4HNAB

Kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
431
structure length
431
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a kinesin-tubulin complex and implications for kinesin motility.
pubmed doi rcsb
source organism Artificial gene
molecule tags Motor protein
molecule keywords Tubulin alpha chain
total genus 172
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hnaB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4hnaB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4hnaB01
3VOAA 4TV9A 4TV9B 3RYCA 3RYCB 3M8KA 3RYHA 3RYHB 2Q1YA 1TVKA 1TVKB 5IYZB 5IYZA 4O2AB 4O2AA 5LP6B 3N2KB 3N2KA 4ZHQB 4ZHQA 2BTQB 2BTQA 5JH7B 5JH7A 3C8LA 4DRXB 4DRXA 4IHJA 4IHJB 3N2GA 3N2GB 5LP6A 5LA6A 5LA6B 5GONB 5GONA 2VAMA 1RQ2A 5CB4A 5CB4B 3RYFA 4ZOLA 4ZOLB 3RYFB 4EB6A 5EIBD 4EB6B 4B45A 3VO9A 4EI9A 5C8YA 5C8YB 2GVIA 4KWEA 3ZIDA 5JVDB 5JVDA 4F6RA 4F6RB 4FFBB 4FFBA 3RYIA 1W5AA 5MN6A 1Z5WA 4ZI7A 4ZI7B 3WGLA 5J2UB 5J2UA 3HKDB 3HKDA 5M7EA 3M89A 3ZBQA 2RHOA 4EI8A 3V3TA 4IIJA 4IIJB 5IJ9A 5IJ9B 4O4LA 4O4LB 1W5FA 4TV8A 4TV8B 5CA1A 5CA1B 3VPAA 4DXDA 1FFXB 1FFXA 3HKCB 3HKCA 3HKEA 3HKEB 5EIBC 2RHJA 3HKBA 3HKBB 2R751 1SA0A 1SA0B 4X20A 4X20B 5IJ0B 5IJ0A 3WGKA 4X1IB 4X1IA 5FNVA 5FNVB 2Q1XA 3RB8A 5LXTB 5LXTA 5CA0A 2BTOA 5CA0B 1W5BA 4LNUA 4LNUB 4U39A 3WGJA 2VAWA 5KX5A 5KX5B 5JCOC 4M8IA 5MN5A 5MN4A 2VXYA 3R4VA 1OFUA 3JASB 3JASA 2RHHA 5EZYA 5EZYB 1FSZA 4O4IA 4O4IB 5ITZA 5ITZB 4YJ2B 4YJ2A 4YJ3A 4YJ3B 3VO8A 2XKAA 1TUBB 1TUBA 3JAWA 3JAWB 2R6R1 2XKBA 1Z5VA 5LOVA 5LOVB 3WGMA 5J2TB 5J2TA 3ZBPA 4XCQA 1W59A 4O4HA 3JARA 3JARB 1JFFB 1JFFA 4O2BA 4O2BB 3JAKA 3JAKB 4O4HB 5KMGA 5KMGB 2VAPA 5LYJA 5LYJB 3WGNA 4E6EA 4HNAA 4HNAB 4O4JA 4O4JB 3UT5B 3UT5A 4EI7A 5EYPA 5EYPB 3VOBA 1W5EA 4X1KB 4X1KA 5JQGB 5JQGA 4I4TB 4I4TA 1W581 4I50A 4I50B 1RQ7A 3CB2A 4TUYA 4TUYB 3JALA 3JALB 3E22A 3E22B 4X1YB 4U3JB 4X1YA 3JATA 3JATB 4U3JA 5JCOA 5LP6C 4WBNA 4WBNB 4I55A 4I55B 5BMVB 5BMVA 2RHLA 4B46A 3RYIB 1RLUA
chains in the Genus database with same CATH superfamily
4L4ZA 5AHKA 3FB7C 3HDHA 4IL5A 4U63A 1FZQA 3B77A 2XNKA 4G23A 1HG1A 4IDBA 2H7CA 3UGQA 3M6FA 4WY2A 2HRCA 1E89A 3FRHA 1N9KA 4UPDA 3ZHBA 4B7CA 2AG1A 2YHAA 3OZXA 5DYTA 2OFFA 2I4NA 3SIUA 1MDFA 1Z6QA 2V7QA 1FNBA 1ORWA 2GK4A 3GELA 3PGKA 3G23A 4Z1MG 1PEYA 1VPDA 3IQEA 2ZOVA 3IILA 3KQOA 5EWLA 1IY0A 1WMBA 3FHTA 3GH3A 3RYFA 1C5KA 1A8IA 3ANYB 4FGWA 3C85A 4DCOA 3FCSB 4BE4A 4ETNA 2F1IA 5FWYB 2JB9A 1XZBA 4INPA 4ZO6A 4QEDA 5KYYA 2QSYA 1UDXA 2P27A 2EFCB 4L72A 5EHIA 3SVLA 4W9MC 2QBYA 1KI7A 5F9HA 4FI3C 3X1YA 4CV2A 1ZD4A 2WAYA 3O0DA 4OBBA 1H2EA 1Z83A 3WB2A 5EIWA 4KHPO 1ZMOA 3C6MA 4K03A 9MHTA 2VP5A 1HEIA 3AESA 3QKRB 4XFDA 1KTVA 1SKAA 4IDCA 4ZJYA 5CX1A 1FNKA 3SGLA 3CN9A 5JSQA 5K8CA 4W5OA 3AFOA 1M9NA 2YWBA 1DQPA 3OE7A 5CM9C 4CM4A 1TJNA 2Z4RA 5CITA 5D7NA 2D2CB 3D7KA 1VPVA 1EJ2A 2ID8A 3ONDA 3DZHA 3PG5A 4LFAB 4H3HB 5SY4A 4JI3B 3RVJA 3CZCA 2XBMA 4EO9A 3OKCA 4A0HA 5EMMA 2YW9A 5LBTA 1RYHA 4U0JA 5IK2D 4G4SP 4A0FA 5ALJA 4ICIA 4NMLA 1PR4A 2J0QA 5T4BA 3DMFA 2FEWB 4XLZA 1E9DA 2IHTA 2OZVA 2R8PA 2GI4A 4JP5A 2QT1A 3RBXA 1Q74A 3ITKA 3ZYZA 1I2BA 4B3DA 3GGCA 2WTXA 3VKWA 2RQ6A 4LF6B 3CD6V 2CWDA 3LUCA 3NUGA 4FMDB 5E8RA 4EHIA 1QS0B 3LWBA 1KZGB 1P2VA 1PFQA 1LJUA 1U9YA 1YZUA 1ZMTA 2GASA 3DHNA 3QEBZ 3T12A 4ETMA 121PA 2AZDA 4H4EA 2JBAA 3I5MA 3CG4A 3LUGA 3VVCA 3DEZA 4JELA 3VOTA 5I7HA 3NR2A 2AWNA 2W00A 2CSXA 4GQBA 1E9BA 1LWOA 2HJFC 1XMXA 1WZEA 3PDWA 2O59A 1MNQA 5KAFZ 5IW8A 1ZD3A 2C4NA 3ZHTA 2EQAA 3BFKA 3I3OA 4P5PA 9ATCA 1VHWA 3UM9A 4RVOA 3SD7A 2GM5A 2BFCA 3EVBA 1LDEA 1OASA 3ZP4A 5C8VA 4H0LB 2Z1DA 2CHTA 1Z7YA 3UAWA 1K0FA 1D1SA 1WP4A 2OORC 2A35A 2PTGA 4FLTA 1ECGA 1IDSA 2IA5A 2PUJA 2YXNA 3HBLA 3G7UA 3FPLA 4RMNA 1SU6A 1ORDA 1K8ZB 2SHKA 2PUTA 2XQIA 4KTTE 4LFCB 1TVEA 2H4JA 2QX9A 2ZTVA 3FUUA 5BN5A 4DSUA 4XCQA 4HYYA 5J40A 4CLHA 2GZ1A 3JRXA 4K46A 1CC1S 1JILA 3TSOA 4G6ZA 5AW1A 3E5MA 4E3WA 1L8LA 4HPWA 4KU4A 5B7NA 1GNPA 2Q2QA 3WYNA 4LVCA 1XTTA 4TRMA 3GQBA 5JQGA 1UWCA 2J48A 4MZDA 4FCVA 4DPMA 3A4NA 2NU7A 3PHLA 4HAYA 1NXWA 4JGGA 4JOQA 2Q1SA 1X8JA 1QQ5A 1VL1A 1IY2A 2CCKA 3QVWA 3EIOA 1AGRA 4Q6WA 4RH3A 4ZYTA 1QF7A 2BFBA 5HKAA 4P38A 5J3JA 3K96A 1Z5GA 4HD8A 2PKRA 3H11A 4DADA 3EOZA 4U1RA 1OX4B 3RYCA 2X5JO 4CWAA 3AVXA 1QVRA 2LO1A 2HN9A 3HYSA 4GKVA 4CN8A 1G8HA 4TYPA 1RXWA 1ECPA 1ZA1A 3LDUA 4KXQA 4YP5A 5TEVA 2W2PA 1TUIA 4GT1A 2GCOA 2YEVB 2VNSA 4GLJA 1WP7A 1EQUA 3UFBA 3DOHA 2QWOB 2CVQA 3EJWA 3I5YA 2OBFA 1ZOOA 1RHKA 4WKBA 2L6LA 1WD7A 3OMLA 4JT2A 5GONA 1U65A 2FMXA 1KO4A 5LHIA 1U7ZA 2XJ9A 2Z3ZA 3ED1A 1V8ZA 2X4GA 3AG3B 3A9VA 2Q5ZA 4JR2A 2QPLA 3BXOA 3IKTA 1Y89A 2R6DA 1C3EA 1F4VA 5JS1A 1G9SA 3RWBA 3TBKA 4FFOA 5A0FA 2MMGA 4LOIA 3D00A 4BLSA 5KVSA 4OIMA 5JD3A 4PC3A 2CV2A 1MJFA 1EBFA 5IASA 4XGKA 3SVZA 1O4VA 2OCBA 5GQSA 1YTFD 2FR0A 3P9QA 1E4EA 1A5ZA 4AZTA 4BOYA 1XRMA 3E48A 5BNIA 3QIVA 1IQUA 3ELDA 3K5OA 4AKHA 1P74A 1RYBA 3A9WA 1SBIA 3C5VA 2VOJA 3PHBE 1V8PA 4HQNA 1V16A 4CM3A 2IPAB 4YYZA 1PV2A 2A2ZA 3TD3A 2H18A 3DGEA 2GAJA 3NATA 3WPWA 5BSFA 4I1PA 3A0HZ 2C82A 3OKFA 2OYQA 4C4YA 1IIRA 4IQ8A 4RGBA 1NJSA 1YF2A 1L7DA 1U0FA 3HR8A 4UBNA 4BV2A 2DWDC 3IGAC 1NJ8A 2D0IA 4IIXA 2RHTA 3WSWA 4CIVA 5SZIA 2RBKA 5IFKA 2XUQA 4Y6RA 3GRKA 2PHNA 1BMFD 3ICWA 2R751 2XMPA 3OGIB 1G64A 4HEA1 4WNCA 5COBA 2QWRB 4AJ4A 5LMCA 5GJBA 1M8PA 1V3TA 2VCEA 1Q5OA 3PRJA 4X1IA 1GEGA 4R9RA 1T4GA 4GOOD 5DHRA 1Y74A 3CCSV 1V5GA 1V1JA 5FAXA 3UB3A 1KJYA 1T3LA 4TZZA 4BW9A 1PTKA 2XE4A 2JGDB 2I3GA 1BWRA 4NOJA 3NC1C 1DGQA 5CW1A 1LBHA 2RHBA 1ADCA 1BS9A 1XRRA 2CBXA 1Q7TA 4NE7A 4ZTBA 3UAXA 3Q7SA 5K2OA 3QUWA 3EY4A 4ARUA 4YUYA 4L57A 4RD3A 5AM2A 4DJ5X 3A8TA 5EPUA 3ESJA 1DL5A 1XLTC 4MH0R 1BS2A 1Q16A 3MHSC 1QR2A 4G0QA 2EFEB 4U2GA 4YJ3B 3HBNA 3PDIA 2QV7A 2X8JA 2H48A 1UZLA 3IAS6 1JR9A 1XDCA 1FU8A 1ZFNA 2ZJBA 3CM0A 4R2KA 3OOHA 2CLFB 1EWTA 3WFZA 1IIBA 4IEFB 1RADA 2XCUA 4UOQA 4O4JF 1NC1A 1EZJA 3ZLBA 4U9HS 4RTNA 1UP4A 4HYOA 4OLBA 5CJ2A 2Q4DA 3R77A 2HIMA 4KIUA 4DEYA 1V54C 3AETB 4BLRA 3R41A 3BA9A 1DCFA 4NR1A 2YWHA 3MCVA 4IGKA 5TQJA 4ER0A 2P0AA 5EHNA 2PTHA 3BDIA 3D3WB 3BPZA 4LR3A 3GJRA 2VXCA 4GYJA 4TRJA 2PUEA 7MHTA 4U7JA 2GTAA 1MQSA 4ESHA 2JIZG 1U8AA 4LDJA 4C7KA 1K33A 2X7JA 4GO1A 1LTKA 3CS3A 4MVXA 1P6UA 1ADGA 3G5AA 4JUDX 4BUZA 2I67A 3NAZA 4D9NA 2P9JA 1I5EA 1ULUA 1Q7YH 1UBKS 3L75H 2ZTUA 3AR4A 3TD5A 3FPBA 3I9NA 5DGXA 5J5AA 3RR2A 2A0FA 2ZZNA 3SHWA 4ZFNA 1ZYUA 5AW8A 2XEDA 2HK6A 2DE0X 3IEUA 2LBWA 1U7OA 3GDFA 3BWBA 1ZD5A 2Z3VA 2Z5LA 1KMQA 1E1RG 3OESA 3LFHA 3AI1A 3DPIA 1G19A 3LBAA 3HO1A 2E6UX 5U9CA 4TLDA 2PUFA 1VIAA 2RI1A 2AUMA 5AT1A 2P3QA 2OO5C 5LQKA 1N7GA 1T91A 2YI9A 2IPXA 4J2TA 4C21A 2J5XA 4PC1A 3HO8A 1OX6A 2ETXA 4FUQA 4BLTA 5B3AA 1KU9A 1JB9A 1L5VA 3VR5H 3A1NA 2IUSA 3QNUA 2QAIA 5I7AA 1DC5A 2GSMB 4OK6A 4FDTA 4BO9A 4M0KA 3V5NA 3VC1A 4B3BA 2HHAA 2H29A 2OZEA 3QHAA 1WDTA 4REQA 4HNQA 4K35A 1NMUB 1NVKA 2JI8A 2EBOA 1GNVA 3NOXA 3SF0A 3D6TB 4D9EA 2QSZA 2EIJB 3OQIB 4DNXA 3Q2KA 4PTZA 4AKGA 1Z0FA 4YJFB 1EJBA 4J43A 4CM8B 1FRNA 5A4FS 1L1QA 4RESA 2NNLD 3QFFA 4ZQIA 3FYUC 1CFJA 2WUEA 3QELB 5AOAA 4EWLA 2DETA 2QI2A 1M2WA 3JAMA 1IEXA 1N32B 2FPSA 1TYAE 2CL0X 3ZXSA 1EUDB 2DM6A 3DB1A 3GNSA 3T5BA 2P69A 1HW7A 1SA0A 2CE2X 2IFTA 1UOEA 2VNHA 2ZVJA 3VM6A 3WYEA 4ETWA 2JD1A 3GFRA 1K5SA 1QCCA 2Z58A 3FPHA 4WFEA 4HP8A 3ZK7A 3U60B 2WSSD 2AH5A 4HWOA 5CB0A 1O9GA 4MKFA 2CDNA 3ECAA 5HF6A 5CB4F 1E9SA 2CUZA 3GMDA 3MTIA 2H8EA 1EFVA 3VOSA 1Z4IA 3DEYX 4NU6A 3L3BA 5CK4A 4CKWB 4Z4CA 2Q3JA 3E4CA 2YMLA 1EK1A 2V58A 3EMKA 3H2IA 2J7PA 3ZU3A 2YUIA 3IJEB 2BRUC 3NNNA 3ILVA 2F3PA 2QYSA 1IBKO 3DE0X 3O83A 1KK1A 3UJAA 3R3ZA 4BE7B 4MEBA 2HDOA 3L6RA 1TYCA 1KNQA 2W0XA 1TNDA 2DTDA 2QK4A 2WA1A 2ZCEA 5LHGA 3PLAC 1AY0A 1C9NA 1G8GA 2DY1A 3FGPA 3NBUA 1BEEA 3OETA 3PGJA 2WA4A 1VYVA 4TLAA 1N6LA 3PZRA 4G9BA 2MHCA 1SCUB 1YNOA 3HC7A 4I9NA 1KZHA 1WPXA 1ZD1A 1GNTA 3RSOA 1C1DB 1MC5A 1YHZA 1Q81W 4P5DA 4UNQA 1I2AA 2VHXA 5H5NA 1PL4A 1TCAA 2CXNA 2VBIA 3FWYA 4JR1A 2DJ5A 2EYUA 4U5XA 5K8TA 3O21A 2PXAA 2E5LB 4FWBA 1RZUA 1KAQA 1X86B 2YXYA 4E5NA 1QVGF 3OPVA 2AI3A 3FWNA 3RABA 3IA7A 2CNNA 1MIHA 3K0CC 4HSEA 4O08A 3STYA 4EJSA 1VHQA 4LMAA 1Y3CE 4R8CA 1QYWA 4LFBO 3I9JA 4EYKA 3FFQA 1PNOA 2IWRA 3ZXIA 2QJTA 1TZJA 4OY3A 5TY0A 2FWJA 4IDGA 1V7CA 5HZGA 5ISMA 2BUCA 4R0NA 3SU8A 1EN5A 1D1PA 3KJHA 2LW1A 1T4CA 2GM9A 5JAUA 1Q43A 1AQUA 3UJ8A 4D8TA 2DHRA 3D6AA 1XXHA 5A4JA 4DJJA 1Y5NA 3DD1A 4MGZR 2KKWA 1GL6A 2QG6A 4MW5A 1H1DA 1MG0A 1JJBA 3BORA 4UB6Z 2P2GA 4FB5A 5A6VA 1B06A 1R6NA 1BD4A 1PNVA 2MMCA 4EMTA 4B5KA 2F67A 3TETA 2QUAA 4QXPA 5KYUA 3RKUA 4A4DA 2BYTA 4OHYA 1P5JA 3OWHA 4XM0A 1TFRA 4B6QA 1A2OA 3M33A 4M46A 2CXQA 4Q4HB 3KIZA 3WNBA 4ZU3A 3K0DA 1MABG 3EY9A 1GFZA 1U1IA 4BGEA 2NAFA 4AIIA 5C5DA 2FLWA 4XQEA 3UO3A 2IEYA 3PWZA 2WJJA 3RRMA 4ZJUA 2XITA 1G21A 5C8YB 2XVYA 1GK9A 4PHGA 1EESA 3CT6A 4CI0B 3B3GA 4MDYA 5HRUA 3LQYA 4JLAA 4MKHA 2GHIA 3NNDA 4BBZA 3AXSA 2PGGA 1BC5A 2KLBA 1DBPA 1KEUA 5AG2A 1UFIA 2A5JA 4WA8A 4L8JA 1HLGA 4I9UA 4KQ2A 4MQ5A 3S0JA 3GD7A 3OCCA 1WXIA 4HYEA 4QU8A 3TL3A 1SCAA 1VQ4F 2Q46A 3Q87B 3UO8B 5C3MA 1OZHA 4XARA 2CE4A 3HB1A 4J80A 1HDYA 2F7SA 4YR7A 1NASA 1OWPA 2AUNA 2Q3EA 5AM4A 1X7DA 4FOOA 4KSYA 5LZ2A 3UHPA 5ESDA 3W9SA 1QIEA 1GTJ1 2DSNA 3TW0A 3LSUA 3AUAA 4OM7A 4IUYA 4IHQA 4JASB 5KWSA 4S2EA 3EQZA 4P30A 3I37X 3KX2A 3UUEA 1O0CA 4GPD1 3R6WA 5I9LA 4ZZ2A 1VG0B 2OT3B 3QJ5A 1XDGA 4PTLA 4ZAZA 2PMKA 3KVVA 3QVSA 4OHKA 5EMLA 1GO2A 2FDCA 4AG6A 2PK3A 1OVMA 2JDIG 3PLNA 4NIMA 5BPFA 1K8RA 3GVCA 1F4NA 1SULA 3L4EA 4IH4A 3I92A 3OQVA 5CFNA 4RELA 3C6QA 1H8EG 3FDIA 1Z18A 3TW8A 1J8MF 1K27A 4TSFG 3FOBA 3AH8A 4KVZA 2VQEB 2IDKA 5IP5A 2F8TA 3VMFA 5HQ3A 1P73A 2R84A 4ZPXA 1VCHA 4PVDA 5ALLA 4RC9A 2A33A 4RTSA 4AP5A 4GYYA 4QPZA 1OIVA 3Q8WA 2O8NA 1R74A 4KO1S 2FUCA 3LD9A 1Y8RB 3KBBA 2JJMA 3MUEA 2X19A 3KAPA 4J0DA 3O92A 5KHOC 2QL7A 2AHOA 2C3MA 3OEHG 2BGWA 3E8MA 3LUDA 3CLKA 1PJBA 1ZRNA 2P9BA 3QU2A 3H9QA 3RIHA 3OD4A 2K7FA 4FFNA 3DAPA 1L0LH 2V9CA 3MSCA 4W5JA 1Q86H 1HE1C 2D5AA 1EKXA 3UMRA 3PEUA 2YRXA 2RH4A 1ZGHA 3KZIZ 1NQXA 4HFMA 5F64A 5E9WA 2HTFA 2N3ZA 2YV2A 2FJUA 1CJUC 1RM1B 3S1AA 3UOAB 1SVWA 3K5PA 1L5HB 5BQXA 2OHHA 4BX3A 4HNUA 1ZMXA 1IZ0A 4MA0A 1N2CE 4PZLA 4C7BA 1EJ6A 4RLFA 4BCDA 5EKSA 3RRXA 4ZVQA 1OJHA 4DR1O 1VLJA 1Z75A 3NUQA 4JQCA 4MOWA 1QGYA 4C9BA 3SJBC 4LJLA 5BXQC 3SS9X 3GGSA 4GQAA 4YAOA 4M53A 2R1VB 3T1OA 1EFKA 2VAVA 3I42A 1NVFA 3HFRA 3RS0A 2G8LA 2PKYX 2ARHA 1W4RA 1T8TA 3I6QA 5B1AB 2C59A 4UTXA 3C3XA 2CH7B 1D5AA 4JBWA 4NECA 1LSJA 5SZKB 4E70A 2ZQYA 2PT6A 2A6PA 3JQQA 1F7YA 5T57A 3U10A 3ESRA 4WACA 4F4UA 2Q9AA 3G5UA 4B5LA 5KU7A 3VNVA 3LQKA 1V96A 1ONIA 1AZWA 4K3VA 3S2SA 2F8SA 5COAA 3IR5A 2IT1A 4QEZA 3VZPA 5LJLA 3D6MA 4UE3S 2Q6TA 4L9AA 4RVDA 1NXOA 1IXKA 2IXBA 2P2YA 2ZJ5A 2B9EA 4M76B 5KTTA 1QK3A 3B8NA 4HLDA 3A31A 5BZBA 2VNJA 4B7XA 5IPFA 1E1CB 2GD6A 3ANMA 1SQ0A 3LOQA 3KDAA 4JI8B 5LM3A 4JOCA 1W6UA 1GUYA 1M2GA 2NUBA 2PD4A 2QN3A 2WNHA 1ZHOA 3GARA 2FG6C 2W8BB 1PQ4A 4KXUA 4WCVA 4ESOA 3COZA 3AFHA 1U0LA 3BF8A 3FOCA 3OAAG 5AHRA 4ZMSA 5EE1A 2DVMA 4XE5A 2Z0AA 3L6OO 1Q12A 2Y9MB 2B3TA 3GJ7A 3A1UA 4Q1BA 5C7OO 2PI4A 1SCNE 1T4BA 1G17A 3C1AA 2DBZA 3R65A 4OAQA 3FOFC 4HUTA 3R9XB 4X65B 2H8KA 1GX1A 1N7JA 1QAMA 1SVOA 4I1IA 2JFVA 4Q7EA 2VWQA 1WXXA 5E9JA 3BL6A 3FA2A 3FYCA 4N3CA 3N2LA 3MTDA 2I4OA 4KYTA 2XKKA 8AT1A 3ZE7A 3VYUC 5K3FB 4HB4A 4U02A 1SUCA 3C7DB 3M6IA 4EPVA 5BNZA 5HOQA 4D26A 4N0PA 4U2KA 5CGZA 5HOEA 3DAGA 2C8KA 2EATA 1IHXA 1KA9H 1W88B 1GR0A 2IYLD 2QD2A 2Y2UA 4MUKA 5F5NA 4B2PA 821PA 2JZNA 4CE6A 1SKVA 2OCDA 2ZXFA 1X7GA 3AU9A 1U3DA 1RKBA 5FNVB 3SKVA 3TGPA 4X5OA 3OFND 4XFKA 1U94A 1CR2A 2PHZA 4CZ2A 3IGFA 3D7LA 2UZ0A 3F96A 1PQUA 3PT9A 3O9OA 1NVMB 2AOUA 2DWQA 3FR7A 2NM0A 4TQGA 5CLIA 3MTQA 3BWDD 4RZIA 4US1R 1AGNA 3EXEA 4IJVA 2H9IA 5AHWA 3OQ6A 4Q1DA 3B09A 2PZSA 1NVPB 1P5FA 2J0VA 2JAHA 2ZP1A 3LV8A 3VSEA 2QR4A 3PPWA 1Z5OA 1JG3A 4MRNA 3R75A 2H1CA 4Q12A 4Q21A 3DV0A 3ZX5A 2P6MA 1FVXA 4W63A 3VPHA 2I2AA 5LIRA 3G3EA 4JJ6A 3ZOZA 2ZAIA 4PLGA 4EB0A 5AUNB 3FD6A 1OTHA 2ZIAA 3Q88A 5EBWC 2CMKA 4CLOA 1YE8A 1TUBB 3SXJA 3P2EA 1URFA 2FZCA 2B20A 4PG4A 1SMKA 4DPLA 1QKJA 3DMYA 3KJGA 3NTUA 5KNCH 4DV4O 5FOTA 2CVZA 4OKNA 4R3NA 1ZGAA 3SAJA 1XUQA 3P9NA 3G1TA 3JAKB 1T9AA 3A1SA 1DP4A 1HE5A 4YH1A 4ZHQF 3DT9A 4Q93A 1RLMA 5A3QA 2QVLA 2R7KA 1IBLB 1I24A 5FLYA 2VJMA 1UOOA 4KZPA 2CNWA 1XNQB 5IJWA 2HO4A 1HP8A 2NXCA 2P5SA 1T1GA 2R60A 4QYSA 3R3UA 2NU7B 4GLLA 4X66B 2Y93A 3W8NA 4B3SO 5IXJA 4FNAA 1PS9A 5K03A 4Y6PA 5AJHA 1XZAA 2JATA 1U6JA 2I9PA 3JYLA 3JTMA 1CEQA 3OY7A 5JNLA 4JYZA 1OX4A 5AIAA 4TQUS 2CGNA 2F4VB 1SURA 2V9YA 1ZOSA 3PL5A 2F90A 4OXRA 3T1NA 4TZ6A 2W6CX 1NJIW 4J6EA 4N18A 3ETDA 5B5SA 3UGTA 3OJWA 3AM5A 4RGVA 3O26A 4G0XA 2GXAA 1Y3DE 3LF2A 1N1DA 3DWEX 5FBKA 3UV7A 7ABPA 1H8HA 3QHQA 3H5IA 4MPTA 1QQ6A 5F76A 4P34A 3T1YB 2ALJA 1FXKA 5FYQA 3PNVA 3OZAA 4DLLA 3P52A 4C5AA 1PYOA 2XV1A 1OAKA 4HUQA 1XVAA 3OEEG 2W4QA 2HDNB 5KPJA 3GPLA 1YHQV 1BD3A 1VLLA 3T4PA 5BYAA 2C4KA 2PX0A 1HQYE 4OHCA 3UO2A 3F5QA 4DB4A 1U04A 4ESEA 2V7VA 1QIFA 1XJ5A 4QPCA 4X91A 1G3QA 2AC2A 4GMXA 3I55F 3DBIA 2C57A 1FYXA 4IDNA 4FBMA 3HJFA 4RZUA 3N0VA 4ZREA 1I5XA 1W57A 2QRJA 4G36A 1G21E 1CEXA 3ASNB 1BNCA 1FMLA 2QR5A 2YZKA 3G8CA 5DTRA 3ABUA 3TI9A 5KBYA 1PM9A 3RYTC 1KS9A 3R23A 4XR4A 2QD3A 4HH0A 2D4HA 1XK7A 3AHEA 5JD5A 2VPIA 4JP2A 1RKVA 3SG0A 1T4MA 2F3QA 2LGJA 4IIHA 2BEVB 1L9XA 3B82A 1RQNA 1ZISA 1OA0A 4TMVA 2C54A 2XD9A 4BZQA 1EYZA 3GHYA 1ZCZA 4EUSA 4AZ0B 4CH5A 3I34X 3DBLA 1MJGA 3ETGA 3A6EA 1ROPA 3CPHA 1EP2B 1Z6PA 1ZGJA 2Q3HA 3L18A 7YASA 1VJTA 4CEIA 2HO5A 1E1DA 4PFQA 3RW0A 1GMGA 1HZJA 2QL6A 4RIIA 1QQAA 1KH3A 4EYGA 4JXZA 1KJJA 2IX9A 3OP4A 5BVGA 2QN6A 1BQ0A 1T0JB 3O8RA 4QUKA 3SY8A 1NYRA 3LO8A 4DT1B 4YXWG 2CD7A 3RF7A 3T7TA 2VQFO 5BP7A 1B6SA 1EXVA 4X89A 3D43A 3T3MB 2XXAB 1QQ7A 1P7GA 2CSLA 2JNBA 1F2UA 4KWTA 5L8VA 3UMMA 4QGAA 1V9LA 1IVNA 2Y2VA 4ZVUA 1W42A 3CURA 1ZU5A 2VDOB 4PHTA 5HCIA 4Q4AB 2W6IG 4EMUA 1LBIA 1UBFA 2BW0A 1FTYA 4AI8A 5IYCO 2CXUA 2IHBA 2QENA 2QTTA 3H2JA 3F98A 3PQ8A 3EHBB 1UDCA 2M6SA 3HU1A 4KQWA 3JSNA 2ZUDA 2CHEA 4QO7A 1XX6A 2M6RA 3WQQA 3FHLA 4BNWA 1KMHB 1HDGO 1XREA 1N0IA 3BIOA 4C8GA 4A03A 1OFUA 5KOIA 4IZIA 4BN4A 3KTAB 1GFIA 1I32A 1MRSA 2IVFA 4HB3A 4LVOA 2HHHB 4NU8X 4R1PA 4UTZA 4F93B 2EEZA 1SM4A 1SCDA 2ZB2A 3PWSA 4EG7A 3EEFA 2XKAA 1ZSYA 2X8JB 2YWFA 3GLQA 3CWBH 4OX9O 2WLJA 2AC4A 3JSXA 4FLZA 2CFOA 3DEAA 4PPNA 1OFHA 4QUBA 3ESYA 1YCIA 2I6FA 2ID9A 3K9BA 5DWVA 2ZRMA 1L6IA 3C24A 2XYGA 3ILYA 4J76A 5C81A 2AN5A 1BHBA 3JQAA 1BQ3A 3I5XA 4DC1A 4AJ9A 2WUFA 4PO8A 3SXPA 1E92A 4ZDJA 2M98A 2ZVDA 4LY3A 3OJLA 3KHSA 1VQVA 5ICCA 1VXOA 3OT7A 4RTLA 1KEWA 2P5OA 1KBQA 3ZLTA 5CD1A 4Q4JB 5JATA 1AG9A 4ZVPA 3KETA 5FBQB 1YDFA 1RQLA 2YMQA 1ELOA 3A0RB 5CNKA 4J7AA 2V7XA 3S55A 1VRWA 5JZOA 2CLHB 2Q45A 2YXDA 4QDZA 4ROTA 5BSWA 3CLRC 4OF4A 3RC7A 5DHFA 1NZ6A 2JGKA 3NAQA 5KVAA 1Y8ZA 2OWEA 4ADSG 3GROA 4K81B 3EGDB 3T3HA 2Z09A 1I6MA 1PZFA 2ZT8A 5EB1B 2E37A 2MSEB 3QI7A 3S29A 2HCBA 1ZN2A 2YRWA 3G8AA 4GOJA 1T1RA 4ID9A 1JXOA 4RK7A 3EGXA 3ZXYA 3OR7C 2FUG6 4AB1A 4EJ2A 3LWDA 1JZSA 4BNKA 3V34A 3IKMB 5K0CA 4ERHA 1HDXA 1OUMA 1GA6A 1VSUA 3ENVA 5DHAA 2PLWA 2PY6A 2QUHA 3DZBA 3ZRSA 2PLRA 4BB6A 1U28C 4MSUA 4L5CA 2V6JA 1EE9A 2F9ZC 2XRZA 2Y1WA 3B6EA 1X1EA 5KOJB 2RARA 4H15A 5BUQA 3KV3O 2XCTB 3G59A 3HA5A 4MVUA 4ZI7A 1QNMA 3Q7PA 2QTNA 3RHTA 1WTCA 1ZGBA 3GZ4A 3T1TA 4LISA 1T36A 3KSUA 2YHSA 4EUNA 1X19A 1ISFA 1Y4ZA 1PFVA 2RC5A 1QO9A 1MMMA 3OIVA 4BFSA 4ZO9A 3RTGA 2DFNA 5MFPA 5T7BA 1WRBA 4EKDA 3KKYA 1CZHA 4REQB 3GGGA 4PN7A 2QEXV 4Z3DA 2RHCA 2PSJA 2OE2A 3MJFA 3CCSF 3RREA 2VQ3A 2PZEA 3S5UA 3BQ9A 3BTUA 4URZR 4CM8A 2VSOA 3OHPA 1LSUA 4C20A 3P2JA 3PE4A 3H1HH 2XRYA 3VPDA 1AJQA 1PL0A 1EZ1A 2FPIA 2VQFB 1NR1A 4M87A 1CJMA 4DC0A 3GCDA 1SN7A 2XWPA 2VUUA 3L0ZA 4PQGA 5BUSA 1V9PA 1M2KA 1OU0A 3HN6A 4HXEB 3ZQUA 5D5HA 3IAYA 3RSHA 1V35A 4MVJF 3SEZA 4DQKA 5I47A 2WQ6A 1U02A 2YZMA 4EUEA 4MRRA 1LJLA 2G4VA 3UH1A 3F6EX 3SXUB 2HU5A 5A9SA 3OZGA 2LZ0A 2FSVA 3SHQA 3HWRA 5HGXA 4KFCA 3NMUF 3I04A 2WB4A 3G0BA 1LI4A 2UUAO 3B8HA 3NWBA 4MV6A 3ABSB 4WJZA 1DUVG 2J1LA 4ASUG 3CNOA 2ZINA 3FTQA 5L3SB 1DAGA 3M4ZA 3Q11A 5L3DA 1H69A 4FR2A 1I6WA 4C0QC 4KWCA 5C3UA 1ECCA 4NVRA 5IHPA 4M83A 3RFVA 2W2LA 3VTAA 1UBLS 3E7XA 2XE6A 1C9YA 1YVUA 1RJWA 1QIMA 1UODA 1RJDA 3QI2A 5F78A 3E9ZA 4R1SA 2BUAA 3KLPX 3WXBA 3L0BA 3ZDZB 1GIAA 3CEPB 2GBGA 2HPHA 3BL5A 1DTWB 3GNLA 4N5NA 4LMBA 3PNMA 4GUDA 4RS3A 1R1DA 1AQNA 4O4HA 1RAGA 1V9SA 4HJXA 2ORYA 2DLCX 2Z1UA 3VDMA 2UXDO 3HDVA 4JI5O 4FNGA 4GLBA 4KHZA 2YFYA 4C06A 4Q20A 1FBTA 5DOVA 4D80A 1KF0A 2FP4A 2EIXA 5B4UA 4MUEA 3R8XA 2ZJ0A 5AKXA 1BU5A 4TXJA 4XYMA 1DXYA 1JAXA 3SC3A 3UT0A 4JDPA 4Z3OA 4UZSA 1S3JA 4QPJA 3WNDA 2CNBA 1MSWD 4PA6A 3H0CA 3ND7A 1W85B 3E22A 3IAAA 4U3JA 1JZTA 2UZHA 2HT6A 2RG1A 3ESBA 3JQBC 4HDNA 5I01A 3ZWQA 1M72A 2VTKA 1XAIA 4V0RA 3CSSA 4PAOA 3QEJA 5ALMA 1IHOA 3VOAA 2JNWA 3OMNB 2R4UA 4OIFA 4UNRA 1Z5PA 2B99A 5CXQA 4WQMA 2Y69C 3P2KA 4ITUA 4OSPA 2ZQZA 4C0BA 1UAAA 1CR4A 1Z0ZA 2Q5HA 3A3PA 1WMFA 1YAJA 5GIOE 3CC7V 4IHJA 1GZUA 2EJCA 3N2GA 2FQXA 3N3AC 4F56A 1B23P 1H2BA 2AD5A 1JNYA 3I04M 3QBEA 3LDDA 4WNYA 4RTKA 4BN5A 1NT2B 2VNKA 1RQ2A 2BGJA 1H3FA 2IM9A 2OG2A 1TF7A 3B2QA 4Q66C 2ARKA 2EJUA 1RS0A 3HSYA 3C7TA 4N3GA 4R3UC 5AW0A 4Q7QA 3K16A 3G88A 3CXHF 1NI8A 1YL7A 2VAXA 3G79A 2WNIA 4ZCSA 2BO1A 3IQGX 3LMKA 4QBHA 4RTQA 2DOSA 1GCIA 1OLSA 1P4HA 4GPZA 5MGNA 4DR7O 5D84A 4QWMA 4BXOA 2D3WA 3UJHA 3NIBA 5DM1A 1C9KA 1BGWA 1JECA 2NNUA 1VQOF 1GQQA 3TGUH 2F4VO 2ZWMA 3KSBC 1CLIA 1B04A 1H5QA 3LNNA 4MW8A 5L3QA 2X4LA 3I8XA 1IVSA 2VHVA 3ZMVA 2X2PA 3T4EA 2ZR9A 4WFGA 5IJ9B 4WSOA 3M3HA 1A8UA 2QUZA 3OLCX 4JKIA 5EIAA 2V6FA 1JLMA 1GLNA 1KZ1A 3ENNA 3IUBA 5EP3A 5AOVA 1FUUA 1T6NA 1XTQA 4LNAA 2PZ8A 4OMCA 2QI9C 3BERA 4KQCA 4FNOA 4YP7A 4Q3OA 4G4WA 3OSUA 5IMSA 1G6UA 3BRCA 4EPWA 2W2QA 1CUGA 1U3UA 2CYBA 4OQMA 5HS6A 3V4ZA 3HJHA 2YASA 3LE8A 1TRKA 1JQJC 3BE6A 2QWQB 2W6JG 3X44A 1JLSA 3K06A 2HJHA 5F98A 2DAPA 2DYRC 4MICA 4Y6QA 3TKAA 5LB2A 4UOZA 2O3QA 3AG4C 3Q3IA 5IBCA 3IJPA 2ZUBA 3M6MD 3A2KA 2GD2A 2NLJC 2HHHO 1YACA 3CUTA 3KKOA 3MQ2A 4I55F 4M0DA 5EE5B 1GNQA 3AUJB 5C1PA 3OIDA 3N7TA 1PYGA 3TQQA 1MN6A 3CEJA 4HZ3A 4NABA 3QKWA 3O73A 5H80A 1ABEA 1Y8RA 3K72B 4QYIB 1V4BA 2P2ZA 3E8SA 5M3BA 3N7UA 3NYQA 3M34A 4D4LA 1DQSA 1JHAA 2HRYA 1U8TA 4H7HA 4MULA 5EXEA 2O7QA 5H9WA 5BN3B 4N5LA 4AG5A 4AP6A 2R66A 1FS0G 2W7TA 5G40A 3B12A 1I9CA 2YV1A 3MNFA 2DWCA 3LNCA 3Q3JB 3BFRA 1ESZA 4MLCA 4REMA 3SE0A 2IZOA 3BMOB 5E79Z 3C3KA 4JI7B 4LSGA 4I3GA 3EEYA 3DJYA 4N1AA 1N8KA 3RVPA 3RFXA 4AURA 1Z0DA 5AXAA 5DEDA 1GSHA 4X1KB 4AJOA 2V7TA 1CLEA 3LECA 4IOMA 4DSTA 3YASA 1G55A 2RGUA 3BB3A 2Q69A 1YB1A 1Z35A 3ZV6A 4YCCA 1DX4A 5B64A 4TTRA 4M9ZA 5ITSA 5FLXN 1XEWY 2SNIE 4LYFA 1U7TA 1JNXX 1FKAO 1H7MA 2B36A 3FR8A 2APJA 1Q1BA 4MW0A 4MYCA 2R1VA 4IQFA 2CNOA 2XXJA 3G7NA 1J95A 4BCBA 4DIOA 2XGJA 3C3AA 2JH9A 3Q8XB 4DBLC 1SIUA 4IP0A 4JLVA 4I46A 1XWIA 3A6KA 4PSKA 2OGZA 2IV3A 1WS6A 1OMOA 3QF4A 2UXXA 4ER5A 1XV5A 4UKDA 5EE0A 2GYWA 3UPTA 2Y48A 1GYPA 4UTRA 1QVFF 3TLXA 1JHUA 2MYTA 2JVIA 2FSPA 4WASA 3HU2A 1E1YA 4ZOLB 1DBWA 3HCFA 3F73A 2XI4A 1J0BA 4M1ZA 2YJZA 4PGAA 4FYMA 4DFDA 5HF9A 1IURA 4LDNA 3T1YO 1KWGA 1ZJJA 4KOEC 1O5OA 1GVHA 2CTWA 4JOSA 4B9AA 2XSZA 1C81A 3N28A 2HWUA 1KBOA 2O5VA 3I39X 3PKJA 5F2EA 4D0LB 2DQ0A 1PE0A 3E1KA 5AJVB 4BL5A 1SHLA 1E1RD 2Y1FA 3ONVA 2LJ2A 1DBRA 1I0ZA 4PCLA 4WN9B 4U9UA 4AULA 2G7ZA 2IYXA 2X5NA 2WVHA 5FUYA 4IDEA 3BKXA 1VTKA 3T0IA 5A5FA 2Y69B 3AVQA 2W6ID 1MZFA 3F4BA 5CGQB 4YRKA 2IJKA 2MYUA 1OI7A 1W47A 1HEYA 3RGBA 4RMGA 1OX5A 3THXA 4HWPA 1YRYE 4F9EA 3I9V1 4FS3A 3LUTB 3GP8A 1WETA 1ZVKA 2Z3WA 1Q6HA 3P20A 4X8HA 2F43A 3VYTC 5FL7D 3RIGA 3ZCPA 1VG9B 1V7PC 3P4YA 3PIIA 4M60A 4B1FA 1U63A 5AUPB 2P9TA 4YCMA 1NBMG 1Z2AA 2QSUA 3IE0A 4JAAA 5ALEA 4LFCO 1P91A 2GBLA 3CWZA 4J0FA 1SRYA 1SU4A 3JSAA 4LOHA 3ZQ6A 1HPLA 4RDCA 1SIBE 3R9KA 2CUNA 3WAKA 3G0HA 4FFMA 3EXG1 1P7ZA 1XRPA 2FK7A 5CIQA 1L4LA 1CR1A 1X9HA 2ZUTA 3G2PA 4AL4A 5K8VA 1KAOA 1MVOA 1X1DA 3DWFA 1GADO 4NU0A 1L5OA 3KCQA 1FOEB 3X2FA 3ZDRA 3OJXA 4TKUB 2QTVA 5JO0A 2Z6UA 3RSZA 1LNSA 4A8TA 2PMBA 2X1MA 1A88A 3L06A 3KKZA 4RSMA 4KEAA 3CLTC 3T4ZA 1D6JA 2QU7A 1SWVA 3EXEB 3Q1KA 2X58A 4M8IA 1E1KA 1UK8A 3EAGA 4LZNA 1UXJA 3ORFA 3M4YA 3OWXA 4AJKA 1CJKC 3VH1A 4K0RA 3MOIA 4OGWA 4YJHA 3DV0B 4MV0A 3OW2F 2GZDA 2JGEA 2BFEA 3IAUA 5K6AA 1NPTO 3P9KA 4MP3A 4OQQA 4DAEA 5A71A 3NWPA 4ANFA 2GEUA 2UU9O 1R64A 2HF7A 2VRWA 4LSMA 4IDQA 1M2JA 2Y76A 2HI0A 1SB8A 5AKLA 4NOMA 1ZUNB 5A4MS 3JARA 2W2KA 4J6FA 1PW5A 3L07A 2BR3A 1GZ7A 1BDIA 4EY8A 3EB9A 4A0SA 1OZFA 3MBOA 4ZQFA 1CUCA 4E6PA 1PF5A 2VWJA 2R85A 3CCLF 2ZGVA 1YGYA 5A2GA 1CYEA 4HGOA 3TRKA 3CRAA 4YMTA 4JWTA 3E5RA 3EASA 2Q2WA 4QOHA 1JKIA 1ID1A 2A0YA 3X1MA 4UHEA 3H5LA 5GW7A 3U81A 1PGPA 2BE7A 1XYGA 2LVBA 4I55B 2AR9A 3GH1A 4FW8A 3DC2A 2FFHA 3C3MA 4CLRB 1QYDA 1K3UB 2RB4A 1GU1A 1KYZA 3N05A 2JJ2A 3FFXA 1KBHA 4HNTA 4GSLA 3HXMA 2UUBO 4DV7O 1Z0AA 1S2IA 1RZVA 4WFJA 4ZHQB 3B1YA 1E0DA 3HDGA 4Q00A 3F3YA 3ABRB 3PYMA 3UAZA 1IEVA 3NFRA 5CBHA 3TIXB 2OCIA 1C9EA 1Z4QA 2VJLA 4GBJA 1DINA 4GEKA 3AG7A 3V2IA 5L3VA 4XEHA 4O0LA 3JTEA 4UFPA 4IJWA 3H2GA 1VBNA 1MB2A 4FYJA 4LGMA 2G1JA 3T5CA 4IVNA 1LC0A 4EKEA 4JYAB 2LBTA 5G4VC 2FI1A 4MQ6A 3FTNA 3KUXA 4IGGA 3MHTA 3N2EA 2B0CA 2I6UA 2HEGA 2YZ7A 2BHRA 1M6YA 2OQRA 1WCV1 4UATA 2JHFA 3AQ4A 2ZTLA 4AHCA 3RC2A 4DABA 5LKRA 1HX7A 3KQNA 1RWWA 2XA1A 2OAQ1 2ZI5A 1L7XA 3KM0A 3STTA 2FR8A 3IL2A 2V9PA 1LEHA 3PNPA 1BJKA 5KWVA 1KMNA 1OC2A 4DGQA 3CWCA 5A5DA 3GNTA 3FVTA 4QSHA 4HYQA 4QYXA 5KHGA 2N1BA 4PI2A 4ZVOA 2X41A 4PG6A 3CZAA 3DC7A 4WOKA 1OZAA 1ZM9A 3EUAA 3F5SA 1RC0A 2I66A 2BFAA 4EI8A 1NU1H 3ZEDA 5H3HA 3H6GA 4DR1B 1ZA2A 4XUDA 4J03A 1JHMA 1H6AA 1CYDA 3L0IB 1AZLA 3NHFA 2H8CA 4TROA 4BLWA 2I2CA 4EGSA 2ZF8A 2HPAA 4GKJB 1F17A 3L8HA 3NM6B 3QW4B 4RVSA 5HFAA 1KEZA 1SOAA 2BI4A 2WD8A 2YJ6A 3K0FA 5DP2A 1D5CA 4CEIB 3ZIAD 2RGDA 2MWMA 2RIPA 2OK7A 4KNVA 3VQWA 3WWYA 2Q8PA 5BVGB 5EJ5A 5KVVA 4XM2A 2P9FA 1U2TA 2BEKA 3DYBA 2QE7D 1VBFA 1H5UA 1ZKDA 3LOPA 4D79A 5KOYA 2JVKA 2XUKA 3KJJA 4BECA 2H92A 2JHPA 4OBEA 4I4TF 4B6GA 4KP7A 2BBWA 2ONZA 4GYCB 3B9QA 3I4LA 3FCEA 3OEWA 3GMIA 2CXTA 4QBIA 2VHEA 3C45A 4RVNA 4Z3KA 1AQ6A 4KUMA 4PLWA 5FR2A 1NV8A 1WXHA 4U2BA 2RAVA 3OAAA 1H85A 4GSKA 4JFRA 2A4MA 1AVTA 1OYYA 2CLMB 2QJOA 1W19A 5C4IA 1AN0A 2FMKA 2QIOA 4JGIA 3WNCA 4PDMA 1SVUA 2I1VB 2WALA 1S8OA 2FSHA 5ITZB 3WMWA 1Z47A 2XDWA 3JWPA 4JHLA 1V1RA 4J7KA 2YOFA 2X0DA 2YV4A 5IYBO 4OA5A 1GGFA 3S2GA 1KSFX 2HGZA 4ZRDA 5E7IA 1I3CA 3TD6A 1Z06A 1QRTA 2EZOA 3ZUGA 2YC0A 3AK3A 1P0CA 2X6AA 3C87A 2YR0A 1DQRA 5KPDA 4RTPA 2OBYA 2YY5A 3E3OA 1NL3A 3N76A 3NNSA 3Q7EA 521PA 2I7VA 2VHYA 1IL0A 3R6LA 2XOKA 4DIKA 1NLMA 1R5OA 3U0VA 2HRZA 2XLCA 3NIDB 4PR0A 1OFTA 4CM1A 4X61A 1GZ5A 2PXHA 3HB3B 2NU9A 3JQAB 2A5GA 1M2NA 1PR3A 4NB5A 2FMIA 2Q5JA 2WTAA 2XCLA 3K31A 4J4BA 4NMWA 4PQFA 3TFWA 4EELA 3DMGA 4I7ZB 5FFNA 4D3ZA 3PJEA 1U31A 4DY6A 5DM6V 1FRFS 5EZ5A 2R6HA 4Z4EA 2FCRA 4F4DA 4X9QA 3T2MA 3U4CA 4BS9A 1E3JA 3V9PA 4EO4A 4WJKB 1CE8B 1LTQA 5DDIP 3B60A 3PGVA 1DRVA 3V4OA 1YHQF 3B1XA 3OOJA 3OCUA 1FX0A 3TB4A 1E3TA 3ANNA 3SVTA 2IS6A 1ZVQA 1FXSA 4F86A 2AX3A 3HWWA 3OZRA 4BZWA 5C5EA 4FEAA 2PI5A 2HXGA 3U7HB 4KXVA 3FRIA 4W5RA 2O0KA 4M6WB 2QTGA 1CRQA 2AR7A 3GBPA 4EW6A 2FW6A 3CYPB 3ILHA 4L4XA 1LCIA 1E5QA 2CF6A 4PYQA 4R40A 5HDBB 3SF8B 4HAZA 3H3FA 3JQ8B 4UQPA 4MXDA 4QU0A 1GRRA 2QRVB 1K89A 1X0VA 5ALTA 1OBFO 1FFTB 3R7SA 1LV7A 1LX6A 1NNSA 1H94A 4G4XA 1T15A 1LK7A 2UUOA 4Y1GA 3KNZA 3W5HA 4D44A 3M2PA 4O0MA 1A1VA 2NMVA 4PA9A 1WMDA 4EEXA 3BVOA 3QNEA 4KMOA 1V3VA 2XUOA 5HWSA 5HJ2A 4DNFA 1PHRA 1Y8CA 3GR6A 2DU8A 4DR6B 1V9CA 3CKMA 2D3OW 3H1LH 4G5QA 2C7RA 1P1BA 4IYRA 5DSTA 4QTUB 4N9QA 5K3OA 4CC5A 4IKEA 4TSFD 4K9OA 1JFTA 1BSMA 4MIOA 3BA8A 1EWQA 3QYJA 2IJIA 1HE4A 2DHDA 2X6TA 1DS6A 4IIJB 3MERA 5HE8A 5FOQA 1NBME 2AMFA 2QNIA 3GOQA 4X6UA 1X8LA 2DCUA 4R50A 4CPDA 1V0JA 1ZN9A 1RYMA 1M6VA 2BGLA 5KEIA 2OTMA 2ZT6A 3LUBA 3NTXA 4HDAA 3V1LA 1N2ZA 3AF1A 2XAHA 3I1IA 4HRYA 4XJVA 1MEOA 4O02B 1Z74A 3QBVA 3WLJA 2BH9A 2X4IA 2OTCA 3H3JA 1QZUA 3A6FA 3W9UA 3LYHA 1CUEA 4HX9A 3FUXA 2YJ4A 4F3YA 3INYA 2P90A 3B8MA 5J5VA 3NKFA 5KNBA 3L79A 3P7MA 1KVRA 2VAWA 4BBPA 3KEOA 3EVCA 3ZHCA 2IOFK 4H7IA 5EC2C 2ZBPA 3TLJA 4EK9A 1XCOA 4I9WA 5AYVA 2FFJA 4Y9TA 3SYOA 4GXRA 2IZ5A 4DXWA 1TA8A 1EWKA 2DY0A 3B38A 2XT0A 3AZPA 4FT2A 4ENRA 5L3SA 2WYHA 3HABA 3VMMA 1KKDA 3SHVA 3MF4A 3SQWA 2JLXA 3EQ7A 2Q21A 1RAEA 1WW3A 3BA6A 3WLSA 4ISBA 2X0FA 4J9VA 4EG8A 1JX6A 1NUTA 2XGGA 5IKXA 3GJSA 1YQNA 3ONWA 4MQFA 4R68A 1G2PA 3EWSA 5BSKA 5HZMA 4XI9A 1A27A 1DKQA 5KA5A 3K1JA 4X0EA 5AK0A 5J2TA 2HGSA 1EB9A 5K4AA 2GN4A 4MCJA 4W1SA 4MVWA 4PNHA 1AC5A 1TZMA 4R5MA 5KYVA 3CJHB 1MABB 3KXDA 3MJ4A 4ZGWA 5A5VA 1ZICA 1XRQA 4O2AF 5A4DA 3BWYA 2BM9A 2PUGA 3WQSB 2VI5A 5HF5A 4GVPA 1G6Q1 2Q0XA 2ZDGA 1XCPA 1O57A 3SX2A 4BVBA 4LECA 3IMPA 3FSEA 1BE1A 3QTYA 1Z7WA 4YRNA 3MRVA 2P79A 2RHRA 4RIGA 3F78A 3APOA 3R76A 4N65A 5DBHX 4HDNB 3VR5A 1DRUA 4RVHA 4EA9A 4Z4HA 2VPPA 1HDEA 3Q8KA 3HBJA 4RY8A 1KQFA 5SYNA 3MK31 1U0BB 4K9NA 1FFEA 2X6BA 1HK7A 4MW4A 2ZRGA 3ZV7A 5A03A 3U1BA 1XYVA 2JLZA 2Q1YA 4TYYA 4YRMA 4RTMA 4Z0NA 2VYCA 4RA9B 4IUDS 4BO7A 3IX7A 1JEJA 1YGPA 5EOVA 5EUCA 4D4GA 4IBOA 4R2WA 4YV7A 2BKAA 3BRWD 3K70D 3UK6A 2VJOA 3CPSA 3KEQA 4G0WA 4R2IA 1JBEA 1SD2A 1ZCAA 4DV1O 5HXZA 2R62A 2ZNIA 4KX3A 4KUEA 3FPKA 1SF9A 4RE6A 2FFQA 5IVDA 3O90A 2CW4A 2ZDQA 4JVMA 4M1KA 1IV1A 5JJIA 5HK9A 4UMVA 1KQOA 3TUZC 5BSHA 5FA5A 1MO6A 1EFRA 1GPDG 2HRRA 3E0QA 3G68A 3PGXA 4PNPA 2XNDG 3AG1C 3UXMA 4QQNA 3BK7A 5JVDA 2XMCA 4KREA 4UPEA 3MQFA 2XMDA 4ZTUB 4XCVA 2KB1A 1CNEA 4UU7A 5CM8B 5DN9A 5J9FA 3IBCA 2B2XA 3QVGB 4ND4A 4DBZA 3FX7A 3FOWA 3RGGA 4BNNA 1VA4A 3IQZA 4CNBA 2AN1A 3X2SA 4ZVMA 1CJCA 1E1QA 1R8JA 1TM1E 1YBAA 4J7XA 4RYDA 4Z99A 1CW2B 3NO4A 5J1SB 4FBLA 4DQLA 5F3DA 4UB8Z 4RADA 4YR9A 4KFTA 5CA1A 2JS5A 4UVCA 3DC5A 3VAZA 3RH0A 2ERYA 1XQ6A 5IYZF 3KZ1E 2YHIB 5B5EZ 2H1IA 2K6GA 3DP7A 4IGFA 4MTCA 2QZZA 4UU8A 4WLOA 3N2YA 2BR4A 3B5JA 3NOQA 3L4JA 1RI2A 2DTEA 2YFKA 1H2HA 4ASUD 1BL8A 4KR2A 4V03A 3AK2A 1VGRA 1R7RA 3FFWA 3O75A 1VMEA 4DRZA 1BCCH 1IBKB 1V8BA 3Q6NA 3KAJA 4II7A 3BH0A 4N5DA 1VFPA 2WD7B 1E6UA 4AECA 2QW1A 5B53A 4C4RA 5EHQA 5ARBA 4KXLA 1NVVQ 2ZAUA 4ZV7A 2NZUG 1X1SA 1BKDR 1PS8A 2WA2A 3TMKA 1BSVA 2OVBA 3MWEA 1VJDA 3OLYA 4OQYA 5EMNA 3V48A 4BN0A 3GLFB 1N2BA 1TTHA 2BHSA 3VTKA 4AWXA 1NUUA 1XZJA 3MMSA 4KBGA 1BCSB 2UYNB 2A14A 1V11A 4YV0A 3KQKA 4NZPA 3PUYA 1G4UR 2DC1A 2C9OA 1N8RH 3ISJA 4W9NA 3SSOA 1T8UA 3T06B 3TTTA 4K3UA 2YUTA 2G70A 1C7QA 4J0JA 4F2HA 4R2MA 3HVRA 3QWIA 5E4TA 1U1DA 2JCSA 2OBBA 4JBNA 3S81A 3QFSA 4JP1A 3HL4A 1YT5A 3FFMA 13PKA 1YOBA 4OJKA 5MFZA 1D07A 3LU1A 1K2WA 3IP5A 2I7DA 3QPUA 3ED5A 5AKEA 5IEBA 5TMEA 3NOOA 3RG2A 3RBVA 1X59A 2OQIA 4O2BA 3IMFA 3GEMA 2W6JA 4OHVA 3B78A 2YOGA 3H5OA 1JL3A 3AZOA 1XXHE 2BBTA 1Y4MA 3WHKA 4KGVA 5HKLA 2WQ7A 3M82A 3SJBA 1NFFA 4UCSA 3LAWA 3PD1A 1FZTA 1PJ8A 3IIEA 4FN4A 4X90A 1JBQA 1K7FB 1KVUA 4DQUA 2UXBB 1C2YA 3H8WA 2AOXA 1N8NA 1VF6C 2R00A 2ZS8A 4HGQA 4KK4A 5CVDA 1CQIB 1H4VB 3DYVA 5I6DA 4PSDA 3GJ5A 3DXRB 2A1UA 4B08A 1PK7A 4FKMA 4YWJA 3CE9A 3NDJA 1AT1A 2C31A 1WX1A 1MF7A 5A9TA 4EY4A 5I7FA 3D6FA 1YZLA 4P8RA 4LOLA 2PX4A 4OXSA 3KTOA 4BP9A 4JYAO 1WKVA 3DKRA 1T9CA 3HZRA 3ETHA 4Y1EA 1UK7A 1E0JA 1NN1A 1UF9A 2YJGA 2HVKC 1ODFA 5AO9A 3VJKA 3I9OA 3WHIA 1S72V 1X7PA 1R4ZA 1Y4DE 3JQ9A 1U3FA 4HQRA 2PVCA 1S8FA 1VQ8F 2GCIA 3B70A 4I8IA 2LP7A 4DCTA 4IXNA 2VS0A 1YB2A 2I6TA 2DP4E 1D7OA 3EDCA 2GVIA 1K86A 1OT5A 1VE3A 3PTZA 3X2EA 2HFJA 3L7NA 3M4NA 3MBMA 2PJDA 3NHPA 1J42A 4DUZO 2R4TA 1IBMB 4HATA 4NMMA 1CUIA 2ZM6O 4JI2O 1HNWB 1CY2A 7GPBA 3AEZA 3W6UA 5MDHA 4GP6A 2RAFA 4P83A 4E5PA 1DC4A 1RI1A 1VQ1A 2JJ2D 3IOCA 2RB9A 3QVXA 5TRTA 2QE7A 3DEKA 3L2OB 2IZ6A 4FEYA 1EN6A 3L0CA 2HVJC 1VG1A 3KZKA 1R18A 3F4KA 2WSBA 3F5MA 1M34B 3CCJF 4YRSA 1YMUA 2VJPA 2B82A 3KDPA 1F0YA 2EU8A 3LPLA 4KLAA 2VQSA 2ATIA 4DQDA 1DIOB 1GPBA 1R3KC 2JI4A 4V0ME 2Q6AA 2HSWA 2XZDA 4LQDA 1C8LA 1Y5MA 1QIJA 1NRXA 2ZJ8A 5CLLA 4ZO4A 4K0KB 3SQDA 1ST3A 3KFXA 2JFWA 4EPRA 3FRJA 1FFAA 3D4BA 1GG9A 4FYKA 5EAZA 1LUAA 4UCQA 1Y5RA 4G5SA 3AP2A 4QUHA 1S76D 2JH8A 3C6KA 4ND6A 2FUEA 1L8OA 4JZGA 4KN5A 3IFSA 3TBFA 2A9KA 2NXWA 5JC1A 4ZAGA 2DKOA 1R3UA 4M1OA 1B43A 5IDJA 2Q2OA 1TCCA 2ZI7A 4HTFA 1IOZA 4WEOA 4BMOB 3C3PA 3IHTA 1M2HA 2CJFA 1FA9A 1M66A 2XQVA 3NBMA 4B32A 4DT1A 5IDXA 2O14A 4GR4A 1EUCA 5J59A 4GSYA 2P6RA 1VLHA 1K06A 2B7CA 2R47A 1OH8A 2ZB3A 4CMBA 1U0NA 1V43A 2J67A 1GDTA 3ZRVA 2HRDA 4NCNA 3V1MA 2XUPA 2H31A 4B5CA 4KQ9A 1KI9A 2L2QA 4QFCA 3IUNA 4MVCA 3I52A 3SBOA 3I4FA 3MN1A 5SV2A 1VF7A 4N23A 4UBJA 4BVHA 4PHCA 1K7CA 1RXYA 1KC3A 2PL9A 1D2EA 4RKEA 5HUHA 4BQRA 2W2LD 2L26A 3CNEA 4PRKA 2PL5A 2DT8A 4L16A 4OG2A 3W0LB 2L17A 4KDRA 4ARSA 4CF3A 1GOTA 3K9HA 3F46A 4ISCA 1YCFA 2XAQA 1YB5A 5DN6G 3ZBPA 2DHQA 5HM8A 3O1LA 1JEYB 3HCDA 3HCNA 4NTYA 2X8WA 4PPGA 4WXRA 3L7KA 4FNMA 5DTMA 4BO0A 4O4JB 2LCQA 1JPUA 2AN4A 2FFRA 2O4CA 2UKDA 3NVKE 1SBYA 1ISPA 4MROA 4M1QA 4XIJA 2Z5UA 2C20A 4ENVA 3VYSC 4OK3A 2YQZA 4XZ3A 1Z15A 2Q5IA 3QSYA 1NBOA 1ZITA 4JN6B 1RHQA 1NONA 3ROXA 3K71B 4BRSA 4HMOA 2XAFA 4KFRA 1EAMA 1KTIA 4P2ZA 2OC9A 2EEPA 4I55A 2QM0A 3PPIA 5DXAA 3HR4A 3IUEA 1TXGA 3HBAA 1N3BA 4L0MA 4PX3A 1MX1A 4NUTA 2JLCA 4Z9XA 4EP1A 1R6VA 1U96A 1WCIB 5CLHA 2WHPA 1R37A 3R0JA 1N2SA 4URHA 4YQYA 1QPZA 1JAYA 1IN8A 3H17A 3TH5A 5FPKA 2FV8A 2PRZA 1WSWA 1GSOA 3DFKA 621PA 4MYDA 3A1FA 2YWRA 5AI6A 2CFTA 1RI5A 1XTZA 5GTIZ 3FBGA 5GONB 4ZOLF 4RLSA 2GH1A 2XW6A 4HWTA 2JLBA 4BNJA 1D2AA 4EB6B 1W36C 1RE1A 1RFYA 1M8KA 1U2GC 4BBAA 3IAHA 1ZESA 2Z1NA 3F6RA 2FUKA 5EQJB 2ZUEA 2Q9UA 3ZWWA 1DJMA 1TEZA 1QGED 5LL6P 1CY0A 1GTRA 3VSAA 4K87A 5HPYB 2JAWA 3GJ8A 4CUKA 1YC5A 3H01A 4BR6A 2JHCA 4P84A 4E1BA 3CUSA 5HIMA 3V80A 3TDNA 3FLBA 1IY1A 3M6AA 3STHA 4C76A 1K7DA 4MV4A 1FEZA 4ZJPA 3I1JA 5K01A 3KQUA 3ZOKA 1RAAA 1Y4UA 3FJYA 3DBOB 5L3BA 4P9OA 1Q84A 1CIPA 3K08A 2Y4NA 1P72A 4C5BA 2BDEA 1NM5C 3EQ8A 1U3CA 3UYLA 1PGNA 1Y33E 1LPAB 2OKCA 5ED0A 3UHOA 4PN3A 2DB3A 2QMOA 1ENYA 2W0SA 3C6YA 2ITCC 3GWZA 4WWHA 4KL1A 3V4RA 3KTFA 2AF4C 1SVSA 2WFLB 4NQZA 1GN6A 5KUKA 2BGUA 2WG1A 5EIHA 4CEJA 2ZU6A 1R0CA 4J9YB 1HKHA 1X80B 5CHEA 1CUSA 1QOZA 1Z5NA 4A8JB 2B94A 4C0XA 1BXZA 1KQPA 1R8YA 2UZIR 3BB4A 4J4TA 4ND3A 4WKCA 4XAQA 4B34A 3P8ZA 2IU3A 1P7PA 2I55A 4KPFC 1E2DA 4P3PA 1SQGA 2G6BA 3I5AA 5DJ5A 2H2AA 4EYEA 5DCLA 4MARA 4UFZA 4KPGA 2R5WA 1J9EA 4HPXB 2V7EA 3LLVA 5EKTA 1VF5B 4BRWA 4EVRA 5JFTA 1QFSA 5IKEA 3PV0A 4Q19A 4IFEA 4XH9B 3OE7G 3D6UA 3NANA 4AQYO 5GV7A 3TXAA 3V4LA 1J49A 3DXYA 3IC7A 3R5HA 2PVSA 3HP7A 5LDDC 1G8MA 2NTEA 3GAAA 3KUCA 3L84A 2ID7A 4L8YA 4NV0A 1UFKA 5DMXA 3T7AA 4DSAA 4ZCTA 3RAJA 4KV7A 1KXZA 4D98A 2IBSA 3A9UA 5ITZA 1EG7A 1MEJA 4BFZA 3ABOB 4R7TA 3DVAB 3FUWA 3ZLJA 3KR0A 4U3FH 1D4AA 1YZNA 3K6KA 3PDIB 3KO8A 1UKBA 2AC7A 1KY4A 1C8KA 2REQB 2BKXA 3CZRA 2R96A 2VP2A 2PPVA 4M0LA 3L8FA 4HZUB 4OMDA 2HMVA 2JG3A 3P2MA 1JJ2U 2XA2A 4HJRA 4KLRA 3TVTA 1H9CA 1JLRA 4FMBB 1QLWA 1GO1A 2B2CA 3QWBA 3U4QA 4IIUA 4LBYA 2F3UA 1U5BA 1GZDA 2DBRA 4WGGA 1ZWZA 4QHSA 2QDXA 2W6QA 5M29A 1Y5LA 3AETA 2CDYA 2PT9A 2X8LA 3WFVA 2P9ZA 3C1OA 4D4HA 2R9RB 3OWOA 3OBIA 4JI1O 2OEPA 3MA0A 2ZS7A 2EP7A 4HMQA 4LPKA 4W6ZA 2C2HA 4ARAA 4B4VA 5IT4A 1J2JA 2JJYA 2Q3BA 2V6GA 5H2FZ 1NP6A 3FPGA 4RW0A 4BGUA 4H1WA 1RCTE 5LXTF 4B46A 2EJTA 2IYSA 4ZQGA 1QLJA 1W8DA 4MUBA 2X40A 2PZKA 5ECGC 1IBMO 5AQ1A 3D6HA 2D2FA 2WD9A 4PLYA 3ERCA 4E15A 3CN7A 4LMRA 5E6RB 3T1HB 1U5CA 2ISSD 4MS3A 4NESA 3ROMA 3HTXA 2I2XB 2OZBA 1I2CA 3IT2A 4MUYA 1ZD9A 5IY5B 4DIBA 2Q0QA 2O8FB 4G86A 4FYXA 1JKJA 3E4DA 5KWEA 2IOFA 4ZK2A 5FA8A 4L5IA 3NPMA 1FFDA 4PY2A 3RFFA 4XIIA 3Q72A 1UC4B 1LRJA 3ZKAA 1NC3A 4QNHB 5ALGA 3HR7A 1TI7A 1NY5A 4MW1A 1M8FA 3JQ8A 4EZIA 3EPHA 2FETA 4YJGA 3AF6A 1QC5A 5C46F 3IAEA 4RVUA 3B8EA 3IUJA 2VNAA 3SQXA 1YCGA 4G1FA 1F12A 4MVMA 2AN3A 2B8NA 2CDCA 3B48A 4KMRA 4O25A 2PTMA 4EFLA 4NLLA 3FAVB 1WXDA 3ESAA 3LY9A 2GNPA 3WB9A 3F0TA 3NTLA 2AFIB 3PQEA 1WOMA 2AQKA 4FOTA 4Z9BA 1Q22A 2XRMA 3N2NA 4JC4A 5GY7A 3W8EA 3HXOA 1FNNA 3VAYA 1TVCA 4JP3A 1Y48E 4ZKEA 4ALNA 2QMEA 3HM2A 1CIJA 1NLUA 4L95C 4FDAA 5K3EA 2I2FA 3N6VA 1C4OA 1E3LA 1ONOA 3EC2A 2EX0A 2HR3A 3IBFA 3TBHA 4KNWA 3A1WA 1G2IA 2H6EA 1SD1A 2WKSA 1IATA 2OFPA 2HA6A 2OBNA 2P5UA 3DJFA 3H0KA 4G0MA 1TAUA 5HF8A 3BWEA 3GO4A 2HLDA 1W25A 1BE0A 1M6VB 2JDIA 2LRHA 2VEDA 1BJRE 2HMAA 5DI3A 4ZVRA 5CEJA 2UZAA 4CQLA 3IXLA 3U7GA 1RRPA 3LDEA 3QBDA 3DCYA 4OFZA 4PS0A 4IEEA 1H1LB 3GFOA 4DDWA 4FOLA 1IOVA 1NXQA 1XQYA 2K5UA 1G0NA 3U7EB 3U4MA 2BP7A 3IRVA 1XR3A 4LN1A 4I1SA 1AS2A 1II0A 3ZMTA 1OE0A 2WVAA 3AI2A 3AB7A 1LB1B 4YRAA 4ZKIA 5ELXA 5FF9A 5DHPA 1VF6A 1M57C 1Y76A 3HA3A 2HSGA 3PJDA 4JBXA 2Q62A 4TL7A 4OYYA 4RPJA 4NBKA 4EFEA 5HNKA 4LYJA 1ZTEA 2BJVA 2Q0OC 3JW8A 2VRBA 3EAQA 2JFHA 3RLIA 3KOWA 2G4LA 3P97A 1SRQA 1KOGA 3PEFA 3R0QA 1JJOA 3CJTA 3PC4A 3R9IA 1J5XA 4AY5A 3H8VA 3AV0B 4K26A 5LLTA 3CCUV 2IK8A 3H9CA 4RJIA 3W6PA 1USVA 3FXAA 3D3IA 5EB0A 4BNTA 2DW4A 3DMNA 3K04A 4HLUC 4YIHA 1Z5ZA 2VA9A 4BV9A 4ZT2A 1F0KA 2NXJA 3NORA 1E6LA 1YQUA 3PFKA 2XE7A 4JJAA 4A26A 3HY4A 2XT6A 2QX7A 4DUZB 4P93A 4I4TA 3PVZA 5I9BA 1S72F 2B1QA 2D6FA 5EIXA 3V7NA 1UT8A 4FGUA 4CH6A 3MJDA 4C1BA 1M0WA 2QF7A 3EWIA 1JEQB 2QTHA 3P71T 1Q6IA 3ASNC 4UBKA 1KSGA 4EX7A 4OX9Y 1F60A 3ZGYA 3IIIA 3DLHA 4DO2A 1FL9A 1JSLA 1YKSA 4JX8A 2R8ZA 4GP9A 2Z6QA 1Q83A 4B7KA 1U99A 2G6TA 2WZQA 5C7LO 1ZAYA 1AKVA 2VR1A 1XEQA 4Y98A 2SKEA 2XOEA 4I9FA 5I7EA 2JD2A 3SN6A 1MPXA 2FYTA 2WZCA 3W5AA 2JIQA 2EINB 1UDAA 2C2WA 3IESA 4GE0A 4HNGA 4ZALA 1FP7A 3E2MA 4LCUC 1LLUA 5JV5A 3EC1A 3H5WA 3QY9A 2JFYA 4GOXA 2VT3A 4X9XA 1ESEA 3ZH2A 3OQJA 1G21B 2PYZA 3ZJZA 2GMWA 1NOKA 3E5NA 5T41A 4DCCA 3UFXA 1WDMA 5JVDB 5HBRA 3I09A 4F6RB 4Q7LA 3PFFA 4DIUA 4F04A 3K8YA 3PHCA 3PT5A 4ICGA 1M56C 1ICEA 2V03A 4C08A 1D2CA 2B1IA 2H1HA 3DE1X 3ADPA 1V3UA 3OY2A 4EG1A 1S96A 4YIKA 1GD1O 1RR6A 2Q7DA 3SX4A 5KX5F 1EVKA 4EARA 1GU7A 4IILA 4U6QA 4WCDA 3OX1A 3Q3GE 2BCEA 4ZDWA 5CNJA 3CH7A 3VZSA 3QKTA 1T0IA 2VLIA 3HY3A 4CNQA 3CLRD 1B7GO 3SFTA 2FPGA 4YRZA 1YFLA 4NHEA 4QELA 3WQRA 4LGVA 1OBHA 3WY9A 5HUJA 5ARCA 4WAUA 4YCLA 3C7KA 3DEFA 4HEHA 1QG2A 4EJSC 1J0AA 3LQ2A 3ZNNA 2IV7A 4FDUA 5F7ZA 1XBLA 4MMXB 1KDTA 2IIBA 4EGQA 2XE8A 2WMDA 5C7IO 3J81A 3AEUB 4TV8F 1CP3A 3AUTA 4KMMA 4DR5B 2NGRA 3CF4G 4QG7A 4U2EA 3RJZA 3F6PA 4OX9B 5HXUA 1Q92A 4RM2A 2H0QA 4D6XA 1TEHA 1OW3B 3A4YA 4JODA 1MC4A 4A2QA 4LE1A 2CN1A 5JJBA 3KCNA 1QK5A 3DS8A 5IJ0A 3CX6A 1GN4A 4HRXA 3P0HA 2AGVA 3ZJTA 4JJZA 3TCUA 1SUIA 1MB9A 1VKOA 2J4CA 1VIYA 2HBYA 3EVEA 1A9RA 1YIAA 1IXBA 5EJMA 2XHBA 1I4LD 1Z73A 1T2DA 2DFLA 1L7MA 2H2DA 2WD7A 3L40A 4L74A 5TF0A 4P0PB 3W2FA 2Q0SA 4ZJZA 2WDZA 3LQRA 1RLGA 1TQ6A 4C7UA 1CY6A 3QV2A 4PO3X 3O4HA 5KHIA 1SXJD 5FTWA 3MWEB 1S5HC 4MRVA 5C4MA 2J0EA 1XWWA 2NZVG 1XZHA 2EBFX 3HZHA 1JU9A 1NLYA 1BCSA 3ML1A 3QF7A 2H9YA 3QLEA 1XMIA 2FRXA 4GOKA 1W48A 3K12A 1YDHA 3SKXA 5B4TA 5JR3A 2H57A 5ICGA 4B40A 5EWJB 3ZYCA 1JYFA 2C5EA 2KJQA 1E6KA 4JU8A 4UQLA 1L0BA 1D0IA 5GGXA 5IJAA 1E6WA 3JZFA 3KJNA 3KT8A 4MWOA 3GVIA 4N49A 3R7FA 1SK8A 1W0KA 5EJ2A 5AHOA 1OTYA 2ZJYA 3ZKWA 2QORA 4PANA 4O2BB 1H8HG 1UM9A 3KLMX 1BHJA 4KKXB 3SSNA 4COKA 4EA7A 1EUZA 4M8KA 7REQA 1KI6A 3QEAZ 4YY3B 1WUIS 3QUSA 5IH7A 2G09A 2EULA 1JQLB 2A9JA 7AT1A 1IXSB 1LLQA 2DG2A 2QMUA 2AG8A 3IALA 4K6GA 1T3TA 2ZWVA 4TUYB 4BDSA 1V5WA 1BDBA 2D8MA 1X7YB 2Z8ZA 3ASUA 4UE6A 4N82A 2E1PA 3CUUA 1EP1B 1QRSA 2CVPA 3G67A 1DO8A 3H84A 4PX2A 1E7YA 5KC9A 3DOOA 3CH6A 3PN1A 4TV9B 3IOEA 2CZCA 1MNAA 1XKQA 1P1IA 2Y0EA 3K09A 4JSRA 4M0PA 1J90A 2PO5A 3KUKA 3CYQA 1WO8A 1G5PA 2QGFA 1MA3A 2JL1A 2QTFA 2ZRJA 4INOA 1YTFB 3J80M 4I6EA 2IQ5A 4BFXA 1W1UA 2OGUA 2WT8A 4LC9A 5CLJA 4R7ZA 4Y0VA 2ZIZA 5I5GA 2QSJA 2OPHA 1WNSA 2NTNA 3VJRA 3T5PA 3LW8A 4DLWA 1NW6A 4DK0A 3LHFA 2IC5A 2VCYA 5E9AA 5KQSA 2VDWA 4FLWA 3C5CA 3DQZA 2OT5A 3BSSA 3DT8A 4BGVA 1EBUA 2NNWB 3U3JA 5B1EA 3E3AA 2P0EA 1K7YA 2F4NA 3RTDA 2ZT9B 2DYKA 2P78A 1VHDA 3SJZA 1SKBA 4AILC 4FFBA 3IELA 1GO0A 1T9BA 3ZD8A 3BREA 3N5KA 3K05A 1AXRA 6Q21A 2F00A 2XAAA 1YI8A 2CVLA 1I94O 1WUKS 1Z25A 4FLXA 2JKYA 2ZKIA 4R6WA 1Q19A 1XLUA 1Z2EA 2BSKA 1JALA 3H75A 1K4DC 4IDOA 3RLFA 1Y6FA 3HCBA 1GN9A 1C9MA 4KE7A 3HKDA 2HIGA 1FW6A 3HLKA 1STOA 4M3NA 2V9ZA 3HFSA 2X2EA 3E3NA 3H13A 3CTPA 5DBGA 4EGCB 1OSNA 3QFRA 2GN9A 1G16A 4DC9A 4P3YA 4RKQA 2G71A 1OGJA 1RT9A 3IODA 1UMBA 1W1WA 2RHMA 4X3OA 2WE7A 1CDDA 3AI7A 1H3EA 3D4IA 1R4MB 2PF4E 1P49A 2I34A 4WBXC 3FKSA 1UJ2A 1L5FA 3QWFA 4TSKA 4KFMA 2RHGB 4G09A 4IV8A 4L73A 1COWA 1ORHA 1XEXB 4ND7A 4X8LA 5FI3A 1CJBA 1NPYA 4QTXA 3IEMA 1W88A 3OQBA 1VQ6F 2OHJA 3T3GA 4EVSA 3W5CA 5JU6A 1CLUA 1Z2GA 1PRYA 5FNVA 3KP1A 4OK5A 4J4HA 1BAPA 2FSFA 3JV7A 4QOEA 3MHHC 5EXXA 5KNCD 3B3AA 3EBPA 3VSCA 4LJ5A 4R1OA 5CA0F 2F8LA 2YC4C 4G26A 4TWIA 1Z56C 1OCRC 4YAKA 4B8ZA 4DJTA 1EFPA 3BX1A 2Z04A 1FS6A 2XUDA 4EGAA 5JNTA 2IH1C 2V3VA 3D6NB 2NN4A 1EVYA 3C5HA 4PRZA 1XDDA 3LO5A 5GAJA 4Q9DA 3DOIA 4U7HA 3DOJA 1TKAA 4MS1A 2JGAA 3CG6A 5H3CA 4EG5A 5DSXA 3G9TA 3PC3A 1GN3A 5C1DA 3OQNA 2REBA 5IWCA 2C4TA 1DKPA 3CW9A 4YAWA 3ZU5A 4CLOB 5IUKC 3TSWA 3LMEA 4RIHA 4EHDA 2ZULA 4DYDA 1PJSA 1RXIA 1POXA 2HJVA 1UUFA 2Z8YM 5THQA 2UYCA 4PYOA 3NRBA 3QLUC 2CBGA 2FJPA 4BUJA 3N53A 4CI9A 1E9RA 1BDJA 3U3MA 3E9YA 3FKQA 4HT3B 4S04A 2W2VA 2X1VA 1E7MA 2HUPA 3GA0A 1UXGA 5AM1A 4FKBA 1QH8B 3QVUA 1PNMA 4AD8A 3SEQA 4X64B 3UZUA 2E5FA 1GV0A 1XRSB 4WESA 4EBBA 3WWPA 3LY5A 4CIDA 2C2AA 4US0R 3ZN2A 1WVIA 2J9FB 1CCWA 4WBNB 2DT4A 1L8XA 1OXUA 2YWEA 3BYZA 4G8BA 1Z6TA 3R7WA 1HZZA 2YN2A 1Q77A 4C2BA 4G07A 1AMNA 1EQAA 4Y2JA 2DPMA 4K7JA 4XVHA 3TZBA 3OQ1A 4D4MA 1LK0A 3GG9A 4EABA 1E3IA 2B5WA 2Y8EA 2H4YA 3PDCA 3NEJA 2M32A 2FC3A 1E20A 2ZIEA 4J49A 2QAJA 4X54A 1NJ2A 4BU1A 1SC5B 1XL4A 3PQ4A 1B26A 4MVJD 1CRLA 1KJWA 1DADA 2JIMA 3BIWA 5LA6A 1QG6A 3CMCO 1QIHA 3GVPA 4YREA 3REQB 2PX5A 4KE9A 5CB4A 5BN4B 3TCNA 3VR4D 4L50A 1HNNA 3D01A 2ZSDA 3PR1A 4L07A 3WJ7A 1C3XA 5JSZA 1U7XA 4QDOA 5FWXA 1YBFA 3IXMA 4CFSA 5E4YA 4YUZA 1UC9A 1B3BA 2BCGY 2QVYX 4OHOA 3FLMA 2WTBA 1RQPA 1DE0A 1J20A 5EN4A 5IN4A 3H1AA 5ALFA 5FOSA 1Y6JA 4TTAA 1LUVA 1QAHA 4ONEA 2OL4A 3C7AA 4H6VA 4LXUA 3WPXA 4WZBA 3NC4A 5FPOA 5EEHA 1DMRA 3I45A 5KJEA 3BYQA 1N5IA 5J4VA 1PGJA 3EYWA 1XA4A 3O74A 4W7SA 1XZGA 4AJPA 3I2YX 1WQ4A 1QIGA 2RHOA 4XWOA 3ZV3A 1PLLA 1IM2A 3DZGA 2BELA 2HZBA 2FOLA 3V7QA 3FPCA 3PENA 4HF7A 3W2GA 1ZX1A 3FNRA 4BJ3A 3AKZA 1BVYF 3R4CA 4ND8B 2QA4F 3DBLB 4F4JA 5LP1A 1N3IA 2FKXA 4Q9KA 3CCMV 4CEJB 4MS4B 1N2JA 2W6MA 4JAVA 3DTNA 5SZHB 2XHZA 3QPBA 4ALJA 2UXDB 4LRQA 5C35A 5FL3A 2VZLA 4Y18A 4X20A 1AKMA 3AEQB 3LX4A 4NYJQ 1EEHA 2VRCD 4G3XA 3TAXA 5F35A 4IEIA 1PFUA 2HV8A 4INAA 1VQPV 1F2UB 2ZQMA 2BTUA 1JXQA 2OCPA 3V1KA 3AWIA 4AZ3A 1PZMA 5JYDA 3BWVA 1TMYA 4Q4AA 3BULA 2ZUWA 4KQIA 2OA0A 3ZWAA 2GDSA 3OMWA 3QXXA 4L4UA 3DZCA 5CU7A 1EPUA 4JI0B 1EWYA 3EUEA 1OFVA 4JMLA 4KR0A 2WKPA 4W9NC 4RK1A 4X7RA 3RVQA 5EVCA 4CLRA 2ZKOA 4PV7A 2AEEA 1ECFA 1UDWA 3GEPA 5CLQA 5DLDA 3F0GA 2C83A 5DIZA 4AF6A 1GTVA 1Y1TA 2A1TR 2W58A 5D3MB 1G4YB 1D9XA 2FX2A 3MVEA 5G1OA 1RD4A 4AJ1A 2P2CA 2ZR0A 2BMWA 2YBDA 3EOAI 4OMFG 3S2YA 4AG3A 4B4WA 2ZDHA 4RVCA 3NDIA 4TXLA 5ELLA 2ZIXA 5EO3A 1Y9AA 2A5FA 2AFHA 3FTCA 1ZS9A 2GZ3A 3BMCB 4LXGA 4X93A 3TMYA 2V5UA 4FONA 3ZU2A 4A23A 2BL4A 1D7AA 3EXHA 4RTOA 5KAMA 3UG7A 3O9VA 2Q5FA 5FH9A 3FB1A 5KMGA 3PNSA 4DLVA 3HRHA 3PITA 4EHAA 2D5BA 3U4DA 1JJVA 1TUGA 4N3NA 4F8JA 3DCJA 4XWKA 2GD1O 3W7SA 1YDWA 2YJ5A 3NDRA 3ABLC 4E94A 5IT9A 4Q9LA 4F1KA 3L43A 4PFSA 2VF7A 3ORSA 1SXPA 1GZ4A 1PKEA 3NGXA 2G83A 3R5FA 4J3JA 1P4GA 2IYRA 2W22A 2AJTA 3AVWA 1XCGB 1B8NA 2DWEC 4HDKA 4QAQA 3UF0A 4OJYA 4RY0A 1G98A 2RCNA 4Q4JA 3DDZX 3IP1A 2ZREA 3EF0A 1Y9ZA 3EW7A 3OM9A 4LBWA 5I8ZA 1NW3A 2XCSB 5BV7A 1U43A 1O2DA 5HBGA 2KSQA 2GZMA 2ZE5A 4D8YA 1QE3A 3SDSA 3BILA 2JAXA 2VUIB 3TLGA 2WVJA 3I2IA 1X7XB 2GJ8A 3D0QA 3K1YA 5FBRB 5JNWA 2Q3CA 3H9GA 5DECA 5FPRA 3DD5A 3W06A 3L4BC 3ZWPA 5JMTA 3L0OA 1M3SA 2I3AA 3CJQA 3GIWA 4YRRA 2WWYA 1PFGA 1SVKA 3CVVA 2WKRA 4I50F 1QHEA 1CUZA 2Q6IA 1VIDA 1CQWA 1XRLA 3HR0A 3EGXB 2HA4A 3H1EA 4DV2B 5T6MA 2ZE6A 2ORIA 1VQMV 1MAUA 2R87A 2HS4A 1OVGA 1WB7A 4Q1VA 4RQEA 2X0LA 5AXCA 1TKCA 1HSOA 1R4NB 1XELA 3RFCA 1T1EA 4FLEA 1Z16A 4D41A 5ETJA 2J3LA 1NU6A 2D1TA 3IV7A 2HBZA 3H99A 3MMZA 4RFSB 3ZHXA 5D5PA 2C8JA 1KC1A 2HV9A 2MK3A 3K3WA 5INTA 4ZI7B 3SZUA 2POCA 5ALWA 2ZUFA 1BMFA 1P7BA 4GX1A 1KFEB 4YCJA 1MTOA 3ZR4B 4GMKA 1AVMA 1XKTA 3NAMA 1VJ0A 4XYEA 2Z9BA 3MIIA 5CK5A 3CCEF 1FPQA 3WTCA 2RCVA 1AKYA 1SQ5A 1E2KA 3TLAA 3DYIA 1QR9A 1EP9A 3H83A 2O20A 3R5SA 3GVXA 3DDNA 1P60A 2FR1A 2XMZA 3WLKX 1D5NA 5KQGA 3V4SA 3WRYC 1SQXH 1SUAA 4YXFA 4DR2O 2QN8A 1ZINA 5DNEA 2B4AA 4DV0B 1E4OA 2Q6KA 4KRXA 4UNNA 4GMDA 3I6YA 3N74A 4D92A 4W1PA 4E14A 4EJFA 1G5RA 4CDRA 4ZYWA 4MVJM 5KNDA 3GMTA 4RFLA 2AZ0A 4K28A 3UW3A 4ZK7A 1H1LA 2WU1A 3A3NA 3I0NA 3SCZA 2QXYA 5JIBA 2JI7A 3KPWA 5GOZA 4YRIA 2ZRHA 4YALA 1Z2DA 5FOXA 3R5JA 3O4JA 2BTOA 1CQZA 4HDCA 1B3QA 1YU9A 1U1CA 4LMPA 1NYTA 2NVWA 1R0ZA 3GL9A 2B1RA 3GYQA 1AUOA 1M67A 2CNLA 2TMDA 1L5LA 3VTIC 3P9SA 2V55B 3TR5A 2G88A 1H65A 3CVYA 1CF9A 1N8TA 1SG9A 1VSBA 2ACVA 1XDSA 1ZVJA 2I1LA 3FD5A 1HRKA 2ZRDA 3KVYA 2PGJA 3LX6A 3O4GA 4HZIA 5K6AC 5K99A 3ELYA 3JD0A 4R8RA <