1K9MH

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k9mH00
3IR9A 1M1KH 2QI2A 3I55F 3JAMM 1YIJF 1PXWA 2KTVA 3CCSF 3CC4F 1DT9A 1Q81H 2VGNA 4C4WC 4X3LA 3CMEF 3SIVA 3CPWF 3V7QA 5GINC 3LWOC 1GO0A 1Q86H 3G4SF 3CCUF 3FFMA 3SIUA 1VQNF 3MCAB 1KC8H 5A2QM 3CD6F 1YJ9F 3CMAF 3CCJF 3OW2F 1YHQF 5GAPK 2LBXA 1N8RH 3NVIB 3CG6A 1VQ8F 2OTJF 1CK2A 2QA4F 3CPQA 1X7OA 2JNBA 1QVGF 1K9MH 3CCMF 1RA4A 1KD1H 1W42A 2WALA 2OZBA 1ZWZA 3LWRC 1YJWF 1VQ5F 1W40A 3AGKA 1GZ0A 1VQ9F 3O85A 3OBYA 3N4YA 1VQOF 5G4VC 3CCEF 3N4ZA 3J80M 1KQSF 2KG4A 1IPAA 3CCLF 5FJ4C 1YJNF 4LCKA 2QEXF 3J7AR 5EWRA 1VQKF 5GIPC 3WXMB 3V7EA 1X52A 2BO1A 1RLGA 3NK7A 1GO1A 3CCVF 3G71F 3CCRF 3CC2F 1XBIA 1VQ4F 3JCMM 2VGMA 1H7MA 2ALEA 3E1YA 1K8AH 1Q7YH 1VQLF 4X3MA 1QVFF 1X7PA 1SDSA 1W2BF 3PLAC 2KTUA 1JJ2F 2OHWA 3VMFB 3NMUC 3NVKE 1NMUB 3G6EF 3OBWA 3RA5A 3I56F 1S72F 2AIFA 5GIOC 3J81M 4TZZA 2I6DA 1YITF 5DCVA 3E20B 3LFOA 3HAXD 2CZWA 2LBWA 3NK6A 3PAFA 2FC3A 3ON1A 1M90H 1T0KB 3VI6A 3RA6A 4NUTA 1VQPF 1K73H 1CN7A 3CC7F 5G4UC 4BW0B 4BY9D 1YI2F 1NJIH 1W41A 1Q82H 1VQMF 3LWVC 2OTLF 5GANK 1W3EX 3LWPC 3LWQC 3HJWC 2HVYD 3CCQF 3GYQA 3CXCF 1E7KA 1VQ7F 1VQ6F 5EO3A 5FLXM 5IT9M
chains in the Genus database with same CATH superfamily
3FPIA 3S0YA 3IMPA 2YXZA 2KTVA 3P10A 3S03A 2RHLA 4G4ZA 2VGNA 3D54A 4BT4A 4C4WC 5LP6B 3CMEF 3SIVA 4RQOA 1W5FA 3CPWF 3V7QA 5GINC 3G4SF 3SIUA 1VQNF 4O4HA 3S0WA 2ZVZA 2QTPA 1YJ9F 3CCJF 3TD5A 4BT3A 5J2TB 4F6RA 1VQVA 5GAPK 3RYCA 1TVKB 2OTJF 3F0GA 4I4TB 3VIUA 5FNVA 5JVDB 4YJ2A 3VTIC 3ZP7A 5HP8A 3ZO8A 3JAKB 3F6MA 3D00A 2IAFA 1RA4A 4O4JB 4YJ3B 3HKBB 1W55A 2OZBA 5MN5A 5EZYB 1IV3A 3JATB 2R6R1 3LWRC 2RHOA 3AGKA 1FFXA 5EYPB 4LNUB 1VQ9F 4U3JB 3IKFA 3CB2A 3M84A 4I50B 3S02A 3N4YA 2VAPA 3HKEB 4G88A 5HXUA 2PMPA 1KQSF 5BMVA 2Z1FA 4LCKA 5EWRA 3MQWA 1W5EA 2W8BC 2RHHA 5GIPC 2HX0A 1TUBB 3UT5A 2AMTA 4U39A 5JCOC 3N2KB 3ELCA 3KIZA 5JQGA 3HKCB 2B33A 3E22B 3NK7A 3M1XA 2MQEA 4ZHYB 5LOVB 4EB6B 4BT6A 3WJRA 2HRYA 2ALEA 2CSLA 1K8AH 5EIBC 1QVFF 5C8YA 5LXTA 4X1YB 5JH7B 3NMUC 3HTNA 3NVKE 4BVTA 1SA0B 3F0FA 2N48A 4WBNA 4IIJB 2I6DA 4DRXA 3E20B 3LFOA 4IHJA 2G9IA 2LBWA 2ZVYA 3FBAA 3C9UA 4O2BB 3RYFA 3ON1A 3VOBA 1Q8RA 1M90H 1T0KB 3JALA 3RA6A 4NUTA 3RYHB 3HKCA 4BVSA 3EORA 4G4YA 4HNAA 1R1MA 4BW0B 1YI2F 3WPXA 3JASB 1VQMF 2OTLF 5CA1A 3HJWC 5HY4A 3CYPB 1E7KA 1KNJA 1Z5WA 2PHNA 5HY0A 3QTYA 2ZOVA 4X1YA 1VHAA 2QI2A 4ERHA 4C8EA 2GZLA 4O4HB 3K0TA 1UFYA 4M8IA 3VCZA 4I55A 1Q81H 4BT7A 1XRGA 3MDOA 3RYCB 3LWOC 3IKEA 3FFMA 4EI8A 5FNVB 2Z1UA 4YJ2B 4O4LA 2LBXA 3NVIB 3CG6A 2H6LA 3JARA 3M4SA 4NWOB 3ZP4A 1VQ8F 1CK2A 3LYBA 2QA4F 1QVGF 3S06A 1FFXB 4TV8A 1K9MH 3CCMF 1J7HA 3WGLA 1KD1H 1UI9A 2WALA 1ZWZA 3T80A 1Z5VA 1H47A 3FD6A 1YJWF 3RE3A 1W40A 5BMVB 1X25A 5EB0A 2KGWA 3OBYA 4FFBA 3CCEF 1SZQA 3L7QA 3UT5B 2FGYA 2KG4A 3CCLF 1U43A 5FJ4C 5JQGB 3C9TA 2ZODA 2QEXF 4X1IB 3J7AR 4C82A 1IV2A 1VQKF 2YYEA 3V3TA 2VXYA 3CCVF 3G71F 1ODEA 4TV9A 3CCRF 5C8YB 5LXTB 3ZOPA 1JN1A 2Z01A 3E1YA 2VAMA 3VO8A 3C9SA 1FNJA 2HRUA 3QUWA 1ONIA 3PLAC 2KTUA 3ERNA 3TD4A 4WBNB 2Z1EA 1NMUB 4DRXB 4IHJB 4ZHWA 1RQ2A 3ESJA 3RYFB 1KNKA 1JFFA 2AIFA 3JALB 3J81M 5IJ9A 5LYJA 4X1IA 4HNAB 2K1SA 2OTMA 3JVHA 3PAFA 3I7TA 5HWEA 3OONA 5CA1B 1XV2A 3P4EA 1OFUA 1K73H 3K2XA 4C8GA 3CYQA 1CN7A 1GX1A 5KMGA 5HXZA 1COMA 2DYYA 3D01A 2GLZA 4ZI7A 1W41A 4G4WA 1DBFA 3LWPC 3KJKA 3CCQF 2R751 3CXCF 1VQ7F 4ZK7A 5EO3A 4BVQA 3LDTA 2BTOA 4I55B 3VYSC 3HKDA 2VAWA 4B45A 3I55F 1JD1A 3RYIA 3CCSF 2H8CA 2UZHA 1YQNA 3CC4F 4BT5A 5GONA 3HWUA 5IJ0B 4X3LA 1W581 2Q1YA 4O4LB 1GO0A 3JARB 3CCUF 1KC8H 5A2QM 2HP0B 3CMAF 4TV8B 1YHQF 2BTUA 1N8RH 5CA0A 5HP7A 4ZOLA 3FD5A 3CPQA 1X7OA 3LMEA 4O2AA 4DXDA 4FFBB 4ZHQA 1U40A 1VQ5F 5ITZB 1GZ0A 5MN6A 1JY8A 4O4IA 1VQOF 5G4VC 2V9YA 2F9ZC 1W59A 3DC2A 4E6EA 5IJ0A 1YJNF 5HY2A 2I6RA 4TV9B 3WPWA 3MCQA 2LBTA 3C9RA 3V7EA 3JAWA 2BO1A 2HP0A 1IV1A 2IG8A 5HY1A 1RLGA 1RLUA 1GO1A 3WJPA 3IEQA 5CB4A 5MN4A 1QU9A 3N2GA 4KWEA 1Q7YH 1W5AA 1SDSA 2GVIA 3VYUC 4X1KA 4X20B 5EAZA 4B5CA 1W2BF 1JJ2F 1JFFB 1XHOA 2UYNB 4B62A 2OHWA 3VMFB 5ITZA 3VOAA 5IJ9B 5LYJB 2UYPA 3WGMA 2UYKA 3G6EF 3WGJA 3KHNA 3RA5A 2AIZP 1S72F 2IQQA 1CLIA 2CWJA 2UYJA 5GIOC 3I3FA 4TZZA 2CW4A 3VYTC 1YITF 5DCVA 3HAXD 3V4DA 5KMGB 5LA6A 3DDNA 4ZI7B 5KX5A 2Z1TA 2RB9A 2ZAUA 1U3PA 3CC7F 5G4UC 4BY9D 1NJIH 1Q82H 3LWVC 5GANK 2CHSA 4B46A 4BVRA 3HKDB 5J2UA 1PF5A 5IYZA 1VQ6F 3RYIB 3QHDA 3Q8HA 4X20A 3IR9A 5GONB 2UYNA 5AVMA 1M1KH 3KE1A 3GTZA 2P6YA 5LP6C 2HS3A 3JAMM 1YIJF 1PXWA 1DT9A 1Q86H 5CA0B 3WJQA 4ZOLB 3MCAB 1IV4A 3CD6F 4XCQA 3OW2F 5LP6A 3F0DA 1QAHA 4O2AB 4ZHQB 3K14A 3KJJA 2JNBA 3C8LA 5J2TA 4BT2A 3BYQA 1TVKA 3WGNA 1W42A 4O4IB 4I4TA 3MBMA 4G4XA 5JVDA 1OAPA 1FNKA 3JAKA 3O85A 4YJ3A 4O4JA 1VH8A 3HKBA 4PWTA 5EZYA 5JCOA 2HS0A 3N4ZA 3JATA 3J80M 1W5BA 1FSZA 4R40B 3JAWB 4TUYB 5EYPA 4LNUA 1IPAA 4U3JA 4I50A 3HKEA 2BTQB 4G4VA 5EIBD 3WXMB 5CB4B 1X52A 3N2GB 2Q1XA 2L26A 3CC2F 1XBIA 1TUBA 1VQ4F 3JCMM 4X1KB 2VGMA 1H7MA 4RHAA 4NQ3A 3F0EA 3S0HA 2H8EA 5B8FA 3R0PA 3N2KA 2RHJA 3E22A 1H48A 2NMUA 3U0OA 1VQLF 4X3MA 5LOVA 1X7PA 4EB6A 2DT4A 3IEWA 3TD3A 3B6NA 1QD9A 3P0ZA 1U3LA 2EWCA 4C81A 1RQ7A 1VK3A 3OBWA 3I56F 4C8IA 5LA6B 5KX5B 5JH7A 4TUYA 2CHTA 3WGKA 1SA0A 1W57A 1NQ3A 2CZWA 2LCAA 5EB1B 2ZF8A 3NK6A 4EI7A 4EI9A 2FC3A 1T0AA 2CVLA 4IIJA 3VI6A 4F6RB 1VQPF 5J2UB 3GHZA 1YGYA 5IYZB 2HS4A 4O2BA 1W3EX 3LWQC 2HVYD 3RYHA 3GYQA 3K12A 2HQSC 2HP3A 5FLXM 4ZHVA 3JASA 5IT9M
chains in the Genus database with same CATH topology
3IR9A 1M1KH 2QI2A 3I55F 3JAMM 1YIJF 1PXWA 2KTVA 3CCSF 3CC4F 1DT9A 1Q81H 2VGNA 4C4WC 4X3LA 3CMEF 3SIVA 3CPWF 3V7QA 5GINC 3LWOC 1GO0A 1Q86H 3G4SF 3CCUF 3FFMA 4EI8A 3SIUA 1VQNF 3MCAB 1KC8H 5A2QM 3CD6F 1YJ9F 3CMAF 3CCJF 4XCQA 3OW2F 1YHQF 5GAPK 2LBXA 1N8RH 3NVIB 3CG6A 1VQ8F 2OTJF 1CK2A 2QA4F 3CPQA 1X7OA 2JNBA 1QVGF 1K9MH 3D00A 3CCMF 1RA4A 1KD1H 1W42A 2WALA 2OZBA 1ZWZA 3LWRC 1YJWF 1VQ5F 1W40A 3AGKA 1GZ0A 1VQ9F 3O85A 3OBYA 3N4YA 1VQOF 5G4VC 2F9ZC 3CCEF 3N4ZA 3J80M 5HXUA 2FGYA 1KQSF 2KG4A 1IPAA 3CCLF 5FJ4C 1YJNF 4LCKA 2QEXF 3J7AR 5HY2A 5EWRA 1VQKF 5GIPC 3WXMB 3V3TA 3V7EA 1X52A 2BO1A 5HY1A 1RLGA 3NK7A 1GO1A 3CCVF 3G71F 3CCRF 3CC2F 1XBIA 1VQ4F 3JCMM 2VGMA 1H7MA 4NQ3A 2ALEA 3E1YA 1K8AH 1Q7YH 1VQLF 4X3MA 1QVFF 1X7PA 1SDSA 1W2BF 3PLAC 2KTUA 1JJ2F 2OHWA 3VMFB 3NMUC 3NVKE 4BVTA 1NMUB 3G6EF 3OBWA 3RA5A 3I56F 1S72F 2AIFA 5GIOC 3J81M 4TZZA 2I6DA 1YITF 5DCVA 3E20B 3LFOA 3HAXD 2CZWA 2LBWA 3NK6A 3PAFA 4EI7A 4EI9A 2FC3A 3ON1A 5HWEA 1M90H 1T0KB 3VI6A 3RA6A 4NUTA 1VQPF 1K73H 1CN7A 4BVSA 3CC7F 5HXZA 5G4UC 4BW0B 4BY9D 2GLZA 1YI2F 1NJIH 1W41A 1Q82H 1VQMF 3LWVC 2OTLF 5GANK 1W3EX 3LWPC 4BVRA 3LWQC 3HJWC 5HY4A 2HVYD 3CCQF 3GYQA 3CXCF 1E7KA 1VQ7F 1VQ6F 5EO3A 5FLXM 4BVQA 5IT9M 5HY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IR9 A;  1M1K H;  2QI2 A;  3I55 F;  3JAM M;  1YIJ F;  1PXW A;  2KTV A;  3CCS F;  3CC4 F;  1DT9 A;  1Q81 H;  2VGN A;  4C4W C;  4X3L A;  3CME F;  3SIV A;  3CPW F;  3V7Q A;  5GIN C;  3LWO C;  1GO0 A;  1Q86 H;  3G4S F;  3CCU F;  3FFM A;  3SIU A;  1VQN F;  3MCA B;  1KC8 H;  5A2Q M;  3CD6 F;  1YJ9 F;  3CMA F;  3CCJ F;  3OW2 F;  1YHQ F;  5GAP K;  2LBX A;  1N8R H;  3NVI B;  3CG6 A;  1VQ8 F;  2OTJ F;  1CK2 A;  2QA4 F;  3CPQ A;  1X7O A;  2JNB A;  1QVG F;  1K9M H;  3CCM F;  1RA4 A;  1KD1 H;  1W42 A;  2WAL A;  2OZB A;  1ZWZ A;  3LWR C;  1YJW F;  1VQ5 F;  1W40 A;  3AGK A;  1GZ0 A;  1VQ9 F;  3O85 A;  3OBY A;  3N4Y A;  1VQO F;  5G4V C;  3CCE F;  3N4Z A;  3J80 M;  1KQS F;  2KG4 A;  1IPA A;  3CCL F;  5FJ4 C;  1YJN F;  4LCK A;  2QEX F;  3J7A R;  5EWR A;  1VQK F;  5GIP C;  3WXM B;  3V7E A;  1X52 A;  2BO1 A;  1RLG A;  3NK7 A;  1GO1 A;  3CCV F;  3G71 F;  3CCR F;  3CC2 F;  1XBI A;  1VQ4 F;  3JCM M;  2VGM A;  1H7M A;  2ALE A;  3E1Y A;  1K8A H;  1Q7Y H;  1VQL F;  4X3M A;  1QVF F;  1X7P A;  1SDS A;  1W2B F;  3PLA C;  2KTU A;  1JJ2 F;  2OHW A;  3VMF B;  3NMU C;  3NVK E;  1NMU B;  3G6E F;  3OBW A;  3RA5 A;  3I56 F;  1S72 F;  2AIF A;  5GIO C;  3J81 M;  4TZZ A;  2I6D A;  1YIT F;  5DCV A;  3E20 B;  3LFO A;  3HAX D;  2CZW A;  2LBW A;  3NK6 A;  3PAF A;  2FC3 A;  3ON1 A;  1M90 H;  1T0K B;  3VI6 A;  3RA6 A;  4NUT A;  1VQP F;  1K73 H;  1CN7 A;  3CC7 F;  5G4U C;  4BW0 B;  4BY9 D;  1YI2 F;  1NJI H;  1W41 A;  1Q82 H;  1VQM F;  3LWV C;  2OTL F;  5GAN K;  1W3E X;  3LWP C;  3LWQ C;  3HJW C;  2HVY D;  3CCQ F;  3GYQ A;  3CXC F;  1E7K A;  1VQ7 F;  1VQ6 F;  5EO3 A;  5FLX M;  5IT9 M; 
#chains in the Genus database with same CATH topology
 3FPI A;  3S0Y A;  3IMP A;  2YXZ A;  2KTV A;  3P10 A;  3S03 A;  2RHL A;  4G4Z A;  2VGN A;  3D54 A;  4BT4 A;  4C4W C;  5LP6 B;  3CME F;  3SIV A;  4RQO A;  1W5F A;  3CPW F;  3V7Q A;  5GIN C;  3G4S F;  3SIU A;  1VQN F;  4O4H A;  3S0W A;  2ZVZ A;  2QTP A;  1YJ9 F;  3CCJ F;  3TD5 A;  4BT3 A;  5J2T B;  4F6R A;  1VQV A;  5GAP K;  3RYC A;  1TVK B;  2OTJ F;  3F0G A;  4I4T B;  3VIU A;  5FNV A;  5JVD B;  4YJ2 A;  3VTI C;  3ZP7 A;  5HP8 A;  3ZO8 A;  3JAK B;  3F6M A;  3D00 A;  2IAF A;  1RA4 A;  4O4J B;  4YJ3 B;  3HKB B;  1W55 A;  2OZB A;  5MN5 A;  5EZY B;  1IV3 A;  3JAT B;  2R6R 1;  3LWR C;  2RHO A;  3AGK A;  1FFX A;  5EYP B;  4LNU B;  1VQ9 F;  4U3J B;  3IKF A;  3CB2 A;  3M84 A;  4I50 B;  3S02 A;  3N4Y A;  2VAP A;  3HKE B;  4G88 A;  5HXU A;  2PMP A;  1KQS F;  5BMV A;  2Z1F A;  4LCK A;  5EWR A;  3MQW A;  1W5E A;  2W8B C;  2RHH A;  5GIP C;  2HX0 A;  1TUB B;  3UT5 A;  2AMT A;  4U39 A;  5JCO C;  3N2K B;  3ELC A;  3KIZ A;  5JQG A;  3HKC B;  2B33 A;  3E22 B;  3NK7 A;  3M1X A;  2MQE A;  4ZHY B;  5LOV B;  4EB6 B;  4BT6 A;  3WJR A;  2HRY A;  2ALE A;  2CSL A;  1K8A H;  5EIB C;  1QVF F;  5C8Y A;  5LXT A;  4X1Y B;  5JH7 B;  3NMU C;  3HTN A;  3NVK E;  4BVT A;  1SA0 B;  3F0F A;  2N48 A;  4WBN A;  4IIJ B;  2I6D A;  4DRX A;  3E20 B;  3LFO A;  4IHJ A;  2G9I A;  2LBW A;  2ZVY A;  3FBA A;  3C9U A;  4O2B B;  3RYF A;  3ON1 A;  3VOB A;  1Q8R A;  1M90 H;  1T0K B;  3JAL A;  3RA6 A;  4NUT A;  3RYH B;  3HKC A;  4BVS A;  3EOR A;  4G4Y A;  4HNA A;  1R1M A;  4BW0 B;  1YI2 F;  3WPX A;  3JAS B;  1VQM F;  2OTL F;  5CA1 A;  3HJW C;  5HY4 A;  3CYP B;  1E7K A;  1KNJ A;  1Z5W A;  2PHN A;  5HY0 A;  3QTY A;  2ZOV A;  4X1Y A;  1VHA A;  2QI2 A;  4ERH A;  4C8E A;  2GZL A;  4O4H B;  3K0T A;  1UFY A;  4M8I A;  3VCZ A;  4I55 A;  1Q81 H;  4BT7 A;  1XRG A;  3MDO A;  3RYC B;  3LWO C;  3IKE A;  3FFM A;  4EI8 A;  5FNV B;  2Z1U A;  4YJ2 B;  4O4L A;  2LBX A;  3NVI B;  3CG6 A;  2H6L A;  3JAR A;  3M4S A;  4NWO B;  3ZP4 A;  1VQ8 F;  1CK2 A;  3LYB A;  2QA4 F;  1QVG F;  3S06 A;  1FFX B;  4TV8 A;  1K9M H;  3CCM F;  1J7H A;  3WGL A;  1KD1 H;  1UI9 A;  2WAL A;  1ZWZ A;  3T80 A;  1Z5V A;  1H47 A;  3FD6 A;  1YJW F;  3RE3 A;  1W40 A;  5BMV B;  1X25 A;  5EB0 A;  2KGW A;  3OBY A;  4FFB A;  3CCE F;  1SZQ A;  3L7Q A;  3UT5 B;  2FGY A;  2KG4 A;  3CCL F;  1U43 A;  5FJ4 C;  5JQG B;  3C9T A;  2ZOD A;  2QEX F;  4X1I B;  3J7A R;  4C82 A;  1IV2 A;  1VQK F;  2YYE A;  3V3T A;  2VXY A;  3CCV F;  3G71 F;  1ODE A;  4TV9 A;  3CCR F;  5C8Y B;  5LXT B;  3ZOP A;  1JN1 A;  2Z01 A;  3E1Y A;  2VAM A;  3VO8 A;  3C9S A;  1FNJ A;  2HRU A;  3QUW A;  1ONI A;  3PLA C;  2KTU A;  3ERN A;  3TD4 A;  4WBN B;  2Z1E A;  1NMU B;  4DRX B;  4IHJ B;  4ZHW A;  1RQ2 A;  3ESJ A;  3RYF B;  1KNK A;  1JFF A;  2AIF A;  3JAL B;  3J81 M;  5IJ9 A;  5LYJ A;  4X1I A;  4HNA B;  2K1S A;  2OTM A;  3JVH A;  3PAF A;  3I7T A;  5HWE A;  3OON A;  5CA1 B;  1XV2 A;  3P4E A;  1OFU A;  1K73 H;  3K2X A;  4C8G A;  3CYQ A;  1CN7 A;  1GX1 A;  5KMG A;  5HXZ A;  1COM A;  2DYY A;  3D01 A;  2GLZ A;  4ZI7 A;  1W41 A;  4G4W A;  1DBF A;  3LWP C;  3KJK A;  3CCQ F;  2R75 1;  3CXC F;  1VQ7 F;  4ZK7 A;  5EO3 A;  4BVQ A;  3LDT A;  2BTO A;  4I55 B;  3VYS C;  3HKD A;  2VAW A;  4B45 A;  3I55 F;  1JD1 A;  3RYI A;  3CCS F;  2H8C A;  2UZH A;  1YQN A;  3CC4 F;  4BT5 A;  5GON A;  3HWU A;  5IJ0 B;  4X3L A;  1W58 1;  2Q1Y A;  4O4L B;  1GO0 A;  3JAR B;  3CCU F;  1KC8 H;  5A2Q M;  2HP0 B;  3CMA F;  4TV8 B;  1YHQ F;  2BTU A;  1N8R H;  5CA0 A;  5HP7 A;  4ZOL A;  3FD5 A;  3CPQ A;  1X7O A;  3LME A;  4O2A A;  4DXD A;  4FFB B;  4ZHQ A;  1U40 A;  1VQ5 F;  5ITZ B;  1GZ0 A;  5MN6 A;  1JY8 A;  4O4I A;  1VQO F;  5G4V C;  2V9Y A;  2F9Z C;  1W59 A;  3DC2 A;  4E6E A;  5IJ0 A;  1YJN F;  5HY2 A;  2I6R A;  4TV9 B;  3WPW A;  3MCQ A;  2LBT A;  3C9R A;  3V7E A;  3JAW A;  2BO1 A;  2HP0 A;  1IV1 A;  2IG8 A;  5HY1 A;  1RLG A;  1RLU A;  1GO1 A;  3WJP A;  3IEQ A;  5CB4 A;  5MN4 A;  1QU9 A;  3N2G A;  4KWE A;  1Q7Y H;  1W5A A;  1SDS A;  2GVI A;  3VYU C;  4X1K A;  4X20 B;  5EAZ A;  4B5C A;  1W2B F;  1JJ2 F;  1JFF B;  1XHO A;  2UYN B;  4B62 A;  2OHW A;  3VMF B;  5ITZ A;  3VOA A;  5IJ9 B;  5LYJ B;  2UYP A;  3WGM A;  2UYK A;  3G6E F;  3WGJ A;  3KHN A;  3RA5 A;  2AIZ P;  1S72 F;  2IQQ A;  1CLI A;  2CWJ A;  2UYJ A;  5GIO C;  3I3F A;  4TZZ A;  2CW4 A;  3VYT C;  1YIT F;  5DCV A;  3HAX D;  3V4D A;  5KMG B;  5LA6 A;  3DDN A;  4ZI7 B;  5KX5 A;  2Z1T A;  2RB9 A;  2ZAU A;  1U3P A;  3CC7 F;  5G4U C;  4BY9 D;  1NJI H;  1Q82 H;  3LWV C;  5GAN K;  2CHS A;  4B46 A;  4BVR A;  3HKD B;  5J2U A;  1PF5 A;  5IYZ A;  1VQ6 F;  3RYI B;  3QHD A;  3Q8H A;  4X20 A;  3IR9 A;  5GON B;  2UYN A;  5AVM A;  1M1K H;  3KE1 A;  3GTZ A;  2P6Y A;  5LP6 C;  2HS3 A;  3JAM M;  1YIJ F;  1PXW A;  1DT9 A;  1Q86 H;  5CA0 B;  3WJQ A;  4ZOL B;  3MCA B;  1IV4 A;  3CD6 F;  4XCQ A;  3OW2 F;  5LP6 A;  3F0D A;  1QAH A;  4O2A B;  4ZHQ B;  3K14 A;  3KJJ A;  2JNB A;  3C8L A;  5J2T A;  4BT2 A;  3BYQ A;  1TVK A;  3WGN A;  1W42 A;  4O4I B;  4I4T A;  3MBM A;  4G4X A;  5JVD A;  1OAP A;  1FNK A;  3JAK A;  3O85 A;  4YJ3 A;  4O4J A;  1VH8 A;  3HKB A;  4PWT A;  5EZY A;  5JCO A;  2HS0 A;  3N4Z A;  3JAT A;  3J80 M;  1W5B A;  1FSZ A;  4R40 B;  3JAW B;  4TUY B;  5EYP A;  4LNU A;  1IPA A;  4U3J A;  4I50 A;  3HKE A;  2BTQ B;  4G4V A;  5EIB D;  3WXM B;  5CB4 B;  1X52 A;  3N2G B;  2Q1X A;  2L26 A;  3CC2 F;  1XBI A;  1TUB A;  1VQ4 F;  3JCM M;  4X1K B;  2VGM A;  1H7M A;  4RHA A;  4NQ3 A;  3F0E A;  3S0H A;  2H8E A;  5B8F A;  3R0P A;  3N2K A;  2RHJ A;  3E22 A;  1H48 A;  2NMU A;  3U0O A;  1VQL F;  4X3M A;  5LOV A;  1X7P A;  4EB6 A;  2DT4 A;  3IEW A;  3TD3 A;  3B6N A;  1QD9 A;  3P0Z A;  1U3L A;  2EWC A;  4C81 A;  1RQ7 A;  1VK3 A;  3OBW A;  3I56 F;  4C8I A;  5LA6 B;  5KX5 B;  5JH7 A;  4TUY A;  2CHT A;  3WGK A;  1SA0 A;  1W57 A;  1NQ3 A;  2CZW A;  2LCA A;  5EB1 B;  2ZF8 A;  3NK6 A;  4EI7 A;  4EI9 A;  2FC3 A;  1T0A A;  2CVL A;  4IIJ A;  3VI6 A;  4F6R B;  1VQP F;  5J2U B;  3GHZ A;  1YGY A;  5IYZ B;  2HS4 A;  4O2B A;  1W3E X;  3LWQ C;  2HVY D;  3RYH A;  3GYQ A;  3K12 A;  2HQS C;  2HP3 A;  5FLX M;  4ZHV A;  3JAS A;  5IT9 M; 
#chains in the Genus database with same CATH homology
 3IR9 A;  1M1K H;  2QI2 A;  3I55 F;  3JAM M;  1YIJ F;  1PXW A;  2KTV A;  3CCS F;  3CC4 F;  1DT9 A;  1Q81 H;  2VGN A;  4C4W C;  4X3L A;  3CME F;  3SIV A;  3CPW F;  3V7Q A;  5GIN C;  3LWO C;  1GO0 A;  1Q86 H;  3G4S F;  3CCU F;  3FFM A;  4EI8 A;  3SIU A;  1VQN F;  3MCA B;  1KC8 H;  5A2Q M;  3CD6 F;  1YJ9 F;  3CMA F;  3CCJ F;  4XCQ A;  3OW2 F;  1YHQ F;  5GAP K;  2LBX A;  1N8R H;  3NVI B;  3CG6 A;  1VQ8 F;  2OTJ F;  1CK2 A;  2QA4 F;  3CPQ A;  1X7O A;  2JNB A;  1QVG F;  1K9M H;  3D00 A;  3CCM F;  1RA4 A;  1KD1 H;  1W42 A;  2WAL A;  2OZB A;  1ZWZ A;  3LWR C;  1YJW F;  1VQ5 F;  1W40 A;  3AGK A;  1GZ0 A;  1VQ9 F;  3O85 A;  3OBY A;  3N4Y A;  1VQO F;  5G4V C;  2F9Z C;  3CCE F;  3N4Z A;  3J80 M;  5HXU A;  2FGY A;  1KQS F;  2KG4 A;  1IPA A;  3CCL F;  5FJ4 C;  1YJN F;  4LCK A;  2QEX F;  3J7A R;  5HY2 A;  5EWR A;  1VQK F;  5GIP C;  3WXM B;  3V3T A;  3V7E A;  1X52 A;  2BO1 A;  5HY1 A;  1RLG A;  3NK7 A;  1GO1 A;  3CCV F;  3G71 F;  3CCR F;  3CC2 F;  1XBI A;  1VQ4 F;  3JCM M;  2VGM A;  1H7M A;  4NQ3 A;  2ALE A;  3E1Y A;  1K8A H;  1Q7Y H;  1VQL F;  4X3M A;  1QVF F;  1X7P A;  1SDS A;  1W2B F;  3PLA C;  2KTU A;  1JJ2 F;  2OHW A;  3VMF B;  3NMU C;  3NVK E;  4BVT A;  1NMU B;  3G6E F;  3OBW A;  3RA5 A;  3I56 F;  1S72 F;  2AIF A;  5GIO C;  3J81 M;  4TZZ A;  2I6D A;  1YIT F;  5DCV A;  3E20 B;  3LFO A;  3HAX D;  2CZW A;  2LBW A;  3NK6 A;  3PAF A;  4EI7 A;  4EI9 A;  2FC3 A;  3ON1 A;  5HWE A;  1M90 H;  1T0K B;  3VI6 A;  3RA6 A;  4NUT A;  1VQP F;  1K73 H;  1CN7 A;  4BVS A;  3CC7 F;  5HXZ A;  5G4U C;  4BW0 B;  4BY9 D;  2GLZ A;  1YI2 F;  1NJI H;  1W41 A;  1Q82 H;  1VQM F;  3LWV C;  2OTL F;  5GAN K;  1W3E X;  3LWP C;  4BVR A;  3LWQ C;  3HJW C;  5HY4 A;  2HVY D;  3CCQ F;  3GYQ A;  3CXC F;  1E7K A;  1VQ7 F;  1VQ6 F;  5EO3 A;  5FLX M;  4BVQ A;  5IT9 M;  5HY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...