N0NA 3H9VA 1XA3A 5AOVA 3JASA 4D45A 3CX7A 4K9OA 1XCPA 1LI7A 1SQ0A 1CU1A 1VQ4V 3ICOA 5L6MB 4NZZA 3HDJA 1C7JA 4INZA 3BE5A 1U2QA 3T0GA 3NDPA 1D09A 1FMFA 5BNTA 4AJEA 1Q1NA 1RPRA 5IBRA 2EJRA 3BQMB 4E4TA 1KMCA 4BMSA 5CVTA 4ND7A 1TYDE 2H63A 3MFYA 4R40A 3OECA 3VR6A 1WNFA 3QEJA 3QWFA 1NFFA 2IHYA 5A9TA 3JSLA 1YU6A 4NKRA 4LOAA 4BFSA 3BRSA 2V7TA 3KKYA 1K6XA 2PBZA 2FWAA 1P2GA 3LY5A 1B0AA 2PR2A 3GT4A 4LCEA 2YUTA 4HPWA 3LH5A 4L2IA 4BVGA 3QX9A 5DIFA 3VNRA 3JCUZ 4HC4A 3E8BA 1VKJA 1YI1A 3DO5A 3UAOA 2YVUA 3KKMA 2PX6A 1IN1A 2I3AA 3C15C 1EHYA 5CIYA 4B40A 5DBEX 3U60B 4PEVA 5AKHA 1BAPA 4NUTA 1GTZA 2XNDA 5AKXA 1J22A 1SULA 3TVDA 2JD1A 2ZTSA 3PXDA 2PJDA 3PVZA 4Q7JB 4CYMA 3DLTA 2IEZA 3M8KA 3U4AA 3ZE6A 1JEYB 2WSSA 4PC2A 1M1KW 1PR5A 4I8IA 1Z35A 4FB4A 2P5UA 1ROPA 2HQSC 3MTBA 4BNYA 5LQCA 3ZJYA 4KQ9A 3ZJ5A 3D6FA 1G8YA 3AZQA 3ORHA 3ZHYA 1F4LA 5K5EA 1UKBA 4K6MA 3GQVA 1V55B 4ND8A 3ASVA 3RRNA 2FVXA 4E2XA 1Y1TA 4COKA 5AW6A 4GPEA 3A3YA 1HOTA 2FZKA 4QUIA 5FPHA 4A0GA 1IZ3A 4C4RA 4H1HA 1KYVA 3CKKA 2N0SA 1CP9A 1FNKA 2C4UA 2C0QA 4K6GA 1VHLA 3JD4A 5A5VA 2NR5A 3FYEB 1HO3A 1MOPA 5E1AC 1H2ZA 1LDMA 5J2TB 3CC2V 2F8LA 1I0HA 3NV9A 1F0YA 4M7RA 4W5HA 4D82A 3PQDA 5FUBA 4EHJA 2COUA 4MP3A 4JI4O 3BHMA 3GK3A 2WSBA 2Z58A 3K9LA 3QE2A 3QJGA 5G53C 1BXRB 2QTVB 3M34A 4NNPA 1H22A 1I1QB 4HN2A 3QO7A 3PGJA 4B6RA 1XOUA 3E8GA 2VUUA 4R41A 4MJXA 4CEHA 4NH4A 3P5SA 1BXKA 1CD5A 1T9DA 2O2ZA 3NOQA 2PSDA 3QUTA 1KAMA 4FWIB 4IDFA 4HDOB 3IQGX 4IEFB 4X3PA 4MAAA 1Z06A 3G49A 4MP8A 5FORA 4DV5O 4BUCA 1PP4A 3QKIA 3G8DA 2LR0A 3CWQA 1VPVA 2BONA 4WTOA 2HRQA 3VU8A 3FSJX 5TGDA 1E1DA 1QLWA 1TU3A 1RBZA 1XMVA 3PTLA 1HZZA 3U62A 3KXIA 1MXFA 2X58A 3LYBA 1E18A 1ZIYA 4B3TB 1JDUA 1XDSA 3GCWA 1XTUA 3HEAA 3QUBA 5T8KC 3CB4A 3W5HA 2B1IA 5EJ7A 3EXFB 4L8WB 1TJYA 4XFDA 3N0VA 1KZ4A 2Y71A 4B7CA 2CHSA 1QHXA 7GPBA 2G8NA 4BQNA 2HF8A 5AJTA 3EEBA 2PM8A 3CLUD 4IKPA 2FQ1A 3SJQC 2OK7A 4JOCA 3HGMA 4X1YB 3ZXSA 1Q86H 1A04A 1G9XA 2C5AA 4HRXA 3U48A 5GGXA 1VF7A 3ICQB 2BSKB 5B7QA 1Q0LA 2BMWA 4LZJA 1R9NA 4MS4A 1GL3A 3ROEA 3NHRA 3ZBUA 4J6EA 3KEGA 4XUCA 1Y8QB 3Q3CA 1DGQA 1P2VA 1X8LA 4OQQA 5ADHA 1PT8A 1A8PA 3L8FA 1XL6A 3D2CA 3H5IA 2Z6UA 1MN6A 3FYHA 2EP5A 2X5OA 2YMPA 4DA0A 1SVWA 4JUCA 4CG0A 1JKJB 3ROMA 2VFAA 2R7MA 4WBNB 3CMEV 1C7QA 2IFTA 3PYLA 2JFXA 4KDCA 2JGJA 1DAFA 4P08A 4G4WA 2Q9UA 3GVXA 3P0HA 3SWWA 1JQKA 2D1YA 4K81B 1RYDA 4BNNA 4ZZIA 1NPDA 4DF3A 4X8OA 4H44B 3DHEA 3K9WA 4YMTA 2NTYC 2O59A 2WJPA 1NATA 4XQ9A 1LJLA 4PZZA 1XNHA 4EO7A 1IBLB 3C8MA 1JX6A 4B7ZA 4O4JB 1OZFA 2UZ3A 2FL4A 4XDKA 2GEUA 2HTEA 3CR8A 1EUDB 5JDCA 5TJHA 1CHNA 1KS2A 5K0LA 1TUEB 1ICEA 5HNKA 4YIKA 1P3JA 1WXFA 3I30X 1TD9A 3C3BA 3FBWA 4QX6A 3BL5A 3LY7A 1L7XA 2GD6A 2ZEJA 1FQOA 4OQ4A 4DJJA 3BJRA 1L3CA 1BCRB 1T5HX 3CR7A 3MFQA 1U90A 1V11A 3H6HA 4PVDA 2Q2OA 1C4OA 1E9VA 3VOAA 1QE0A 4NTXA 4HJRA 5IARA 2Q6AA 4QUGA 3PX3A 4A4DA 3SJUA 3TM5A 4B7XA 3FDXA 2HRCA 1ULHA 4BR6A 4UFPA 2PZEA 3FDZA 3M0EA 4JSYA 2P4SA 1P33A 4OH1A 2BCCH 2DWOA 2Y1OA 3NHJA 1UXKA 1JR3E 3S2IA 1ZH8A 2C4HA 2EKPA 5EESA 5FH9A 3B1KA 3MJEA 1ZS9A 4GYWA 5L53A 4CV0A 3FW1A 4MNTA 2VL7A 4NOMA 3ZI7A 1E2EA 2YW2A 3MCTA 4OF4A 1MCZA 2IDKA 1T9GS 4GKJB 4TLBA 5C8ZA 4BX2A 1Q6UA 3PR1A 4ZHSA 2BWJA 3C8UA 2BZGA 1W4RA 4GO1A 1E5QA 2CBGA 1E8MA 3EF3A 3G2HA 4D0SA 5HG0A 4ISCA 4N65A 4D4LA 4MPRA 1T91A 4EEZA 4R5MA 3W5AA 1NRXA 1U3LA 1D5WA 1GU7A 2CWJA 4PHGA 2D8MA 3BCSA 3OJLA 3QLUA 3CCLV 4HAYA 4YJFB 1ECBA 5LUBA 3UV6A 4QELA 4YRJA 1WMEA 3F6PA 1ICIA 3GLFE 4C0HA 1CJSA 4KXMA 2AI2A 3MGCA 3OLXA 3VZBA 2J6IA 2CNOA 2XQIA 3RJ9A 1V5FA 2JBAA 3NC1C 3NBFA 2GASA 1Y9AA 3LWZA 4OXKA 4WVFA 3SZLA 4D6YA 2VHEA 1GAWA 3EZ2A 5F35A 3BWYA 2WIAA 2PKYX 3GDGA 4PFJA 2XUKA 2FRDA 3X1JA 5BW4A 4MRMB 4MVMA 5E95A 2X76A 1X7DA 2NQ2C 3BMOB 1MNGA 2QGNA 4IBOA 4BKUA 3IR5A 2RGGA 3IP1A 3WA6A 2ZXEA 2V6BA 2YXYA 1SKMA 2R7NA 4BWGA 5BQFA 4RK0A 1VJ5A 1V96A 5NLLA 2YV2A 4BO4A 3TLGA 3ZWKA 3KFVA 4UFNA 4EYQA 2HHHB 3DG9A 1R6DA 1RXIA 3KE1A 1E2PA 3WPXA 2O2HA 3DNMA 4IQFA 4MLZA 2X13A 3EDCA 2PWBA 1FMTA 3L3BA 5C51B 3FPHA 3V9AA 1F5NA 4C6HA 2P9HA 4II2A 2RB5A 4QPNA 1H3FA 3N74A 1X7XA 5A4KA 5GONF 1T13A 4PRKA 3AUTA 1U7XA 2X6QA 4A2QA 3ZBTA 2CN1A 4M89A 3TIIA 5KHGA 1E7YA 2FNAA 3WADA 2ZROA 1Q2XA 2X3UA 4ER0A 2HSJA 5DYGA 3P3PA 2BGKA 3C3DA 3DC6A 4ED9A 3COYA 2B25A 1EZ1A 3W7BA 2QLNA 2JDIA 3FDIA 3L0ZA 2CJPA 2WLIA 3PICA 1Q86W 3ZIAA 2I1WA 4OOFA 4MR8A 4A0FA 3KZIZ 2VJMB 3C8LA 1GZ6A 2E1PA 3K8YA 3CRNA 3L1JA 3MJRA 4M0MA 5ALUA 1VF6A 3A3OA 3NHFA 2ZT8A 1BKYA 3R1IA 3UVEA 1G8JA 4CG2A 1IULA 3MN1A 1JEEA 1N1GA 2X0JA 4BMCA 3BMQB 5LXTF 3HACA 5A6SA 2ZI5A 3I55F 4I66A 1I6WA 5LA6F 4Z7NB 1Y7IA 3ZZUA 5HM8A 4HDMB 2VYCA 4H7KA 3G5UA 2QQGA 3ZLUA 3FVRA 4UTNA 3UJ8A 2V1DA 1W36C 3KJQA 4PYKA 3L0OA 4HEHA 5J5VA 4H17A 3CUTA 2BN4A 3PC4A 3TJMA 5IC4A 2GUGA 2AGVA 2HYDA 3KJHA 3MSCA 4XSVA 4CFZA 5JJCA 5JO0A 3SEAA 3KQLA 5C0OE 3G0HA 1E6LA 4NOKA 3GB7C 2B0CA 2WB4A 5TT1A 1JPXA 2LCAA 1FXWA 4HATA 1SZJG 3SC4A 1NVVR 2RG7A 4XIFA 2ZIVB 1PD3A 2ATKC 2WQ6A 4N23A 1WW2A 3H9UA 2XUGA 5IWAO 3O26A 2BD0A 4DPMA 4ZJYA 4PYOA 3SGLA 5A9RA 3NWBA 2F00A 3A4TA 3T9DA 5L4NA 2I3DA 1K8AH 1N2BA 4DEXA 3NIBA 1XI2A 1IY8A 4QDTA 3MBOA 1YEWA 3SJAC 4N5HX 5CX1B 2NO6A 4LJ7A 3FWPA 1AZWA 3LBNA 4EUSA 2WNHA 3W6NA 1V39A 2PGJA 2ZDHA 3ICVA 4JOBA 5T3UA 3DKPA 2DFLA 1T5DX 2A1TS 2HMYB 1RP3B 1P2SA 2R1VB 4MKFA 2BFDA 2P5SA 4BFZA 1IB6A 1L5RA 2BY4A 1EB8A 4W4KA 1Y5NA 4UU0A 1NC1A 2AR7A 1XTPA 2XHEA 3U3XA 4EHHA 5AH0A 5MF6A 1DXYA 1TIPA 2IOFK 3F0FA 1Q6IA 1JI3A 1U8UA 1V7PC 2ILTA 3H99A 4JXKA 3D3JA 4AN0A 2OXIA 4CF4A 2FJ0A 2BCEA 5ITWA 4ZHYB 4X20A 1C4XA 3E5HA 1PJ8A 4U6NA 5B7GA 1TA8A 2C4WA 1I2MA 3A27A 3SJ7A 2I62A 4Y9RA 1DLBA 3ZNPA 4B3SB 5CYPA 1QQ7A 5KJFA 4MIYA 4RVGA 3L7IA 1T6NA 1YI8A 4BFVA 5HQ3B 2YC2C 2FE4A 3E81A 3IGFA 3VVLA 1A9OA 5KYWA 4B82A 5BQ5A 3UC5A 5I45A 2PR7A 1QHHB 3CCQF 2OBLA 2HK9A 3EF0A 4LDRA 5T6BA 4EYOA 3NYRA 1DIGA 1W2BF 4XEHA 3UMCA 1J8MF 1VJTA 1SC9A 4WFBV 3ZE0B 4X6LA 4AROA 4BO5A 1EINA 1NN5A 3WLJA 4NS4A 4PNEA 1CJKC 2X5JO 3VPFA 4RD0A 2EBOA 1MDBA 3OCCA 5L7YA 1C7ZA 4IMPA 3RHZA 3PHLA 1IQPA 3UG6A 1VZ2A 2LO1A 3H3JA 4U0KA 1YQQA 2B8TA 1PG0A 5BMVA 3LDAA 4UU1A 1G18A 2DKNA 3IJ5A 2YXDA 5JRJA 1HF3A 1KI6A 2QRNA 1PZFA 3FTPA 3LX6A 4DBZA 3GRFA 3SCZA 2XT0A 3RS8A 1F23A 2CW4A 1FSSA 4N82A 3ZJ4A 1BMFA 1U0GA 3S02A 2VHXA 4IFEA 4D41A 2XGJA 1UJ4A 2NYUA 2EJVA 4FS8A 5KUMA 4FZ1A 2OMEA 3P2EA 3L4EA 2ID8A 5AW7A 1TJ4A 1FUIA 1AZTA 4GAEA 4GZ5A 4XSHA 5J5CA 3UM7A 3AVXA 5IYDO 3OW2F 3LU1A 4YP9A 4YASA 2QEXV 2WD9A 3GEDA 2JNWA 2ROQA 4Y1EA 3G8CA 3OEEG 1A0OA 1EFVB 5GJWC 1NQOA 1KY3A 3OP1A 2AYYA 4G4VA 3FD9A 4PV7A 5KQPA 4J7UA 4LQDA 1E0SA 1R16A 3IE2A 4QYIB 4RA6B 5AXCA 4TVSA 5ALQA 1YQGA 1JA1A 3G89A 3FFTA 3RKRA 3TH5A 4YRKA 4WAUA 1J8QA 5FRDA 4OBBA 5KSYA 1XNQB 4Q18A 3CW8X 4YIPA 1QZZA 2G40A 4HTFA 4OHYA 5EP2A 5L3DA 1RPTA 5KYKA 1V6AA 2N05A 1M74A 1R0KA 4EJ0A 1NUSA 3WDLA 5F52A 5TIIA 2A3RA 3ZHOA 4HX9A 2PKCA 3B48A 1BHO1 2YWRA 4RM3A 3JY6A 1R27A 5HXUA 1YCFA 3PPXA 4BU0A 4F2PA 1GT91 3IR6A 4GRIA 4ALNA 3H11B 4GMHA 4E2LA 2FJUA 3DVQX 1K68A 4RS3A 2O05A 2OQIA 4Q66C 5EFZA 3QU5A 1H8HD 3LHKA 1EFVA 2HMAA 2JLUA 1M76A 2BFDB 4HNRA 1Z68A 3WP1B 1CDOA 5E9JA 5JSUA 1GH6A 2YXNA 5L3RA 2O2GA 1VQOF 4ALMA 3H4IA 4QYXA 3DT6A 4HAMA 3SQMA 4F8JA 4JGGA 2WNSA 3BM5A 3W8FA 1PF5A 1KDVA 1K86A 4MB2A 2H1LA 1Q21A 2VQ3A 3R0JA 5PNTA 5AK6A 3VNVA 1V54B 1D0SA 2PYDA 4DSAA 2VPTA 4BZWA 3I34X 2QJ1A 1NPYA 4M88A 5FULA 1HDYA 1MOZA 2BGNA 4M9UA 4RCYA 3GRCA 2B36A 5B1SA 1V3UA 1QCDA 1X38A 5TQ0B 1XRQA 1X1QA 2YBDA 3RSQA 3IVMA 5JMPA 1V26A 3JRWA 4AKHA 4K7JA 3REGA 3RVLA 4MWCA 2AIZP 3ZWVA 1EE9A 3CONA 1EZZA 2FPGB 2GARA 4A3SA 1LFDB 3OQVA 1A9ZA 4JD5A 3ESRA 4MB6A 4J0EA 4J8PA 1Q0QA 2C3PA 5ALYA 4LQLA 4BO2A 4K9RA 4MTGA 1BQZA 1TJPB 2Y67A 2YN0A 4EFDA 5KIAA 2B5OA 3TJRA 3ZGOA 1SUCA 2C1EA 1MQAA 2NZ2A 4OJYA 1M7BA 2N42A 4F72A 5FPTA 5BNWA 4FGKA 1NNI1 5HBRA 5KINB 1OAOC 2Z6AA 3MS2A 2WF9A 4L3OA 3X3HA 3D5TA 1P5JA 4C4WC 3AIKA 1YFKA 3ED1A 2BAGA 3EASA 4H7FA 2A9FA 1IK4A 4JJAA 1GUFA 2BCJQ 2C59A 2G08A 3RG8A 3HVUA 4JEUA 4TTVA 3V32A 1PL7A 1QG2A 1KUQA 4MUBA 5KYGA 3L05A 3NNDA 2OWEA 4WCEV 2O4UX 1DJLA 4R81A 4JGIA 5AIAA 4JZYA 3JAWA 1Y7HA 4ID9A 3HJGA 3E8XA 3IFSA 4JUDX 2H1WA 4I5DA 3L77A 4V3CA 2Y1GA 1UBJS 2A5FA 4E3WA 2BH2A 4J6FA 3JPWA 1PD0A 1QVZA 4ZTUB 5BRAA 1PFUA 2R4TA 4KX3A 1A50B 3KXLA 4WPGA 3UYLA 1GM5A 1BEUB 3PEUA 5JQWA 1GO1A 4O0MA 4R3WA 2Q2VA 3FMPB 4FYIA 4KVFA 1S9HA 3LRXA 1QIHA 1IHYA 4OQFA 3HKCB 1JIXA 5JAPA 1OU4A 1YONA 3H84A 1E2LA 3SXUB 3RK1A 2GBPA 3VKUA 4B7UA 1KO1A 5AKJA 3GRKA 1CVLA 3EFEA 5E1DA 1SD2A 4HSEA 5SY4A 1BCSA 3GLIE 1T1SA 5LHGA 1O8BA 2QMUA 1T3ZA 1E4VA 2Y6UA 4DDWA 1G38A 1M6NA 3K03A 1XLWA 5FTWA 1KOLA 4JXJA 3KDAA 1FRZA 3FH0A 1VLMA 1GPMA 1N5LA 1H0SA 4YACA 2IH3C 1NWHA 3NRCA 1G17A 1GT6A 3V34A 4E31A 3HTNA 3FYDA 2WA4A 4YFYA 3SBDA 1B7GO 1GNPA 1G5HA 2R47A 5HEKA 3R7WA 3T34A 4D9FA 2OECA 4FCWA 2PEZA 3LDHA 1U99A 4W1PA 4QASA 2RBKA 3PCTA 5FNVA 3QV1A 1NXWA 1ZZGA 1Y48E 3NM6B 3EIUA 2CLOB 1IQ0A 3DDZX 5D5PA 1M7GA 1AHIA 3AKEA 4JVLA 4P4TA 2FSIA 3LUKA 2DBVO 4Q3KA 4URYR 5HKBA 4LOLA 5BVHB 5KYXB 3QXXA 4MW0A 1E1YA 2H48A 1K63A 5J59A 2ZRGA 1O94C 4US1R 5E38A 3UH0A 4WHMA 3NBQA 4C7BA 4CM8A 4BLOA 4C07A 5K9ZA 2WPDA 3HH8A 1UDAA 1X1AA 2ZFUA 1EZ4A 1IVYA 2DT5A 2POQX 1UOQA 3QELA 4TKMA 4DM7A 1OFUA 3NG1A 4H6VA 3R74A 4LMPA 3ZQKA 2GYWA 4NC9A 4K40A 2Q6LA 4TL7A 4PG8A 1KMNA 3MSXA 1Q5PA 1NVPB 1CY6A 1QO9A 1BXZA 1OI2A 2V7PA 2EGGA 1RKBA 3AI7A 3TSCA 3I2FA 5B4UA 1XDZA 4EKNB 3PK0A 1MA0A 4QPDA 4ZGBA 1JJVA 1DC5A 1BE6A 2PL5A 1LRJA 1PJLA 4ON9A 5BSMA 1N8RW 1C9EA 5KYXA 2FR1A 4CI0B 3OM3B 3BJZA 3C14C 1W1WA 1XIVA 1LH0A 1LF0A 1XK7A 1JF8A 1RC8A 4F97A 1V9CA 2OZVA 2X3FA 3E8FA 2I6SA 4PC1A 4TM7A 5DHUA 4L16A 3M3DA 4JBYA 3DKKA 4K6HA 4QBHA 4UQOA 3RV4A 5FA8A 5BY2A 4BDTA 2QEXF 4YJHA 2WYOA 3EFOB 4LF9B 5SZJA 1Q22A 2LP4Y 1N0UA 2BT4A 3ZHRA 5EWRA 3H0EA 1UI9A 1ZOSA 4QNNA 1XAJA 4WK2B 3AUSA 1YHQF 1N4DA 3AF5A 3KU4A 4HGYA 3DV0B 4R2JA 4HUQB 4MYSA 2YIBD 2OV3A 4NWIA 4LJSA 5B3JA 3OZXA 3C90A 2SBTA 1ISPA 3OAAA 1M67A 2WFLB 5A62A 5BQOA 1ID8A 4NAUA 4GP9A 2ZDIC 4UPEA 3HQ4O 2ZIAA 4R9UC 3V97A 4O4LA 2H08A 2JF0A 1LX6A 3E8HA 3EQ9A 5FUYA 3EQ8A 4QU0A 3VO8A 5AVSA 9GPBA 2PZBA 4DJDC 1KVRA 3IILA 5H4HA 4W5RA 4O2AF 4Y2PA 4RJKA 3VNSA 2BHLA 2E6UX 4WECA 2YSUB 5J2UF 4DCPA 3A1UA 1NMSA 1NLMA 4I9FA 4BQEA 4QGSA 3QSGA 3O82A 5HKKA 2VH1A 1QQAA 1ENPA 3PNPA 2O20A 4FLEA 5ENVA 3IAS1 1XC7A 3AV0B 3CRAA 3B3GA 2A1TR 3FI0A 3SZUA 4EGCB 4HNVA 5FHRA 4X6XA 5L3QB 2JAPA 1K8RA 1SCDA 3KL4A 4IP0A 4CDGA 2FYUH 1W9MA 1HQCA 4TL6A 5E6UB 5KAFZ 1U8XX 4JBIA 1KEEB 4CCYB 1P7VA 3P20A 3PRKE 4YXFA 1MVNA 1P7YA 1Q15A 1A7KA 4PG7A 5AI6A 1AVTA 3WKEA 3NKVA 2GHRA 5FOWA 2PJZA 2V7XA 1J5EO 1HNZO 2DTEA 5FPYA 4A6DA 5JXGA 2ESRA 1DKRA 1AO3A 3UAVA 4C4SA 4Y67A 1D6JA 2ODEA 2DE0X 2V5VA 3EEIA 2AH5A 4YI3A 3B5EA 4PCAA 3TLBA 3IBCA 4WK6A 1OCOB 1G2QA 3ZGYA 1DT3A 2DBZA 1JKIA 1SOUA 4IXNA 2R86A 3R7FA 4G4YA 4Q3LA 2AC2A 5EJMA 5EK0A 3CHYA 3KOUA 2F3PA 2QLFA 5K4GA 3VO9A 5JH7B 1IHUA 1JT2A 1XOIA 3CEIA 5FUQA 1SZQA 4RZQA 1E2DA 4CH3A 4IOMA 2XKJE 1KFEB 3T5GA 4RY9A 4PPYA 3JQFA 1HC7A 3QM1A 4IL5A 4C82A 2FH5B 3SPGA 3PNMA 2WPDD 5LGNA 4FX5A 4K0KO 4TZKA 1ZWLA 3M82A 1KJQA 1DCFA 3EWIA 1I3NA 1JMYA 2RI0A 2F9FA 4GPBA 4BJ3A 5B5SA 1RLIA 1FSGA 2NVWA 1NS1A 1IN7A 3SIWA 2YWFA 3HA7A 2ZYWX 3T1YO 4G2TA 4OMDA 2BEUB 1E3TA 4QTXA 4TKVB 2VNIA 1J2UA 2CHEA 2G67A 2BFFA 3LCMA 3NT2A 5KNDH 5KTNA 1JNXX 4EX7A 3F7YC 1UK7A 2VAPA 2KLBA 3ETLA 1A69A 2JJ2D 5AI9A 5ULLA 3I83A 2RSLA 5FO1A 3VNQA 3K1AA 2VYVD 1YJWV 4KX5A 3A9VA 2O8FA 3ESCA 2E3JA 4HY3A 3UWMA 2CNNA 2VCEA