1K9MH

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k9mH00
1ZWZA 3CCJF 1QVFF 1W41A 1YJWF 3NVKE 1VQNF 5A2QM 3AGKA 1RLGA 1Q81H 2CZWA 3IR9A 2LBWA 3LFOA 4X3MA 1VQ9F 1IPAA 2QI2A 3E20B 3RA5A 1S72F 1VQ8F 2FC3A 4BY9D 3PLAC 3CCSF 3OBYA 3LWPC 1M90H 2HVYD 5DCVA 1CK2A 2JNBA 3CMEF 1NJIH 3FFMA 1YJNF 1YI2F 1VQ4F 2AIFA 1N8RH 3NVIB 3LWOC 1SDSA 1VQMF 1X7OA 5GANK 1GO1A 3G4SF 2QA4F 1Q86H 1YITF 1KD1H 3CXCF 1JJ2F 3CC4F 3LWQC 5G4UC 1W40A 2ALEA 3LWRC 3CPWF 2OTLF 3VI6A 4BW0B 2LBXA 2VGMA 1K73H 1KQSF 1KC8H 1X7PA 3V7EA 3V7QA 2OZBA 1YIJF 5GINC 4LCKA 3G71F 4X3LA 1VQOF 3HAXD 2KTUA 1DT9A 1NMUB 5GIOC 3WXMB 3NK6A 3LWVC 3CC7F 2QEXF 2WALA 1RA4A 3GYQA 1VQPF 3SIVA 3MCAB 3CCMF 5FJ4C 3J81M 5G4VC 1M1KH 3OBWA 1YJ9F 5GAPK 3J80M 1VQKF 2BO1A 3CMAF 3I55F 2KG4A 3N4ZA 5EWRA 1X52A 3J7AR 3SIUA 1Q82H 3CG6A 1E7KA 3I56F 3CCQF 3ON1A 3CCLF 3NK7A 1YHQF 3RA6A 1W3EX 1VQ5F 3HJWC 1GZ0A 1GO0A 4C4WC 3O85A 1CN7A 1W2BF 3CC2F 1K8AH 3CPQA 3CD6F 2I6DA 1H7MA 5GIPC 4TZZA 3JCMM 3CCEF 1VQLF 3PAFA 3JAMM 1VQ6F 1Q7YH 5EO3A 3CCVF 4NUTA 3N4YA 3CCUF 5FLXM 1K9MH 3VMFB 2VGNA 1W42A 3E1YA 3G6EF 1T0KB 2OHWA 3NMUC 1QVGF 2OTJF 3CCRF 2KTVA 1PXWA 1VQ7F 5IT9M 3OW2F 1XBIA
chains in the Genus database with same CATH superfamily
1RLUA 5B8FA 1QVFF 1W41A 3C9RA 5GONB 3S03A 3NVKE 4O2AA 5KX5A 1VK3A 3D01A 1RLGA 5EYPB 5CA0B 2CZWA 1SA0A 3RYCB 3Q8HA 3WGJA 3M84A 4X1YB 3JAWA 2QI2A 2RHLA 3RA5A 2DT4A 5IJ0A 1S72F 2UYKA 3CCSF 5CA1B 3N2GA 1Z5WA 1M90H 4HNAA 4BT6A 3KIZA 1YI2F 3MCQA 2HRYA 3LWOC 1VQMF 2RB9A 5EZYA 4M8IA 1GO1A 3WJQA 4TV9B 4ZK7A 1YITF 3VO8A 1KD1H 2GLZA 5J2TB 3JARB 4ZHQB 4F6RA 1U3PA 5G4UC 3JALB 2OTLF 3DDNA 5ITZA 3CPWF 1IV3A 2CWJA 4O4HB 1K73H 4O4LB 3K14A 3JARA 3V7QA 4X1IB 2OZBA 4U3JA 5GINC 4EI7A 5JCOC 1Z5VA 4BT3A 2Q1YA 1DBFA 1ONIA 3ERNA 3JATA 3NK6A 4X1IA 3LWVC 3R0PA 5JH7B 1COMA 3WPXA 1RA4A 3F0DA 3J81M 2IAFA 1M1KH 3JAKA 3S06A 2B33A 4IHJB 3FD6A 5LOVB 4BVSA 2HP0A 2H8CA 4TV9A 4U39A 5EWRA 3N4ZA 4X20A 3GTZA 4C8EA 4ZHVA 4YJ3B 5HP8A 4X20B 2BTOA 3RA6A 3K2XA 1GX1A 1GO0A 4X1KA 3WGKA 4YJ2B 5LP6A 4C4WC 4YJ3A 2CHTA 5GONA 5J2UA 5HY1A 2RHHA 2I6RA 2AIZP 3D54A 1PF5A 2HRUA 1VQVA 3S0HA 1IV2A 1U40A 2VXYA 4ZI7B 1H7MA 5GIPC 1ODEA 5FNVB 1JD1A 3KE1A 3HKBA 4R40B 1VQ6F 1H48A 3ESJA 5KMGA 1QU9A 5FLXM 1K9MH 1KNKA 2N48A 2VGNA 1W42A 3CB2A 4I4TB 2HS3A 3QUWA 1CLIA 3BYQA 3VYTC 4C8IA 5JVDA 4O4IB 3WJPA 1J7HA 2W8BC 1QD9A 3V3TA 1PXWA 2MQEA 2Q1XA 4E6EA 3OW2F 1ZWZA 3CCJF 2IG8A 3ZP4A 4F6RB 3ZO8A 3B6NA 4O2BB 3D00A 1U43A 1SZQA 4B62A 4TV8B 3I3FA 5A2QM 2BTUA 1VQNF 3C8LA 3TD3A 2R6R1 1Q81H 2CSLA 2YYEA 4U3JB 2LBWA 2Z1FA 3LFOA 4O2BA 4X3MA 5HWEA 3KJKA 2FC3A 1SA0B 3OBYA 3KJJA 1CK2A 2JNBA 3JVHA 3WGNA 4I4TA 3IKFA 5HXZA 2DYYA 4LNUA 5C8YB 3P0ZA 2V9YA 1XV2A 2QA4F 3CYPB 3E22B 3OONA 1JJ2F 1TVKA 3CC4F 5JQGA 2NMUA 3LWQC 2LBTA 4G4YA 1RQ7A 1JFFA 1W581 1KC8H 3V7EA 3JASA 4YJ2A 1UFYA 3LDTA 4X3LA 3IMPA 3F0EA 4O4HA 1DT9A 4FFBA 3WXMB 4KWEA 2F9ZC 3JASB 4ZI7A 5MN5A 1W55A 5LYJA 3CC7F 1W5EA 2H8EA 3FBAA 3GYQA 1VQPF 3SIVA 2ZOVA 4PWTA 2VAMA 3TD4A 2PMPA 3HKDA 5LYJB 3J80M 2ZVYA 5IYZB 2Z1UA 3HKEA 2QTPA 2UYPA 3M4SA 3QTYA 1TVKB 3VYSC 3C9SA 3ZOPA 5EB1B 4EB6B 4B5CA 3CG6A 3T80A 5J2UB 3I56F 1E7KA 3I7TA 2CVLA 3ON1A 3NK7A 1W3EX 4ZOLB 3O85A 1W59A 3CC2F 1K8AH 1W5AA 3CPQA 3HKBB 3RYFB 1QAHA 2UYNB 5JH7A 4G4VA 4ZOLA 3GHZA 4TZZA 3CCEF 2HS4A 3C9UA 1VQLF 3PAFA 2AMTA 1FFXA 1TUBA 3HKCB 5LP6C 2H6LA 1Q7YH 4NUTA 3N4YA 1W57A 2HP0B 3CCUF 3E1YA 3L7QA 2OHWA 4IIJB 4I55B 3FPIA 3DC2A 4G88A 4BT2A 3CCRF 1T0AA 5EZYB 2L26A 4G4ZA 1H47A 3RYIA 4BT7A 4I55A 1R1MA 3UT5A 2Z1EA 4NQ3A 1YJWF 1NQ3A 5JQGB 5HY4A 3U0OA 5FNVA 5EAZA 2HS0A 1FFXB 1TUBB 4DRXB 3E20B 3HKCA 3VCZA 5EYPA 4G4WA 4BY9D 3RYCA 1FNKA 3LWPC 2HVYD 3VTIC 5DCVA 3MQWA 3CMEF 3E22A 3MDOA 3FFMA 1YJNF 3ELCA 1VQ4F 5HY2A 1X7OA 2YXZA 4HNAB 4NWOB 2FGYA 3TD5A 4TUYA 5IYZA 4O4JA 3G4SF 1Q86H 5EB0A 1UI9A 3CXCF 5IJ9A 1W5BA 3RE3A 2RHJA 2VAPA 4BW0B 2LBXA 5CA0A 1XHOA 1X7PA 5IJ9B 2LCAA 3JATB 1YIJF 4LCKA 3WGMA 3G71F 3JALA 4I50B 1IV4A 4RQOA 4DRXA 2RHOA 1NMUB 1JY8A 2KGWA 5LA6B 2ZVZA 2QEXF 1JN1A 2WALA 4BT4A 3CCMF 5FJ4C 5G4VC 2ZAUA 3F0GA 1YJ9F 1XRGA 3VIUA 4EI9A 3P10A 2BO1A 5BMVA 2KG4A 1KNJA 3K12A 4BVRA 3JAKB 2CW4A 3J7AR 4IHJA 3SIUA 1W5FA 4BVQA 3CCQF 3CCLF 1JFFB 5HY0A 1VQ5F 3HJWC 3IEWA 1GZ0A 5LXTB 3LMEA 1CN7A 2UZHA 3VOBA 1W2BF 3CD6F 4TV8A 3FD5A 3IKEA 3VOAA 3HWUA 2I6DA 4WBNB 5LXTA 1FSZA 1OFUA 2G9IA 5EIBC 5AVMA 2ZODA 3RYFA 4O4IA 2BTQB 5CA1A 3HKEB 3VMFB 3G6EF 1FNJA 1T0KB 3RYIB 4ZHWA 3RYHA 3NMUC 5CB4B 5KMGB 1VHAA 3WJRA 2CHSA 1VQ7F 5IT9M 2HQSC 1RQ2A 4O4JB 5MN6A 3M1XA 4X1KB 5LP6B 3K0TA 5CB4A 3F6MA 2ZF8A 3S0YA 3JAWB 3AGKA 3CYQA 2UYNA 2UYJA 3IR9A 1VQ9F 1IPAA 3QHDA 4O2AB 5KX5B 3WGLA 4B46A 4FFBB 1VQ8F 2IQQA 3ZP7A 4B45A 4C8GA 3PLAC 2OTMA 4TUYB 3S0WA 1NJIH 3LYBA 2GZLA 3RYHB 2AIFA 1N8RH 3NVIB 1SDSA 2EWCA 1YQNA 4C82A 5GANK 1VH8A 5MN4A 4LNUB 5C8YA 2PHNA 3KHNA 4DXDA 1W40A 2ALEA 3LWRC 3V4DA 3VI6A 4ZHYB 1X25A 1YGYA 2VAWA 2VGMA 1KQSF 4ZHQA 3WPWA 2Z1TA 1VQOF 5ITZB 3HAXD 4EI8A 3S02A 2KTUA 3N2KA 5EIBD 5GIOC 4WBNA 4G4XA 3N2GB 5LOVA 3MCAB 3OBWA 5GAPK 3EORA 1VQKF 2HP3A 3CMAF 3I55F 2K1SA 3IEQA 3HTNA 4RHAA 1X52A 3MBMA 5J2TA 4IIJA 5JVDB 1Q82H 1Q8RA 2R751 2Z01A 4O4LA 1YHQF 4BT5A 4EB6A 4I50A 2P6YA 1OAPA 4ERHA 3N2KB 4C81A 5LA6A 3VYUC 1U3LA 3JCMM 4X1YA 3JAMM 4XCQA 4BVTA 5EO3A 3CCVF 3HKDB 3C9TA 5HP7A 5IJ0B 1IV1A 3F0FA 2HX0A 5BMVB 5HXUA 5JCOA 1QVGF 2OTJF 3UT5B 2KTVA 3P4EA 2GVIA 1XBIA
chains in the Genus database with same CATH topology
1ZWZA 3CCJF 1QVFF 1W41A 4NQ3A 1YJWF 5HY4A 3NVKE 3D00A 1VQNF 5A2QM 3AGKA 1RLGA 1Q81H 2CZWA 3IR9A 2LBWA 3LFOA 4X3MA 1VQ9F 1IPAA 2QI2A 5HWEA 3E20B 3RA5A 1S72F 1VQ8F 2FC3A 4BY9D 3PLAC 3CCSF 3OBYA 3LWPC 1M90H 2HVYD 5DCVA 1CK2A 2JNBA 3CMEF 1NJIH 3FFMA 1YJNF 1YI2F 1VQ4F 2AIFA 1N8RH 5HXZA 3NVIB 3LWOC 1SDSA 5HY2A 1VQMF 1X7OA 5GANK 1GO1A 2FGYA 3G4SF 2QA4F 1Q86H 1YITF 1KD1H 2GLZA 3CXCF 1JJ2F 3CC4F 3LWQC 5G4UC 1W40A 2ALEA 3LWRC 3CPWF 2OTLF 3VI6A 4BW0B 2LBXA 2VGMA 1K73H 1KQSF 1KC8H 1X7PA 3V7EA 3V7QA 2OZBA 1YIJF 5GINC 4LCKA 3G71F 4X3LA 4EI7A 1VQOF 3HAXD 4EI8A 2KTUA 1DT9A 1NMUB 5GIOC 3WXMB 3NK6A 2F9ZC 3LWVC 3CC7F 2QEXF 2WALA 1RA4A 3GYQA 1VQPF 3SIVA 3MCAB 3CCMF 5FJ4C 3J81M 5G4VC 1M1KH 3OBWA 1YJ9F 5GAPK 4EI9A 3J80M 1VQKF 2BO1A 3CMAF 4BVSA 3I55F 2KG4A 3N4ZA 5EWRA 1X52A 4BVRA 3J7AR 3SIUA 1Q82H 3CG6A 1E7KA 3I56F 4BVQA 3CCQF 3ON1A 3CCLF 3NK7A 5HY0A 3RA6A 1W3EX 1YHQF 1VQ5F 3HJWC 1GZ0A 1GO0A 4C4WC 3O85A 1CN7A 1W2BF 3CC2F 1K8AH 3CPQA 5HY1A 3CD6F 2I6DA 1H7MA 5GIPC 4TZZA 3JCMM 3CCEF 1VQLF 3PAFA 3JAMM 1VQ6F 4XCQA 4BVTA 1Q7YH 5EO3A 3CCVF 4NUTA 3N4YA 3CCUF 5FLXM 1K9MH 3VMFB 5HXUA 2VGNA 1W42A 3E1YA 3G6EF 1T0KB 2OHWA 3NMUC 1QVGF 2OTJF 3CCRF 2KTVA 1PXWA 3V3TA 1VQ7F 5IT9M 3OW2F 1XBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWZ A;  3CCJ F;  1QVF F;  1W41 A;  1YJW F;  3NVK E;  1VQN F;  5A2Q M;  3AGK A;  1RLG A;  1Q81 H;  2CZW A;  3IR9 A;  2LBW A;  3LFO A;  4X3M A;  1VQ9 F;  1IPA A;  2QI2 A;  3E20 B;  3RA5 A;  1S72 F;  1VQ8 F;  2FC3 A;  4BY9 D;  3PLA C;  3CCS F;  3OBY A;  3LWP C;  1M90 H;  2HVY D;  5DCV A;  1CK2 A;  2JNB A;  3CME F;  1NJI H;  3FFM A;  1YJN F;  1YI2 F;  1VQ4 F;  2AIF A;  1N8R H;  3NVI B;  3LWO C;  1SDS A;  1VQM F;  1X7O A;  5GAN K;  1GO1 A;  3G4S F;  2QA4 F;  1Q86 H;  1YIT F;  1KD1 H;  3CXC F;  1JJ2 F;  3CC4 F;  3LWQ C;  5G4U C;  1W40 A;  2ALE A;  3LWR C;  3CPW F;  2OTL F;  3VI6 A;  4BW0 B;  2LBX A;  2VGM A;  1K73 H;  1KQS F;  1KC8 H;  1X7P A;  3V7E A;  3V7Q A;  2OZB A;  1YIJ F;  5GIN C;  4LCK A;  3G71 F;  4X3L A;  1VQO F;  3HAX D;  2KTU A;  1DT9 A;  1NMU B;  5GIO C;  3WXM B;  3NK6 A;  3LWV C;  3CC7 F;  2QEX F;  2WAL A;  1RA4 A;  3GYQ A;  1VQP F;  3SIV A;  3MCA B;  3CCM F;  5FJ4 C;  3J81 M;  5G4V C;  1M1K H;  3OBW A;  1YJ9 F;  5GAP K;  3J80 M;  1VQK F;  2BO1 A;  3CMA F;  3I55 F;  2KG4 A;  3N4Z A;  5EWR A;  1X52 A;  3J7A R;  3SIU A;  1Q82 H;  3CG6 A;  1E7K A;  3I56 F;  3CCQ F;  3ON1 A;  3CCL F;  3NK7 A;  1YHQ F;  3RA6 A;  1W3E X;  1VQ5 F;  3HJW C;  1GZ0 A;  1GO0 A;  4C4W C;  3O85 A;  1CN7 A;  1W2B F;  3CC2 F;  1K8A H;  3CPQ A;  3CD6 F;  2I6D A;  1H7M A;  5GIP C;  4TZZ A;  3JCM M;  3CCE F;  1VQL F;  3PAF A;  3JAM M;  1VQ6 F;  1Q7Y H;  5EO3 A;  3CCV F;  4NUT A;  3N4Y A;  3CCU F;  5FLX M;  1K9M H;  3VMF B;  2VGN A;  1W42 A;  3E1Y A;  3G6E F;  1T0K B;  2OHW A;  3NMU C;  1QVG F;  2OTJ F;  3CCR F;  2KTV A;  1PXW A;  1VQ7 F;  5IT9 M;  3OW2 F;  1XBI A; 
#chains in the Genus database with same CATH topology
 1RLU A;  5B8F A;  1QVF F;  1W41 A;  3C9R A;  5GON B;  3S03 A;  3NVK E;  4O2A A;  5KX5 A;  1VK3 A;  3D01 A;  1RLG A;  5EYP B;  5CA0 B;  2CZW A;  1SA0 A;  3RYC B;  3Q8H A;  3WGJ A;  3M84 A;  4X1Y B;  3JAW A;  2QI2 A;  2RHL A;  3RA5 A;  2DT4 A;  5IJ0 A;  1S72 F;  2UYK A;  3CCS F;  5CA1 B;  3N2G A;  1Z5W A;  1M90 H;  4HNA A;  4BT6 A;  3KIZ A;  1YI2 F;  3MCQ A;  2HRY A;  3LWO C;  1VQM F;  2RB9 A;  5EZY A;  4M8I A;  1GO1 A;  3WJQ A;  4TV9 B;  4ZK7 A;  1YIT F;  3VO8 A;  1KD1 H;  2GLZ A;  5J2T B;  3JAR B;  4ZHQ B;  4F6R A;  1U3P A;  5G4U C;  3JAL B;  2OTL F;  3DDN A;  5ITZ A;  3CPW F;  1IV3 A;  2CWJ A;  4O4H B;  1K73 H;  4O4L B;  3K14 A;  3JAR A;  3V7Q A;  4X1I B;  2OZB A;  4U3J A;  5GIN C;  4EI7 A;  5JCO C;  1Z5V A;  4BT3 A;  2Q1Y A;  1DBF A;  1ONI A;  3ERN A;  3JAT A;  3NK6 A;  4X1I A;  3LWV C;  3R0P A;  5JH7 B;  1COM A;  3WPX A;  1RA4 A;  3F0D A;  3J81 M;  2IAF A;  1M1K H;  3JAK A;  3S06 A;  2B33 A;  4IHJ B;  3FD6 A;  5LOV B;  4BVS A;  2HP0 A;  2H8C A;  4TV9 A;  4U39 A;  5EWR A;  3N4Z A;  4X20 A;  3GTZ A;  4C8E A;  4ZHV A;  4YJ3 B;  5HP8 A;  4X20 B;  2BTO A;  3RA6 A;  3K2X A;  1GX1 A;  1GO0 A;  4X1K A;  3WGK A;  4YJ2 B;  5LP6 A;  4C4W C;  4YJ3 A;  2CHT A;  5GON A;  5J2U A;  5HY1 A;  2RHH A;  2I6R A;  2AIZ P;  3D54 A;  1PF5 A;  2HRU A;  1VQV A;  3S0H A;  1IV2 A;  1U40 A;  2VXY A;  4ZI7 B;  1H7M A;  5GIP C;  1ODE A;  5FNV B;  1JD1 A;  3KE1 A;  3HKB A;  4R40 B;  1VQ6 F;  1H48 A;  3ESJ A;  5KMG A;  1QU9 A;  5FLX M;  1K9M H;  1KNK A;  2N48 A;  2VGN A;  1W42 A;  3CB2 A;  4I4T B;  2HS3 A;  3QUW A;  1CLI A;  3BYQ A;  3VYT C;  4C8I A;  5JVD A;  4O4I B;  3WJP A;  1J7H A;  2W8B C;  1QD9 A;  3V3T A;  1PXW A;  2MQE A;  2Q1X A;  4E6E A;  3OW2 F;  1ZWZ A;  3CCJ F;  2IG8 A;  3ZP4 A;  4F6R B;  3ZO8 A;  3B6N A;  4O2B B;  3D00 A;  1U43 A;  1SZQ A;  4B62 A;  4TV8 B;  3I3F A;  5A2Q M;  2BTU A;  1VQN F;  3C8L A;  3TD3 A;  2R6R 1;  1Q81 H;  2CSL A;  2YYE A;  4U3J B;  2LBW A;  2Z1F A;  3LFO A;  4O2B A;  4X3M A;  5HWE A;  3KJK A;  2FC3 A;  1SA0 B;  3OBY A;  3KJJ A;  1CK2 A;  2JNB A;  3JVH A;  3WGN A;  4I4T A;  3IKF A;  5HXZ A;  2DYY A;  4LNU A;  5C8Y B;  3P0Z A;  2V9Y A;  1XV2 A;  2QA4 F;  3CYP B;  3E22 B;  3OON A;  1JJ2 F;  1TVK A;  3CC4 F;  5JQG A;  2NMU A;  3LWQ C;  2LBT A;  4G4Y A;  1RQ7 A;  1JFF A;  1W58 1;  1KC8 H;  3V7E A;  3JAS A;  4YJ2 A;  1UFY A;  3LDT A;  4X3L A;  3IMP A;  3F0E A;  4O4H A;  1DT9 A;  4FFB A;  3WXM B;  4KWE A;  2F9Z C;  3JAS B;  4ZI7 A;  5MN5 A;  1W55 A;  5LYJ A;  3CC7 F;  1W5E A;  2H8E A;  3FBA A;  3GYQ A;  1VQP F;  3SIV A;  2ZOV A;  4PWT A;  2VAM A;  3TD4 A;  2PMP A;  3HKD A;  5LYJ B;  3J80 M;  2ZVY A;  5IYZ B;  2Z1U A;  3HKE A;  2QTP A;  2UYP A;  3M4S A;  3QTY A;  1TVK B;  3VYS C;  3C9S A;  3ZOP A;  5EB1 B;  4EB6 B;  4B5C A;  3CG6 A;  3T80 A;  5J2U B;  3I56 F;  1E7K A;  3I7T A;  2CVL A;  3ON1 A;  3NK7 A;  1W3E X;  4ZOL B;  3O85 A;  1W59 A;  3CC2 F;  1K8A H;  1W5A A;  3CPQ A;  3HKB B;  3RYF B;  1QAH A;  2UYN B;  5JH7 A;  4G4V A;  4ZOL A;  3GHZ A;  4TZZ A;  3CCE F;  2HS4 A;  3C9U A;  1VQL F;  3PAF A;  2AMT A;  1FFX A;  1TUB A;  3HKC B;  5LP6 C;  2H6L A;  1Q7Y H;  4NUT A;  3N4Y A;  1W57 A;  2HP0 B;  3CCU F;  3E1Y A;  3L7Q A;  2OHW A;  4IIJ B;  4I55 B;  3FPI A;  3DC2 A;  4G88 A;  4BT2 A;  3CCR F;  1T0A A;  5EZY B;  2L26 A;  4G4Z A;  1H47 A;  3RYI A;  4BT7 A;  4I55 A;  1R1M A;  3UT5 A;  2Z1E A;  4NQ3 A;  1YJW F;  1NQ3 A;  5JQG B;  5HY4 A;  3U0O A;  5FNV A;  5EAZ A;  2HS0 A;  1FFX B;  1TUB B;  4DRX B;  3E20 B;  3HKC A;  3VCZ A;  5EYP A;  4G4W A;  4BY9 D;  3RYC A;  1FNK A;  3LWP C;  2HVY D;  3VTI C;  5DCV A;  3MQW A;  3CME F;  3E22 A;  3MDO A;  3FFM A;  1YJN F;  3ELC A;  1VQ4 F;  5HY2 A;  1X7O A;  2YXZ A;  4HNA B;  4NWO B;  2FGY A;  3TD5 A;  4TUY A;  5IYZ A;  4O4J A;  3G4S F;  1Q86 H;  5EB0 A;  1UI9 A;  3CXC F;  5IJ9 A;  1W5B A;  3RE3 A;  2RHJ A;  2VAP A;  4BW0 B;  2LBX A;  5CA0 A;  1XHO A;  1X7P A;  5IJ9 B;  2LCA A;  3JAT B;  1YIJ F;  4LCK A;  3WGM A;  3G71 F;  3JAL A;  4I50 B;  1IV4 A;  4RQO A;  4DRX A;  2RHO A;  1NMU B;  1JY8 A;  2KGW A;  5LA6 B;  2ZVZ A;  2QEX F;  1JN1 A;  2WAL A;  4BT4 A;  3CCM F;  5FJ4 C;  5G4V C;  2ZAU A;  3F0G A;  1YJ9 F;  1XRG A;  3VIU A;  4EI9 A;  3P10 A;  2BO1 A;  5BMV A;  2KG4 A;  1KNJ A;  3K12 A;  4BVR A;  3JAK B;  2CW4 A;  3J7A R;  4IHJ A;  3SIU A;  1W5F A;  4BVQ A;  3CCQ F;  3CCL F;  1JFF B;  5HY0 A;  1VQ5 F;  3HJW C;  3IEW A;  1GZ0 A;  5LXT B;  3LME A;  1CN7 A;  2UZH A;  3VOB A;  1W2B F;  3CD6 F;  4TV8 A;  3FD5 A;  3IKE A;  3VOA A;  3HWU A;  2I6D A;  4WBN B;  5LXT A;  1FSZ A;  1OFU A;  2G9I A;  5EIB C;  5AVM A;  2ZOD A;  3RYF A;  4O4I A;  2BTQ B;  5CA1 A;  3HKE B;  3VMF B;  3G6E F;  1FNJ A;  1T0K B;  3RYI B;  4ZHW A;  3RYH A;  3NMU C;  5CB4 B;  5KMG B;  1VHA A;  3WJR A;  2CHS A;  1VQ7 F;  5IT9 M;  2HQS C;  1RQ2 A;  4O4J B;  5MN6 A;  3M1X A;  4X1K B;  5LP6 B;  3K0T A;  5CB4 A;  3F6M A;  2ZF8 A;  3S0Y A;  3JAW B;  3AGK A;  3CYQ A;  2UYN A;  2UYJ A;  3IR9 A;  1VQ9 F;  1IPA A;  3QHD A;  4O2A B;  5KX5 B;  3WGL A;  4B46 A;  4FFB B;  1VQ8 F;  2IQQ A;  3ZP7 A;  4B45 A;  4C8G A;  3PLA C;  2OTM A;  4TUY B;  3S0W A;  1NJI H;  3LYB A;  2GZL A;  3RYH B;  2AIF A;  1N8R H;  3NVI B;  1SDS A;  2EWC A;  1YQN A;  4C82 A;  5GAN K;  1VH8 A;  5MN4 A;  4LNU B;  5C8Y A;  2PHN A;  3KHN A;  4DXD A;  1W40 A;  2ALE A;  3LWR C;  3V4D A;  3VI6 A;  4ZHY B;  1X25 A;  1YGY A;  2VAW A;  2VGM A;  1KQS F;  4ZHQ A;  3WPW A;  2Z1T A;  1VQO F;  5ITZ B;  3HAX D;  4EI8 A;  3S02 A;  2KTU A;  3N2K A;  5EIB D;  5GIO C;  4WBN A;  4G4X A;  3N2G B;  5LOV A;  3MCA B;  3OBW A;  5GAP K;  3EOR A;  1VQK F;  2HP3 A;  3CMA F;  3I55 F;  2K1S A;  3IEQ A;  3HTN A;  4RHA A;  1X52 A;  3MBM A;  5J2T A;  4IIJ A;  5JVD B;  1Q82 H;  1Q8R A;  2R75 1;  2Z01 A;  4O4L A;  1YHQ F;  4BT5 A;  4EB6 A;  4I50 A;  2P6Y A;  1OAP A;  4ERH A;  3N2K B;  4C81 A;  5LA6 A;  3VYU C;  1U3L A;  3JCM M;  4X1Y A;  3JAM M;  4XCQ A;  4BVT A;  5EO3 A;  3CCV F;  3HKD B;  3C9T A;  5HP7 A;  5IJ0 B;  1IV1 A;  3F0F A;  2HX0 A;  5BMV B;  5HXU A;  5JCO A;  1QVG F;  2OTJ F;  3UT5 B;  2KTV A;  3P4E A;  2GVI A;  1XBI A; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  3CCJ F;  1QVF F;  1W41 A;  4NQ3 A;  1YJW F;  5HY4 A;  3NVK E;  3D00 A;  1VQN F;  5A2Q M;  3AGK A;  1RLG A;  1Q81 H;  2CZW A;  3IR9 A;  2LBW A;  3LFO A;  4X3M A;  1VQ9 F;  1IPA A;  2QI2 A;  5HWE A;  3E20 B;  3RA5 A;  1S72 F;  1VQ8 F;  2FC3 A;  4BY9 D;  3PLA C;  3CCS F;  3OBY A;  3LWP C;  1M90 H;  2HVY D;  5DCV A;  1CK2 A;  2JNB A;  3CME F;  1NJI H;  3FFM A;  1YJN F;  1YI2 F;  1VQ4 F;  2AIF A;  1N8R H;  5HXZ A;  3NVI B;  3LWO C;  1SDS A;  5HY2 A;  1VQM F;  1X7O A;  5GAN K;  1GO1 A;  2FGY A;  3G4S F;  2QA4 F;  1Q86 H;  1YIT F;  1KD1 H;  2GLZ A;  3CXC F;  1JJ2 F;  3CC4 F;  3LWQ C;  5G4U C;  1W40 A;  2ALE A;  3LWR C;  3CPW F;  2OTL F;  3VI6 A;  4BW0 B;  2LBX A;  2VGM A;  1K73 H;  1KQS F;  1KC8 H;  1X7P A;  3V7E A;  3V7Q A;  2OZB A;  1YIJ F;  5GIN C;  4LCK A;  3G71 F;  4X3L A;  4EI7 A;  1VQO F;  3HAX D;  4EI8 A;  2KTU A;  1DT9 A;  1NMU B;  5GIO C;  3WXM B;  3NK6 A;  2F9Z C;  3LWV C;  3CC7 F;  2QEX F;  2WAL A;  1RA4 A;  3GYQ A;  1VQP F;  3SIV A;  3MCA B;  3CCM F;  5FJ4 C;  3J81 M;  5G4V C;  1M1K H;  3OBW A;  1YJ9 F;  5GAP K;  4EI9 A;  3J80 M;  1VQK F;  2BO1 A;  3CMA F;  4BVS A;  3I55 F;  2KG4 A;  3N4Z A;  5EWR A;  1X52 A;  4BVR A;  3J7A R;  3SIU A;  1Q82 H;  3CG6 A;  1E7K A;  3I56 F;  4BVQ A;  3CCQ F;  3ON1 A;  3CCL F;  3NK7 A;  5HY0 A;  3RA6 A;  1W3E X;  1YHQ F;  1VQ5 F;  3HJW C;  1GZ0 A;  1GO0 A;  4C4W C;  3O85 A;  1CN7 A;  1W2B F;  3CC2 F;  1K8A H;  3CPQ A;  5HY1 A;  3CD6 F;  2I6D A;  1H7M A;  5GIP C;  4TZZ A;  3JCM M;  3CCE F;  1VQL F;  3PAF A;  3JAM M;  1VQ6 F;  4XCQ A;  4BVT A;  1Q7Y H;  5EO3 A;  3CCV F;  4NUT A;  3N4Y A;  3CCU F;  5FLX M;  1K9M H;  3VMF B;  5HXU A;  2VGN A;  1W42 A;  3E1Y A;  3G6E F;  1T0K B;  2OHW A;  3NMU C;  1QVG F;  2OTJ F;  3CCR F;  2KTV A;  1PXW A;  3V3T A;  1VQ7 F;  5IT9 M;  3OW2 F;  1XBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...