4HNAB

Kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
431
structure length
431
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords Tubulin alpha chain
publication title Structure of a kinesin-tubulin complex and implications for kinesin motility.
pubmed doi rcsb
source organism Artificial gene
total genus 172
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hnaB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4hnaB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4hnaB01
3N2KB 4TV9B 4IIJA 3M89A 5J2TB 3N2KA 4TV9A 1TVKB 1TUBA 2RHOA 5KMGB 4EI8A 1TVKA 3N2GB 5IYZA 5KMGA 3N2GA 5KX5A 5LOVB 3HKBB 4I55B 1JFFB 3ZBQA 3HKBA 5CA0B 1W59A 4X1IB 1JFFA 3WGNA 5CA0A 4X1IA 3E22A 4O4JA 5LA6B 5J2UB 3HKCA 5LA6A 4DRXB 4B45A 2RHHA 5BMVB 5MN5A 4O4IA 3WGLA 1Z5WA 3JASB 4F6RB 5BMVA 3JASA 4F6RA 3ZIDA 5LYJB 3RYCA 1W5BA 4FFBB 3HKDB 2Q1YA 5LYJA 4E6EA 4I4TB 2RHJA 4TUYB 2XKAA 4I4TA 5EZYB 5LXTA 3HKEB 4X20B 3HKEA 5J2TA 5IJ9B 3RYHB 3VOBA 5IJ9A 5IJ0B 4EI9A 5JH7B 5C8YB 3M8KA 3VOAA 5JH7A 4U3JB 4LNUB 5C8YA 5JQGB 4I55A 5LOVA 2BTQB 4U3JA 4O2BB 5EIBD 5CA1B 3RYFB 5CA1A 5J2UA 3ZBPA 3RYFA 3JALB 5EYPB 4DRXA 3JALA 4ZI7B 5EYPA 5JVDB 1FSZA 3CB2A 4ZI7A 1W5EA 5JVDA 4DXDA 3WGMA 3UT5B 4XCQA 1SA0B 4YJ3B 3UT5A 4FFBA 3HKDA 1SA0A 4B46A 4YJ3A 5FNVB 5M7EA 3VO8A 3WGJA 3RYIB 5CB4B 4TUYA 1FFXB 3RYIA 4O4LB 3VPAA 5EZYA 2VAWA 4O4LA 2R6R1 1OFUA 4X20A 4EI7A 3RYHA 1W5AA 3RB8A 5IJ0A 4IHJB 1RLUA 2Q1XA 3JATB 4IHJA 4LNUA 5JQGA 1W5FA 2VXYA 3WGKA 2BTQA 5MN6A 4O2BA 3V3TA 4X1KB 4TV8B 5LP6C 4EB6B 4X1KA 4TV8A 4ZHQB 4EB6A 4U39A 3JAKB 3JARB 5JCOC 4IIJB 3JAKA 1TUBB 4O4HB 5GONB 3C8LA 4O4HA 5IYZB 5KX5B 2VAMA 5FNVA 5GONA 4M8IA 4X1YB 5EIBC 3JAWB 5CB4A 4X1YA 1FFXA 4I50B 3JAWA 3E22B 4I50A 4O4JB 3HKCB 5ITZB 4WBNB 5ITZA 2RHLA 2GVIA 1Z5VA 4HNAB 4WBNA 1RQ7A 4O4IB 1W581 4YJ2B 4ZOLB 4HNAA 1RQ2A 4KWEA 5MN4A 2XKBA 3JATA 4ZOLA 5LP6B 4YJ2A 2BTOA 2VAPA 3RYCB 5LP6A 4O2AB 2R751 4O2AA 5JCOA 3VO9A 4ZHQA 3R4VA 5LXTB 3JARA
chains in the Genus database with same CATH superfamily
3E3OA 4PWZA 3HZOA 2XMZA 2W43A 2W2NA 3OD5A 3RW0A 1TX4B 4WFFA 3K0AB 5LIRA 2OCCB 1NJSA 3R7BA 3PBKA 2GETA 1T35A 2UXNA 2VDPB 3RAGA 2QUBA 2JGDA 3GU3A 1D4OA 1W48A 5FUXA 1YR9A 4OGLA 3BMXA 4YP1A 3MCQA 4A6DA 1AZWA 2QA5A 1KMQA 3NTXA 4RS3A 5A9SA 1LBEA 1Y74B 4FYPA 4WN3A 4AUKA 3LNMB 1AP6A 3V7NA 4YC7A 4TYNA 3SQWA 1ZFNA 5H2FZ 2CL5A 1ABEA 2ZJBA 4JASB 1TU3A 5I9SA 3AI2A 4GKKO 3N2YA 4DDKA 1GV1A 2WG2A 3DA8A 4WZAB 4FZ1A 3FTCA 2WSYB 1VJ0A 3QE9Y 2JLQA 3L71H 3IEQA 3KAPA 3K6SA 3W5UA 1MPXA 5IT5A 1GLGA 3RARA 4S2UA 3AB8A 3D00A 4MUKA 4IGFA 1XSEA 5H1YA 2KS6A 3KUXA 1LQTA 2D0IA 4HT3B 2DWEC 1P2FA 5BYJA 5KTPA 1N9GB 5IJ9A 4PSUA 2OHFA 3EW9A 2P6JA 4C0HA 4PSDA 2AOTA 1T26A 4QPPA 3AEQB 4IMJB 4L50A 2DQ4A 4N01A 2P9ZA 4PLFA 5BW5A 1XCBA 2B1IA 1QF6A 5F2VO 4WKBA 2IJIA 1PFGA 2D5CA 1VQKF 3W4KA 4FIZA 3GCXA 2CWWA 3CEIA 4B3BA 3WHLA 4GR9A 4J4HA 1N77A 2VL7A 5EHIA 3QTYA 4PAGA 3UHAA 4FKZA 4NZNA 2X6TA 3PVCA 3R0IA 2FSVA 4URFA 1RZRD 4DXWA 2WJVA 5LUBA 2P7IA 4YUXA 2C0PA 3JCMM 2OCAA 2XMCA 3OC6A 4H1VA 5EB0A 1BD4A 1YFKA 4G0OA 1PV4A 4BBJA 1X74A 3V2GA 3G89A 4P08A 1XDDA 4JCCA 2ECPA 1T8WA 3HL4A 4TMFA 3WKCA 1T2CA 4KLRA 5KSOA 4UNIA 1XLVA 4QXOA 2QXTA 3R1IA 4K8ZA 5A04A 1PEYA 4ER5A 1L3CA 3DBHA 5KAIZ 1YR2A 1E18A 1EVIA 3QQ5A 2HDWA 2NTYC 5IHXA 4BZPA 4YGXB 3EQ8A 1CDOA 1LZLA 5EUMA 3AUUA 1YT5A 3ESQA 1MX5A 1NXWA 1XEWY 4B3GA 2PT9A 5DO9A 1XXLA 2P90A 3KJFA 1SHJA 5JAHA 2AXNA 3BK2A 3MRXA 1JCHA 2PZGA 4IMIB 5SZHB 5KVCA 4MW7A 1C8LA 2UZIR 3ZH2A 1VG1A 3H86A 4IGKA 2O8EA 1DV2A 1I51A 3EFEA 1P8JA 3E5MA 3M9WA 3C43A 4BP8A 4QU9A 4BCDA 1XV5A 3VVMA 4YS6A 1TVKA 1V9LA 2ZZKA 5A5DA 2Q2VA 3JSXA 4GOND 1I9GA 2LXNA 1FEZA 5GZ3A 1I9CA 3FUWA 3AM4A 3S29A 3J80A 4H08A 3WLFA 3WQSB 1L4NA 3C90A 4UBIA 1RYHA 3I61A 1JQDA 2CH7B 4OTZA 4QTUB 2H0QA 1I7NA 2D06A 2DUJA 4K3UA 3E86A 3LWDA 2ONKA 2Y0IA 4RD0A 1EX9A 5J63A 1JLSA 2DFVA 5LC1A 3RVQA 4IKEA 4NYMQ 1HWYA 2C4MA 1AXEA 3WV5A 4JXZA 5AVZA 3GT4A 2H4HA 2K7ZA 3I5XA 1AS2A 1C8KA 1ZI8A 2FCAA 3UWSA 3NONA 2C7BA 4ZGBA 4YR9A 5EL0A 3GGCA 1Y6RA 3ZQJA 3R0ZA 4MQFB 4Q0MA 1VL2A 2Q9UA 1XWIA 1M0SA 1VFNA 2AIFA 2F2TA 3H6HA 2RGXA 1RHKA 2WI8A 1A9ZA 3M9LA 4UHKA 2X0EA 1PWHA 2GLUA 2JGUA 4ZZIA 4WLNA 5E4TA 2YC4C 1RLTA 4OATA 4NHOA 4YDRA 2P5UA 2EG9A 1G8KA 1HYGA 3R3UA 5LN1A 3QG5A 2R8XA 3O4JA 4DY6A 1QQTA 4MWDA 2HVYD 3H5RA 4QXMA 2ON6A 1IZ9A 1Y74A 1B42A 1T4DA 2XQJA 3AI1A 5EXPA 3FKSA 3AKDA 1W88B 1L5OA 2OZEA 3H05A 3A1TA 3LO5A 4CIYA 3AUYA 4ALMA 3KTFA 4DY4A 2CVPA 4LF4O 5ESDA 4MEAA 1KL7A 4K05A 4JASA 1TRHA 1OVGA 1FP2A 2C82A 1BDBA 3OFKA 4EJSB 1DBFA 2G09A 3ENWA 3ZP4A 1SD5A 3EXHA 1VMKA 1FQOA 3PCRB 5CM2Z 5HZMA 2JZCA 3AERA 2IWRA 5EAIA 2P67A 1H1DA 1GARA 1KVTA 1Y89A 3S2GA 1Z5WA 5HE8A 1QOQB 2C96A 1YR7A 3PSHA 5ALQA 1T8UA 2DMXA 1JVMA 2B1QA 2RI6A 1VLHA 3L7MA 3CNBA 3LGAA 3DF7A 4UXJA 4G4SP 1ZAKA 2V6BA 5J47A 4QQNA 3ASOB 3AF6A 2VRNA 2QMOA 1U1GA 3AFNA 4C8EA 4TKLA 1DJQA 5EYPB 4BW9A 3AEQA 3S55A 1ILWA 3ZMTA 4G28B 1YDMA 2WIGA 3QWHA 4WKNA 5CBPB 3QKTA 1I0HA 1GK9A 3UAOA 2VNJA 5D6NA 4EM6A 2OUKA 3C4VA 3U17A 1KNQA 3V8VA 1YJWV 3RTGA 2C9MA 3NANA 1I2BA 2IPOA 4DZTA 4B81A 2WP0A 3E7XA 1KE2A 4N7BA 4MTOA 3EVGA 4D8XA 1WY7A 4D57A 4A0SA 2CXNA 5I3CA 1KO5A 4RKFA 4LF9B 2PM8A 2NO4A 1S1MA 3JAMA 1G5PA 2YWXA 2P65A 3EVFA 3AG1B 3KOMA 4KTTE 3OPNA 2UXXA 1ZITA 2JRLA 4HAIA 3QTTA 4DV7B 1H9BA 1HNWO 4KQJA 1U2EA 1NG1A 2FP3A 3CV3A 5AKJA 1FD9A 3E7FA 2XLCA 1NJ6A 4ZT6A 5AJHA 1OX4B 2Y2VA 2QVZX 3CEHA 4C88A 3IR5A 5HWSA 5I9TA 5ANRB 4F85A 2W0FC 3MRTA 2RHRA 2AFIE 1OAOA 4MZXA 2QD1A 2H1IA 4DQKA 1OIVA 4EFMA 4AO8A 1N3BA 3ED1A 1O9BA 1IXRC 2D00A 3PHIA 3K0CA 4A7PA 3M7IA 3D6UA 4TL9A 1CIVA 3HM2A 3KKQA 1RI3A 4M6WB 1ACMA 2PH1A 2GHRA 1WW3A 3MG9A 3O47A 1E4YA 5G0UA 5IH3A 3GEHA 3OP4A 2QSJA 2A4MA 3USCS 1Q57A 5C5IA 4RKRA 1SD1A 4NK4A 1K4KA 4URWR 2WT9A 3AR2A 2NP6A 3BWDD 3W9UA 5LQMA 1W6UA 3K72B 2WOJA 1E6EA 3TQTA 2O7NA 4L0DA 3MUEA 4G4VA 1JR3E 1Q0UA 4OU5A 3N2ZB 1XJQA 1P5FA 2VJQA 4NG4A 1K3EA 1ZNYA 2HWUA 1HRKA 2B35A 2X23A 4R2IA 4M89A 3CLRD 3I6IA 2OGSA 2GAAA 1LFDB 1JQAA 3DOCA 4GC5A 4HNRA 1X70A 5HGJA 3V1TC 2B1RA 4Q12A 2CH7A 3LWRC 4FN4A 1MO5A 3SDLA 3OZIA 3L0YA 1KZYC 3BKWA 3TTVA 3BTSA 4HY3A 1ECBA 4ESEA 4D8VA 3WLMA 1PHRA 1C0PA 1XFDA 1NJ2A 1MRSA 3KZMA 1HQDA 1CWUA 3WNVA 1VPLA 1FDUA 2CXUA 3HSYA 4PYIA 1RPJA 2AHRA 5FPSA 4MGIR 4HDMB 5BW8A 5SY9A 3T94A 1QM5A 3ZWBA 1E1RD 1D8TA 1NI4B 1UBGA 3TF5A 1ULTA 2IVZA 1T8SA 5CP8A 2GA9A 2FZGA 3CEJA 3SC3A 1NC3A 4TUYB 1MG5A 4WCFC 5KQSA 1M9NA 4UHDA 4RWUA 1XQ8A 2M1ZA 4BRWA 2Z0MA 2IIBA 1EQ2A 5JPIA 2GEKA 3IGAC 3DBVO 2P1RA 3WK9A 1ZJYA 3SJZA 3RC9A 4YHHB 2CDCA 1NYQA 2NM0A 3U7JA 3IAFA 1N1GA 3BXXA 1LDYA 4JSYA 5BNZA 2MSKA 3UICA 1W88A 4PLWA 4CTNA 1R0XA 3PA8A 1G2OA 1BHO1 4Y2TA 3CC7V 5C5EA 4LX0A 3STZC 5LUAA 4J6EA 3W6PA 2CKMA 5CDHA 3GEMA 2YEVB 1XHFA 3TLBA 3PQFA 3KSBC 5A2GA 3RUFA 3N58A 1SERA 2JJ2D 4YONB 1ULAA 2D5BA 3BY6A 2EINB 3EEQA 3T35A 1B8VA 1J95A 1A8IA 3RS3A 4MW0A 2HU7A 4L22A 2JCGA 4EW3A 1VQKV 3O03A 1W94A 4FXOA 4MS3A 5FO1A 5K51A 1B8OA 3PITA 4MIEA 4DZRA 4QJBA 4GX1A 5HOQA 2HQSA 2C1ZA 4FEEA 5EYPA 5F51A 4Z4HA 4KO1S 4BPRA 1L7RA 5ICFA 4XQ0A 4JD5A 3DCYA 3RSCA 1PR0A 3GFTA 3BIWA 1V37A 4L4YA 1IZYA 1JIJA 4NESA 3TIVA 3RSOA 1TJPB 2QX7A 2DBQA 3LPMA 4KSCA 3NJ8A 4B6GA 2X3FA 1OAPA 1E2UA 4WZBE 3H2GA 1T9CA 2YINC 1XD2B 1A8QA 3DOOA 2AHOA 4P3OA 3TLGA 2NG1A 4PA3A 3FOZA 1OI7A 2JA2A 2IS4A 2WUVA 2SKCA 3HKBB 1R3JC 2XD9A 4BVQA 1UBHS 5C35A 3MVEA 5GGXA 4H7JA 1AKUA 1HEUA 4X20B 3ETEA 2XWJI 1II8B 3ZRXA 4F9GA 3PLRA 3PLNA 5LD2C 3D54D 2PJUA 5I8ZA 3QPCA 2ZG6A 4RU1A 1FYFA 1P3Y1 3MYYA 1JA8A 1TYCA 4M6WA 4J1NA 2AWOA 5DBIA 1COWA 3U0ZA 5IFLA 2CK3D 5C93A 4MPRA 5JLAA 1U28C 4RVNA 4YRAA 3O9MA 4LNAA 5CPBA 1M56C 3BD8A 5CT4A 3KB2A 5IC6A 3ASUA 3ITDA 4LGCA 1PX2A 1UJNA 2RK4A 1C4OA 5G3ZA 3G8BA 2Y71A 2NXJA 2VS0A 3CTPA 4PDVA 4F4IA 1R10A 1NAIA 3KOYA 1GGEA 2WM2A 1VB5A 4RIGA 1WNTA 4BO1A 3O2QB 1C9MA 1SUDA 3HPQA 3GEIA 3DEAA 4K0RA 4W7SA 5KYXA 2FL4A 1T2EA 4K0KO 3C1TA 3I2YX 2F43B 1IM5A 2C7OA 5IYBO 1MOFA 3AR9A 1Q44A 3MOGA 1SBTA 1GZHB 4PPQA 4XPZA 1BH6A 3S3TA 4PF1A 5EHQA 2XV1A 3KPYA 5JSUA 5K6AA 4OA5A 3KBBA 3H5IA 2PMFA 2VCHA 1I3MA 3OX2A 2ZSIA 3TTUA 4I5IA 5JJIA 2WZCA 4H3SA 4IF6A 1IBMO 1M74A 1YIDA 2OXRA 2V7QD 3MMXA 3EG9B 1P1HA 2K9PA 3HDYA 4CKBB 1EK2A 4JJIA 4CUKA 3TRFA 1KYIA 4LJ4A 4MUIA 3ADBA 4NOJA 2VAPA 5AIBA 5DV9A 1NM5A 5E6RB 4JI8O 4HDMA 4MNTA 1NVAA 2ZUBA 3TNJA 5HFLA 2GEUA 2Z2IA 4E1AA 2ICAA 4FN5A 4R2WA 1I08A 1VIDA 1NI4A 3N39C 5C8XA 2ZB4A 4N03A 4D3SA 1UT8A 4L8GA 3WGYA 4I1IA 1JFSA 3ZU2A 2HF8A 2QJWA 1SM4A 4QKQA 5JT1A 1B00A 1VOTA 4EY7A 4M99A 4K6CA 3N8KA 3P2IA 3WZ2A 3FUUA 2QPOA 2JIDA 2HDOA 3UUGA 3ZMVA 3C3SA 1LX7A 2BL4A 4KQKA 3FOEC 1RMQA 4FOOA 3RABA 1U2PA 4HRXA 2VAWA 3UGTA 2A88A 2AIZP 3NU1A 4GIBA 5E4FA 1K8RA 4C21A 4K9LA 1FB5A 3T4UA 4ZKIA 1N8RW 2GF2A 3Q5EA 4NDZA 2YFKA 1UJ2A 1Q7BA 3EG5A 3F7YC 2QDKA 2VQSA 5BR8B 2QEXF 2WPNA 3RVPA 1JW9B 1KH1A 5NLLA 2H9YA 2JCSA 4Z2YA 4YRQA 5E7MA 4D7AA 3FHTA 3G7NA 4FNMA 3RSSA 4MJXA 4JEUA 3QW4B 3ZE8A 4GI3A 1JLLA 3L7YA 2OFOA 1T6XA 1ELOA 1WKVA 3JR7A 1XPUA 4GUNA 2KSDA 4RZ3A 5DYTA 3L0DA 2FMXA 2PQ2A 2ZYTX 3ZE1B 4TVKA 3NHSA 5FULA 5CFLA 1KRXA 3KYCA 1G1MA 3A6JA 3QX8A 5CIWA 1OPRA 5IWAB 4KVZA 4C76A 3NB0A 4EUSA 2AFHE 1RTTA 4L2IB 3LC2O 2X7RB 3BULA 1ZMRA 3CCVF 4O3FA 4N8EA 1NIPA 3PXGA 1DKLA 5CT5A 1RBQA 4G4ZA 1TJ5A 1O6BA 2Q5IA 1KSJA 3PC8A 1CR4A 1ENZA 4QWWA 5DLYA 1OJHA 4CWAA 2VHCA 2I4OA 4RCZA 3HA7A 2VSYA 3X1ZA 5F73A 1NP7A 3BXHA 4JP8A 4P9PA 4FDUA 1XZFA 5TPWB 5AW8A 4GZ5A 5LU9A 1RW4A 3SX2A 1UCFA 5A4KA 2QD5A 2QVCA 3D01A 1S72F 3FLBA 3H11A 3HKBA 2V7VA 4TMTA 5IXSA 5IMBA 1P45A 3ZI4A 2JLBA 2X0LA 3JQ7A 2JHCA 4C7OB 1PL6A 1J9ZA 3N0WA 3HXLA 4FGWA 4PC1A 3ZU4A 4ALKA 1EAMA 3NKVA 1R27A 3PRKE 3SJ7A 5IH7A 3LXUX 5CLHA 5F98A 1GY8A 2D74A 1VXRA 1UOOA 2X8BA 3LD9A 2XVMA 1VQ1A 1P62B 3RD5A 1ZCBA 1VIAA 1K1EA 5E7QA 4C5CA 5LBQA 1ZK3A 1KQ3A 1XRRA 4XGRA 4D96A 3DTNA 1A2BA 1ZIYA 3RU9A 1FUEA 3TIFA 3A4TA 1K7XB 1DCMA 4EMTA 3AIIA 1Q7YH 2K87A 1Z39A 3KJGA 3OFSA 2IEGA 4DJTA 1ZUD1 3FD9A 1BCCH 1W0JA 4EUNA 4O59O 4WASA 2A5LA 4H0CA 4XGNA 4IRUB 5BYBA 2NT4A 4MKHA 1XRLA 2GYWA 2ESRA 5KSYA 1IWOA 1HRDA 2DG2A 1DG3A 3I01M 1AGPA 2C2YA 4L7QA 1V47A 2HK9A 3PDIB 3W7UA 1O58A 4LXTA 3CKMA 4IRXA 3DLTA 4DF3A 2ZQYA 1LWNA 4AZVA 1ODJA 4E2LA 3B60A 3R7SA 2Y4UA 1RWMA 2WG1A 1JHAA 4YA6A 4JI6O 1H8EA 4P58A 4RLFA 4Y2SA 5A5FA 4HRVA 4IHQA 4Q3DA 3TQQA 4V0SA 2YJZA 3EG9A 4CKBA 4QNMA 3ZQ4A 1GQSA 2Q5EA 2H57A 1N0JA 2R751 5E6RA 1XMJA 2WHPB 4UOZA 2XXJA 1OBVA 5EBMC 3TMYA 2A5DA 3BGVA 4CMCA 1KZ4A 2OXEA 1K8XB 4LYYA 4C20A 3MT8A 2VQEO 3EBOA 3AHJA 4DA7A 2ID4A 2D0PB 2YH2A 1WJGA 1UJ5A 3GP5A 4H4DA 4BAYA 3SYNA 1PJBA 1KMHB 2YWCA 5LA6F 4RL4A 4RY2A 1F5NA 2OXTA 4RZHA 1GILA 1IUNA 1G60A 4U2FA 1Z7EA 2C4NA 1PGPA 4LG1A 1QOPB 1ZSNA 1OHHD 3VZQA 1F8FA 1J07A 4DDHA 1L7OA 3CR3C 2FA9A 3FTEA 2OHIA 1VQMF 3MRVA 2GESA 3OO0A 1PDVA 3E7DA 2YXHA 2W6IA 5AVWA 3L0BA 3ZZ1A 3T5PA 2R4QA 2QE7G 1GQOA 2P0EA 3ZQKA 5H9VA 4JI5B 4TWAA 4NCXA 4HYEA 3KJXA 2KBFA 2P69A 3ZHUA 1X8JA 3FDFA 4JI7B 2O7VA 1EFRA 5JBQA 3ZW7A 5I3ZA 5BOVA 4BVFA 4R41A 2LBWA 2IW3A 1NDUA 3FI0A 5EESA 3CUSA 2QYHA 2VJNA 1TZCA 4L2IA 3VVCA 1MOSA 3HR0A 3CTMA 3KEQA 4BVJA 3FSEA 4TV8B 3P20A 1OZGA 2O19A 2Y0PA 1EXNA 3KAQA 1B6QA 4TTPA 4C7BA 1R3DA 4CH6A 2QYOA 4JI3O 3MSCA 3GVXA 4LHEA 3TW6A 5TPWA 1CNMA 3IQWA 4C4WC 4YRGA 5CJ2A 1Q7GA 3LNTA 3ICXA 4PQGA 4BMDA 3ROXA 1KP9A 2XB2A 2Q1UA 3O4FA 4HNQA 1JQ0A 1GRQA 2RBKA 2NYVA 3WGZA 4IFBA 2IHKA 2GAFA 1KZ6A 5KHKA 4J6FA 4C7OA 3REOA 3DL7A 4PAMA 2PZJA 5KNBA 4OUDB 2YUIA 3NBMA 3JSNA 1KYXA 3WDMA 3DT8A 1DQNA 3D31A 3C8UA 3INGA 1DMRA 3UCFA 1ZM9A 4QVKA 4O2BA 2JIRA 4ATNA 3FSGD 4UCSA 4KUMA 3PEFA 4MTCA 4HVCA 1FA9A 5FYQA 4QJ5A 5HK9A 4GMFA 3A28A 2JH8A 3O2NA 1VKHA 1BAPA 3HLYA 1K5QA 1NQ5A 3ISTA 4F91B 1Q81W 5KNDD 3LYUA 3ON1A 1R0KA 3HXKA 4FBMA 1IOWA 5HKBA 1G21B 2V7UA 4R31A 3APQA 2HQ1A 5JDCA 3EZ6A 2ODPA 3MWDB 1PEAA 1S7GA 2C54A 2EJVA 4ETNA 5I7RA 1OCZC 8OHMA 4OHZA 5JMOA 4X7MA 2AZTA 3FGNA 4E51A 1P7WA 1GKYA 4M7WA 4U9UA 2LGQA 3IPXA 1P91A 4RUFA 3PUYA 4CL8A 2CYCA 1C0KA 3SHQA 4U2CA 2R3SA 2ZUTA 4RY9A 4PA7A 2YC2C 2RGEA 5JVDB 4U6NA 4BMOB 3PDIA 2AJTA 4MV0A 1A8HA 4FT2A 1PKXA 2O50A 4WKPA 1ADJA 2D1YA 4UASA 4BAGA 1JAHA 4LKOA 4RJJA 2O3QA 3D7NA 1ONNA 1EK6A 1E6MA 4R9UC 3AF5A 5BVGB 5GVSA 2QM7A 2Y1LA 2Y9MB 1R6DA 4M22A 2ZE5A 2HJRA 2IYQA 4OKSA 2BGUA 5ALMA 1BROA 1VJRA 4LXHA 3E8XA 3L02A 5T6MA 3H18A 1QP8A 3CS3A 2J6BA 4EZIA 5HS4A 2PFGA 2WB2A 2R6JA 4G56A 1JJAA 2BKVA 4CM9D 1B1AA 3M2PA 3DWIA 3LPLA 2WHPA 2CV0A 1G16A 3BWCA 4YCBA 4CMJA 1HDJA 5KTYA 4EGAA 3WWZA 4FLZA 4D9KA 4RMNA 3MAJA 5GPBA 5IBCA 4MJLA 1EHCA 3REQB 4K2AA 3FPLA 3K92A 1TAGA 4BEBA 1LWOA 5KKAA 4IIVA 4OK6A 1NSYA 2NSDA 2R0QC 1ZVJA 3PKJA 3A9CA 3J7TA 4DSUA 1VJTA 4R40A 3JW8A 1PD1A 4WLOA 1U0TA 4O4LB 2QEXV 1GUFA 1KMHA 2C0CA 1AGRA 3DPSA 1QIJA 4Q1EA 4IF4A 4TXHA 4L78A 3JZAA 3GLTA 1V9PA 2IYTA 4EKNB 2AUTA 2X0DA 2DE0X 1F7VA 1TCBA 4Y2GA 2O5RA 3FJYA 4QBIA 1GCGA 1U0BB 2QRQA 3SYOA 1ZG3A 1L5NA 1M6HA 2RH5A 5CFNA 4LBZA 2ZDGA 5H3CA 4UCQA 4KHZA 1PS0A 3FI9A 1OLXB 1KECA 4HC4A 4U8GA 4YREA 2QTAA 4UTPA 5IYZA 4DIFA 2DJ5A 1VCNA 1DELA 1QFYA 3U40A 3PX2A 3OEYA 1B26A 3MSXA 2VGMA 3CCVV 3E4CA 3GDGA 2Z57A 3ZU6A 4UNRA 4Q20A 3T1QA 2Q7DA 1LPBB 2FPXA 3STYA 4LJ9A 4ZP1A 3ZGZA 3KKMA 3UV7A 3ZV3A 1OU4A 5IZCC 1QIGA 2RBGA 5JNVA 3PHHA 5HIJA 4BKOA 4ON9A 3Q0IA 3NHYA 4AILC 3FPAA 3S03A 1YR8A 1NQVA 1BC5A 4TV8A 3RSZA 1S72V 1R3KC 2HPVA 4YX9A 5AM2A 1RYFA 1IPEA 3MOIA 2QD4A 1CPYA 2P11A 2XGSA 5ES4B 1I7QB 1J33A 4D0GA 5ED4A 2JLUA 3BHNA 1VSBA 3EUFA 4MVJI 1W36C 1E9FA 4YRNA 1R3IC 1RKQA 1V3QE 2VF4X 4WV3A 5LL6P 3PDCA 5FAKA 2Z95A 3HVKA 1HNXB 3TOZA 1JDPA 3GD5A 1UT5A 4P5DA 3V5NA 2V3CC 2AR0A 1YDEA 5I9IA 1GCIA 2PT7A 4YMWA 3RRYA 2GXSA 2CVOA 2IBTA 2HMAA 4R1OA 5FFFA 4DCMA 2R2GA 2FOIA 2DT5A 1ZI9A 4L8FA 1GM7A 3ZMZA 1SVLA 3WDLA 1E5XA 3UWKA 3VM6A 1IQPA 1QG4A 1MABA 4H13B 2X5OA 3IT0A 3ZY6A 2YWRA 2BGIA 1LI4A 3I8OA 1Q6IA 2HBYA 4A73A 3W2GA 4B76A 2HRYA 5H7XA 3FE2A 4BIUA 1JH8A 1IZ3A 5G40A 5BWLA 5MN4A 3GGGA 1H3EA 3H1TA 4XQEA 5CDYA 1KAEA 2FETA 3N2IA 4ZZ3A 1R50A 1AKMA 4HVAA 2XUKA 1QU7A 4D7TA 4EVRA 2W2MA 4FR2A 3R7AA 3LK7A 5I47A 2IS1A 2ARHA 1E32A 1E79G 1I6KA 5FH9A 2XIQA 3PK0A 4I4TB 1JR6A 3K9SA 3VC1A 2V4ZA 2GZDA 4R7GA 2HSWA 2FW1A 1DBRA 1EWTA 3DD5A 1KTIA 4DREA 5JVDA 4B4KA 2AQKA 1B93A 2HA3A 5CA0F 4S1TA 4Q16A 2WIDA 1K5GA 1YRLA 4X6UA 2NO7A 4YK7A 3LO8A 1VE1A 4OLFA 2G08A 3P10A 2QI9C 2JK0A 3HDVA 4BJ1A 3USZA 1K7CA 5GONB 1M5TA 3DZGA 3GHHA 3AYXB 1OIWA 1K3UB 5IPFA 2J3QA 3ZVLA 4PR3A 2EJCA 1LS6A 1VSVA 2QN2A 1F4LA 3S81A 2LIPA 5G0WA 4ZHSA 3T9FA 1BXKA 4I1OA 2GLZA 2OYQA 2NXWA 3D7LA 2YIDA 3GCZA 4EMUA 2GARA 5KWIA 1IIRA 1S7CA 3L0SA 5K01A 2JNWA 1WSDA 1UDRA 2OGUA 4CMHA 2J7KA 5JXHA 3MHTA 4HGNA 2O14A 3K9NA 4YO8A 4Y1FA 3WL7A 2ZTHA 4KQWA 1I0LA 3S2YA 3L7AA 1B8PA 3BXPA 1AQYA 4DR5B 4O4LA 1NBMA 2V8BA 4FXPA 2VF7A 5E4YA 1VQMV 1J2UA 4F04A 2ETVA 3Q7EA 3QI2A 5D3ZA 2N47A 2QV0A 1YJWF 1YZUA 5KYTA 1KC8H 2F8MA 2ZRFA 2DQ3A 5C1OA 3EIUA 5K99A 1LPOA 4ZI3A 3BHJA 2OAP1 1G2IA 4H3HB 4QPJC 2I5PO 4RWEA 1XWFA 4Q3NA 2Z83A 5T8KC 1UMBA 1B7GO 4DIUA 4Z4QA 1KKMA 3R6WA 3SJUA 2HK6A 2BKXA 3DL2A 4KLNA 1TM2A 1L1EA 4JEIA 2PJDA 3A2LA 4EPYA 2I76A 1U7HA 5COQA 1TT5A 4EPTA 5J2TA 3ZYZA 1L5VA 1ZCFA 2VDMB 1N78A 1BMFG 3TXSA 4MWOA 1F4NA 4RVFA 4I55A 2FAXA 1GFSA 4CBVA 2EW1A 3LFOA 2VDVE 4EY8A 4G5HA 1Y7TA 4ERXA 1O95A 3IEVA 2VSQA 4H7DA 1ZN9A 1JZTA 5TXGA 4CR7A 5AM3A 3RBZA 3L9DA 3BD6A 1IXMA 4DQXA 4QPKA 4OQEA 3LF1A 1FMTA 1GNLA 1TIPA 2EZOA 1TXGA 1II0A 2HQBA 3BGSA 4DLAA 4PYRA 4I3FA 4I08A 3DZIA 2ZEJA 4K9PA 3KQPA 5IG2A 2WSIA 4YRSA 3J7AC 1NYTA 1P0QA 1XKLA 4UM5A 3W04A 1C9EA 2IYZA 1NAHA 1QB7A 1EFCA 4F71A 1XDCA 2I3AA 3DOUA 3WVNA 3H0KA 1A71A 1AUXA 1K6EA 2FN4A 3E7PA 4AG5A 2J3IA 3JQ9A 4LV6A 3NNSA 5K09A 1W73A 3VOBA 3PGMA 1KO4A 4NTZA 1MGOA 1R16A 4ZPXA 3MCTA 3CO0S 4PCAA 3BB1A 5ALVA 5ALGA 3LY5A 4ZV7A 3EARA 1P1IA 2Q5QA 1GN9A 4RENA 2J4FA 4C1BA 2ZITA 2O7QA 4WOBA 4JH0A 5I48A 1TMOA 1JSXA 4LGMA 2ILTA 1BNCA 3ABQB 1QF7A 3V7FA 1R0RE 3RU7A 5HXUA 3WGGA 2PH7A 3UFXB 1SIBE 5ITVA 3PUHA 3E23A 1H42A 3QFFA 4DILA 3AU9A 2DQ0A 1USVA 1LC0A 3G2NA 4RMIA 3DQPA 4E88A 3PNQA 5JWOA 3JD2A 5JS8A 5E3IA 4MICA 5DTEA 1DBIA 4K87A 1JFFB 3RK4A 5EBWC 2Q1WA 3HU3A 4YRPA 1Z4NA 5L53A 2ATXA 2NYRA 2ZD9A 1IIBA 2CGEA 1E9DA 3VYVA 3TVDA 3NBAA 4I4TA 1J0DA 1H65A 2HPZA 1QAOA 3HBAA 5BV1A 1XQ1A 1KO7A 1UANA 5FD8A 2E4YA 2XUIA 1E0JA 1SCIA 3JWPA 4D4MA 1EGHA 3RC3A 4L9RA 1X7HA 4ZYYA 4FB4A 2QL6A 2HA5A 3CB2A 1V9SA 3QU7A 1IU9A 2FYUH 2X0FA 4FFBA 4A10A 4P54A 2YICA 3Q1LA 3RUAA 4GXQA 1PDOA 4CPDA 4HEJA 4YO7A 2WIBA 3ZDFA 4UMDA 3EXHB 1HY3A 3PQ6A 2FSFA 1EX7A 4ZEWA 1MX3A 3K4HA 3AERB 5GONA 3BRCA 2YIBD 3CC7F 2R4TA 4J0DA 1BHQ1 5E1BA 2J3JA 2ZCJA 4WFHA 2QJOA 1V9CA 1VL8A 2XMQA 4N47A 3AG2C 1BWPA 3I64A 4II7A 3V4LA 2OBBA 3UUWA 3V34A 5ALEA 4U0JA 1E2IA 3H1BA 1CZKA 5JOQA 1F6DA 3IQFA 4UVCA 4Y9RA 2Q3EA 2R96A 3DXFA 4PHCA 1PE0A 2C59A 3CEMA 3NWPA 1JVNA 1X9HA 4TYWA 4BPBA 2F1IA 3N8NA 4YPFA 2HADA 4JYPA 3WL3A 2PZMA 5JAQA 2IEBA 3JRXA 4D3DA 3PFIA 1DKRA 1BE3H 3IALA 3OM0A 1LVHA 2A9FA 3E9MA 2BMVA 5KU1A 3U2QA 3B70A 1BKYA 4LDAA 1KPIA 3G6EF 2X1HA 1M57B 1WDLA 2X9GA 3RBAA 3IIJA 1RQ7A 3SIVA 4DMUB 3QHPA 2BTOA 3VRHA 2Q5HA 5DTQA 3W6UA 1VQLF 3INYA 1GTG1 2AKEA 1H0KA 3FNIA 2GUZA 2G77B 5HM8A 1IV3A 2VP5A 2ZU0C 2VHYA 1M0WA 3BSWA 4XX1A 4D26A 2CDBA 4ZYXA 4S35A 1JJ2F 2WT8A 1QQCA 4I9NA 1TE2A 2BMDA 4IXTA 4DWOA 2HA2A 4EI9A 2WFZA 1X86B 4NAVA 1ZK2A 1EK0A 1J6UA 3BSFA 3P4YA 1M4UA 3VKFA 1SUSA 3ZR4B 2XVZA 3UW1A 2V8OA 1TUEB 4AI6A 4OP1A 3DE6X 2V4MA 2JLSA 4PAOA 3CP1A 1T9DA 2B8TA 5T4EA 2BMEA 1KOFA 3DTVD 1PJ4A 4IH1A 1Q82W 2I65A 5ER6A 4BV2A 2Q9CA 4B17A 5G4KB 3RUCA 2CYAA 1JX6A 3HEMA 4GBMA 1SU7A 4YLYA 1AQUA 2I6FA 4OF4A 4L4XA 2ZPAA 3IFXA 1DIOB 1DC7A 4DIBA 5CT8A 1XA4A 1WCWA 4FKBA 1HKUA 4LYHA 4LWSB 5AIAA 1OWPA 3OETA 3OTGA 2BOCC 3BTUA 5EPUA 4RK5A 2H1VA 1YQXA 4BE4A 1IN8A 2PLFA 3U5TA 4EKEA 3ZCXA 4ZJUA 1XBLA 2GM3A 2G36A 5EMNA 4JC5A 1OXBB 2UUBO 3M5PA 4V2IA 3C3TA 3NCHA 2P3OA 1L4EA 4X84A 1N6LA 5TDHA 1CZUA 4PAQA 2MMGA 4GOKA 1SPXA 1UEJA 2WZBA 3AXTA 2JBHA 2FOXA 2YCBA 3SQMA 2YBEA 3UFXA 5A0TA 5CT6A 1V4NA 3KFLA 1QNMA 3BCUA 3V1KA 4DWWA 1GGJA 4MINA 5D00A 5JSQA 1M93A 1MR3F 4IIXA 2Y1WA 3TOXA 4RVOA 1NN5A 5CFZA 2J3DA 3D2AA 3H42B 4X8LA 4GC9A 3DFZA 4DPKA 1JFFA 3PGVA 3ZNPA 1I7PA 3LRPA 2O5CA 1RPOA 3HA2A 2HLNA 4HDAA 1CERA 3QLUC 3DO6A 3IDZA 4B44A 1AR4A 3W5VA 3L8DA 5BQ3A 2BFAA 2VNHA 1CE8A 5GINC 4PIVA 2B0CA 2OG1A 1Z4PX 2MYUA 3RS8A 5FI1B 1SH7A 5H5JA 2Y1CA 2VHJA 3O6VA 2ZIWB 4JUCA 4IGEA 5F33A 4L3OA 1JECA 3HBMA 2CLDX 4DCVA 3DL4A 3I53A 5B6PA 4HYYA 2SBTA 1Z5PA 2CFOA 1B14A 1E9CA 3CCJF 4C03A 1XNRB 2PKXA 1XDWA 1EFUA 5D5PA 4NENB 3H87A 4W7HA 5H3HA 1OZAA 1KY3A 4WECA 3NPAA 4KI0A 2QTTA 3K6JA 5AM0A 1RDFA 4J7JA 3M2TA 1ZC3A 2VWGA 5IDJA 4QUIA 3HJRA 5FNVF 1RPZA 2PPVA 4MS3B 5KWVA 4FOSA 4TTAA 5IMSA 2AT1A 5K4HA 3EODA 1O03A 3QUWA 4MP3A 3K5WA 5TVKA 4B6RA 2BEUB 4J4BA 2JIMA 3ESRA 2XHEA 5FV7A 3PSAA 4M9UA 4F1JA 2WFMA 2H31A 1CIJA 1Z0JA 4GOLD 5EJ5A 2XE7A 4TGLA 2ISCA 1NVBA 4I8XA 1H5NA 4L1KA 4EGCB 4J2TA 3KP1A 3WMWA 4ID9A 3ZDEA 3GG9A 3KU4A 4MKIA 1KJQA 3BQ9A 1QU3A 4N6OA 2JLYA 3GEPA 1OV9A 4I6GA 4EQZA 1M2FA 1R9MA 1QIKA 3TLGB 3DM9B 4ETMA 1IHPA 2Q2QA 2SHKA 4ITVA 4WFEA 1NTMH 4MJ3A 1YRHA 1ZMXA 2NUPB 1XEWX 3QKRB 1N3IA 4NWOB 4QHYA 4ASUA 2BHSA 2HS4A 1FX0A 5DHPA 2R86A 2ACVA 3HNPA 3FYTA 1C0EA 2Q27A 4LZWA 4E4RA 4ZKEA 1FFCA 2PRZA 4BLRA 4J16A 1C1XB 1U3WA 1H5QA 3GXOA 1N7IA 1VA4A 2GPJA 4KAFA 1NVPB 2FWBA 2WF8A 3CZ5A 2BKUA 2ZYHA 4QLBA 3JWJA 3TNFA 1ACJA 4K7JA 1TUEA 4W7IA 2WOOA 2IITA 1PEKE 3K6KA 4NCNA 2R8ZA 2YVQA 2AG0A 4DQLA 3ZYCA 3M5DA 3H2YA 3NETA 4FLTA 4JODA 1L4FA 4BMYA 3NX4A 2Q6AA 4KN6A 1NJ8A 5G4KA 5JYCA 4WBNB 1ZGHA 3CWQA 4D56A 1RQ2A 1Y8ZA 4EKYA 1HR0B 3GLFB 3IQHX 4C6HA 1PJRA 3IMEA 5KYXB 1CETA 3EQZA 1TUBA 4Q4HA 4JQYA 3LQFA 4JBYA 4LWSA 4EYSA 5CFPA 3OZCA 4I1PA 4K35A 5AVJA 2LGWA 4KHPB 4L0CA 2AG6A 4RDIA 4NMLA 1MN6A 1XPRA 2DKFA 3V46A 3FB8C 3OZBA 3KYIB 4FWIB 3U60B 2XOKG 4JYAB 3RHZA 1V1JA 5B8FA 4H77A 4RM2A 1YZLA 5KHGA 2IY7A 1WM1A 3DE5X 4BMSA 4DG5A 4S2EA 1N33B 4R7ZA 4F3RA 1RC0A 5C31A 4F3KA 3ZX5A 4NV0A 3G79A 3APOA 5JJ5A 1YL5A 4U7WA 2ZAUA 3C3YA 1USGA 4G0WA 3B6IA 1CY2A 1BQ3A 3F49S 3HH8A 2W4MA 3GNLA 3VNRA 5CA3A 2Q67A 3KPWA 4BKMA 4CLDA 2PNJA 1DTOA 1UINA 3BJRA 2GBCA 2VK1A 3QFHA 3ZRWB 5JC1A 3SMVA 3ZCPA 2V03A 1Q1GA 3ZWPA 2YXLA 1ZINA 1CUBA 3QOYA 4P0TA 3LFHA 2VK4A 2AF3C 1IJFA 2JGFA 2ZZMA 4TTTS 3TQHA 3ZGNA 3HVHA 2FW8A 2I6RA 4BMNA 4NVRA 3G0IA 4FLUA 3LY7A 3ZN1A 4NBVA 3C9SA 1ZSVA 3DZJA 1Y1QA 1GUZA 2P4EA 4KUHA 2VJMB 2VZ9A 1PR3A 1NMEA 2CTRA 2OV3A 4DIEA 2JLXA 4S12A 3FPFA 3K71B 3VJRA 4BX2A 2PMDA 2Z1FA 4ZAGA 3OF5A 2VWQA 2DHQA 1QMPA 1DO2A 3MTQA 1JEYA 4QIWF 2KE5A 4NENA 1GPMA 1MG0A 2YWHA 3SMQA 4EP1A 2NZYA 1JLLB 1PWXA 1XHOA 3DF9A 2XWPA 3C8ZA 2Q99A 4C0BA 4DRZA 4H6XA 3UENA 3F1KA 1HYBA 1L4HA 1RRKA 3KYCB 1Y3BE 4P86A 1HE4A 2RHWA 3MWYW 1NLMA 2ONCA 2BEUA 3I2IA 3FZQA 1WN7A 1V16B 2R2AA 2BWJA 3R3JA 1IEVA 1AT1A 3QSGA 2IEAA 4EYEA 5K03A 4AS2A 3HXOA 2C58A 3BH6A 1Z73A 3G6EV 2RI1A 1GZVA 4CM8B 1UKEA 3BMNB 5BQ5A 1AF7A 3STWA 4Q6WA 2WAMA 3KEGA 2EIKC 1J0AA 4N39A 1NBWB 1G6Q1 4C07A 4OYYA 3PXDA 3DE1X 5B5EZ 1NZDA 1VQLV 5B6IA 4N3CA 4B3MB 5E1MA 1B16A 4MO9A 3H11B 3VYUB 3DV2A 3MJEA 1V96A 1BDHA 4LDPA 2XQFA 2QR2A 4OHFA 3RGBA 2V7GA 3JQ7B 1E1QD 2NUPA 1XTBA 3WYGA 3HY6A 3QKRA 2GLTA 2PO5A 2BZGA 1O7JA 3T3MB 2VG8A 4BVSA 5C4IA 4OL0A 1ZO8A 2VVTA 2IYWA 3W78A 4HJRA 5GIOE 1F7UA 1UXIA 1YS7A 5HMMA 1A27A 4AMZA 4BWFB 3G5UA 1C1XA 1AUVA 2HO4A 4A92A 2AC7A 2CWDA 5C8DA 1RKXA 1GNVA 1WXHA 1T5BA 4FUQA 1HQKA 3Q7SA 3ZN2A 4KFMA 3TEFA 3LT2A 4BAUA 2PNFA 3H1IH 1KI1A 3TJMA 3WIOA 2AYYA 1ZWIC 2JFGA 2ATCA 1T2NA 2C9CA 3KTDA 5HZGA 1QYRA 4DLKA 3E3MA 2WPDG 1M7GA 5A4MS 1DDGA 1ZPDA 3W3ZB 3O1JC 1OI4A 1J0BA 2IA5A 3WWYA 3OFNA 1DBQA 3HJUA 5L3CA 1X8XA 1DXHA 4WBNA 4RWZA 1TYEB 2BISA 1OE0A 1OCCB 3GLFA 4MPDA 2C99A 5DH9A 1INLA 4UNSA 4DR4O 3VFDA 3NALA 2D7CA 4JLPA 1XF1A 2DF8A 3B6NA 4Z7QB 4XM1A 4QM7A 3AGQA 4C14A 2WA4A 4ARUA 4G2TA 4H37A 3V4RA 3FCYA 1IJBA 1KJ8A 3MJHA 4X3LA 4HZUA 4G8BA 1EN6A 4WUVA 1SPBS 2ZJ1A 4EABA 7AT1A 3VAZA 1TK9A 5DIZA 4UEOA 2X15A 5CR9A 3ELBA 5FB3A 3CCQF 2IH3C 3HN7A 2QTRA 1I5EA 3BXGA 4M46A 4DSTA 2BFWA 3WFVA 4UHEA 3JD4A 1DPGA 4NCKA 5C0OE 4MYHA 4B6EA 3KOUA 5A6SA 3IJ5A 1BDMA 3DQQA 1DJNA 2Z5UA 1SUIA 1KDZA 4B3TB 1QMGA 3E53A 3ZRWA 5FOXA 2O20A 2QWNB 1M10A 2KQXA 4BLSA 1SXQA 1CY7A 3L6OO 1MC8A 2F9MA 3E2EA 3DG9A 4HWPA 3WB1A 1HETA 4ZO6A 1EFVA 2FLWA 1B73A 3K0FA 4AY4A 2XVAA 1XEQA 3KX2A 3DULA 3QNEA 3CCJV 3WDSA 4PFQA 4DABA 3QJGA 4LQ4A 5H83A 5D6OA 4H7EA 4H17A 5C4MA 2VJMA 3IKEA 4WJKB 5AVXA 1OYYA 5C81A 2BGTA 2DSNA 3PQDA 4KO3S 3P9RA 2OYCA 1CS4C 2QZSA 2G63A 4M0UA 5HX7A 4LHXA 1T1GA 3NIBA 2J41A 3O8DA 3T99A 2VDOB 3RRMA 1M34A 1N92A 4OG2A 1VXOA 4K6FA 4HEA1 4TMKA 5IZ4A 4XJTA 4IIJA 4OMUA 1DJMA 2Q41A 2VAVA 2JFNA 4WXRA 3MQFA 4BFCA 3KLNA 5HY2A 4EF4A 1PG2A 1U9IA 1U4OA 1ZA2A 5TT0A 4HS9A 3ABIA 1RWWA 1E3DA 1AKRA 1V16A 4B3JA 5DK6A 1GKLA 3NOXA 5AKKA 3WRXA 2RGUA 4G4IA 5J9FA 2PKCA 3WY9A 3EDYA 4CM8A 4G4JA 3BMNA 1NTRA 5K1ZA 4GLFA 1GTL1 3EIXA 4PZPA 1JIVA 1NDHA 4RANA 3IH5A 2GYVA 4F2PA 4HMOA 3C5CA 1KYTA 4UUAA 4PSCA 2GR9A 2PGIA 4JJ6A 5DEDA 4CVNA 5KYYA 1AQJA 2ZSAA 1CZLA 2JH9A 4KH0A 1DC8A 1WA8B 2QG4A 3UMYA 3IUEA 2Z6QA 3IT3A 1N6RA 3ECSA 4HDKA 2P41A 3DE2X 3QOXA 1NUTA 5FPOA 1BYIA 3WJQA 5JCPA 4N3NA 4L28A 4L9SA 3UOGA 1GQ2A 4KMMA 1STOA 4B71A 2XCLA 5E7JA 1QZ3A 2R00A 2PBZA 3VR5D 1W1UA 2B94A 1TAQA 4O2BB 5EPOA 2J30A 4RORA 3EGXA 3A9RA 4UUJC 3ETJA 1Y42X 2E48A 4BMVA 1H6CA 2F3QA 3R0JA 5EUQB 5AD1A 2Y9PB 3D3JA 1GGVA 2XNHA 3L1JA 1KD1W 1DKOA 1IG3A 2EERA 2BRUC 3RI3A 2AQ8A 4LYEA 2P2DA 1EQUA 1IN5A 4GPTA 1QAHA 5K0SA 1X1CA 3AOEC 5KOJB 2DY0A 2KWIA 3E8SA 1T9ZA 3DFMA 3JQAB 2DUNA 4ZOLB 2Z8XA 3LKDA 1L0BA 3SG0A 1YCFA 3NZEA 4KRFA 3ILYA 2XA9A 3HMKA 2XMRA 3H1AA 1GZ7A 2FUG1 3RM3A 1K4YA 5J58A 3R7LA 3BA1A 4NJMB 1BYUA 2LUOA 2O3SA 3R5KA 3Q7IA 2AZXA 2E1RA 4OQLA 2I1QA 5B2FA 2FN3A 3H5VA 2ZTUA 1QO9A 1NMSA 4EFKA 4YAOA 2G17A 4X5OA 4ZANA 4R2KA 4CFZA 2NPIA 4HLUC 4HB0A 4ZTZB 4MIKA 2G9NA 2PWBA 2IPAB 1Y9JA 2C4KA 3GELA 4B7KA 3EXFB 2P9HA 3FR8A 1E9RA 4J9UE 4W6QA 2NSJA 3SJCA 2P2CA 4LV5B 3KQMA 1TYZA 4UV9A 3AHDA 1WQ1R 4KWEA 2M6SA 4FVTA 4BMZA 1U8AA 1M2OA 3SP1A 2R9RB 3TLEA 2FDRA 1A4RA 4KH1A 4CHTA 2WB4A 4MMXB 4XEHA 1O89A 3PX7A 2IIVA 4HLNA 3MK31 2YMQA 2H1WA 2CFTA 4ZYWA 2YZMA 1RC8A 4MUHA 1FXHA 3BE4A 5TPZA 3DLAA 4F1KA 1LLUA 1X8LA 1BEEA 4R40B 2OSVA 3CHXA 1BZKA 4Q02A 3H3XA 4IV0A 2KYRA 1GSOA 3AR7A 5IABA 1CFZA 5ERYA 3ROGA 5KI6A 4BJ5A 3QHAA 5MF6A 5FR1A 1U8XX 4P22A 4WNIA 2BSKB 3DKPA 3GLUA 4L7VA 1L8QA 5DMHA 4EI7A 3TLZA 3CX3A 4XUEA 1LDGA 3I9KA 1NPDA 4KQIA 1N0IA 1QH9A 2EZ4A 1YQQA 3QLEA 4EHHA 1WV0A 3B78A 3HG7A 4OX9Y 2C9BA 2K1SA 5IYZB 3RGWS 2R6GA 4FKMA 5EIWA 4EF6A 1KJZA 3WL5A 4DUGA 1PNOA 4FYYA 1XF9A 4DXHA 3DDCA 3ESYA 1CRWG 1G6UA 2EFCB 1RQGA 5AVQA 3I1YA 3QMMA 2JAOA 3CX4A 1C7RA 3O85A 3UG7A 4PLCA 5I9LA 5AFSA 6PFKA 3OIDA 3VU3A 2EX1A 5CDUA 1UOPA 2AOUA 4BNFA 1GR0A 1NG9A 2A1UA 1NI3A 2PS1A 2IXBA 1JIKA 4TSKA 4TZTA 5FBVB 4RIIA 3DBLB 3Q9LA 4BY9D 4JJKA 3CCLV 2ZI3A 3IJ4A 2V3WA 1P81A 4J1SA 3V2UA 4UVAA 1W57A 2Q4OA 3L0PA 3FPBA 1WPBA 2XEXA 5SV2A 4DNXA 2CHVA 3MIZA 5ECGC 1R8JA 1F8GA 4RJTA 2ZSEA 3E48A 1TJYA 2GXQA 1NOJA 4YCCA 3LUTB 1W4RA 1YITF 3U26A 1ULBA 2F9ZC 3OLVA 3GXBA 3R5FA 3YASA 1GNPA 5ALRA 1C3XA 1P0IA 4Q1FA 3FHLA 3T1HB 2WWFA 4OSEA 1TGVA 1WA8A 4J7AA 3OZDA 4Z3DA 3OESA 3GFRA 1DUSA 2VWHA 1J8VA 1BXRB 4G8JA 3LL7A 3GP3A 1FX1A 3I5DA 3N2NA 5TC4A 2Q9BA 2NZVG 2L42A 1N3LA 3UMBA 3O21A 2E21A 4NZPA 3KQSA 1FXKA 4OIMA 2RHMA 1NSFA 1OFGA 1DSSG 3H9JA 4MS4A 2G1KA 4NNJA 4MDEA 3O9VA 4I50F 3JD0A 2IOQA 2AN1A 1T5DX 1RQNA 4G4WA 4LOJA 1MABB 1UWCA 1YR1A 3C6MA 3IAXA 4DCNA 4HGQA 1GTMA 2UYYA 5AKGA 1EBBA 1OWNA 3N2EA 2OGWA 2EC5A 2DUMA 2OOSA 3ZDQA 4C7VA 1U6KA 1UP4A 1XA0A 1FP1D 1ENPA 4Y67A 4E08A 4N5HX 3I23A 2GHYA 2BDUA 1H47A 2CVZA 4OQ4A 1C8VB 2Q0AA 4CGYA 1GG5A 1IJKA 3BA6A 3O8NA 1Z6YA 5KOJA 5CLFA 3TFWA 3JQAA 3J7AR 4MVJM 4WKGA 2EIJC 4ZOLA 1USKA 2A78A 5KEIA 2J09A 4HFMA 1KY2A 4KQXA 4X63A 1X1EA 3A1UA 4BLWA 2HC9A 3HVJA 4JLMA 3H5LA 3MS2A 3SD7A 4NJMA 4HH0A 4TZ0A 2QN3A 3F6SA 5MDHA 4RXTA 5J5CA 4GP6A 3CCQV 2QPAA 4FMCF 2GK7A 2O1WA 3FHOA 4ENTA 3K5PA 5AKLA 1VBMA 1U90A 2OK7A 1FP7A 4B33A 1HUQA 1W47A 2C2MA 1S3IA 3TB4A 3R8CA 1DQPA 4YBZA 3IB6A 3NBZC 2C2HA 3SU8A 4LZNA 3GJQA 1IBKB 5NULA 3CG6A 3LA6A 4FGKA 1ZESA 2PCLA 2EZPA 4DUYB 4UFNA 3LNNA 5HP4A 2XSZD 4DR3B 2E49A 4TKVB 4OXKA 1IONA 1PGNA 4TS3A 3LZDA 3R41A 1Y3DE 3EXFA 4DNOA 2C3PA 2NTNA 1NVVR 2HHHO 2ZDHA 3DJFA 3C48A 4BBAA 4PRZA 1MEJA 1ETHA 3ED5A 2QP3A 4WOPA 1P0MA 2WEKA 3KUCA 4B8ZA 1YK0A 3LDGA 4YCAA 3U4GA 4DYLA 1WVIA 5AJZA 4AZWA 5B36A 4FWBA 4BNZA 2OZLB 5B7PA 3MS4A 4Q6GA 3G13A 1FFEA 5MN5A 3BE6A 4OHOA 2DWDC 3F6YA 4EOGA 4WKCA 4UATA 3UBMA 1WRBA 2B4TO 2A0YA 1ULSA 3LDEA 3W8FA 5EJ2A 4Q82A 1SUAA 3OZVA 5DASA 3S44A 4RD2A 3VNBA 2PUWA 4EHAA 4AG6A 1PP9H 3QPWA 1HNZB 3EGCA 3KTOA 4UW9A 4ZEOA 2MW2B 3B53X 1LW7A 1FJXA 2BSKA 1AVTA 2X7XA 1NXXA 3U3MA 1SG0A 1Q84A 1MFPA 3L9XA 1EPUA 2KX7A 3Q3IA 3EHDA 3ORQA 1UMBB 1XALA 4DA0A 2DYSB 2OIEA 1PSWA 2OBFA 5ALUA 3SZRA 5J40A 2QM4A 3NEYA 5AYVA 2BAGA 1SESA 1ZP6A 2J4DA 1TT5B 4A0GA 5J2TB 1DJPA 1IN4A 3LUPA 2X0NA 2QSYA 3KAKA 4I55B 2KTUA 4JL6A 1TOAA 2HUNA 5AKIA 3GG2A 1WSWA 5CXUA 1GAXA 3ILHA 4LTNA 5CEJA 3FLEA 1RQXA 3SJBA 2JJYA 3AHIA 5EMKA 3ZGOA 3FA2A 2FMHA 3N0XA 1RI4A 3DBLA 3VU9B 1C3EA 4U5QA 1OCOB 1M6VB 1ONBA 1HOTA 2JIZA 4BO2A 1T9HA 4TS4A 3MT9A 4KRYA 4UUBA 1SOAA 4I7ZB 4PI2A 4IWNA 1W36D 4URHA 3DDOA 4C6TA 1NXVA 2XNDA 1I5RA 1EN5A 3L8EA 2IPMA 4MUYA 4B6JA 5FORA 3MBKA 3G68A 2VHZA 1MAWA 4JA2A 4HDSB 5A7FA 5J1SB 2V0NA 4G6ZA 1AGYA 4DHWA 2X8LA 3FYEB 3QXCA 3VX4A 3M6XA 5DTIA 3WIEA 5KOYA 1Q14A 1GTOA 4QBKA 3ZOKA 2CAZC 2IDZA 4AS3A 1R5BA 3TM4A 1IMJA 1TRKA 1BXRA 2FXIA 3OTHA 4AN1A 1YZHA 1CUUA 1D0VA 4IDAA 5EJ4A 4NBKA 4HN4B 1Y63A 3RVNA 2HDNB 4DEYA 1XZHA 2QZZA 2W2KA 4WZAE 2BKAA 2QTBA 1B0AA 1Z8FA 4ND3A 3GT7A 3EWNA 3I0NA 2HMUA 2FSUA 2CDRA 5EQDA 2WHXA 1NJIH 3NOOA 5DM60 4ZTUB 3C7AA 3WG7C 2RJNA 1EDEA 2I6TA 1DRJA 1TFUA 3MGCA 2I3DA 1ZSYA 3KQOA 1X7PA 4HDQB 4BOYA 3JYLA 2H59A 4KU4A 3IODA 3WHKA 4LF7O 4KBGA 4HFNA 2F48A 2Q8PA 4GD3Q 4IQ8A 4A36A 2GFHA 4BW0B 5I4IA 1JT2A 3QH4A 2J9RA 3K70C 1KIMA 3IEMA 3OKAA 5IEBA 3A3NA 1WUYA 4RHAA 3G1WA 4KN8A 3DMYA 3ZY4A 4KPUA 4XI9A 3ZDZB 5JTTA 4G4XA 2MR5A 1YDGA 4QGPA 1U0EA 4OXSA 3II6X 3IQXA 4RE6A 3IV7A 3PDJA 3GBSA 1SZCA 1CQPA 3WIUA 1N7JA 4R1UA 2SKDA 4DUPA 3DFKA 2C2AA 1LXCA 3A6FA 2X8AA 1D0SA 1GOTA 1CEQA 4FFBB 1H8HD 3V1NA 1L5SA 5ARCA 5H16A 1DRKA 1BN7A 3CUTA 3P2MA 4G1BA 1WTAA 2BD0A 1SZTA 1XLTA 2XRZA 2ENUA 2ZB8A 1YBMA 3FCCA 2G0NA 2X9VA 3BWXA 4PC2A 1YE5A 4HADA 1ICIA 5F1KA 2I7XA 4JJ4A 4DS3A 3ZY3A 1K7FB 3P27A 2WVJA 1RXYA 3ROTA 4N3GA 1X25A 3IELA 1YQ9A 3LG2A 4TKVA 1AV6A 2C07A 2V55B 4JC8A 1WXXA 2HHJA 3DXXA 4JSTA 5HBRA 3HLTA 3FYIB 2EJBA 1SN7A 3VYTC 4LJLA 2YZNA 3KO8A 4X3CA 1IPAA 2AMVA 2OZLA 5ICCA 1QGOA 4PFKA 2DGDA 1YC2A 2FHSA 4YQEA 3O8RA 3S4YA 5GADl 2IYOA 4WKOA 5FOWA 4TSFA 4XVRA 5KNCD 5AJUA 4RPCA 4IQFA 1Y1RA 1TTPB 3SR4A 2OENG 3O3NB 3K20A 1HE1C 1IXBA 1BCRA 3KKKA 4JT8A 5ADUS 3P3NA 3HR7A 4HUQB 1KH2A 5JAUA 3D5QA 1DKPA 2GUZB 4RA9A 4KGVA 4RCVA 4OU4A 2HU5A 5FL7D 4FZ5A 2QRPA 3GZNA 5DXJA 2J3MA 1JIIA 4OO3A 3BK7A 1POXA 2VAXA 3LBIA 3PFKA 3D6TB 2FLKA 3VPDA 3EC1A 4HX5A 2CMFA 1HQYE 2V7EA 1SIUA 4F60A 3LHDA 3WG9A 3WQBA 3EA0A 4WBSA 4LWOA 3E70C 3STTA 4X92A 2PD6A 5LZ9A 2FG5A 1PNVA 4RK4A 1FDTA 4LYFA 2JL1A 4LRWA 3VU9A 4R6XA 1YITV 4RCYA 3ANXA 1M6VA 1FW8A 3VPGA 4ZI5A 5K0NA 2NSLA 5HUHA 1E3JA 3CSDA 1R4NA 2UYGA 3LSTA 2YW2A 1NVVQ 2QP9X 2J0UA 5K0CA 5YASA 5LBTA 3E9YA 3ABZA 3S0JA 1VQ9V 1XQYA 5ESWA 4HDSA 3EZXA 3K57A 1JMYA 1MF7A 2UXBO 1U6JA 4PZ0A 3R09A 4HB3A 2EX0A 5CFOA 4C06A 1XKQA 2EDCA 2BBOA 3AIOA 3DXRB 4MI9A 3LSQA 1IQ0A 2O2EA 2ZRMA 5L7TA 4WXYB 4Z9XA 5IY5C 1CULC 1THTA 3AG6A 3L6RA 3SJAA 3GRRA 1BQEA 4IOMA 3C5HA 3CNOA 1TKRA 3F7TA 2JFZA 2GTPA 1XPOA 2JCYA 1HE5A 2IU6A 4L8VA 3FB1A 1MORA 2PUBA 1E4OA 1PV1A 4NXMB 2B6NA 4RA6A 4FFWA 1L7AA 1KMNA 5LOVF 4YCNA 4G36A 1JHQA 3G49A 1RQLA 4NONA 5HF5A 3FMVA 1LD3A 1U8TA 3S5UA 5EIAA 4PXAA 5DK4A 1TUGA 4RLSA 2ZIAA 3UO8B 2J85A 3K9LA 2L69A 5FPYA 4EVIA 1EGQA 2RJOA 5K8VA 5FHQA 1EBUA 3URMA 1E69A 4HH3C 5LP6B 1G9SA 2GZHA 1C7EA 4EB3A 4QXRA 4BO9A 4ECAA 4XVUA 3N6XA 4A2CA 5B1OA 1CE8B 5DHTA 1OY1A 2PGGA 1T3GA 1RJ9B 4JJGA 5EO3A 3TO5A 4W5JA 4MUFA 5JLJA 4QFDA 4J1TA 4F5EA 1Y9AA 5FLXN 3MXTA 2X5JO 3U11A 3U61B 5U4XA 3FOBA 1P1FA 4EY4A 1KEEB 4OYRA 1MNQA 4W5HA 4JCOA 1NBOA 1CK2A 1YOBA 1XO1A 3K0DA 1BJRE 1JVSA 3KRTA 1U3GA 5BSEA 1EE2A 2P9CA 1OCEA 3MT0A 4DSZA 1DC3A 1RYEA 1G64A 2O0KA 5FJJA 3ASYA 3LYHA 2QL9A 3F0EA 5I9MA 4G07A 1O4WA 3CW9A 1JFLA 3K0SA 1H4TA 4KRXA 1Q19A 3AB7A 3WLHA 2GVIA 3P0ZA 3VDNB 2OV8A 1O94C 3EVNA 4PNEA 2FHPA 3LBYA 2CBZA 2A33A 2PS3A 3AEYA 2P75A 1F12A 4R2MA 3S2IA 1KFCB 3VISA 3AW8A 3ET5A 5BXYA 1NVGA 4ETWA 1I32A 5J4HA 4Y2XA 4JT4A 1UAYA 3QVVA 1E3EA 3A6KA 3O3OB 4N3BA 3IP8A 4IEIA 2A9JA 2YDEA 4DSNA 2G67A 3VHQA 1BL8A 4WY8A 2GI4A 5KIAA 3OM1A 3QFRA 4BWYA 3PFHA 3ZG6A 4TT3D 1J70A 4MWGA 5K8TA 5JAZA 1JNYA 5GVRA 2PUCA 3JVHA 5K3SA 1E63A 5CNKA 4LXQA 3U44A 1E9AA 1QRUA 4HUQA 4CI0B 3QXSA 3BQMB 1X42A 2AK2A 5B5SA 1FX0B 1SMKA 3RRFA 3SF8B 3TNLA 1UQRA 1NGSA 1KYZA 4XUDA 3TJZA 1TK2A 2HEPA 2TSYB 4E7OA 4AF8A 1XLUA 4BCBA 2EQBA 2LPMA 4W4TA 4YNBA 2IXAA 4B3DA 3WLOA 2QVGA 3CPHA 1SC6A 2QWPB 1N2OA 2WA1A 5FJIA 3DLHA 4G5RA 5JDIA 1M5IA 4B4OA 1VQPF 2JJQA 3SWWA 4RF3A 1JQLB 3EISA 2CDAA 3U6KA 3QIAA 3P9KA 1N34O 3DVSX 1GM8A 1P19A 5IKXA 4F9TA 3REFA 5AKZA 2CNBA 4RVCA 5KYVA 1Y80A 1SAYA 3N8DA 1OFUA 4HAOA 1U3UA 4BNTA 3UC5A 2WSLA 1NTOA 2RK6A 2BGLA 3BF8A 2YIVX 1U9JA 3UHOA 5FYDA 2D62A 4OGQB 1TUBB 4Q4HB 2Q6IA 4Y2PA 1DIGA 4JLDA 2I1WA 1VRCA 4WH0A 2WD7B 3CC8A 4GP7A 5DM4A 3FDIA 3CCCA 4TQFA 1ODSA 4FYVA 4ZN6A 3DXRA 4Q3AA 1THGA 4V02A 2WMNB 1TI7A 4IYIA 1WZNA 1FTNA 2TMGA 3OE1A 4DMHA 2R47A 1RBMA 3DZFA 1H2NA 3G6BA 3ZLVA 4OFXA 3AWIA 3PVZA 2E7ZA 5B6JA 4W5NA 2D4AA 5DULA 4XDGA 4W1SA 2PAAA 2DAPA 2J4CA 1HV8A 2PUTA 4O8CA 1BFDA 2Q2OA 5HP8A 4ISBA 2FR0A 2VYCA 5IAEA 3K16A 4MA5A 3R3VA 2WKPA 3W9SA 5TEVA 1BMDA 5E3HA 2WLKA 1Z18A 5K4AA 3R9XA 4QDTA 1NU8A 3X2FA 3O0TA 3TFOA 4MTGA 3GUVA 4BGUA 4LS3A 5K0FA 4ML3A 1FJGO 2KW5A 2C03A 4UZSA 4ZAVA 4E11A 4XFJA 1ZUHA 2K2WA 4UU8A 3H5WA 3K2XA 3HUDA 3BDIA 2CSLA 2DLNA 2OFFA 1VSQA 1J90A 4EKGA 5CW1A 4K9SA 2RKBA 5LP6A 1H66A 3R4VA 3H0EA 3GMDA 4L5AA 5AM5A 2FR8C 5GWXA 3A70A 4C81A 2YXYA 2FJUA 4UBNA 4EL0A 1RJ9A 1VYVA 3F5FA 5K8CA 4X62O 4MYCA 1VZ2A 5DCVA 1IBLB 3FZYA 1SWVA 4J2HA 3RVZA 1QORA 2JAXA 3P2EA 4H7KA 4F9EA 1Z34A 4R8CA 1R0SA 1EJ0A 3REGA 4CTKA 3X1MA 4K3VA 1KEEA 5CD1A 1RBZA 1JEYB 3DDNA 2EEZA 4B80A 3PRYA 3K9WA 4BLUA 4PIMA 1UBFA 3RW9A 2IBMA 5HF9A 1SELA 1X1QA 2VUSA 2JHAA 4CLEA 5JCJD 1Q3EA 5B2ZA 3Q7QA 1DX4A 1FRNA 3X1YA 3COVA 1DE0A 4QUDA 2HMTA 3K15A 3K9QO 4HDNB 4R01A 1WJZA 2PI4A 4FIDA 3U0VA 2FZEA 5TMBA 2AK3A 3L40A 2YBDA 3M89A 3WKDA 2HIHA 4G97A 2JAQA 3I39X 2X0IA 3MPUA 1W59A 1NU1H 4WACA 1ZD3A 4J7ZA 1MT3A 1VIYA 5SZKB 2PA3A 1ZVKA 1CLEA 1A8SA 2WKWA 1W52X 3MJSA 1IOVA 3IBGA 3RSHA 1I0ZA 4RW0A 3SLRA 1I2ZA 2ZS9A 3JYPA 3AUAA 1H23A 4OQQA 2RHGB 4AF6A 3D0QA 4RSHA 4M87A 3GAMA 3NFYA 1YB1A 2JI6A 3E6AA 3PT9A 1VGRA 2LRHA 3T3DA 4P7FA 4K2HA 3FFQA 3MBMA 5HIIA 4DMRA 3QRWA 3H4IA 1A77A 3GBVA 2B78A 3R9KA 3CG4A 2C98A 3VSBA 3TECE 3SF8A 1MA0A 3ZCQA 2PI5A 1X1DA 2Z9BA 4KSBA 1M1UA 3ICWA 1W1WA 4XH9B 2ODMA 4LJ8A 3UUEA 1FDIA 4LC9A 4FMTA 5AI0A 3U7EB 3JASB 1YXMA 2IYUA 1MO2A 4MWEA 1UBEA 4DC1A 4CT5A 1NZJA 2B92A 3I6ZA 4LXUA 4RM3A 1Z26A 3SF0A 4I1YA 2GPBA 2HT1A 3WTBA 3VZCA 4U8HA 5HZHA 4MVJE 2JDIA 5SZIA 1PT9A 1X87A 1OA1A 2DBRA 2Z9DA 3B7PA 4PVDA 5JJEB 2RMKA 2ZRQA 3ABTA 3T3GA 1K33A 1DC4A 3UB3A 3WFJA 4MX8A 4RZIA 2SKEA 4NZYA 4U9IS 3ZXUB 1YFLA 5JALA 3TBHA 4E03A 2WD7A 2EFYA 4IDCA 4IJUA 4PS0A 3CJRA 3D59A 2EKPA 3WA6A 3TX6A 5LKAA 1L7VC 2A0XA 3QVXA 3S28A 4HZUB 4DC0A 3PEVA 3A4LA 4LF5O 3DZ8A 3A58B 2PQ0A 2PX5A 3GFSA 4JUBA 1Q2XA 1UWLA 5SYNA 1GNRA 3I9V1 1IQUA 4RELA 3DP9A 3CCSF 1YH3A 4YAEA 3BEOA 3OAAA 2GB4A 1VHTA 2DPGA 1CP9A 3RA6A 3TPCA 3HQ4O 4UAJA 2E4UA 5CB8A 5A6SB 2J3HA 4B34A 2EWCA 1YMQA 4NMWA 4G67A 2W48A 1YS2X 2Y69C 1CQZA 1JG1A 1A9YA 5EG5A 5EZYF 5LGNA 3UAVA 4Q3KA 2WJ3A 4HEQA 3UA3A 1LNZA 2J46A 2NPFA 2GJKA 4E5PA 2I99A 3GRCA 4BW5A 1EFVB 4IJQA 3K0FB 3G0BA 2XWBF 4L02A 2OFXA 4DV1O 1LVUA 1EAYA 2EFHB 1OFVA 2OD7A 3AP3A 3SOPA 3NC0C 2JAHA 4QG3A 1JDVA 1NURA 4Y6OA 3TD2A 3LQ2A 4I1SA 3WBKA 3KE9A 1U2TA 1RM0A 2VJAA 1T13A 3NBXX 1PW5A 5F7ZA 2KLHA 3TBKA 1GO0A 5FHRA 2P8SA 2NVUA 1EGMB 3D2CA 2FYTA 1FNCA 2HMWA 1GPKA 1T15A 1DCFA 4P8RA 3ZOPA 5D5HA 3ILVA 1E1LA 4C3UA 4M9CA 1M34B 2QI2A 1DAKA 1DARA 4NCJA 4IIJB 3VVLA 3CS5A 4XVCA 5JHGB 1FDWA 3MF4A 3LW8A 1OTYA 3FPCA 5I7EA 3VNVA 4E07A 1BE0A 4HDNA 3IC5A 4RNDB 3ELUA 4KAJA 5T41A 4MI3A 4MVJH 4R81A 3S0HA 3AUTA 5LVAA 1XDBA 4NEQA 1M75A 2TS1A 5TQJA 4FM1A 4P36A 1N75A 4FS3A 3DW1X 3U3DA 1RZUA 3AIMA 2KQUA 2P7TC 2A5GA 1ZIDA 1R0BA 3WIDA 1ZBDA 2IFTA 3FSRA 3FBWA 2GHIA 4PR0A 3CCLF 3DEJA 3EXG1 2CW4A 2RCNA 3OD1A 1AG9A 3NW9A 2WFAA 3Q41A 3L8FA 5KYYB 2ZIXB 3TXXA 4PTYA 4HPXB 1OVMA 5G1OA 4TN5A 2C57A 4JI2O 4QYXA 1Z74A 5LNK6 1NDQA 4IOLA 4CF5A 1JVBA 4EW2A 1JZQA 2P2SA 1X7XA 3ZWVA 3Q1KA 2Z2JA 2SECE 4HDKB 4FB5A 1YE3A 1KBQA 4FZJA 5FDFA 4A8JC 2DUWA 4CF7A 4BVRA 4U5XA 1QHHA 2JKVA 1VQPV 5HJEA 1XMIA 5EB1B 1I2CA 2IF0A 4BV8A 3DB2A 1Q8RA 3VV3A 4EHFA 4HQ6A 3KSAC 3SKXA 4BO7A 3IEPA 3T3NA 3EGXB 4JGIA 3RLIA 3JASA 4KK4A 1L5YA 5FQOA 2GAJA 2H1OA 5JO9A 4HAMA 3VH4A 2IDKA 1L5HB 1ILEA 1UK8A 3OJFA 2DECA 5DSXA 2EL9A 4OPAA 4ROSA 1AGXA 3OE5A 1Z75A 4RKWA 4TQUS 1ZRSA 5UKDA 2P9YA 3VOTA 4H6WA 4FNGA 4UC0A 1XTIA 2PD3A 1Z4OA 1W4BA 1BHJA 4U00A 3WGKA 1Q0RA 3HYCA 2C95A 3EDRA 4URVR 3ASVA 2KLBA 1H4VB 3U0BA 2GDJA 3DDUA 4B7XA 3EVEA 1YF3A 4OB7A 3KPVA 3HO1A 1L5QA 4IILA 1G2PA 3A1FA 2EW2A 1Z17A 1QFXA 1ZL2A 1JIXA 5L9AA 4RAOA 2RK3A 4BUJA 2F1MA 1OTXA 3TL6A 1DC5A 3QV1A 5EE5B 1JA0A 3W7VA 1PFUA 4F97A 3VBCA 1UXKA 4FMDF 5EXTA 4O4JF 2VPYA 2OQ2A 3ZD8A 4RBNA 2ZR9A 2DRIA 7ABPA 1JJBA 4MQMA 2WVAA 4P9NA 2OLJA 3SC2B 4QNNA 3K1TA 4Q03A 3NAGA 3L5KA 3P45A 4KYIB 1C14A 2DOSA 1WY5A 4EJ6A 1M2OB 3Q8WA 4RF5A 3PUWA 1E79D 1WOMA 3OPVA 4TZ6A 5HP7A 3ZWNA 3BS4A 4U7GA 4BE7B 4J1QA 5IAOA 1Z7GA 3S40A 5WRFA 3FFAA 4KLAA 2OCXA 3GPLA 2HNAA 3GJ6A 3OZRA 5B3JC 2BDTA 4XB2A 2DQZA 5E9WA 4YFVA 1PGJA 3VR2D 1S2GA 1ZONA 3IAEA 2RBEA 2UUAB 2WA2A 3X2SA 4Q39A 4PYKA 1P1KA 1A0OA 1MH1A 1YTUA 5MFPA 4RVHA 4F06A 3DM5A 1ZOSA 4FBGA 3HB9A 1E7YA 1CR1A 5DM0A 3OCXA 1E66A 4IDNA 2HEGA 3I56F 3BL8A 2VR1A 3W8DA 1E2DA 4L75A 1GO1A 1ULZA 1XMXA 2JHGA 4EX6A 5IT9A 3KZOA 3K09C 4MVWA 2JG3A 3OJLA 3DOIA 4PG6A 1Z7WA 5F5XA 4E1BA 1IZ8A 2OTCA 1NQTA 3RC7A 1REQB 2Q3BA 3RUDA 1WU7A 4OBXA 1U2GA 5JQGF 1TEVA 2AOUB 2ZSDA 1AQNA 2ISSD 4JLUA 2A1UB 5FR2A 2F00A 2ZIFA 3HEAA 3L7NA 3L7OA 3UTCA 2ZAMA 1U2QA 3BDAA 2G8LA 4KB5A 3G2LA 3RC2A 3CYOA 1XGKA 2WQ6A 3C6QA 3OIWA 3O2SB 3TLCA 5BMVB 3WPXA 4YVFA 1YSCA 1S8AA 4ZU3A 4WAUA 2F3PA 2WF5A 4NE7A 3JVDA 1JEJA 1QYIA 3KQKA 3HKEB 2QD3A 3AVVA 1A98A 2IXFA 2VDWA 4FDMA 3UAXA 1JEAA 4PBRA 3ZU5A 2CFCA 2XT6A 8ABPA 1CUEA 1G21E 3MINA 3ZCUA 1D1SA 2ZIXA 2JLZA 1VMGA 3WSVA 1ZM4A 1VMEA 2MDTA 3BCCH 4NBUA 2OFWA 3FFWA 1TLTA 3OZTA 1UODA 2HMVA 3LJKA 1U2DC 3NAQA 4XASA 1Q43A 1C2YA 1JDBC 3RIGA 1L9KA 2PX4A 1D7AA 4P9OA 4G0QA 1VE7A 1BMFD 3FPHA 3EVCA 3GUHA 1FXKB 3AFOA 1EFDN 3IFSA 3ODPA 1JN0A 1XL4A 4MS4B 1FRFS 1I6MA 2ZBFA 4B7EA 4A03A 4TLEA 2H92A 1FYXA 1D2CA 5AI9A 4HDOB 3P2YA 4Z7NB 1W0KA 3HFRA 2WLTA 4JL8A 1SOVA 4UXIA 3VR4A 1YCDA 5H82A 1QJ4A 3X2QC 2ZFUA 2F8LA 3RKRA 1HK7A 4RZQA 1R3LC 2FSPA 1J5XA 4U7JA 4HNTA 1HTBA 1L5HA 1QHFA 4CMEA 3T5MA 2E76B 4CS4A 1S2LA 2NACA 1G63A 4IXWA 1PTJA 1F38A 1P0CA 2CNWA 4IZOA 4YMTA 4XLLA 1EDBA 4B4WA 1KI2A 3FGPA 1J2JA 3PUIA 3JTEA 3PU6A 521PA 3N0RA 3WRYC 1JNXX 4BGIA 4FMPA 1WMAA 2A9KA 4R3UC 2H2GA 2ALEA 3DLPX 1DG9A 3WQQA 3M34A 5E8RA 1GNSA 5HFJA 3H2IA 1JWAB 4ZRNA 4HSGA 3AB3A 2YHUA 4NCAA 4PV7A 1NQWA 2H2IA 1OV4A 1NBME 3GDHA 5KDOA 1RE1A 3RQIA 1BX1A 3CCSV 1Q0SA 4PTLA 4B3RO 1BHBA 3ZV7A 3H4VA 3N2GB 4TRJA 2FMFA 1UPAA 1KJ9A 1JEEA 3UQ8A 4E4TA 4KR2A 4MV3A 1KAQA 2WV7A 2C2OA 1HZZA 4BLPA 5BVHB 5ELLA 4EGFA 1MGPA 1PG5A 4DM7A 4K28A 1JTVA 1DX6A 4KKXB 2W9XA 2FUEA 4E3ZA 1NUQA 4U7PB 3SC2A 1FMLA 1I3CA 1DX9A 2P5YA 4MRNA 2GTAA 1ND6A 1YQDA 2Q3HA 3JYHA 3OZ7A 4H4EA 1RWNA 4NLLA 2GBOA 1NBHA 1ODLA 3ZUGA 2AS0A 5H02A 2WWIA 4BJ3A 2A2ZA 2X41A 1F23A 1IY8A 1VL0A 4U6QA 1T8YA 2WWVD 3SJQC 6AT1A 2YI8A 1H2KA 1PLKA 4AQYB 1XJWA 3CLUC 4N49A 2H2DA 4FX5A 3TZKA 1FLDA 1QPZA 1U3DA 4EEQA 4PFJA 3CMAF 3P4UA 4OX9B 2WJ4A 1ZNXA 1US6A 3U9TA 1K6XA 4MULA 3HC7A 3S1SA 5I5EA 1NJGA 3T1YO 1J0CA 3K0GA 1E6CA 1K27A 2XAJA 1AGNA 1NUHA 1JHOA 1U7PA 3AKZA 3HYTA 2VS1A 3KV3O 2Z1DA 1WXGA 4EI2A 1JBEA 1UMDA 2GD2A 1KFBB 3CVOA 3PHCA 2JFYA 4G26A 4D4GA 2VCEA 1DVRA 3UATA 3BK1A 3UYLA 4N23A 1REQA 4CDGA 1NOKA 1KVUA 3S8MA 4DV4B 2LDXA 1S89A 2WF7A 4EWLA 1CK4A 4MVSA 2PRYA 2JB9A 2Q5CA 4BWGA 5LMNB 1WNFA 4NE9A 2B33A 4ZCIA 3LP8A 1O0BA 4OBEA 3PJRA 3RJ9A 3ZNQA 4UNNA 1Q11A 4F7DA 1D6NA 3L77A 1E0AA 2JAWA 1XNHA 5BMVA 2BFDA 3MJVA 2JVIA 1JA1A 4MKXA 4C6TB 1RYBA 4CH5A 4GAEA 4OJTA 4WN9A 1VCIA 2Y0DA 4DA8A 3HKEA 4AJLA 1FRZA 2X3YA 1V35A 1V5WA 3R7NA 3RSGA 3WYDA 2MT9A 4DG8A 1LTQA 1Z6AA 5LXTF 4RO2A 5FPKA 1XMOB 5DCWA 3EEOA 4IDQA 1R73A 3JQDA 3BCSA 4XE5A 3QX9A 2V6GA 3LXRA 121PA 2PRKA 3AX6A 1ORRA 4Q4JA 4Q1AA 3V7QA 2A0KA 3LUCA 1VQ9F 3K53A 2F9LA 3H1JH 1OT5A 1KEUA 4G88A 1ZHFA 4E5SA 3N4ZA 4X95A 2OCDA 3E4DA 3UAZA 1TTHA 1Q0ZA 4NZOA 1ZDMA 1WUJS 4H0LB 5B12A 2Z8YA 2W2KB 1S5HC 3I0MA 1BGYH 4YDSA 3A6PC 3BWEA 1THZA 1ICEA 3A2KA 1IE3A 3T06B 3C3XA 1Y6FA 4BNYA 4EECA 1QVGF 1XHEA 2HN9A 1JHYA 2WTMA 2P9EA 1BWSA 2XRFA 1ES9A 3MS7A 1AJNA 4CU2A 4AK9A 3CCEV 3D3NA 1QU2A 1B3QA 4QDUA 2FUNB 4BX3A 4TXNA 2PSHA 3SDSA 1HDIA 2VJKA 5IDYA 1ZL8B 1Y5RA 3HB3B 1JP7A 4PX5A 3UJ9A 2B5WA 1XRNA 2JFFA 4LDNA 4ZT5A 4KPUB 3DCIA 3MYRA 1LSOA 1XHLA 3VOUA 4O2LA 2SICE 3F3SA 4A5SA 1LSUA 5FUQA 1M6NA 1DDOA 3GBPA 3BJMA 5CTAA 3SSOA 3PJEA 4IMPA 3AVYA 3WK8A 3FBTA 1WPGA 4WOJA 2NWQA 3U80A 1P77A 2TRSB 3GQVA 3N2GA 3RN4A 2VHUA 1QXSA 2RKOA 4BVHA 4WCDA 4CLXA 1SO8A 2GBFA 4H15A 4J0QA 3I2FA 3QUSA 1ECPA 5BVHA 4KXLA 5K3DA 2V97A 2QDOA 3GVMA 3SE0A 1DU4A 3TG2A 2ZDIC 1C80A 1WMBA 2BSAA 4D5EA 3DAYA 1P60A 1LV8A 1G3RA 3VDRA 1WHSA 3R0QA 4AKHA 2ZBUA 3SBXA 4DJAA 2ZAYA 4XYGA 1F3LA 4RIHA 4W5OA 2HJFC 3OSUA 1Z2OX 2ZT6A 2MYPA 4BNVA 2AEJA 2AX3A 4UTXA 2D7DA 4DK1A 3KVOA 4JI1B 2EP8A 3VO9A 3RT1A 1IULA 5KDLA 2IV3A 2P77A 4K6MA 1KBZA 3I56V 4WNAA 1H9AA 1AB5A 2VN8A 3LY8A 3FDXA 2QL5A 1Q21A 3OP1A 4MUMA 3VHXA 3VPHA 1LJ8A 4GX5A 2YWEA 1BCRB 1YTFD 1FW6A 1W1IA 4A6XA 4JYCA 3LTEA 4B2PA 3W6OA 4C4ZA 2AUNA 4RA9B 3KZ1E 3A10A 4IUCS 2IQ5A 4P81A 1G4HA 3GZNB 4IYRA 1KWGA 2CBGA 3K2QA 1RM4A 4Z4EA 2X9NA 2HR1A 1U65A 2GF9A 2R44A 3KCQA 4F86A 1UFIA 1Z4LA 1RM3A 2Z09A 2DC1A 4MB2A 4PEVA 3BERA 4IG4A 4F96A 2RGNC 3VGPA 2HIGA 5ERXA 1K9MH 5TEWA 4NYIR 3N2KB 1XTTA 4DQDA 4H7PA 3AJ8A 4I9FA 4IX1A 2EYUA 3SQNA 4RK0A 4QODA 4DIMA 3F7OA 2UAGA 1R4NB 2CF6A 1CY6A 5BSRA 3BCRA 4G41A 2J0UB 5EERA 4AKTA 1IRXA 2IM9A 4HWOA 5C3UA 5E2BA 4M8KA 3RR2A 4ZVLA 4DYVA 4TWJA 1WV1A 4QJ3A 1Z28A 3ISVA 4W1PA 3PEYA 4M2LA 4UNPA 5GANK 2VATA 3PHLA 4L15A 1K4MA 4AWBA 3CF6R 3LVRE