1K9MH

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k9mH00
1VQNF 1SDSA 2KTVA 2KTUA 4TZZA 3RA5A 2CZWA 5FLXM 5DCVA 3VMFB 2I6DA 5IT9M 1YI2F 1YHQF 3NVIB 3JCMM 1JJ2F 1YJNF 3CD6F 3SIVA 3I55F 1IPAA 3CG6A 1S72F 1NJIH 2BO1A 3V7EA 2OZBA 2LBWA 3I56F 3G4SF 3CC2F 3V7QA 2OHWA 3CCEF 3VI6A 3CCUF 3ON1A 4X3MA 1GO0A 4C4WC 5EO3A 2ALEA 3SIUA 1X52A 3N4ZA 1QVGF 3E1YA 1W2BF 3WXMB 1K9MH 1X7PA 1VQ5F 1RA4A 1PXWA 3CPWF 3CC7F 1W3EX 3AGKA 3OBWA 5A2QM 2QA4F 1T0KB 5G4UC 3CMEF 1QVFF 1GZ0A 3LWVC 4X3LA 1Q82H 5FJ4C 3CCLF 4NUTA 1GO1A 3LWRC 3NVKE 1CN7A 1VQOF 2WALA 1VQ9F 1YJ9F 2OTJF 5EWRA 1VQ6F 3CMAF 1Q81H 1W42A 3LWQC 2QI2A 1ZWZA 2VGMA 3JAMM 3FFMA 1YIJF 5GINC 2VGNA 1NMUB 3LFOA 1YITF 2AIFA 2KG4A 5G4VC 2JNBA 3N4YA 3RA6A 3CPQA 3PAFA 3CC4F 1VQPF 5GANK 1XBIA 1CK2A 3OBYA 1YJWF 1X7OA 1M1KH 3NMUC 1N8RH 3HJWC 3O85A 1DT9A 2LBXA 1VQ4F 1KC8H 2FC3A 3G6EF 3CCJF 1E7KA 3G71F 3CCMF 1M90H 1H7MA 3J7AR 3CCSF 3MCAB 1VQKF 3J81M 1KQSF 3CCQF 3CXCF 3HAXD 3J80M 3OW2F 3GYQA 1W41A 3LWPC 1Q86H 3CCRF 1VQ8F 3NK6A 2HVYD 1W40A 1VQLF 1KD1H 3E20B 1RLGA 4LCKA 3NK7A 5GIOC 5GIPC 4BY9D 2QEXF 2OTLF 4BW0B 5GAPK 1VQ7F 3PLAC 3LWOC 1VQMF 1K73H 3IR9A 3CCVF 1K8AH 1Q7YH
chains in the Genus database with same CATH superfamily
4HNAA 1VQNF 1X25A 3V3TA 5CB4A 5HY1A 3RA5A 2HS0A 3JATA 3I3FA 3VMFB 5CA1A 2IAFA 4C8EA 5IT9M 3S0YA 1RQ2A 1OAPA 1U43A 1YHQF 3K14A 4E6EA 4EI9A 3S02A 3SIVA 2R6R1 2PMPA 1IPAA 3CG6A 4BT7A 1S72F 5MN4A 4ZOLA 1UFYA 2ZOVA 4IIJB 3G4SF 1OFUA 1VHAA 2Z1FA 3QUWA 3V7QA 4I50B 3VI6A 5GONB 3CCUF 3T80A 4X3MA 3L7QA 1GO0A 5EO3A 1W57A 2GLZA 4IHJA 1QVGF 3VOBA 3RYIB 1VQ5F 4EB6B 2LBTA 4BVRA 4DXDA 3WGMA 5KMGA 3RYCB 3CC7F 4BT4A 3ZOPA 5J2UA 1RQ7A 3CMEF 4C8GA 3LWVC 1XV2A 1UI9A 2YYEA 1TVKA 5FJ4C 1TUBB 1W59A 1GO1A 5BMVB 4X1IB 2MQEA 5KX5B 1JFFA 2AMTA 1QAHA 3CB2A 4YJ3A 2HS3A 3JVHA 1VQ6F 2OTJF 1J7HA 5LP6C 3UT5B 3M4SA 3LWQC 4BVSA 3MBMA 1IV2A 2CHTA 3S03A 1YIJF 5GINC 1NMUB 3WPWA 3WGJA 3JAWB 4O2AB 1YITF 1SZQA 2KG4A 1SA0B 2JNBA 2BTUA 3CPQA 2Z01A 3E22A 4X1KA 1VQPF 3DC2A 1QU9A 3JARA 4HNAB 4B62A 3EORA 1CK2A 5GANK 1YJWF 3NMUC 2IQQA 2YXZA 2HP0A 2W8BC 5LOVB 3MDOA 5CA1B 4O2BA 1NQ3A 3ESJA 1QD9A 4WBNA 4TV9B 5HY2A 1M90H 3J7AR 3HKBA 3RYHA 4RQOA 1GX1A 5EIBD 3WGKA 4ZOLB 1KQSF 3HAXD 5IYZA 3GYQA 1W41A 3V4DA 2HS4A 4ZHYB 2HVYD 5IJ0A 2HRUA 4ERHA 4IHJB 4NWOB 4LCKA 3NK7A 5GIOC 2QEXF 4O4JA 1VQ7F 5LYJA 4EI8A 1VQMF 5C8YA 3C9UA 4NQ3A 3FPIA 5J2UB 2VXYA 1U40A 1SDSA 4O4HA 5HP8A 2KTVA 4O4IA 2CZWA 5FLXM 5EIBC 1H47A 5J2TA 3IMPA 5HY0A 3F0FA 5ITZA 1YJNF 1JD1A 3CD6F 3I55F 3RE3A 3WJQA 2BTOA 2OZBA 5LA6A 1H48A 1Q8RA 3HTNA 2OHWA 3KJKA 2AIZP 1VH8A 4C4WC 3D01A 4LNUA 3SIUA 3KJJA 3E1YA 5EZYA 2Q1YA 3U0OA 2VAPA 1T0AA 3HKDA 4X1KB 1PXWA 2VAMA 3OBWA 2QA4F 3K12A 4I4TB 3IKEA 1COMA 2RB9A 3KIZA 5EYPA 5FNVA 1Q82H 2N48A 3HKCA 4I55A 3RYFA 3JASA 2RHLA 3NVKE 3ZP4A 3F0GA 2WALA 5IYZB 1YJ9F 1VQ9F 5CA0A 2UYNB 5B8FA 4ZI7B 3Q8HA 3CMAF 1Q81H 3IKFA 1FNKA 2QI2A 3LMEA 4U3JB 5IJ0B 2ZVZA 4BT2A 2VGMA 3JAMM 4G4VA 5JCOC 2NMUA 3MQWA 3GTZA 4O4JB 5EAZA 5LXTA 5G4VC 2RHHA 3IEWA 1VQVA 1M1KH 3OBYA 3O85A 2HX0A 1FNJA 3G6EF 3JAKA 4B45A 4ZHQA 5J2TB 5JVDA 3CCSF 5IJ9A 1VQKF 4YJ2A 4KWEA 4F6RA 5LP6A 3CXCF 1W5FA 3LWPC 1Q86H 1VQ8F 1U3PA 3NK6A 4ZHVA 1W40A 1KD1H 3ERNA 3TD3A 1PF5A 2F9ZC 2LCAA 2H8EA 3BYQA 1VK3A 5GAPK 1Z5VA 3P4EA 3PLAC 1FFXA 2ZODA 1U3LA 3HKEA 5EB1B 5CB4B 5HXUA 3JATB 4C82A 2R751 5JH7A 3C9SA 2CVLA 3WJRA 3DDNA 2VAWA 1RLUA 2I6DA 5EYPB 4RHAA 3NVIB 4TV8A 4I55B 2BO1A 3V7EA 4X20A 2EWCA 3I56F 2PHNA 2HRYA 3P10A 2FGYA 3ON1A 4DRXA 5KMGB 4O4LA 1YGYA 3VCZA 3N4ZA 2GZLA 4BVQA 3WXMB 4IIJA 1FSZA 4ZHWA 2DT4A 4C81A 1X7PA 1W5AA 4M8IA 4I50A 1RA4A 2ZAUA 1ONIA 3ZP7A 3VYUC 1TVKB 3OONA 3RYIA 1KNKA 2Q1XA 4FFBA 1IV4A 5HXZA 1T0KB 1QVFF 3P0ZA 1GZ0A 3JAKB 1JFFB 4X3LA 3C9TA 1IV1A 3RYCA 3GHZA 4ZHQB 2G9IA 4YJ3B 2GVIA 5IJ9B 3M1XA 4YJ2B 4F6RB 1CN7A 1VQOF 3KE1A 4G4XA 5LP6B 5EWRA 2CSLA 2UYKA 1W42A 4X1IA 5KX5A 3I7TA 3CYPB 3IEQA 3E22B 3N2KA 2VGNA 3LFOA 3JARB 3WJPA 3UT5A 4R40B 4X1YA 5JQGA 3D54A 2HP0B 2OTMA 3N4YA 3RA6A 3CC4F 5MN6A 4G88A 4G4WA 1R1MA 3VTIC 1XBIA 3JAWA 3LYBA 4O2BB 1X7OA 4O2AA 4WBNB 4TUYA 1N8RH 1W5EA 2DYYA 1DT9A 3HKBB 2LBXA 2RHJA 3RYHB 1VQ4F 1KC8H 1IV3A 4B5CA 1E7KA 2CW4A 3CCMF 5LOVA 4TV8B 3B6NA 3J81M 3VYTC 2I6RA 3F0EA 3OW2F 4X20B 4TV9A 4BT6A 3CYQA 3K0TA 5EB0A 2H8CA 3N2GA 5LYJB 5JCOA 3E20B 4DRXB 4O4LB 5C8YB 5GIPC 3VYSC 4BY9D 4XCQA 3TD4A 2P6YA 4O4HB 3C9RA 3LWOC 1K73H 3IR9A 3C8LA 4O4IB 3CCVF 2ZVYA 1Q7YH 4FFBB 3FD6A 3ZO8A 5ITZB 2KTUA 4TZZA 5DCVA 2L26A 1YI2F 3WGLA 5LA6B 3JCMM 1JJ2F 3FBAA 4G4YA 2HQSC 2H6LA 1NJIH 4LNUB 4EI7A 3VO8A 3HWUA 3JALA 2LBWA 4U39A 3WPXA 5EZYB 3VOAA 3F0DA 3K2XA 3WGNA 3QTYA 5HP7A 4BT5A 3CC2F 2UZHA 3CCEF 3HKDB 3N2KB 2Z1EA 3S06A 4BT3A 1CLIA 2ALEA 3TD5A 1X52A 1K9MH 1W2BF 4X1YB 3R0PA 3S0HA 5JQGB 1W581 5AVMA 1KNJA 3CPWF 5FNVB 1W3EX 1XHOA 3AGKA 4TUYB 5A2QM 2CHSA 1JY8A 3HKCB 5G4UC 3RYFB 3JASB 2IG8A 4ZK7A 3FD5A 3M84A 5CA0B 3CCLF 4NUTA 2QTPA 2CWJA 2Z1TA 3LWRC 4I4TA 2UYJA 1JN1A 2UYPA 3N2GB 1ZWZA 4BVTA 5LXTB 3FFMA 5GONA 2UYNA 4ZI7A 1W55A 3ELCA 4U3JA 2AIFA 3PAFA 4EB6A 3F6MA 4G4ZA 3MCQA 1XRGA 2RHOA 3LDTA 2KGWA 3HJWC 5JVDB 2FC3A 3CCJF 2HP3A 3G71F 4PWTA 2ZF8A 1H7MA 1TUBA 3VIUA 1Z5WA 2B33A 3MCAB 4C8IA 5BMVA 2K1SA 1DBFA 1W5BA 3CCQF 3KHNA 3J80M 5HY4A 2BTQB 3JALB 3CCRF 1ODEA 5MN5A 1FFXB 3HKEB 1VQLF 1RLGA 3QHDA 2V9YA 2OTLF 4BW0B 5JH7B 1SA0A 3S0WA 5HWEA 4B46A 1YQNA 3D00A 1K8AH 2Z1UA
chains in the Genus database with same CATH topology
1VQNF 4NQ3A 3V3TA 1SDSA 2KTVA 2KTUA 5HY1A 4TZZA 3RA5A 2CZWA 5FLXM 5DCVA 3VMFB 2I6DA 5IT9M 1YI2F 1YHQF 3NVIB 5HY0A 3JCMM 1JJ2F 4EI9A 1YJNF 3CD6F 3SIVA 3I55F 1IPAA 3CG6A 1S72F 1NJIH 2BO1A 3V7EA 4EI7A 2OZBA 2LBWA 3I56F 3G4SF 3CC2F 3V7QA 2OHWA 3CCEF 3VI6A 3CCUF 2FGYA 4X3MA 3ON1A 4C4WC 1GO0A 5EO3A 2ALEA 2GLZA 3SIUA 4BVQA 1X52A 3N4ZA 1QVGF 3E1YA 1W2BF 3WXMB 1K9MH 1X7PA 1VQ5F 1RA4A 4BVRA 1PXWA 3CPWF 3CC7F 1W3EX 3AGKA 3OBWA 5A2QM 2QA4F 5HXZA 1T0KB 5G4UC 3CMEF 1QVFF 1GZ0A 3LWVC 4X3LA 1Q82H 5FJ4C 3CCLF 4NUTA 1GO1A 3LWRC 3NVKE 1CN7A 1VQOF 2WALA 1VQ9F 1YJ9F 2OTJF 5EWRA 1VQ6F 3CMAF 1Q81H 1W42A 3LWQC 2QI2A 1ZWZA 4BVSA 4BVTA 2VGMA 3JAMM 3FFMA 1YIJF 5GINC 2VGNA 1NMUB 3LFOA 1YITF 2AIFA 2KG4A 5G4VC 2JNBA 3N4YA 3RA6A 3CPQA 3PAFA 3CC4F 1VQPF 5GANK 1XBIA 1CK2A 3OBYA 1YJWF 1X7OA 1M1KH 3NMUC 1N8RH 3HJWC 3O85A 1DT9A 2LBXA 1VQ4F 1KC8H 2FC3A 3G6EF 3CCJF 1E7KA 3G71F 3CCMF 5HY2A 1M90H 1H7MA 3J7AR 3CCSF 3MCAB 1VQKF 3J81M 1KQSF 3CCQF 3CXCF 3HAXD 3J80M 3OW2F 3GYQA 1W41A 5HY4A 3LWPC 1Q86H 3CCRF 1VQ8F 3NK6A 2HVYD 1W40A 1VQLF 1KD1H 3E20B 2F9ZC 1RLGA 4LCKA 3NK7A 5GIOC 5GIPC 4BY9D 4XCQA 2QEXF 2OTLF 4BW0B 5GAPK 1VQ7F 3PLAC 4EI8A 3LWOC 1VQMF 1K73H 3IR9A 5HWEA 5HXUA 3D00A 3CCVF 1K8AH 1Q7YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN F;  1SDS A;  2KTV A;  2KTU A;  4TZZ A;  3RA5 A;  2CZW A;  5FLX M;  5DCV A;  3VMF B;  2I6D A;  5IT9 M;  1YI2 F;  1YHQ F;  3NVI B;  3JCM M;  1JJ2 F;  1YJN F;  3CD6 F;  3SIV A;  3I55 F;  1IPA A;  3CG6 A;  1S72 F;  1NJI H;  2BO1 A;  3V7E A;  2OZB A;  2LBW A;  3I56 F;  3G4S F;  3CC2 F;  3V7Q A;  2OHW A;  3CCE F;  3VI6 A;  3CCU F;  3ON1 A;  4X3M A;  1GO0 A;  4C4W C;  5EO3 A;  2ALE A;  3SIU A;  1X52 A;  3N4Z A;  1QVG F;  3E1Y A;  1W2B F;  3WXM B;  1K9M H;  1X7P A;  1VQ5 F;  1RA4 A;  1PXW A;  3CPW F;  3CC7 F;  1W3E X;  3AGK A;  3OBW A;  5A2Q M;  2QA4 F;  1T0K B;  5G4U C;  3CME F;  1QVF F;  1GZ0 A;  3LWV C;  4X3L A;  1Q82 H;  5FJ4 C;  3CCL F;  4NUT A;  1GO1 A;  3LWR C;  3NVK E;  1CN7 A;  1VQO F;  2WAL A;  1VQ9 F;  1YJ9 F;  2OTJ F;  5EWR A;  1VQ6 F;  3CMA F;  1Q81 H;  1W42 A;  3LWQ C;  2QI2 A;  1ZWZ A;  2VGM A;  3JAM M;  3FFM A;  1YIJ F;  5GIN C;  2VGN A;  1NMU B;  3LFO A;  1YIT F;  2AIF A;  2KG4 A;  5G4V C;  2JNB A;  3N4Y A;  3RA6 A;  3CPQ A;  3PAF A;  3CC4 F;  1VQP F;  5GAN K;  1XBI A;  1CK2 A;  3OBY A;  1YJW F;  1X7O A;  1M1K H;  3NMU C;  1N8R H;  3HJW C;  3O85 A;  1DT9 A;  2LBX A;  1VQ4 F;  1KC8 H;  2FC3 A;  3G6E F;  3CCJ F;  1E7K A;  3G71 F;  3CCM F;  1M90 H;  1H7M A;  3J7A R;  3CCS F;  3MCA B;  1VQK F;  3J81 M;  1KQS F;  3CCQ F;  3CXC F;  3HAX D;  3J80 M;  3OW2 F;  3GYQ A;  1W41 A;  3LWP C;  1Q86 H;  3CCR F;  1VQ8 F;  3NK6 A;  2HVY D;  1W40 A;  1VQL F;  1KD1 H;  3E20 B;  1RLG A;  4LCK A;  3NK7 A;  5GIO C;  5GIP C;  4BY9 D;  2QEX F;  2OTL F;  4BW0 B;  5GAP K;  1VQ7 F;  3PLA C;  3LWO C;  1VQM F;  1K73 H;  3IR9 A;  3CCV F;  1K8A H;  1Q7Y H; 
#chains in the Genus database with same CATH topology
 4HNA A;  1VQN F;  1X25 A;  3V3T A;  5CB4 A;  5HY1 A;  3RA5 A;  2HS0 A;  3JAT A;  3I3F A;  3VMF B;  5CA1 A;  2IAF A;  4C8E A;  5IT9 M;  3S0Y A;  1RQ2 A;  1OAP A;  1U43 A;  1YHQ F;  3K14 A;  4E6E A;  4EI9 A;  3S02 A;  3SIV A;  2R6R 1;  2PMP A;  1IPA A;  3CG6 A;  4BT7 A;  1S72 F;  5MN4 A;  4ZOL A;  1UFY A;  2ZOV A;  4IIJ B;  3G4S F;  1OFU A;  1VHA A;  2Z1F A;  3QUW A;  3V7Q A;  4I50 B;  3VI6 A;  5GON B;  3CCU F;  3T80 A;  4X3M A;  3L7Q A;  1GO0 A;  5EO3 A;  1W57 A;  2GLZ A;  4IHJ A;  1QVG F;  3VOB A;  3RYI B;  1VQ5 F;  4EB6 B;  2LBT A;  4BVR A;  4DXD A;  3WGM A;  5KMG A;  3RYC B;  3CC7 F;  4BT4 A;  3ZOP A;  5J2U A;  1RQ7 A;  3CME F;  4C8G A;  3LWV C;  1XV2 A;  1UI9 A;  2YYE A;  1TVK A;  5FJ4 C;  1TUB B;  1W59 A;  1GO1 A;  5BMV B;  4X1I B;  2MQE A;  5KX5 B;  1JFF A;  2AMT A;  1QAH A;  3CB2 A;  4YJ3 A;  2HS3 A;  3JVH A;  1VQ6 F;  2OTJ F;  1J7H A;  5LP6 C;  3UT5 B;  3M4S A;  3LWQ C;  4BVS A;  3MBM A;  1IV2 A;  2CHT A;  3S03 A;  1YIJ F;  5GIN C;  1NMU B;  3WPW A;  3WGJ A;  3JAW B;  4O2A B;  1YIT F;  1SZQ A;  2KG4 A;  1SA0 B;  2JNB A;  2BTU A;  3CPQ A;  2Z01 A;  3E22 A;  4X1K A;  1VQP F;  3DC2 A;  1QU9 A;  3JAR A;  4HNA B;  4B62 A;  3EOR A;  1CK2 A;  5GAN K;  1YJW F;  3NMU C;  2IQQ A;  2YXZ A;  2HP0 A;  2W8B C;  5LOV B;  3MDO A;  5CA1 B;  4O2B A;  1NQ3 A;  3ESJ A;  1QD9 A;  4WBN A;  4TV9 B;  5HY2 A;  1M90 H;  3J7A R;  3HKB A;  3RYH A;  4RQO A;  1GX1 A;  5EIB D;  3WGK A;  4ZOL B;  1KQS F;  3HAX D;  5IYZ A;  3GYQ A;  1W41 A;  3V4D A;  2HS4 A;  4ZHY B;  2HVY D;  5IJ0 A;  2HRU A;  4ERH A;  4IHJ B;  4NWO B;  4LCK A;  3NK7 A;  5GIO C;  2QEX F;  4O4J A;  1VQ7 F;  5LYJ A;  4EI8 A;  1VQM F;  5C8Y A;  3C9U A;  4NQ3 A;  3FPI A;  5J2U B;  2VXY A;  1U40 A;  1SDS A;  4O4H A;  5HP8 A;  2KTV A;  4O4I A;  2CZW A;  5FLX M;  5EIB C;  1H47 A;  5J2T A;  3IMP A;  5HY0 A;  3F0F A;  5ITZ A;  1YJN F;  1JD1 A;  3CD6 F;  3I55 F;  3RE3 A;  3WJQ A;  2BTO A;  2OZB A;  5LA6 A;  1H48 A;  1Q8R A;  3HTN A;  2OHW A;  3KJK A;  2AIZ P;  1VH8 A;  4C4W C;  3D01 A;  4LNU A;  3SIU A;  3KJJ A;  3E1Y A;  5EZY A;  2Q1Y A;  3U0O A;  2VAP A;  1T0A A;  3HKD A;  4X1K B;  1PXW A;  2VAM A;  3OBW A;  2QA4 F;  3K12 A;  4I4T B;  3IKE A;  1COM A;  2RB9 A;  3KIZ A;  5EYP A;  5FNV A;  1Q82 H;  2N48 A;  3HKC A;  4I55 A;  3RYF A;  3JAS A;  2RHL A;  3NVK E;  3ZP4 A;  3F0G A;  2WAL A;  5IYZ B;  1YJ9 F;  1VQ9 F;  5CA0 A;  2UYN B;  5B8F A;  4ZI7 B;  3Q8H A;  3CMA F;  1Q81 H;  3IKF A;  1FNK A;  2QI2 A;  3LME A;  4U3J B;  5IJ0 B;  2ZVZ A;  4BT2 A;  2VGM A;  3JAM M;  4G4V A;  5JCO C;  2NMU A;  3MQW A;  3GTZ A;  4O4J B;  5EAZ A;  5LXT A;  5G4V C;  2RHH A;  3IEW A;  1VQV A;  1M1K H;  3OBY A;  3O85 A;  2HX0 A;  1FNJ A;  3G6E F;  3JAK A;  4B45 A;  4ZHQ A;  5J2T B;  5JVD A;  3CCS F;  5IJ9 A;  1VQK F;  4YJ2 A;  4KWE A;  4F6R A;  5LP6 A;  3CXC F;  1W5F A;  3LWP C;  1Q86 H;  1VQ8 F;  1U3P A;  3NK6 A;  4ZHV A;  1W40 A;  1KD1 H;  3ERN A;  3TD3 A;  1PF5 A;  2F9Z C;  2LCA A;  2H8E A;  3BYQ A;  1VK3 A;  5GAP K;  1Z5V A;  3P4E A;  3PLA C;  1FFX A;  2ZOD A;  1U3L A;  3HKE A;  5EB1 B;  5CB4 B;  5HXU A;  3JAT B;  4C82 A;  2R75 1;  5JH7 A;  3C9S A;  2CVL A;  3WJR A;  3DDN A;  2VAW A;  1RLU A;  2I6D A;  5EYP B;  4RHA A;  3NVI B;  4TV8 A;  4I55 B;  2BO1 A;  3V7E A;  4X20 A;  2EWC A;  3I56 F;  2PHN A;  2HRY A;  3P10 A;  2FGY A;  3ON1 A;  4DRX A;  5KMG B;  4O4L A;  1YGY A;  3VCZ A;  3N4Z A;  2GZL A;  4BVQ A;  3WXM B;  4IIJ A;  1FSZ A;  4ZHW A;  2DT4 A;  4C81 A;  1X7P A;  1W5A A;  4M8I A;  4I50 A;  1RA4 A;  2ZAU A;  1ONI A;  3ZP7 A;  3VYU C;  1TVK B;  3OON A;  3RYI A;  1KNK A;  2Q1X A;  4FFB A;  1IV4 A;  5HXZ A;  1T0K B;  1QVF F;  3P0Z A;  1GZ0 A;  3JAK B;  1JFF B;  4X3L A;  3C9T A;  1IV1 A;  3RYC A;  3GHZ A;  4ZHQ B;  2G9I A;  4YJ3 B;  2GVI A;  5IJ9 B;  3M1X A;  4YJ2 B;  4F6R B;  1CN7 A;  1VQO F;  3KE1 A;  4G4X A;  5LP6 B;  5EWR A;  2CSL A;  2UYK A;  1W42 A;  4X1I A;  5KX5 A;  3I7T A;  3CYP B;  3IEQ A;  3E22 B;  3N2K A;  2VGN A;  3LFO A;  3JAR B;  3WJP A;  3UT5 A;  4R40 B;  4X1Y A;  5JQG A;  3D54 A;  2HP0 B;  2OTM A;  3N4Y A;  3RA6 A;  3CC4 F;  5MN6 A;  4G88 A;  4G4W A;  1R1M A;  3VTI C;  1XBI A;  3JAW A;  3LYB A;  4O2B B;  1X7O A;  4O2A A;  4WBN B;  4TUY A;  1N8R H;  1W5E A;  2DYY A;  1DT9 A;  3HKB B;  2LBX A;  2RHJ A;  3RYH B;  1VQ4 F;  1KC8 H;  1IV3 A;  4B5C A;  1E7K A;  2CW4 A;  3CCM F;  5LOV A;  4TV8 B;  3B6N A;  3J81 M;  3VYT C;  2I6R A;  3F0E A;  3OW2 F;  4X20 B;  4TV9 A;  4BT6 A;  3CYQ A;  3K0T A;  5EB0 A;  2H8C A;  3N2G A;  5LYJ B;  5JCO A;  3E20 B;  4DRX B;  4O4L B;  5C8Y B;  5GIP C;  3VYS C;  4BY9 D;  4XCQ A;  3TD4 A;  2P6Y A;  4O4H B;  3C9R A;  3LWO C;  1K73 H;  3IR9 A;  3C8L A;  4O4I B;  3CCV F;  2ZVY A;  1Q7Y H;  4FFB B;  3FD6 A;  3ZO8 A;  5ITZ B;  2KTU A;  4TZZ A;  5DCV A;  2L26 A;  1YI2 F;  3WGL A;  5LA6 B;  3JCM M;  1JJ2 F;  3FBA A;  4G4Y A;  2HQS C;  2H6L A;  1NJI H;  4LNU B;  4EI7 A;  3VO8 A;  3HWU A;  3JAL A;  2LBW A;  4U39 A;  3WPX A;  5EZY B;  3VOA A;  3F0D A;  3K2X A;  3WGN A;  3QTY A;  5HP7 A;  4BT5 A;  3CC2 F;  2UZH A;  3CCE F;  3HKD B;  3N2K B;  2Z1E A;  3S06 A;  4BT3 A;  1CLI A;  2ALE A;  3TD5 A;  1X52 A;  1K9M H;  1W2B F;  4X1Y B;  3R0P A;  3S0H A;  5JQG B;  1W58 1;  5AVM A;  1KNJ A;  3CPW F;  5FNV B;  1W3E X;  1XHO A;  3AGK A;  4TUY B;  5A2Q M;  2CHS A;  1JY8 A;  3HKC B;  5G4U C;  3RYF B;  3JAS B;  2IG8 A;  4ZK7 A;  3FD5 A;  3M84 A;  5CA0 B;  3CCL F;  4NUT A;  2QTP A;  2CWJ A;  2Z1T A;  3LWR C;  4I4T A;  2UYJ A;  1JN1 A;  2UYP A;  3N2G B;  1ZWZ A;  4BVT A;  5LXT B;  3FFM A;  5GON A;  2UYN A;  4ZI7 A;  1W55 A;  3ELC A;  4U3J A;  2AIF A;  3PAF A;  4EB6 A;  3F6M A;  4G4Z A;  3MCQ A;  1XRG A;  2RHO A;  3LDT A;  2KGW A;  3HJW C;  5JVD B;  2FC3 A;  3CCJ F;  2HP3 A;  3G71 F;  4PWT A;  2ZF8 A;  1H7M A;  1TUB A;  3VIU A;  1Z5W A;  2B33 A;  3MCA B;  4C8I A;  5BMV A;  2K1S A;  1DBF A;  1W5B A;  3CCQ F;  3KHN A;  3J80 M;  5HY4 A;  2BTQ B;  3JAL B;  3CCR F;  1ODE A;  5MN5 A;  1FFX B;  3HKE B;  1VQL F;  1RLG A;  3QHD A;  2V9Y A;  2OTL F;  4BW0 B;  5JH7 B;  1SA0 A;  3S0W A;  5HWE A;  4B46 A;  1YQN A;  3D00 A;  1K8A H;  2Z1U A; 
#chains in the Genus database with same CATH homology
 1VQN F;  4NQ3 A;  3V3T A;  1SDS A;  2KTV A;  2KTU A;  5HY1 A;  4TZZ A;  3RA5 A;  2CZW A;  5FLX M;  5DCV A;  3VMF B;  2I6D A;  5IT9 M;  1YI2 F;  1YHQ F;  3NVI B;  5HY0 A;  3JCM M;  1JJ2 F;  4EI9 A;  1YJN F;  3CD6 F;  3SIV A;  3I55 F;  1IPA A;  3CG6 A;  1S72 F;  1NJI H;  2BO1 A;  3V7E A;  4EI7 A;  2OZB A;  2LBW A;  3I56 F;  3G4S F;  3CC2 F;  3V7Q A;  2OHW A;  3CCE F;  3VI6 A;  3CCU F;  2FGY A;  4X3M A;  3ON1 A;  4C4W C;  1GO0 A;  5EO3 A;  2ALE A;  2GLZ A;  3SIU A;  4BVQ A;  1X52 A;  3N4Z A;  1QVG F;  3E1Y A;  1W2B F;  3WXM B;  1K9M H;  1X7P A;  1VQ5 F;  1RA4 A;  4BVR A;  1PXW A;  3CPW F;  3CC7 F;  1W3E X;  3AGK A;  3OBW A;  5A2Q M;  2QA4 F;  5HXZ A;  1T0K B;  5G4U C;  3CME F;  1QVF F;  1GZ0 A;  3LWV C;  4X3L A;  1Q82 H;  5FJ4 C;  3CCL F;  4NUT A;  1GO1 A;  3LWR C;  3NVK E;  1CN7 A;  1VQO F;  2WAL A;  1VQ9 F;  1YJ9 F;  2OTJ F;  5EWR A;  1VQ6 F;  3CMA F;  1Q81 H;  1W42 A;  3LWQ C;  2QI2 A;  1ZWZ A;  4BVS A;  4BVT A;  2VGM A;  3JAM M;  3FFM A;  1YIJ F;  5GIN C;  2VGN A;  1NMU B;  3LFO A;  1YIT F;  2AIF A;  2KG4 A;  5G4V C;  2JNB A;  3N4Y A;  3RA6 A;  3CPQ A;  3PAF A;  3CC4 F;  1VQP F;  5GAN K;  1XBI A;  1CK2 A;  3OBY A;  1YJW F;  1X7O A;  1M1K H;  3NMU C;  1N8R H;  3HJW C;  3O85 A;  1DT9 A;  2LBX A;  1VQ4 F;  1KC8 H;  2FC3 A;  3G6E F;  3CCJ F;  1E7K A;  3G71 F;  3CCM F;  5HY2 A;  1M90 H;  1H7M A;  3J7A R;  3CCS F;  3MCA B;  1VQK F;  3J81 M;  1KQS F;  3CCQ F;  3CXC F;  3HAX D;  3J80 M;  3OW2 F;  3GYQ A;  1W41 A;  5HY4 A;  3LWP C;  1Q86 H;  3CCR F;  1VQ8 F;  3NK6 A;  2HVY D;  1W40 A;  1VQL F;  1KD1 H;  3E20 B;  2F9Z C;  1RLG A;  4LCK A;  3NK7 A;  5GIO C;  5GIP C;  4BY9 D;  4XCQ A;  2QEX F;  2OTL F;  4BW0 B;  5GAP K;  1VQ7 F;  3PLA C;  4EI8 A;  3LWO C;  1VQM F;  1K73 H;  3IR9 A;  5HWE A;  5HXU A;  3D00 A;  3CCV F;  1K8A H;  1Q7Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...