4HNAB

Kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
431
structure length
431
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Structure of a kinesin-tubulin complex and implications for kinesin motility.
pubmed doi rcsb
source organism Artificial gene
molecule tags Motor protein
total genus 172
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hnaB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4hnaB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4hnaB01
3JATA 5EZYA 5KX5A 3JASA 3WGNA 1W5BA 3WGJA 4F6RB 4TV9A 5IYZB 4M8IA 5J2UA 4I50A 1TVKB 5LA6B 1FSZA 4U39A 3RYHA 5LP6A 4HNAB 1JFFA 3CB2A 5GONA 5CA1B 3RYIA 4I55A 4EI7A 4IIJA 4O4LB 1W59A 4FFBA 3HKCA 4ZI7B 5EYPB 5LOVB 3HKEB 3JAKB 3WGKA 1Z5VA 1W5FA 5ITZB 2RHLA 2VAWA 3UT5B 1TUBB 1Z5WA 4O2BB 3HKEA 2Q1XA 3N2KB 3VOBA 4LNUB 3M8KA 1TUBA 4U3JB 5C8YB 5CB4A 4YJ2B 3JALB 2RHHA 4X20A 5LA6A 4ZHQB 4XCQA 4TUYB 5JH7B 5MN6A 2XKBA 4DRXB 3WGMA 5CA0B 3E22B 4F6RA 5IYZA 1W581 1TVKA 4HNAA 5BMVB 3ZBQA 5IJ9B 5LXTB 3RYFB 3N2GB 5CA1A 4O4IB 2VXYA 3HKDB 4X1YB 5FNVB 4O4LA 5IJ9A 3RYFA 3WGLA 5M7EA 1SA0B 4X1IB 4ZI7A 4O4JB 3JAWB 3HKBB 5EYPA 4WBNB 4IHJB 3JAKA 3JARB 5JCOC 5KMGB 5LOVA 3R4VA 3ZBPA 5ITZA 1RQ7A 4EI9A 3UT5A 4WBNA 4B46A 4IHJA 4O2BA 4O4HB 3N2KA 4X1KB 4EB6B 4LNUA 5JQGB 2RHJA 2GVIA 3RYCB 2BTQB 4U3JA 5C8YA 2R751 4B45A 4YJ3B 5IJ0B 4O2AB 4YJ2A 4O4HA 5JCOA 5J2TB 3JALA 4TV8B 2VAPA 2XKAA 5JQGA 1OFUA 4ZHQA 2R6R1 4TUYA 5JH7A 2BTQA 4I4TB 1W5EA 5JVDB 3RB8A 4YJ3A 3ZIDA 5J2TA 1RQ2A 4DRXA 4DXDA 1FFXB 5CA0A 3JATB 3E22A 3VOAA 5KX5B 3JASB 5EIBD 5BMVA 5LXTA 3N2GA 1FFXA 4O4IA 4TV9B 5J2UB 4I50B 2BTOA 3HKDA 4X1YA 3RYHB 5FNVA 5LP6B 3VPAA 5MN4A 1JFFB 3VO8A 5GONB 1SA0A 4X1IA 2RHOA 3JAWA 3HKBA 4O4JA 4I55B 3RYIB 5KMGA 5LYJB 3JARA 4IIJB 4FFBB 1W5AA 3HKCB 5LYJA 3M89A 4E6EA 2VAMA 3C8LA 4EI8A 4X1KA 4EB6A 5MN5A 4ZOLB 3RYCA 3V3TA 3VO9A 5IJ0A 4O2AA 4KWEA 4TV8A 4ZOLA 5EZYB 5LP6C 4I4TA 5CB4B 5JVDA 2Q1YA 1RLUA 4X20B 5EIBC
chains in the Genus database with same CATH superfamily
2BFBB 5LXTF 1NW5A 4W5OA 4LFAB 3NXKA 4IJMA 4LGCA 4L72A 3IVRA 4XYGA 4WT7A 4LDNA 3K5HA 4E15A 3L75H 4UEWA 1KQFA 2Q1XA 1XVUA 2OCIA 3OFKA 2IH5A 3TVDA 1EN5A 2AOWA 2C29D 5AJWA 5EUBA 4MJ7A 2H1FA 2VDPB 3FNHA 2IDKA 4YAFA 2I7DA 3GNTA 4NXNB 1SC5B 2BKVA 3C3BA 3I1IA 1WQ3A 2FG6C 1YV9A 3IXQA 1Q7TA 1IG3A 3GCXA 1H93A 2R65A 5E8JA 1DAIA 2DUNA 4N5LA 2GPBA 3HBNA 1F8UA 3HA7A 1G3IA 3BMCB 2WIJA 4UUAA 2H0QA 1U1IA 5AKHA 1F38A 1YC2A 4FI3F 2JIZA 1XNRB 3OY7A 3GAMA 1K06A 2WWFA 4CKWA 3QHDA 4WBXC 4CCYB 3DFMA 3U60B 4OX9Y 3WMEA 3BWEA 3KALA 3WBBA 3OMLA 1UH5A 5C18A 3IR7A 2Z8YA 1U2DA 1XWWA 1XJ5A 1XKTA 4XX0B 5BORA 4NYJQ 5JSKA 3BZBA 3LNNA 4FWBA 4LC9A 4XRRA 5G40A 3RF7A 2NU7B 4PGAA 3GU3A 2EKDA 3HA5A 4C03A 1M7HA 2E37A 3E9RA 3PJDA 3MT9A 1U4SA 4K6GA 1QIGA 5GIOC 3LHSA 3G9QA 1EJBA 3ZIAD 3DMTC 3UFXB 1MTZA 4K03A 4KBGA 1O95C 3ORYA 4UW9A 1QRTA 2X9NA 1PFWA 1JTVA 1RYMA 1T1EA 3I9JA 4O6VA 2OP1A 5KA6A 4PCUA 4U0KA 2A1TR 2PX3A 5KSYA 3VR3D 2ZATA 1LV8A 2Q2VA 4UMVA 4I46A 3D0OA 5F73A 4GICA 3KKKA 2I78A 1HZJA 3I9KA 2X1LA 3ZXYA 1MORA 1GWNA 4G84A 5LIPA 5AVXA 4DV6O 1A97A 5EZYA 2CYAA 3QVOA 1LS6A 5CD9A 2QR3A 5LQDA 2H6EA 1ZA2A 3OEHG 1P91A 3W77A 1CUCA 2ZT7A 4OMDA 3O8NA 1YZYA 4FZVA 1N5RA 4RACA 4LJSA 5FUVA 4JY7A 4JLBA 2H08A 2Z2KA 4BVAA 2XKBA 4B7XA 3AEQB 2RHGB 1T1JA 3DDWA 4L0MA 1EFRG 4DEVA 5IUKC 1H4QA 3ZPXA 2DY1A 3GFOA 3PICA 2PGJA 5DT9A 3JALA 4ASUA 4ND8B 2P6OA 3PPIA 2P11A 1J2UA 3F3KA 3C9UA 3NQ41 4RKWA 2GVZC 1G6UA 1JNYA 4BCDA 2Q28A 4QOSA 4H3HB 3FFXA 2RSLA 1XZHA 1Z3IX 3AI7A 3IMGA 3IVMA 2F4VO 1JR2A 1QE3A 3BA9A 2HZBA 3WGJA 2Q3CA 2TECE 2O3QA 1SVIA 1CR6A 3V7EA 1CR0A 3FLBA 4J0DA 2B4YA 2O3JA 2ZJ8A 3TLXA 5KEIA 3AKDA 1IBKO 5H83A 2PS9A 1ZD1A 1X13A 1QYWA 3WWYA 2GN9A 5I9MA 2GLXA 1YTUA 4M21A 4AWXA 3DTVA 1E5XA 4GAEA 4ZIBA 5HJ5A 4HYQA 2NACA 3TAXA 3CD6F 3AHGA 5ALIA 3QKSA 2YIVX 2H5JA 3A4TA 3TOSA 2OTLV 2I54A 3AETA 4KFRA 3MT7A 3Q7EA 2CUNA 2PZSA 4WECA 3D7LA 3T34A 4NV1A 4GVLA 1YR6A 2WPNA 5EZYB 2B69A 3EF1A 3SS9X 3UKDA 1G6KA 1G1XB 3FNGA 4TYPA 2A88A 1FDUA 2H31A 5F7ZA 2OD9A 3K9GA 2PPLA 2ZU0C 4UV8A 5HRCA 3NATA 4P32A 3L0PA 2Q2NA 4AMZA 3RH0A 5H68A 1BSMA 2XV1A 3Q8MA 5EIHA 4F8JA 4A7PA 3BRWD 2VQDA 5ICFA 3I55F 1PR1A 2BFFA 1K66A 4P6VF 2HJGA 3V8QA 1UK9A 5DM4A 1KKCA 4GI3A 1Z4IA 3OIVA 2IYSA 3EPKA 2WB4A 5E2BA 5I3ZA 4YRQA 3GLFE 4IQ8A 2I0FA 3TLGB 4DJ5X 2OORC 4OM8A 1EP2B 2POCA 1L2TA 4G81A 3ZWYA 2JGJA 1OB5A 4PWZA 3DZ8A 4E5KA 4IIVA 3KJEA 2PA3A 4TYWA 1KTIA 1TAHA 2EIXA 4WFGA 3SYTA 3RVBA 3W2EA 3ABRB 3SWWA 1E92A 4GPD1 1RWOA 4BN0A 4ZQBA 4B8YA 2ETVA 5KWSA 1KO7A 1N8RH 2IH1C 2VJYA 1CQJB 4DNXA 4UJ3A 1J2YA 5GIOE 3H87A 1Z5WA 3E53A 5H1YA 5EWJA 3N76A 1SCAA 3WIBA 4BW5A 1H0KA 1Q3EA 4X65O 3IQZA 4GQIA 3L7AA 5JD4A 2UV8A 2DJVA 1JG3A 3ZN0A 2WU4A 4ND5A 1Q11A 3O94A 4CTNA 2X8LA 5HY0A 1Z5UA 1OFUA 1PR2A 5WRFA 1IHUA 2O5VA 1OFGA 2R6CA 2KGWA 1RAGA 1SF9A 4XUCA 3CRW1 2EIKB 3LA6A 4O4HA 5AVVA 1OIWA 5JXIA 3GEDA 1R12A 1KI2A 2O3RA 1ZXLA 3M9WA 4GO1A 2DUUA 5CURA 4N49A 4O0MA 2PX2A 4LX8A 2EZ9A 1TQHA 1QE0A 5BSUA 1GPH1 4H7PA 2IH3C 4FMDF 3A37A 2N05A 3EQ6A 4YV0A 2VNIA 2JCBA 4PDLA 4DG5A 2NAPA 1UK7A 3RIHA 3KQNA 3TQCA 1Z5NA 1VMKA 4X94A 2JJMA 2XODA 2ZCUA 4IKEA 4PJ0Z 3GO4A 4UZFA 3DFIA 1ISSA 3OEWA 4MS3A 2GXQA 4J9VA 2JA1A 2OTJF 4UULA 2UXCO 1DFIA 3S2EA 2SICE 1AOXA 1RFGE 1X9IA 5I9SA 1EESA 2N42A 3LSQA 5JXJA 1I7NA 2EBOA 3R6TA 4BBPA 2YFQA 4AJLA 4YMHA 2I62A 5G4UC 2AG6A 1VCMA 4A6EA 4P81A 3PCXA 1UBUS 4R05A 1Q7YH 3S28A 1UFKA 1VJ5A 1A8IA 1CS0B 4W5HA 3BWVA 3QVTA 5EMLA 3VH4A 3STVA 2CV0A 4K7JA 3ANSA 2NW6A 2ZAMA 3QWAA 5CYFA 4DZZA 2AEFA 4UCTA 1SXIA 2OUIA 2ZCVA 3GH3A 5EJ9A 2I2BA 4L95C 4NARA 1XMPA 4KBYA 2IOYA 2H2IA 4BVJA 3K0SA 2BFCB 4NBVA 1XTUA 1JKFA 1GU1A 3OJXA 5E79Z 4AG6A 2YHBA 4KR3A 3FLAA 3QELB 2QS9A 4YRRA 3ROFA 1OH6A 3CS3A 2BLNA 1D2RA 3FLEA 4UEJA 4IYHA 1UAAA 5ITSA 5C8YB 1H2SB 1X1SA 3STHA 1XF1A 4LOJA 1E2JA 1PJZA 4M8SA 3S7TA 1M66A 2ZB8A 3ZR4B 4TXHA 4KJXA 4IRXA 5I7VA 3BGSA 3CONA 1ZLZA 4QPNA 2W83A 4O4HB 5ALKA 2JANA 4MUNA 1L4YA 3G59A 3M6WA 2DFTA 1O96A 4GH5A 5B3KA 1EB8A 3NTQA 4K8ZA 4NTXA 4ZZ2A 4PBRA 4PN7A 2FCRA 2KTVA 3CCLF 2JCGA 3B5EA 5IAAA 3D3WB 1P75A 1LNQA 5AKYA 3D4PA 4II3A 4XR4A 5BW5A 1LNSA 1YZKA 2OO3A 1JFFA 2P2GA 3TK1A 2WUGA 1OZAA 1COWG 2YV1A 5IAOA 3Q4HB 1YUBA 3OTIA 1B8NA 4FPPA 4LQDA 3UKJA 2PWZA 4HQ0A 3ETEA 2HLDD 2D59A 3NR2A 2BFDA 1RZ3A 4TYQA 4M1WA 4KQ2A 4FFVA 1CY4A 3Q8KA 1Z88A 1OROA 1N75A 5EY5B 1DKLA 3MTJA 1H0SA 1HTTA 4HO1X 2EV9A 5EVCA 1CQWA 1N9KA 1HG0A 1JN0A 2FPIB 4RTLA 2I4OA 1TUIA 3BIFA 1ZNZA 4UUMA 3P0ZA 4O1MA 3CCRF 5TQ2A 1GUAA 3KQLA 1RNLA 3O65A 4NZZA 3QE3A 3L1IA 2X58A 5KHHA 2BDEA 2G1KA 2FPGA 1JBEA 3MUFA 2W0SA 4UPVA 1VLLA 2X6CA 4D92A 1O6BA 1CDEA 4B3RO 1XTJA 3OM8A 4R2MA 1P0QA 4EG8A 2AN9A 4OMFG 1T1IA 2MINB 3PI6A 1C30B 5JUWA 1Z4MA 3B8HA 1VQPV 1C7RA 4OQDA 1A5ZA 5B30A 4QTXA 3FZGA 4H3SA 4RF5A 5EJIA 4P0QB 3T1VA 2HBQA 4N8DA 3H2IA 2H94A 4NB5A 1ABEA 4RK4A 4FS8A 1J8QA 1Y8RA 1KY5A 1MC4A 4BWFB 4CYMA 3NH6A 4Y2RA 1NF2A 4MUEA 3U4DA 4R1SA 3MAQA 1ACMA 4R9RA 1ZOIA 1J0XO 2DWEC 2LGWA 2BJWA 1YXBA 5AUPB 1I5YA 1F0KA 2NMUA 5JC8A 2B6NA 4CR8A 4B6EA 1CTQA 3OJ0A 3O4VA 3R6WA 4MUAA 2PRZA 3A4NA 3R09A 3CJRA 3DE0X 2WHPB 2M6LA 1P31A 4WOBA 4WOJA 5B3LA 3GZTB 2HKOA 1IDN1 4GD3Q 1H6DA 4X3MA 5F2VO 1DIAA 2L26A 4CEIA 3WK7A 2C9DA 3L92A 3KTAA 1ITZA 3EXEA 3PHBE 4MUMA 4PV7A 5LCXA 2ZBDA 4HB3A 1JPUA 2JI6A 1IU9A 3DPSA 2L82A 4I50F 4Q3EA 3KQUA 4UHBA 5JO9A 2BFDB 3RC1A 3UMJA 4KYIB 4O63O 1IOWA 2OAP1 2IEYA 1BZKA 1KEVA 2PD6A 2JG3A 3HL0A 1IXRC 2BOVA 1QKKA 3B40A 5HILA 3IO3A 4OK5A 1NP3A 2YWCA 4COKA 4QWMA 5FWDA 3Q1KA 5FPHA 3S27A 3L7BA 3OAAD 1CRQA 1IUNA 4KU4A 1M10A 1GK9A 2B98A 2OLJA 4DR1B 1H5UA 3P9KA 4UC0A 2P2YA 2E5LO 1N78A 5IPFA 2RBEA 2UYOA 4PNHA 3MFYA 3FOBA 3DOFA 2OFWA 4EG1A 4J4BA 3RT1A 3EG5A 3DP9A 2C5AA 3GDWA 2GKSA 3ULKA 2P1RA 2W6ZA 3ZBHA 3BB1A 1C50A 3P2YA 5THKA 5CM9C 4WV3A 3REQB 1X9GA 3KLPX 3NK6A 2LPMA 4R1OA 4RDHA 3PQ6A 2EEZA 2E4VA 4ZHVA 3RLFA 2IU4A 4F8YA 3RKRA 4OXKA 1XTPA 2EF0A 2ZTUA 4M9QA 5L45A 1J2TA 4BATA 2ZR8A 3VZRA 3D6HA 2J87A 5I51A 3EXHB 1ADGA 3ANLA 3NVIB 1E64A 1X7XA 1SOWA 1BCRA 3NM6B 4M9SA 5DWDA 5BR8B 3QEMB 1FFBA 1L7OA 4LVCA 4X62O 5EUMA 1XEWY 4D3DA 4BQIA 3RYIA 2WT9A 1T9AA 2FEOA 3TTWA 1TZ2A 1X38A 2ARKA 2F7SA 1I2ZA 1SB8A 4HCJA 4Q02A 5KYYA 1CF2O 2QQGA 3T4DA 4TSFD 1V7ZA 3HB7A 3P4YA 4LZWA 4MQBA 1VQLF 2B2XA 3ZZUA 4J0EA 3TINA 4DIFA 1TYDE 4UVIA 2ZRKA 4HDRB 1A50B 1X0XA 2P3LA 1POWA 4FLFA 4CH5A 2R4UA 1FYDA 5HFJA 4KODA 3PA8A 3JSLA 1MB2A 4O59O 2BH2A 3B6KA 3PQ3A 5LZ8A 1PG0A 3E2IA 3JQ7B 1JJVA 2HA3A 1GN3A 4EVIA 3OOSA 1E6LA 2G5TA 3LFOA 3TVTA 4OQZA 4NWIA 4U7WA 4LX0A 4LMAA 1Q91A 2IOHA 4Y0NA 4BEWA 5C7LO 3EORA 2XKJE 3OOJA 1P7ZA 4TV9A 5FWYA 1W36D 3RYHA 4HH4A 3GT7A 3ZVNA 3THOA 3RD5A 5EAZA 5K0ZA 2E4UA 5D00A 1L5QA 2O1EA 1IN6A 3U48A 1PJQA 1E0SA 1XMOO 3UUEA 2PX5A 1C9EA 2PGGA 3JQGB 1UK8A 3PLNA 3WL4A 1DQRA 1Z18A 1U65A 3MXTA 1I4LD 1KWKA 4G5GA 1ETUA 1RAHA 4A0FA 3NYIA 1U0EA 2HVYD 5T7BA 2XWJI 4URHA 1CDZA 4KXMA 3CG4A 3ABMC 5C52B 2FPOA 3NV9A 5IUJC 5HRUA 1MOZA 1OV6A 1BKSB 2PTHA 4YP9A 3OOWA 1J8FA 4BYGA 3J81A 1JJFA 4IDQA 2A9VA 4PGHA 1P1BA 5FUBA 5B4UA 4CR6A 1JR3E 4DA0A 1CUZA 3ELWA 1YJBA 3HVHA 1JV2B 1Y1PA 2AK3A 2JLSA 3L7QA 1RYDA 2AOTB 5JNLA 3EYWA 2VRZA 2FR0A 1PE0A 3NG1A 4WKOA 4HNSA 5IKEA 3PQ4A 3P26A 1UBCA 3CCEF 3FAZA 1JHQA 5AWFC 2WLIB 1Y9JA 4A0QA 3DMTA 2NLOA 3FKJA 2JI4A 1O95A 3R3UA 1P0IA 4N7BA 1C3EA 5JECA 4AI6A 3T7RA 3N75A 3OUFA 3SYLA 3ZRSA 2ZJBA 1XQYA 2A4MA 3WGIA 4R9VA 2YWEA 3WB0A 2H54A 2OYQA 1GYRA 4QJFB 4Q5IA 3KE8A 1LR1A 1OVMA 5C8DA 3UW3A 4OP2A 4G9GA 2D4AA 3RTAA 3ZGNA 1BU5A 1P6UA 4IIJB 1GPKA 4EF6A 1U2DC 1VJ1A 3NBKA 2GYWA 5D8DA 1VKNA 4C81A 4HGQA 3RS3A 3B70A 2QTVA 5BMVF 2CAZC 4CEJB 2IPNA 2DH6A 5G4VC 1Z83A 3B5JA 3OQNA 2GBCA 4I55A 4MQUA 1RRMA 3CX7A 4R8LA 2J0EA 3ZE6A 3DT6A 2X86A 3S2FA 2QGNA 1Y4DE 2AG1A 3BL5A 1GTMA 5DB4A 3IT2A 1GDHA 4QVGA 4L5IA 3K1TA 3SYPA 4K87A 1UT8A 4JASB 3OKFA 1K33A 4AJJA 3KKYA 4B80A 2AI3A 3CG6A 3GLIE 4XQCA 1NLZA 2IYVA 3RUAA 4LGVA 4M0KA 3OJOA 3R9KA 2P0EA 2QU8A 2JLRA 3GLFB 5L9AA 1W73A 3JW8A 2E1RA 5ITVA 2TMKA 2BV3A 2VYQA 4Z5XA 1JFSA 1ZJWA 4DC9A 1SZPA 2AXEA 3TKAA 3IPRA 3ZQ6A 5LGNA 4Y6SA 4YEDA 2XHBA 4I14A 1S96A 3W8FA 2CDBA 3GFTA 4TTTS 2C7PA 2HIHA 4IQFA 4GE3A 4UPDA 2G25A 5I7OA 4LF7O 5EIWA 2J6BA 1XLVA 1OFUX 1U80A 1REQA 3CHYA 1Z36A 2CFIA 4WFHA 1PR4A 1YKFA 3AESB 4KIWA 4PI0A 4CM8A 3LCUA 5A3JA 1RW4A 2XWPA 4LF5O 1WXGA 1CWUA 3GJ3A 5LGUA 4BVFA 5B36A 5K1XA 3K5OA 1GZ5A 4U4AA 3N5KA 4EFKA 2A0KA 3SYAA 1OR8A 2FMLA 1HMPA 1YCFA 1V25A 4N40A 1HYEA 3RE3A 1R8JA 2OWOA 1PJCA 4HGPA 2NZYA 2BUBA 4GOMD 3WLLA 2GPAA 4YONB 4BFCA 5FADA 1CUAA 2B2NA 4GYWA 5FR2A 4YCAA 3FYEB 1F51E 3G1UA 4IWNA 4ZT7A 4CKCA 1WOMA 4CR7A 2ZSDA 1CK2A 1OJ7A 4R69A 6REQA 5ARDA 3R7DA 4QXRA 3PD1A 1AKNA 1CVRA 1V16B 4CF3A 1CY1A 5ALPA 4QECA 3L5KA 5CBKA 1M33A 2FLVA 5C7OO 4CV3A 3X1ZA 2DYSB 1FX0B 2VSFA 2W2OA 5DTJA 4QM6A 3J80M 3FBWA 4INAA 3G88A 3ZU5A 2QG9A 4CFYA 3RVDA 4CLRA 5KNBD 4QIWF 3TR6A 4BP8A 5B2EA 3UQZA 4UTOA 2NXNA 1H3NA 3FZQA 4LF9O 1AXRA 1R9JA 3KQSA 5CM2Z 2VJQA 2RCVA 5HRAA 5JAHA 1X9HA 1TIBA 2BGIA 1CUFA 3EWAA 2OORA 3RFVA 4G4IA 4XFDA 4AI8A 3OM0A 4F71A 2DR0A 4H0NA 3IJ4A 1U6JA 3HKDA 3T7AA 4ISCA 4DMLA 3G4SF 3M1YA 4MYRA 1L3IA 1N8TA 3DZDA 3SJBA 1AK2A 4K3AA 3PC8C 4CQMB 2JGNA 5JNSA 3LP6A 1T0AA 4JAVC 3I32A 1LBTA 2PKRA 2HRQA 4AS1A 1Q15A 1E99A 3APQA 5K9ZA 1KMMA 3N53A 1DBQA 1NMSA 5FA8A 4DXWA 4MULA 3DXRA 3GUCA 1GP2A 2XNDA 3RK0A 2GFHA 3AF5A 4CGYA 5CTAA 3CMAF 2XZLA 1SBZA 3U3JA 5I45A 3E4CA 3GEPA 3GRKA 2RJOA 1JT9A 2P91A 1SJ9A 4X91A 4LDZA 1N8KA 4ND3A 3KAQA 3VTKA 2QEQA 2QZPA 1OBOA 3FF4A 2YV4A 3UO3A 1NFFA 3SBEA 5FPSA 3O7MA 4YAUA 1MO3A 5BQFA 1LUVA 4D4LA 4KC0A 3LBIA 3FTDA 3NHRA 4CE6A 1Z4NA 9LDBA 3UJ6A 1ODLA 1U94A 4NZYA 3CUUA 3OE5A 2Z4SA 1KXZA 3WYNA 1U7WA 5KYXA 1YS4A 1ZIYA 1VCOA 4C4OA 1US8A 3FSRA 3OUTA 3VA7A 4C88A 3PZRA 3IL2A 3D54D 4DIDA 3CLTC 4OA8A 3DMDA 4YECA 2IC5A 3HADA 3MMZA 5TF0A 2FPXA 4JUBA 4XBFA 1Z2NX 1KEEB 1NG9A 4KQGA 3LGAA 1FP7A 3CS5A 2RIRA 1O94C 2W2KB 3L7JA 3SCZA 4PZYA 2D4HA 1YR9A 4UDXX 3SYRA 1K0UA 3JD1A 1W4BA 3C5WP 4W4LA 3IAHA 1NU6A 4TKMA 4PXAA 1P9OA 2VYCA 2JA2A 1VLJA 2G4CA 4L1KA 4JQZA 4NBTA 2VG8A 1KO5A 3BGIA 1ZK2A 3KQOA 3IP8A 3GJ5A 1BZYA 2AZ4A 1ZPDA 4RV4A 2IZ7A 3KQMA 3HM2A 1NVVR 3U6BA 4I9UA 1E6UA 3EUAA 4LUCA 2DQSA 3KJJA 4JS0A 2PUGA 1DX4A 1NQ5A 4UATA 3OCVA 5EMMA 3C3CA 2WPDA 3HCBA 1UQRA 1ZJYA 4X6LA 2WD7B 2EQBA 3NEAA 3MD0A 3O1LA 4G86A 4YAGA 1XLUA 3G17A 3JCZA 4JHLA 4WNCA 5ED4A 1A1VA 1YK0A 2A59A 3DXFA 1H1LA 5CFNA 1TRKA 3UJ7A 2CV1A 4BLPA 4O0LA 1GQSA 3K9QO 1KYYA 4MAFA 5A3QA 1JDUA 1W48A 4FZ1A 3E22B 5ALDA 3WHIA 1O87A 2TRSB 4ZDKA 1KYWA 3L0IB 3TEJA 5AMXA 4HYTA 4XVUA 3PG5A 5IW8A 2JCXA 4IUCS 5C4GB 2B9EA 3T5BA 3WTCA 4DHEA 1XMIA 4EZBA 3UIEA 2FDCA 4M0PA 4NYMR 5JNUA 3W6ZA 4R5MA 3FSGA 2WLSA 1CS4C 2PBRA 4UAUA 1FUUA 1LQTA 1WXHA 4PSKA 2H9IA 1ZGAA 2O8DB 3ZVMA 2I3ZA 3HJNA 3EVDA 5FLKA 2F9FA 3W3ZB 3MRSA 2HMYB 4DNPA 3DBRB 1ZX3A 1IWBB 3DBOB 2WSBA 2IU0A 4N65A 1DXYA 2QM8A 4YQFA 5T8KC 3CEPB 1P2VA 4RHAA 4WFAV 4QBGB 3QNMA 4L16A 5HK9A 1W34A 1Q86W 1HE2A 2X0RA 3NP7A 3ABKC 5C3UA 1DOAA 1ESEA 1F0PA 2PV0A 1PL6A 3V46A 1Y3BE 2O57A 4KGVA 2NO7A 3ETNA 4D9MA 2YJ3A 1E5LA 4TX1A 1XZIA 2X4LA 1QK4A 1TZCA 3KB6A 5K0FA 5IP5A 1S1MA 4JV5O 4PR0A 3R0QA 3B6JA 5BVGA 2X3UA 1BVRA 4RHTA 5CK5A 3ADKA 4FYHA 1GZHB 4KGDA 4UAVA 1OAAA 1ZGZA 3T9CA 2CDNA 4KREA 1J21A 2VTEA 3PUKA 1B74A 3M2TA 4F8EA 4IVNA 3EBPA 1E6WA 1VQ9V 5FBVB 2ZIUB 2PU5A 4K9MA 1XMVA 1TAEA 2EZ4A 4KYTA 2C4MA 4P4UA 4RULA 1CIJA 5DDIP 3CNQS 2HSDA 3D7SA 4KBFA 2GTAA 5LZ4A 2V7WA 3I4LA 1NUSA 1P0FA 2EG5A 4DLKA 4GX5A 2HU2A 1OTXA 2XT9A 4XWOA 3SXPA 1BVUA 1Z7WA 4IDHA 1II9A 3QNEA 2K1EA 3TW0A 2G9IA 3DZKA 1PG5A 1QNLA 2JHFA 1Y9AA 4XASA 1XZFA 1ZESA 4LCKA 3JYHA 4LA4A 2ZXEA 1H2WA 4QGPA 2AR7A 1HFWA 2I65A 4ZXFA 2D0OB 2PG3A 4WGGA 1S1CA 1TA8A 1DJOA 5DYYA 3FKSD 2CK3D 1PYDA 2HRRA 2VDWB 3D31A 1QKIA 1Y7TA 4CIVA 5JSZB 3W90A 4D0LB 2X2EA 5AQEA 1VCHA 3PXBA 2EFCB 2RC5A 3TNJA 2PM8A 3RDPA 3LC1O 1FPMA 2C2ZA 4G5XA 4E94A 4UCRA 2JARA 1NXQA 1G8MA 2C5BA 1GSIA 4MVXA 3UJ9A 2AOVA 2XOKD 4KN6A 2PV7A 5JZSA 1ATZA 4KVFA 4TSKA 1RZRA 4HXYA 3TDMA 3QPVA 1V2GA 1TEXA 3UV7A 1ZJ4A 1DDOA 4E4EA 4WZ6A 1PFQA 2XUPA 3DZBA 1TXGA 1B41A 4QGFA 4XCQA 4OY3A 3DOIA 3ETDA 2ZBVA 4F12A 5JXHA 3CCUV 1QR2A 1JSRA 4GLOA 4DFDA 3OTQA 4UU1A 5JADA 3A2FA 1X80B 2FTKA 4Q1DA 4C07A 1FMTA 2WNSA 2R3SA 1YI2V 1XK6A 4GMKA 2CN1A 3UT5A 3GX1A 1RMTA 3NLLA 2KSQA 3SPCA 3NHUA 3VR4D 5HXAA 3KZXA 1BT8A 3QBEA 3CPQA 2Z6AA 3MRTA 2SKDA 3WA7A 1NKSA 1E3QA 3PSAA 1TF2A 5KDLA 4PPGA 2ZT8A 3KOMA 2Q46A 2G1PA 1Z4KA 3W8RA 3EBOA 2I80A 1I4OA 4L5JA 5A4MS 3F8TA 2H7YA 5ALMA 3DHVA 3EPPA 5E6UB 4MGYR 3QRWA 4DV4O 2IQ5A 3FETA 3REFA 5ER6A 4DXAA 5E9QA 3W7TA 1CZOA 4LI0A 5FEMA 3KETA 4IEIA 3HVJA 5EAIA 1NU1H 3HUFA 4TVBA 1XOIA 3L4BA 3W8NA 3FOEC 4MPTA 3TNLA 1EVYA 3DEHA 3BVPA 3A1WA 1MA0A 2WMOB 3HPQA 5C81A 1DQYA 1MBZA 5ERYA 3HV2A 4JYPA 4JJIA 1QUFA 2X8WA 5B1EA 4UM7A 4CF6A 1UC5B 4PZDA 3H97A 4YJ2A 3J7TA 1J5PA 5G0VA 5HOEA 4ZVQA 4Z7NB 2C3MA 4TZTA 4OCZA 2FPLA 2YJTD 2VUSA 3ZIUA 3R23A 2KWIA 4FQ5A 3RSZA 3ROGA 4TLCA 2XZTA 1YBAA 3L6BA 4I4LA 3ZZ0A 4MLZA 1UADA 4KP7A 4WE3A 3PXCX 4DE5A 4YRKA 1SETA 4RK0A 4W63A 5AJXA 5FWXA 3M1LA 4UE2A 1EWQA 4R68A 4KWTA 4Y9UA 4GL2A 4PSUA 2XWSA 1OX4B 5JZBA 5DSZA 3HR8A 3EWIA 4WKNA 1CJUC 3T4XA 4WAUA 5JJNB 5GIPC 2N1MA 3SSAA 3R5HA 4AJHA 4IIBA 4K9SA 3COSA 3DWGA 2ID4A 3D6FA 5IMSA 1EBUA 1TCAA 1F6WA 4EO4A 1NKVA 4DR5O 1AUOA 1K6IA 4XWWA 2D13A 2C4TA 3AW8A 3KZ1E 2XNKA 4UCSA 3S1AA 2XD4A 3J80N 4WX2B 3FOZA 4RE5A 4KACA 1F51A 2BONA 1CKEA 3HDHA 1TL7C 4DHWA 1ZM3A 1E2FA 2G07A 1IBRA 4N9WA 2ZZKA 1T2EA 2EJBA 1NQVA 2R66A 2VP0A 3WSTA 4L7VA 5GV7A 4ZO8A 3FRHA 2JLQA 1GO2A 1K8AW 4GXQA 3OWOA 3VSCA 1E60A 3EGVA 1N5JA 4B8ZA 4ZCIA 4RA6A 1MUUA 3HCEA 4OLHA 2IWHA 1GAJA 2F3SA 2ECKA 1XHEA 3EXIB 1FW8A 1UJ6A 3IT1A 4C6RA 3EODA 2X42A 4Q9DA 3V4SA 1ODIA 4RLFA 3ZHXA 2GD2A 1NBMG 3GLIB 1AQJA 1VQ5F 3IAUA 2NZVG 1W2HA 1INLA 3E0XA 3JAKA 4MVJA 1H2RS 4C08A 1KWGA 1KR2A 1RKXA 3RYCB 3G71V 1H22A 1QTQA 1B3RA 2PBLA 4KH1A 2B4AA 2C04A 3HHEA 4WK2B 1CQPA 3RJZA 3IQXA 1SWWA 3AVQA 3D1LA 2V03A 4D9KA 4NBSA 3TOVA 5CFMA 4AF7A 1SU8A 4NDNE 1C9NA 4B40A 3JAWA 1M0EA 2X76A 3H9GA 4R1MA 3R20A 1X52A 3OBYA 3HFGA 3BIJA 1DPFA 4ALLA 1MX1A 2WE7A 4MQ6A 2I1QA 3WQBA 3GVMA 1GGNA 2IEDA 4LZOA 2WZBA 4FFOA 2C9YA 4R7GA 4R9SA 2P30A 1QO0D 4KKXB 3RWOA 1RTKA 4EEXA 4MUBA 2NSJA 3K0KA 2H65A 3QE2A 2DLNA 1KBOA 3MCUA 1U11A 5CN0A 1ZGBA 4KO4S 4ZCMA 3MB8A 4Q6GA 5AT1A 4A2QA 4C0XA 5ADHA 3T7TA 4BE7B 4S12A 4EKYA 1D3AA 4KHPO 3OZEA 3VJLA 4G0OA 3V8NA 1MIOA 4PS0A 1K5SA 1N0UA 4LSWA 4HZUB 5ALRA 3CG0A 3OE7G 2D7JA 3FHJA 2CFCA 3PYLA 1G5QA 1YNOA 3VH2A 3TETA 4R2KA 1XRRA 4PRZA 2XT0A 1J2JA 3PK0A 3WLIA 3DFZA 3SQXA 5HOQA 5ISMA 1SUWA 5BW4A 2XUGA 3N05A 4QYSA 1XZKA 4XB6B 1U31A 4B5KA 5ANRB 2WJWA 3W7SA 2FGYA 3EUWA 3TRIA 5AOCA 1X87A 3ZN2A 2ZWPA 4OB7A 3OKCA 4KMMA 1NPTO 2AR0A 1QZXA 1PEAA 2DWDC 4FFPA 2CMHA 4HUQA 4RANA 3H8SA 3FDFA 1QP7A 3HA3A 4OXRA 2VT6A 1TTTA 2Y1KA 3D3QA 3AF2A 3IBSA 1TI7A 3WPXA 3C3DA 3AQ4A 4G0PA 3RVOA 2WIGA 5CT6A 2HXGA 2NUBA 4ZO9A 1YFKA 5DASA 4ER3A 4KIUA 2CLMB 2R751 3W7XA 2HRCA 2EWMA 4M0UA 3Q6NA 4DC0A 1ULAA 3ND8A 5K0CA 5C31A 2O8FB 2WSMA 1Z2EA 4Y6PA 3A2NA 3ZE2B 4F21A 3C90A 3WP1B 4NUTA 3LECA 1IWOA 4CFZA 3T1YO 1QE5A 2VH5R 3U19A 2VSYA 1RXWA 1GG8A 2DPGA 2WT8A 5IRCD 3A3NA 4Q37A 1OT5A 2Y1DA 1QCCA 1IQRA 3PUJA 5KHGA 4IUBS 2ZRQA 5IBRA 3NZEA 4N18A 3DC2A 3LWDA 5TT1A 3ORFA 2HVKC 3IOYA 1XZ8A 1YKSA 2XQKA 2EG9A 5LMNO 4F4DA 2FKNA 2JJYA 5FUYA 4DA9A 1RC8A 4ERNA 4LF4O 3J81k 3H5TA 3B1FA 3Q85A 2LCFA 2R7AA 2G09A 3Q2KA 4DCTA 2ZSEA 3PIDA 2BMDA 4FZ0A 3NHYA 1IC6A 1SCBA 5FWAA 3IP9A 1NASA 1YMUA 4CKWB 5DNYB 4J80A 1OX6A 3BFKA 1Y3IA 2XHEA 5FLXA 3NBUA 2C2HA 2GD0A 1XJCA 2FWJA 5EXTA 16PKA 3EVCA 4EECA 4FWTA 1QU3A 3NC1C 3ORSA 1WTCA 4XVQA 2C5GA 4B84A 2DR3A 3Q88A 2ZVZA 2Y0EA 2W4QA 2QUBA 4YH1A 1E2MA 1UKCA 3ZJZA 2GBFA 4ITRC 1NATA 5LL6Y 2O59A 2GS9A 3UUFA 4MRAA 5FUMA 1QDUA 5I7FA 1A9ZA 4DR2B 1D7AA 4TT3A 3V4FA 2ASVA 1EE1A 1KDZA 5DSTA 3PFWO 2YV3A 3H9EO 2QV7A 2IUTA 4P82A 1NOJA 4E46A 1A4RA 3K4HA 4G0QA 2CKMA 3FTCA 2F3UA 2LD4A 1KZ9A 1NI5A 2QN2A 3COJA 2D3TA 5KAPA 3SYOA 4N39A 3IESA 3RVMA 1U6KA 4F91B 1FFWA 2BMVA 4DXDA 2UYPA 1JPVA 4Y6OA 3GP8A 1I08A 3AJAA 4YFYA 4AIIA 3PC8A 1RM1B 2LR0A 3RGWS 5H16A 4MROA 4JAVA 1C9MA 1LLDA 3OZGA 1VF7A 1HQDA 4A2WA 2W6MA 4XIJA 5AXCA 3WXMA 5I47A 4L4YA 1KI3A 3KJFA 3L4EA 1A2OA 3DUWA 1P4SA 2BGMA 4FFBA 3BXHA 3EXG2 2A2ZA 2QPLA 4ALMA 1I3NA 4LYAA 1JHZA 3QF7A 4AXXA 4J07A 4GRDA 3JALB 4JI5O 4MVJI 1J90A 5IY5C 1NXTA 3IEIA 5CT5A 1Q3HA 4GECA 5CA1A 3PA6A 3R0ZA 1A8PA 2GWRA 5LMCA 1E79G 4LXHA 4QHYA 4BZPA 5BWBA 5IJWA 1NVXQ 3EFFK 1AK9A 1XN1A 3V8EA 1Z8NA 2JLUA 4G07A 2PMEA 3CXUA 3EQ2A 2A0FA 1OI2A 2OCXA 2DB3A 2J4FA 3SJBC 4QNHB 3LTEA 1V96A 1XRPA 4I0WB 1BD3A 2P0AA 3O9MA 4ZIRA 4QUDA 3W3AD 1NQXA 5B7GA 1VGVA 3D6VA 1OY1A 4NF2A 4PHGA 4J4TA 4YRDA 3UJAA 3BPSA 3ZE1B 1UCFA 1O94A 2WC1A 4XUGB 5A04A 1UPXA 1F6DA 4Z0PA 2ACVA 4AAYA 3WYDA 5A2QN 3D02A 3ND9A 3C3AA 3DTVB 1H7MA 3B2QA 4R7ZA 3QKSB 3TTVA 3T7IA 1U8FO 3GRYA 1TCCA 2QIOA 2WI8A 3ZRWA 2JFUA 4B4VA 3AETB 4KFTA 3U11A 1E2BA 1NA5A 3VU8A 4BNZA 2B21A 3DLTA 3GVIA 3KKMA 3TKYA 1R7RA 3B6ZA 3W7WA 5COBA 3O9OA 3WY9A 2H9AA 3L84A 2QJFA 4OVKA 1CN7A 2SNIE 2HXYA 3L7MA 1GCOA 4FDTA 3ZHCA 3D8BA 1ZQ1A 3WQHA 2DZDA 1H4SA 3X2EA 4LBYA 4GUNA 2GA8A 2A6PA 2GK7A 4A8JC 4BRWA 1I5EA 4DC1A 3QV1A 2B8JA 4AY4A 1QIEA 3DSQA 1ILEA 3N5CA 3NRJA 1E4OA 3OWHA 4E2XA 4AZ3A 1II0A 5IM4A 2BFFB 4CDRA 1TEZA 2BELA 3KEOA 1NJ5A 2EZPA 1ZTEA 2OCLA 1P73A 2C7OA 1MD9A 4MMYB 3RS9A 4ER5A 4JXZA 3C3XA 5HJ7A 3I52A 4D4GA 2C78A 4N3NA 5DNEA 1WSAA 4FHCA 1NI3A 5F7JA 4EPRA 4JJGA 4EIWA 2AYXA 3PRJA 5EYPA 2JI9A 3MNFA 5FBWB 1JHYA 1XCPA 4CHTA 4X5OA 3F8SA 2J41A 2J9YB 3ASVA 1GA4A 5E7QA 2UZIR 2WKQA 3WLQA 3P45A 1DF4A 3WQSB 3LF1A 3B09A 2PBFA 2YXYA 4GDMA 4RCZA 4ZIRB 2Z98A 2RC6A 3C3TA 1BQEA 3FJOA 1GQOA 4DQUA 5YASA 1WUKS 2OZBA 1ONNA 5EWJB 2FQXA 4QODA 4E31A 2O8VA 4ZZ0A 5T8KA 1QYVA 2VWKA 3EDRA 4J8PA 4B75A 5PGMA 4ZT2A 3GLHE 4E2WA 3KKQA 1N7IA 3EG9A 2PX8A 2Z04A 1VQVA 4P5DA 5KVCA 5C35A 4J0QA 3G2HA 3KO8A 2VQ6A 2AVDA 1HTBA 1SBCA 4C06A 4M53A 4F5ZA 2F95B 3SYKA 1IPAA 3G9ZA 3LVRE 3S70A 3FDIA 3PJRA 2BMEA 1VA4A 4XWTA 2G9QA 4DRXA 4YAIA 3ADPA 3L01A 3QW2A 2HDNB 4MS3B 4IIGA 3SJAC 4BO2A 1JN1A 1A0OA 1CFZA 4EW1A 4CL2A 3DOUA 3TG2A 2G0NA 1TO6A 3OETA 3D81A 4EJ0A 4JVNA 3GCDA 2ONCA 4CM9A 3FYHA 4Q3LA 1XAJA 4JI6O 2H1VA 2QYSA 4UREA 4BMDA 5AHXA 3KT3A 3QKIA 1KY3A 2Y77A 1TKCA 1KSJA 4NPCA 4BIIA 3EPJA 2YKGA 5FJIA 1JBQA 3U09A 3UENA 3LHFA 1DGSA 2JK0A 1DU4A 4UTXA 721PA 3CW9A 1I2CA 2HQOA 1DRKA 2PEYA 3AX6A 4A0GA 4TTRA 2P3SA 1PS9A 1JL3A 1AR5A 3UMCA 1P5HA 1XZEA 3SN6A 3SEQA 3DLHA 4B44A 3PNQA 1S3GA 3LC0A 1PWXA 5TDHA 2CCJA 4H1HA 4BTVA 2G83A 2PH7A 2PX6A 4YAOA 2OXRA 3HDYA 3FX2A 2QENA 3TTYA 3RRMA 1IV1A 5DH9A 3ZX5A 3L7YA 3ABKB 3T3NA 2V7QD 3AR9A 3DWFA 2OXTA 5GZ6A 1OWLA 1Q82W 4ZK7A 1MC5A 2AC2A 3N1UA 2GSWA 4Q4DA 1XHLA 1ZHOA 2QIPA 4DXHA 3ZMSA 1V54B 1FVXA 2PYLA 4UFPA 1O96B 1TJPB 5MGBA 4EEZA 4Q4AA 1UM9A 1W0KD 1XMXA 4YBZA 1R00A 2Y8EA 2X9QA 4KXLA 1K6MA 4IV8A 3CPJB 1PR3A 1PJTA 2ITCC 2Q6IA 1BS2A 2NTJA 5DXFA 1JT2A 3L4SO 2VHQA 5CA0A 1OTYA 1JMYA 2C4VA 1RVDA 5LB2A 1YRQA 2OCAA 1JFFB 1XZGA 2QUIA 3AJ9A 2VDOB 3A6FA 1QANA 3LXXA 5TGDA 4RCVA 3OZVA 3IIMA 1E9VA 3ZRXA 3KKZA 3NUQA 4M3NA 2IS4A 4YPFA 3T6KA 1YSCA 4N9QA 4I8IA 2GZMA 1V48A 1EMDA 1ZH4A 4WY5A 5TF4A 3TI9A 1M6WA 2I4LA 2DSNA 1P1IA 5EKTA 4IXNA 1L7DA 2F43A 3EH1A 5TISZ 1Q44A 3IVCA 3TJRA 3G0DA 5HXZA 2Q7XA 1V95A 2ZUCA 3ZLBA 4D5EA 2HI0A 3RHZA 2A5GA 1Z0UA 4A26A 2AMVA 2CUGA 4W5QA 1DTWA 4ZDJA 1TGYA 2Z4RA 4RGYA 1EFDN 2IEZA 3A9WA 4EHKA 1FXWA 1P4RA 1U8TA 2YXHA 1J0DA 3BXGA 1L6RA 4KPUA 1CQZA 5GW7A 1VBMA 2VBCA 5TQ2B 3V42A 1JXQA 4U7PB 5GTIZ 2D5AA 3O5AA 3KPUA 2ACWA 4DSOA 5CLJA 4Z1MG 4X6YA 3UPUA 4GQAA 4XW2A 3OZIA 4BYMA 2FPGB 2GEUA 3THXA 2B25A 3TSOA 1AS3A 1C0EA 5ICEA 2XQVA 3HYSA 3BJIC 4X66B 1L0NH 4MKIA 1JQBA 3AVTA 1YCGA 2XEXA 1W44A 4MS2A 3U9LA 1BH2A 4FJ1A 3HA2A 1JIVA 3TLAA 3DKVA 3HU2A 1PUIA 3RG8A 3BSWA 1N32O 4AX8A 2IAFA 4ENVA 3L4BC 5TMDA 2DJIA 4V03A 4OOEA 4PFKA 1U8AA 2JFXA 1Y8RB 3SNHA 1Y7LA 3GYQA 1S3JA 1E7MA 4I9GA 3A06A 2OGWA 2Y9MB 1V8BA 3V1YA 1Y1RA 1YQNA 3WLMA 1EBBA 3G2PA 2GXUA 3OEHA 3SZ3A 4UCFA 2GJ8A 3ERNA 1G6OA 1JYFA 4KQJA 1VL1A 2PMBA 3TECE 3GHHA 4WN9A 2O7NA 3DNPA 4PY2A 3RUIA 3KPVA 2HWKA 2CZGA 4PPNA 4WCEV 4AB1A 1ZGJA 3CEMA 4PV1B 3KQWA 4RZHA 2XB9A 5E9AA 1FMLA 3G1WA 4O2BF 4CEIB 3KTAB 1XU7A 3EXEB 5EPUA 5K1ZA 2HEPA 3OR7C 1LTHR 1W41A 2BZ0A 1V0JA 3EVZA 1HR0O 4H6XA 5KNCH 2JAWA 1J99A 3ZDFA 3B9BA 3Q15C 5TLSA 4B3SB 3QTYA 1L5FA 2F43B 1DOHA 1ZWIC 4OEHA 4GMDA 2O4UX 4P92A 5JAOA 5K99A 4DWWA 5LJIA 2J5BA 4GP6A 3G8AA 3LLSA 5L3EA 1PJ3A 5MN6A 4QEZA 5I4CA 1SU4A 5C1PA 2E4YA 1I0IA 3CSDA 1Z28A 3GPIA 5JWRA 3JVEA 2WAOA 4KPUB 5MF6A 2O5CA 2G80A 5F77A 4EKDA 3F4KA 4A8PA 1XGKA 2R00C 2OHWA 3ZXXA 3I39X 2ZI6A 4ER7A 1W35A 1DX9A 3UKMA 1T34A 1JG7A 3CC7V 4JGIA 4GKJO 5IVHA 4GYJA 4UDNA 3NHZA 4MZXA 3P4UA 1XSEA 4PIPA 3A2LA 1MABG 5JVDA 1KC1A 2Z3YA 5ALWA 3TZHA 4D9BA 1FXUA 3FFAA 3OMIB 1A9PA 1IY0A 1KD1H 1GV0A 1O8CA 1QRDA 1T0UA 3FZYA 1E1RG 5HM6A 1WL8A 4EGFA 4FM9A 5P21A 3HY3A 2GAOA 4MVZA 2XUMA 3BRQA 1S4MA 5EGNA 3KR0A 5ALOA 5KIAA 2PUBA 2C4NA 5KOYA 3BWBA 3V1LA 4WXYB 4IDDA 3KPYA 4L07A 4WCFA 4CKBA 1YJCA 3T3OA 3SR0A 3ELYA 5TJ9A 4IDOA 3RSOA 3TOZA 3DT9A 3TZ6A 1A4IA 1HNXO 2CWWA 2HWWA 3N74A 3JVVA 2QDOA 4AZTA 4LYGA 3OD4A 1X7XB 5TS3A 1Z0DA 1BCRB 3BMXA 2N04A 2QYHA 3SC2A 3RYIB 5A3SA 1Q0RA 2FMHA 1GVHA 5IWAB 1EFTA 2J7KA 4PLFA 4C76A 2H2WA 2PT5A 1XDZA 3MRVA 3L1VA 4Y2XA 3Q98A 5D1HA 2GVNA 4QBHA 1MENA 5KYYB 1L3CA 5EZQA 2ZR9A 4BJHB 3FFBA 2ZXUA 1WTAA 1RXUA 4KK4A 3WYFA 1R9GA 2FTKE 3EZGA 5D3QA 4ZYTA 1M6HA 4XEUA 2IGBA 3ZI4A 3FPGA 1X1QA 1W4AA 2DBRA 4MWGA 1TVKA 2ZVPX 2ZYTX 4W6QA 3WIDA 4HNGA 5G0UA 3HO1A 3EF0A 2X19A 2OV2A 4BW0B 5JE8A 3V4ZA 4AYTA 1QMPA 3CMEF 1LH0A 4JDPA 5JMTA 1TCUA 2ZI3A 2VLBA 3T61A 1TD1A 3OCUA 4ZHQA 1E2EA 3SNKA 3RQSA 3BQMB 4D26A 3VPDA 4TV9B 3M6FA 5FWYB 3IHWA 4IDNA 4FNMA 1SPXA 2W6JG 3RYHB 2QKAA 1IMJA 2VAXA 3OPQA 4R40A 4BLTA 1EH5A 4C7BA 1L4EA 4RETA 5A4JA 4CH6A 1I24A 1NXPA 1FK8A 1TX4B 2QLJA 3PGJA 3QBVA 3IUBA 1RXVA 4UE3S 1Y8ZA 4L8GA 4WFFA 2PZ8A 4D9EA 3K2QA 1W0JD 3OR6C 3G2KA 3PNMA 5DOVA 1KMHA 1HDEA 1LBHA 4Q1VA 3ABSB 1B42A 5KO2A 4QUBA 1N36B 4GKKB 4DDWA 4FJ2A 1JFLA 1SELA 2O5EA 5T64A 3UHFA 4LFCO 4CKBB 1NWCA 4Z9AA 2HYIC 4QFDA 2IBMA 4KR0A 1U8ZA 1LLCA 3K3WA 4N6NA 3SGLA 1FMJA 5CHEA 5CVDA 4DV7B 2VDKB 4OYYA 1WP8A 5KHIA 5L3DA 4LR3A 4QPDA 2FZ5A 4NR1A 1FX1A 4I4CA 5A3RA 3I7TA 2UXBO 2P41A 4IGAA 4P33A 3UEOA 1P4HA 2BFAA 2DM6A 4ZQEA 1XLWA 1I4DD 4K1LA 1YB7A 2B92A 3GDOA 1KJQA 4EF4A 1QO9A 2B20A 1EXVA 1Z35A 3QXHA 1B06A 3SK0A 2D2XA 3QXGA 5BR7A 5FH9A 4JFAA 1MAHA 2FHPA 2I66A 2JHAA 4G27B 1XMQO 1NVFA 1QFJA 4DK1A 5EINA 2J9RA 3PKJA 4RQUA 1RWNA 4YPVA 3ZV7A 1QVFU 1TA4A 3GLHA 3J7AU 1V45E 3MTDA 1U8CB 1GKIA 1KH3A 2DTDA 1Q6YA 1OHHD 3FJYA 3P94A 1M2WA 1Q81W 3BPZA 1ECGA 3BHPA 1P2TA 5TPZD 4OI2A 4HDQB 4HKTA 1ZMXA 1HNNA 1YTLA 1E3WA 4RTNA 1N5DA 4P22A 2HA4A 4JYBA 2FWPA 1UPFA 3HCOA 1E3EA 1NJIW 1GQ2A 1SD2A 1X7HA 1VJTA 6ADHA 1FBTA 1O03A 2PVPA 5CFQA 1Q83A 5IK2D 1T9GR 4AKIA 4JBXA 3ZIAG 3VXKA 4QZVA 2QTVB 1K3TA 4NG5A 4WSOA 5EP1A 4BAGA 4I55B 5H9WA 3BA6A 2IIBA 1HF3A 3ED1A 3NDIA 4Z53A 4K2HA 2WKSA 1T0HB 1ZONA 2P6UA 1CFJA 1P9LA 1Y7IA 1BXRA 4PC7A 4MVJE 4X64B 3FPBA 4GLFA 3WGOA 1F20A 3D5EA 4MTOA 3BZUA 1RJFA 2DC1A 3PKIA 2HHAA 3I2GA 1ORIA 2HWXA 4QO8A 4C78A 3Q7SA 2PUAA 3RFFA 2ZB2A 3DE2X 2V5VA 3GNSA 2BAGA 1V55C 4GM1A 1HOTA 1VOTA 4L50A 2IHNA 3IBYA 1PGNA 4QPPA 1FSGA 1OV4A 1REQB 4U7FA 2CEAA 1E9RA 3LU1A 4NBWA 3FWZA 1I14A 5TV2A 1XG5A 4UD6A 4CM8B 1VJDA 1KZYC 5HJEA 2WM8A 3D4BA 4LZLA 1GPDG 4ECAA 4W1RA 4NBLA 4KMSA 1OH5A 2H8KA 2OKGA 1NI8A 3GHZA 3Q5DA 2JW5A 4J7JA 3GLHB 4ZEXA 4OQLA 4AS3A 2HMTA 3C14C 3HB3B 3RIMA 2YJ5A 4PTYA 4BVTA 4I4TF 4R71A 3DQQA 3OIFA 4D97A 2R8RA 3U7GA 3CINA 3INGA 4NSNA 4JI2O 1DKOA 2Q4EA 1WPQA 3ZY4A 4YYEA 3WYAA 3ODGA 4RY2A 1JY8A 2WUEA 3A70A 5IJZA 1MZFA 4JKYA 3BWMA 1FS4A 1S5LZ 4RVHA 4CKCB 3GJ4A 4KVGA 3NVAA 3FPFA 2QK4A 6REQB 4A8JA 1NNLA 5I4IA 3ZWOA 4RQBA 4D7SA 2WF5A 2X4IA 5KSOA 3H01A 3TNYA 2BI8A 2ZXWC 1Y0BA 5FLYA 3S2ZA 4BGEA 2G77B 4CM4A 4JEMA 4CLRB 1VQKV 1HKUA 1JFRA 3ZWDA 1K9VF 4KLCA 3B7WA 2VDRB 1R1DA 1IZ7A 2P6JA 2KPOA 1K6EA 3BD6A 5IY5B 2GM4A 4EPXA 3DW3X 3IDAA 4RU1A 4EFBA 1C4KA 1FZQA 2GDZA 1WUJS 1N2OA 1VP7A 4DA7A 4MJ3A 3IURA 2HRUA 2VPYA 4Z3KA 2C96A 3C39A 3HKDB 3FWKA 3EEIA 4H1WA 4MW0A 2WP0A 2CLSA 4L0CA 3ESQA 4HVCA 4N0MA 2UU9B 1J7HA 1FYFA 1UEIA 3LYUA 2HP3A 4PXSA 3ESAA 1N8NA 3FVTA 1WB6A 5EIBD 3HCCA 1KI4A 1QGDA 5EIEA 4RH1A 1KTVA 2EP7A 1RE1A 3AEZA 3DXRB 1B43A 1Z15A 2R9RB 3HK2A 1N3BA 3NW9A 3A6JA 1MPTA 2HT6A 2HD4A 2ZINA 4KQWA 2D1FA 5C1BA 5AVOA 5JD3A 2RKWA 2ZAGA 2HV8A 3PUXA 3QVMA 3HI4A 4MV4A 2FF7A 2HHJA 1VQ6V 2B4TO 2ZLBA 4D74A 2QRGA 1Z68A 4QFCA 3IEMA 5DECA 1P3Y1 3ZLUA 4MGZR 3A1VA 3IKFA 1U9YA 1Z7GA 2ZKOA 2HHHO 2IXDA 1S2OA 2JGLA 3VOUA 4YLGA 3H5RA 1Y6ZA 5KYXB 1KSHA 1RM3A 1H9CA 1US8B 4A8JB 5AVWA 3SI7A 4KEAA 3SJAA 2VYVA 4PLGA 1RM0A 2CGEA 2IYYA 2CXHA 1PJAA 1XX6A 1TLTA 1FDTA 4CM4B 4MKZA 1U98A 1UQTA 3TL6A 2W90A 3WSWA 2VZEA 4MICA 4TL9A 5C34B 3GMDA 3WAJA 1HDRA 4RXMA 2YBDA 1CUXA 4TYNA 1KI7A 3AL2A 3G2LA 4RZIA 3RU3A 1K92A 4GP9A 4WXPA 1AKQA 4QTZA 3ROQA 1SC1A 3X2QC 3MJDA 1W2GA 2Q8VA 2MSKA 4CIWA 2G5CA 1JI0A 2VI5A 2FFAA 5F9FA 3V34A 1I0LA 4RK6A 3T7KA 3WS7A 4C20A 1LVHA 3GGDA 2Q67A 1DOZA 3Q8HA 4DUGD 2DLCX 1UKVY 2IF0A 3D6NB 2H5EA 5AHRA 1BE1A 1K86A 4L3WA 2EP5A 4OPHA 5ALVA 3NBFA 1I7SB 4LS3A 3UAYA 2PGLA 3RBZA 3ONWA 3FD9A 1ZC4A 2WTAA 2QX8A 2WWTA 4WA7A 3VC2A 3G89A 1Q7GA 3IAM6 4OHFA 1H1LB 3EHDA 3U0VA 3VR4H 3X1WA 1DO2A 1T5DX 3OSZA 1BJTA 1RKQA 4YO7A 2BSKA 1Q77A 2ZIXA 1N0HA 1QFXA 4DQLA 2XITA 1ZU4A 3HYRA 4ZJUA 4KJZA 2P9CA 1CR2A 5DHQA 4MV1A 3UHAA 3HZHA 3GRAA 2GZRA 4F1JA 3LLCA 2WB2A 4DUZO 3SZRA 3IMEA 3CKYA 5ALHA 4KXNA 2ZAOA 3T3PB 5IWCA 2VDVE 3M0EA 4GZ3A 2C42A 3GGPA 3APOA 4ABYA 3K9FC 3VVBA 2H7XA 4BLQA 4XDLA 4NCHA 4QPCA 3WGGA 4GFDA 1RQNA 2M98A 2PFKA 5A5DA 2OBNA 2ADFA 3VNAA 2UUPA 3O93A 3C8MA 1Z0ZA 5AVYA 5DI3A 1VKOA 1H9AA 3MERA 2QNIA 3BE4A 3PDHA 4DBZA 1SKAA 2ZS8A 3CVWA 2QX9A 2UYQA 4BT7A 3PX2A 1LJ8A 1AQIA 1N6RA 2ZUFA 3ESDA 1CDOA 2E5WA 4BV3A 2HB6A 4I5SA 2CUTA 2E49A 1Q1QA 2HOQA 1O89A 5C5CA 3DDZX 4ZAXA 4JI1B 1HETA 1XZPA 4UUQA 1USGA 3AYZB 1DKRA 3VO2A 1KH2A 4BZQA 3RTBA 4C82A 2VTKA 5KTRA 4LHWA 1RRGA 4BVRA 1N6NA 3QUSA 5BVGB 4ZYZA 1JDTA 3G8YA 4QXOA 4QAQA 3OU2A 1BMFD 1Z6ZA 2E76B 4V1CI 5AOVA 5C5EA 1IH8A 3CE6A 2JDIG 1URPA 8GPBA 1AKRA 4YK7A 1KDTA 3ANMA 1MT3A 2QE7G 2XSZA 2QPAA 3NJRA 5DM6V 2J59A 5GAPK 4K6KA 1FJGB 1KIFA 1Z0AA 2AHYA 1QOZA 2HVJC 4F93B 3L02A 3DFKA 1HFJA 2JS7A 3N2LA 3A6HA 3QJ5A 2LGJA 3EXAA 3ZV4A 4B79A 2BKLA 4H60A 3VU3A 1ADFA 3KV3O 4IHKA 4NHEA 3U6KA 1LEHA 5JQWA 4LC1A 4B2LA 1OFVA 2BSKB 4CCWA 5J59A 1JR6A 3N0WA 2OCPA 3PQFA 5E9WA 3T3DA 1LBSA 1HGXA 3TPFA 1BE3H 2GI4A 4YRNA 1K5GA 4L15A 3CCQV 4B7ZA 1R73A 1QOQB 2YJZA 1Y6RA 1QVWA 2QAIA 3WIOA 3DMYA 2C7VA 3BE5A 4LH6A 1GHTA 4JP3A 1QR8A 2FJUA 1H8HD 4JI3O 1E2QA 1KZ7B 2G82A 1G7RA 3BD7A 2UUAB 1M8KA 2W2QA 1UXKA 1VYVA 3VAAA 3VYTC 2ATCA 2O2DA 2AJTA 2QRPA 1E7RA 4FN4A 3AG5A 1R74A 1S7GA 2D5BA 2D2IA 1J8MF 5BQOA 1WDKA 5DF1A 2RH4A 3GRUA 2PGXA 3HCPA 1SIUA 2EX0A 2PJDA 5CB6A 1PP4A 4QJ4A 2BF4A 3LX8A 1LW7A 1Z25A 5CDUA 4RXUA 4LI3X 1LW6E 2BRUC 1D8AA 4QD3A 3MT8A 4D9FA 2Z01A 3LPMA 3ZEAA 5DTIA 3R6GA 5L53A 4Y30A 3UT5B 1QXSA 5L95A 2IW5A 3WDMA 4LE0A 4IYRA 1U02A 1PT7A 2B78A 3RA6A 9ATCA 6YASA 1NV9A 1VPVA 1BX3A 2B1RA 1IB6A 3W4KA 2O3UA 2R00A 2HU5A 4F3YA 2ODNA 1NBWB 3ZWXA 4RYDA 3QE0A 1EJ6A 1V39A 3PF9A 4DABA 5DHFA 4R0VA 1FP1D 3PB3A 2OOKA 5KU7A 1DF5A 1I30A 4B3XA 4R2XA 1GADO 4OB6A 1D9ZA 3QVVA 1ESMA 1KFJB 2MW2B 3ZZTA 5FTWA 5DNUA 4R6WA 2JIDA 2J4DA 1IYZA 4MYHA 3WJQA 5KX5A 2GEKA 1AH2A 1SD1A 2G88A 3PFBA 2CNWD 3RC8A 1DT9A 1N0JA 4RZQA 2V1DA 2HMWA 2YXBA 4JUCA 2XUDA 4PANA 2YV2A 5KINB 1E3MA 3M1IA 2UYHA 1TGVA 4YJ2B 1B6TA 3W5UA 2COEA 3NOQA 4RHYA 4BO7A 2LCQA 3W79A 2P9EA 5IKOA 1TJ3A 3IDQA 4WLEA 5DISB 2O9JA 3OZ7A 4KQCA 5HBGA 5JQGA 2V4MA 4R1PA 4ND4A 5FWXB 4B0OA 3DHWC 3W1VA 1AF7A 1AZWA 4P34A 1C2TA 4YYZA 1NI4A 5LL6P 3O4FA 4K9DA 3H04A 1J42A 1L5GB 2GTIA 5FAXA 4AUKA 3DZJA 1Y48E 3O82A 1JD1A 3SLGA 1QLHA 1ABBA 2VPIA 5JEEA 2FPSA 4IP0A 2HH9A 4F7DA 3IAS1 1MGPA 3M4YA 5KNDD 4DJTA 2X2PA 3PE4A 1AKEA 1NMQA 4WCFC 3PJFA 3FM9A 1AMNA 2PZFA 4EUKA 4C5CA 5J3JA 4FR2A 3P32A 3FMIA 1JZTA 3S1AB 4NYIQ 4EATA 4KUMA 2E7ZA 3SHFA 2C07A 2GTHA 3QWFA 3DFUA 3RSCA 5JAIA 1WB8A 3H2BA 3W34A 3WJ2A 3PPYA 2CNDA 4RWEA 3GBSA 4P3NA 3UGJA 2GJ4A 1O97C 1Z6YA 4OYRA 3F73A 1UUFA 2Z4TA 4MGEA 3OLYA 4DADA 1RWXA 4RA6B 2LDXA 1KECA 1CZKA 2GOYA 1JEJA 3G1TA 3L5OA 1M54A 3AVWA 2I1WA 3N59A 4DGQA 2Q7DA 3DR3A 1S6YA 3FIJA 2I7TA 2I9KA 4BX2A 4RY9A 2XBLA 5J9FA 3ABMB 3UPDA 2V55B 3JAKB 2V1XA 5LWHA 1W87A 1KJWA 2C94A 4OGKA 4MPJA 3QMMA 3HNPA 2CJPA 4WNYA 3QG5A 4ARZA 5IYZA 3ZXUB 1K8XB 3IFSA 3N2NA 3PC4A 4Q7QA 3QKUA 3JAWB 4LXXA 1RQ7A 3R3WA 3D0QA 5JQGB 1R3KC 4CCAA 5EPOA 2ZIFA 4P3OA 4HDOB 4BDSA 1L1QA 2DN9A 3K96A 1C3LA 4I66A 3A26A 5KHOC 2R6DA 3VNVA 2QXTA 1R66A 3L8DA 5EG5A 1THMA 1Z6XA 4D6TH 3WFVA 5GIPE 2C4WA 3MGCA 1TJNA 4F9FA 1A98A 4LF6O 4GX2A 4GYKA 5ESWA 5K6TA 2ILVA 4IJ6A 1EHIA 3K0GA 4MPRA 4K2AA 4HFRA 3L9XA 3BUSA 1N6IA 1MIOB 3L6RA 3MCQA 3ROMA 3O1HB 5B66Z 4EGCB 4HDMA 2HJRA 2GZHA 1H42A 1NNUA 1KEZA 1T2UA 5KWJA 1N57A 1T5IA 1W55A 2E3CA 4NS1A 1X6VA 3JSNA 2GM9A 2CXOA 4Q4CA 1CHNA 3LX4A 3QUAA 2CGNA 3ZQUA 2ISSD 3AVYA 1AUPA 1YKGA 1LSOA 4AZVA 2RGDA 2BMFA 5KJ1A 3K53A 4ZO7A 4J75A 3G3EA 5K4AA 5AK0A 2A33A 4ZPXA 1KS9A 3OUSA 2POQX 2Q49A 1WXWA 3CB4A 3GP3A 4Z4EA 1BW9A 1R6DA 3O31A 3ANYB 4HUQB 3GLVA 5CMUA 3S40A 3MOGA 4Q3NA 4HMQA 3SS8A 3OPVA 1XTVA 3NEJA 2XZDA 3HN6A 3BEHA 1N34B 4D7TA 1T91A 1KKDA 4DCSA 4CIDA 1RQXA 1HRDA 4A0HA 3V1TC 3SSOA 4Q24A 2PRKA 3NTXA 2YQZA 2KG4A 4F3NA 4OBWA 4MARA 5DW0A 4NIMA 2AZDA 4ARZB 2HU7A 3OQIA 3TLBA 1R2QA 4R54A 4OATA 3WFZA 1VBFA 3OEEA 5J58A 3M3DA 5JLAA 1S2IA 4HB2A 1EFKA 4XVCA 1ACLA 2ATIA 4EDHA 2MCFA 3VX4A 4ZV7A 4UVCA 4YC7A 1DDGA 1DSSG 1JILA 1E96A 4BNFA 1JKIA 1EQ2A 4HWTA 4HXGA 4JC5A 1UDRA 3DL4A 3FGPA 1MZVA 1M1KH 4ZU1X 1EN4A 2OIGA 3KD2A 2C7QA 3QU9A 4L4ZA 4MA4A 4TLBA 1XNHA 2FPWA 2W2VA 1GPUA 4IGKA 5A5VA 4PXYA 3WKBA 3C3PA 3H5AA 3BF8A 1DARA 5B2ZA 3BXZA 2YY6A 1D4OA 3OMNB 1PUJA 1HPLA 4CMBA 3H1BA 3RS7A 1SKUA 4LYDA 3MJHA 3QY0A 1Z5VA 3A6PC 3UKOA 3IHKA 1U7DA 4Z0NA 1IG0A 1SUIA 3GRVA 3FTEA 4RHXA 3IEVA 4TTVA 3G2JA 4QQRA 5BNWA 3MBIA 2DXIA 1HDOA 4QRDA 4AQYB 4MUXA 4CGZA 2X6QA 3ZHQA 1HFKA 1JIKA 2W0XA 5EJMA 3HHPA 2HN9A 2FC3A 2NT4A 3TMYA 1AO3A 5E4JA 1KFEB 2C92A 3S2UA 4PLHA 5FV7A 3FCEA 3GJTA 5C53B 4IG4A 2QWRB 2XE6A 4OGFA 2B4KA 3RBVA 2JFQA 3HFSA 4DR6B 3HRHA 2M6YA 4YIPA 3RK1A 4BJ1A 5IDXA 3ES9A 4WVLA 2A9KA 3VC7A 2ERXA 2VEDA 4JU9A 3OCXA 4JLVA 2VC2B 4D0RA 1MNQA 3LLUA 4C7UA 4L51A 3CR8A 4HAMA 3PVZA 5FRDA 4GSYA 4ROSA 2PGDA 3MMNA 3H5OA 2Q8QA 3OQIB 3R75A 1A1SA 1L4UA 3STLC 2WZQA 2Z5GA 4R81A 3HXKA 1UANA 4OU4A 3UCEA 2FX5A 4YHBA 4Y18A 3ZWQA 3UJPA 3T0FA 3CF0A 3L04A 5IM5A 3BH7A 2WZDA 3NNDA 2BFEA 4INPA 4EA9A 4NDZA 1T9ZA 3F6YA 1IV3A 4UMFA 3VR6D 4E5DA 1NSTA 3IQWA 3TQQA 2J3QA 4C1BA 2D8AA 1ID8A 1WMSA 1H8ED 4DLVA 2GYUA 4U00A 4LECA 4MR8A 2Q9CA 1JHVA 2AA3A 2ZUVA 3WXMB 1Q6ZA 3AFOA 2GN6A 3TFOA 2FV8A 5L7YA 3F7MA 4FFBB 2QP4A 2B8TA 4EG5A 3E83A 3SKVA 1QTIA 4MI6A 1SCQA 2E6UX 2DETA 3ABTA 2N74A 1KAGA 4MI9A 4C05A 1G8SA 4G89A 1S5HC 4QJ5A 4QXAA 3RREA 1RDFA 3A4VA 1QU2A 5KQGA 2DHEA 5CA1B 3S5UA 4DDKA 3P9ZA 3T3MB 5CFRA 4DR7O 1QHNA 3V32A 2YDYA 1YIAA 5FUWA 4EYGA 3SC6A 3M6XA 1QHEA 5ECDA 1ZNXA 3RBAA 4ZREA 2I55A 4N3BA 3LL4A 4KO2S 3ZGVA 5BSKA 3IIJA 2WYWA 1JHRA 1IXSB 4U2FA 4R8VA 1NNSA 3IVAA 1YRBA 4JMPA 4BMZA 2X5KO 3SVZA 1P7YA 3PVCA 4ZV4A 3IRVA 3FVVA 2W6ID 4GPEA 1XTKA 3M83A 4PZ9A 2ZXWB 1WVMA 2I6XA 4BC0A 5AVJA 4K3UA 2QMUA 2EHDA 1TMOA 3ITKA 3ZDYB 3O21A 3TCKA 5LYJA 2EATA 3CC4F 1D4AA 2FZGA 2LZ0A 4I4NA 3GYBA 4TZKA 3E8MA 3OEYA 1NUQA 1SESA 3RAEC 2AK2A 1ZG3A 3FNQA 3ZRWB 5IF9A 4Q7EA 2PQ6A 5L3GA 1NXVA 4UQPA 5EB0A 3RF6A 1SN7A 4JNKA 1SK8A 3HBMA 3ZZ1A 4OLBA 1UP6A 3TGUH 3BG5A 4TKLA 1NIJA 3A28A 5D01A 3RIXA 4CDNA 3PNSA 4KH0A 1EZ1A 4MHSA 1E3DA 4LHXA 1BN6A 3UAWA 3DEAA 3I30X 3VDXA 2OYRA 1A3CA 5FFFA 1J5EO 2RHJA 2H0RA 1ZN8A 4A0RA 2FZKA 3OFVA 4YA6A 3JYNA 1RM5A 2XGJA 4FYIA 1IURA 3W6NA 2PU7A 4OFBA 2EHJA 1B6QA 3AB8A 4AZ3B 2XAQA 1WLEA 4QICA 1BJRE 4P98A 3OPMA 5IE9A 5JTUA 2DR2A 1NW9B 1TMGE 4AN1A 3M4XA 1R5NA 2IBZH 2FSGA 2BMWA 2YHSA 4FTWA 3EQ8A 3JASA 4Z7QB 1MMMA 1MTOA 1JZSA 4JQCA 1Q6UA 3E7PA 3NHPA 1XXLA 4KUHA 5EYPB 1F1JA 3L8CA 4OH7A 3TQFA 2VO1A 2OL4A 2NO1A 2DWCA 3EFOA 4RF3A 3NK7A 1PNMA 3OLXA 2ZDGA 2H4JA 1YDMA 1ODSA 2QVLA 5HKBA 1EUDA 2DOKA 4BT2A 3H9CA 5GZ1A 2J3JA 5HUQA 1YASA 1KNQA 3BGVA 4MMXB 2WJGA 1U9CA 5K05A 1XZNA 2NT3A 1XMJA 3M3HA 2VPTA 4E5MA 1UDBA 2J1LA 2WFLA 2V65A 1FFEA 1NZDA 2D2VA 3EVTA 4KXQA 2J5XA 2IYFA 3EF3A 2QTBA 1GN4A 2GJSA 3JYQA 5L7WA 5DNWA 1VMEA 2HY7A 5LYJB 4WLFA 1PVDA 2WWVD 4DA6A 1GG5A 2C61A 4L5CA 4UHDA 4YP7A 4QOFA 3EG9B 3D8NA 3DDNA 4ARBA 3IPXA 1FNBA 3VO9A 3W9UA 3B36A 4KV9A 4XWAA 4IQGA 4N41A 3X2QB 3LSUA 4I9FA 3UA3A 4ZVMA 2CNKA 2IPAB 1P6QA 4B6RA 2BJVA 3HUUA 2BUCA 2QXUA 1U1DA 5G4LA 2GZ1A 1VLQA 1WW8A 1ZOOA 5IANA 2PZMA 3LT5A 4KDEA 1PNOA 5EXEA 1NJ6A 3CCMV 3PEWA 1YL6A 2C8VA 4GQBA 4DRXB 2XYRA 2YMLA 3VKWA 2VDUE 3RAGA 4M55A 1HOXA 1I3OA 4RSGA 1E8MA 5IXYA 1QIIA 4JD5A 4W8GA 4CMAA 4UCWA 3DUFA 2Y1OA 2IUYA 2ZROA 4FM0A 5JHGB 2AKAB 1Z6QA 4JQOA 1M2NA 3CCSF 1HC7A 3E9YA 4J49A 3U1TA 2GDSA 2DHRA 4D57A 3CPHA 3DEZA 4ZD6A 3QUCA 4YXFA 3BFVA 1F0NA 3TJTA 2IK8A 4QJ3A 5K8LA 4UBMA 3H13A 5D5PA 2P2NA 4HQ6A 2ZANA 2ODAA 3WGUA 4JVOA 3AK1A 1T3ZA 1TIKA 3EFOB 2ZI4A 2FEMA 2BO1A 3WZ2A 1T4GA 3TD5A 1RAFA 2MQEA 4ODIA 3W1EA 3G23A 1ZLYA 4GM0A 3AVOA 1S8OA 4Q03A 1FSFA 1GL3A 3VTZA 3DNMA 3WYEA 1NJGA 2R48A 2AFRA 5DM0A 2HX0A 1M7BA 1ZVMA 2WFLB 1SZCA 4ZT6A 2EEPA 5BY1A 3NTUA 1VE9A 3AF4A 5BV1A 1L7QA 1GOTA 1SHUX 2LRHA 3DAFA 2C2AA 3FCSB 1I94O 3VPAA 2E75B 3CZRA 4BNXA 3H17A 3KT8A 2GTSA 3ZYCA 2CWJA 1PIWA 2BRUA 1JBKA 3GAAA 4JL5A 5KTOA 4FCVA 4B2YA 4E09A 1MJGM 2VCEA 4DVJA 4PYMA 3BJMA 1RWWA 1T15A 5JNVA 2FUEA 4BFTA 4Q4AB 1UM9B 4XFKA 5HG0A 2YJGA 3CZ9A 1IPEA 4LCJA 4N82A 4TQ9A 4K6HA 4RQOA 1KFBB 3B3AA 4YT5A 3ICCA 1IATA 3NU1A 2IEAA 2OSVA 5CA0B 1ZCFA 5DHRA 5D87A 2M6RA 4F2GA 1RRKA 1Q1BA 3ZJYA 3E7WA 5C0OE 1JA8A 2FUG6 3DB1A 4F97A 5BZBA 2IKQA 4DM4A 2IYUA 4WDRA 1UBHS 2Y67A 4Z0HO 1YHQV 1EFRA 4D81A 4AF6A 3MBOA 1EVQA 1NVKA 3QWHA 2B37A 4J2OA 2EZOA 1MJNA 2Y0DA 2NX2A 4NNPA 5CDTA 3NJ8A 3FNRA 3FNEA 2A84A 1N2CA 1M1YA 4DM7A 3T4EA 4P8RA 1NJSA 5CX4A 1G7SA 1YZLA 4G5QA 4ECEA 4DDVA 2Q5EA 5E9JA 3GFVA 5LMUB 5L3RA 3KPJA 1Q43A 3W5VA 3IXMA 1PDWA 1UP7A 3A6GA 4O4IF 4KNYA 3IQHX 4UEOA 4RD3A 4ALJA 5A4FS 5EXXA 1DTWB 2LXNA 3EW7A 1UK6A 1NVAA 4U63A 4EHAA 4INZA 2YQ5A 1EVJA 4H7HA 4BMSA 2VBGA 4H3VA 5LQJA 2G9RA 4DV2B 4MGHA 1SXQA 4AMBA 5KWIA 2GBGA 2WV9A 2WJ4A 3OOEA 2IP4A 1YBVA 4NCBA 2A9QA 4MI1A 3THXB 1IEVA 3FYSA 1CPYA 1YVUA 3RI3A 3EUEA 1SHKA 4EUHA 3DCJA 4A16A 2Z1FA 4PYOA 5JH7A 3HEBA 5FOXA 1IB0A 1QHSA 3DEYX 1K5HA 1P72A 3IYLW 3X1MA 4N54A 2XCLA 2B7CA 2JIPA 2GNAA 4OQ4A 3CNOA 3JYLA 1A9SA 2FKXA 4Y6QA 4BN5A 2FX2A 3A7EA 5CG1A 5K51A 4A73A 1M1XB 1B1CA 2A06H 1G8GA 1NHGA 3TR0A 3QI2A 5DT2A 4WN9B 1JH8A 3MIIA 2P77A 2BUAA 4P36A 5BP7A 4NWOB 2BR4A 2O1WA 1C8KA 2UZ1A 3KVRA 4JUIA 1ORTA 5I5EA 2CMKA 2EZUA 4RAIA 3H5VA 3TFQA 3U81A 1AV7A 1FNJA 2FG7C 3ZE8A 2PKEA 3ITEA 4I1SA 4QWWA 4HEA1 5FJ4C 4ZANA 4M36A 2XXJA 2GHYA 4RXTA 4HV4A 2ET6A 3WKEA 2O06A 3I12A 4FYPA 5CD1A 2JIOA 3AUJB 3UICA 3E20B 3WL3A 3FUTA 5F78A 2ECFA 3C3SA 4E12A 3L40A 2P9QA 5IT5A 4W82A 5BY2A 2Q9UA 4C0LA 2B82A 4QGHA 2LP4Y 3DG9A 4F5EA 1KAOA 3OTHA 3HACA 4NVPA 1CB0A 3WDKA 4LDPA 4BT6A 1ZK1A 4HNAA 3AVUA 4BIOA 3WTBA 2HWYA 2EERA 5DYGA 1YRLA 4AECA 3SKXA 3S5JA 2HJWA 2EBUA 4RIIA 5KC9A 5JVDB 1JR4A 3HQ4O 1QHGA 5DX1A 3B52X 4Q7LA 5FBZA 3NWEA 3DKKA 2CMFA 4H35A 1JIJA 2G38A 2QAJA 1HEIA 3B9PA 1K68A 1ECFA 4ZYVA 3I6MA 5BWOA 4BPRA 1JAZA 4LWSA 4OF4A 2GX6A 4BNLA 4DVGA 3DOOA 5KYNA 4WCFB 1MQSA 2QTFA 2W0MA 1E59A 5BT8A 4Z0TA 1G6Q1 1V9PA 4ZICA 3T5TA 4FNAA 1OYOA 2VNJA 1T36A 1JW9B 1A2QA 1T6YA 1P8JA 4H3KB 3BCSA 5E1BA 2WDZA 3NOXA 5KNBH 3UUGA 3AO0B 221PA 1MNAA 4JODA 5AH0A 2H4XA 3SC2B 4IFBA 2XPCA 1CY0A 4NV0A 1MOFA 1J9ZA 1SUDA 1DCKA 1DMSA 4D25A 2X4GA 3NBXX 1FDVA 2VPXA 4FBGA 2VHCA 2IM9A 1JHMA 5J4HA 3WB9A 1OYWA 5EQTA 2FJ0A 1W40A 3BQNB 5LQNA 1KXJA 4LRUA 5KB3A 1O6ZA 3JARA 3CCFA 4RTRA 3L93A 5AYVA 1X7OA 3M6VA 3K0AA 2EKQA 2QLLA 1YFLA 2I2CA 3LUHA 4OUDA 4LMPA 1K2WA 4ZOLA 2FWIA 4IDEA 3NM5A 3PI7A 2FAXA 3U0BA 1KI1A 3ZYZA 3TLJA 1TVKB 1GTOA 3KOYA 4TSRA 4IHJF 2XB6A 1NMXA 2PQ0A 1N5IA 2QA4F 4TZ0A 3F5FA 1USWA 4CI0B 2C20A 3FVRA 3SEAA 2H2FA 4IW3B 2YC0A 1EUZA 3FPHA 4ZHQB 3FAKA 3U7JA 2R7KA 3I64A 2QX4A 3E8SA 1UBNA 4ZAWA 3LLMA 2Q99A 1DMRA 1ZHHA 2AHOA 3MOIA 3UM9A 1TYZA 4R40B 3OU7A 1ES9A 1B04A 3MCTA 1VL5A 3AEUA 1BWRA 2WU8A 1NAHA 1FYEA 2VA8A 1UBEA 3E05A 1M3SA 4IL5A 1Y1QA 2V9ZA 1ZUHA 1ILWA 3BK2A 1Y9DA 1KMHB 1GV1A 4BKOA 5A05A 4JI4O 5DTRA 5JRZA 1USUA 3T8YA 4ERXA 1H6AA 2REBA 3H0EA 5DK6A 1SM4A 2P9GA 2F9LA 4X95A 2CW4A 1LPOA 2CLDX 1OTHA 2PT9A 3M8KA 2IV2X 2Z30A 3K9LA 3VR2D 1J39A 1MO2A 3IVGA 1COWA 1E9BA 4YTEA 1OGYA 3T54A 5ES3A 5A2QA 3IH5A 4LYYA 1J4AA 3K5WA 1QGZA 2KG7A 4HWGA 4BX9A 2HK6A 1BA3A 2RB4A 4MHOA 3LHDA 1UAYA 3U13A 4HH3C 3O03A 3AI1A 2YBEA 4MW7A 3HU5A 3KT6A 3DXYA 3I1YA 4JU8A 1EI9A 2DH5A 1IEQA 4DRZA 3GWOA 5ESXA 2BTOA 4RK5A 2VP6A 4I1YA 2GSDA 3BL8A 1XTSA 3LDUA 5LHHA 4ZOLB 2LBXA 3IR6A 3KHTA 2DQ4A 3CX3A 1NVBA 4G4XA 1VQ8V 3R5FA 1E3WB 2QRLA 2VRBA 1IBLB 1LDEA 3BY6A 2DKFA 1O57A 1DWQA 3Q10A 1ISGA 3CJHA 1KBZA 2QYOA 4URZR 1ISJA 1X8JA 3ABUA 1JZQA 2Y3IA 1VQ4F 3K16A 3QVSA 1EXDA 5A0TA 1FFSA 5GZ3A 3U56A 2JKVA 1VHTA 1QF9A 4V1CA 1B0PA 4US2R 3PFKA 2JHCA 3MUOA 2PIDA 3ZC3A 1DC8A 1WHTA 3F5QA 1A8UA 5CEJA 5JBNA 2QTNA 4JUFA 2AXPA 1ZM7A 3B1YA 3CWCA 5CVTA 3KNZA 3EZNA 4K3VA 4MO2A 4FK5C 4OHKA 4PHFA 1Q57A 3EIFA 1XD8A 2HXSA 1N2EA 1LRLA 4EJ2A 2JEXA 4LFBO 4MUHA 3RFXA 3QHAA 1FUKA 3HH8A 5B12A 4FOLA 4EY7A 3IE0A 2Q3DA 1OWOA 1BXRB 1ZITA 4B08A 4Y2HA 5HP8A 2PL3A 3QUBA 4M0LA 4RS3A 4CH4A 3EGCA 3QE9Y 2ZITA 2HLNA 3RVKA 3DMNA 3V7QA 3CLRD 4IQ4A 5GGYA 1S8AA 3TQIA 5AKJA 3L74H 2EBFX 4R1TA 3ESRA 3PE3A 4BAUA 3VSEA 3OTOB 3CRMA 2B9VA 1EGHA 3IOCA 1Y3DE 2GF2A 2PKWA 2ZU6A 3SJZA 3U4CA 4A2CA 5EP3A 3C0KA 4EFLA 4KWCA 4PD4F 3S81A 2VJCA 3TZCA 1QX3A 3A05A 1L4LA 1N9GA 2R47A 3PLAC 4P53A 3IO5A 1EXMA 4Q4JA 1ONPA 3R4VA 2BE7A 1VYUA 1RSZA 1OILA 3V6MA 4IBOA 5ENZA 1ESCA 3BHJA 4ZK6A 1E1NA 1G8JA 2NU6A 3MG9A 2XCUA 5KMGA 2JIRA 1ZWZA 3HSSA 2P4SA 3PNOA 2W6PA 4Q3OA 4UVGA 3D3IA 4RJLA 1RYFA 1A2KC 3LUDA 1CJKC 1H2HA 1H2KA 2O8CA 4LRWA 5JS8A 4QARA 5IASA 3ZWWA 4BVGA 1RSOA 1ULBA 1G3RA 1I13A 4FQ8A 4WD3A 3F0GA 3AU8A 3MCAA 4EGQA 3L1HA 3I92A 3TSYA 1R3UA 3NAGA 5AESA 3R40A 3CR7A 4HMPA 3LMEA 2OZLA 4V1CB 1ZL8A 1W8DA 1RI4A 2XDWA 3T52A 4HWPA 4X88A 4TTJA 2GESA 4XYMA 1PT9A 2HA2A 3BYZA 4DQDA 2AC4A 2QHXA 3DEFA 3RSLA 4QL3A 4H59A 1KJIA 2PLFA 4LOHA 4OYLA 4JI8B 3B82A 2QXYA 5AJZA 4JVLA 4PDRA 1PSWA 4ICIA 4CS4A 5JNWA 3Q3HA 3UVEA 3QIAA 4Z6KA 3RW9A 5CLQA 5FL7D 3L8GA 4CL8A 1NQUA 1KNKA 3O95A 3LSYA 3ZOPA