4ZOLB

Crystal structure of tubulin-stathmin-ttl-tubulysin m complex
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 177
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zolB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zolB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zolB01
4X1KA 3JATA 5JQGB 4IHJB 4TV8A 4U39A 4EB6B 4E6EA 5EYPA 4M8IA 3HKCA 4O2AB 3HKEB 4YJ3A 5MN6A 4FFBB 3JAKB 4EI8A 4LNUB 4I50B 4ZHQA 5BMVA 1Z5VA 3RYFB 4TV9B 3N2KA 4HNAA 3RYIA 4O4JA 1TUBB 5JH7A 3JAWA 5LXTB 5ITZB 5KX5A 2XKAA 5EYPB 4WBNA 5LP6B 3HKBA 4DRXB 5LOVB 2R6R1 5CA0B 1JFFB 4X1YB 5EZYB 1RQ2A 1OFUA 5LYJA 1RLUA 5IJ9B 4B45A 4YJ2B 5IJ0A 3N2GB 4EI7A 3RYCA 4I4TA 5CA1A 1TVKA 3M89A 4O4IA 5MN5A 4XCQA 5J2UB 4IIJA 3ZIDA 4X20B 5IYZB 1RQ7A 2VAPA 4I55A 3WGKA 4TUYB 2VXYA 2GVIA 2BTOA 1FFXA 1FSZA 1W59A 3VO9A 3V3TA 4O4HA 4X1KB 3JATB 5KMGA 4TV8B 2R751 3E22A 4X1IA 2VAMA 3ZBPA 3JALA 4ZOLA 5CB4A 5J2TA 4U3JA 5JVDA 3HKCB 4YJ3B 1SA0A 2Q1XA 3RYHA 3HKDA 4EI9A 5C8YA 4O4LA 4ZHQB 5BMVB 3N2KB 4HNAB 3RYIB 4O4JB 5JH7B 5FNVA 5EIBD 3WGLA 4O2BA 3JAWB 2RHLA 5KX5B 4B46A 5GONA 3CB2A 4ZI7A 4WBNB 3HKBB 3JASA 3UT5A 1Z5WA 4F6RA 2BTQA 5MN4A 3JARA 2RHJA 5LYJB 3RB8A 5LA6A 5IJ0B 3RYCB 4I4TB 5JQGA 4IHJA 5CA1B 1TVKB 4EB6A 4O4IB 2Q1YA 3C8LA 4IIJB 4DXDA 4O2AA 3VO8A 3HKEA 4FFBA 3WGJA 3JAKA 4KWEA 3VOAA 3M8KA 1W5AA 1W5BA 4I55B 4LNUA 4I50A 5JCOA 3RYFA 1FFXB 1W581 4TV9A 2XKBA 4O4HB 1TUBA 3R4VA 5KMGB 5LXTA 5ITZA 3E22B 4X1IB 3VPAA 3JALB 5LP6A 4DRXA 5LOVA 3WGMA 5CA0A 5EIBC 1JFFA 4X1YA 4ZOLB 5EZYA 4U3JB 5JVDB 5CB4B 5J2TB 1SA0B 5IJ9A 5JCOC 1W5FA 3RYHB 2RHOA 4YJ2A 3N2GA 3HKDB 5C8YB 4O4LB 3WGNA 5M7EA 3VOBA 2RHHA 5J2UA 5FNVB 5LP6C 4O2BB 4X20A 2VAWA 5GONB 4ZI7B 5IYZA 3JASB 3UT5B 4F6RB 1W5EA 2BTQB 3JARB 4TUYA 3ZBQA 5LA6B
chains in the Genus database with same CATH superfamily
5CT5A 4FFLA 4QQ8A 4I6GA 3C3XA 1BSVA 4NZ9A 3GCZA 1JDZA 4IMIB 3DMYA 1NN1A 2VK2A 5LYJF 3F8SA 3FSGD 2XQFA 1XTTA 5AM5A 2ORIA 2CL6X 3EF3A 3L0SA 1P2UA 4D0RA 3MMZA 3OBWA 3FJ1A 4WCFA 2R6CA 3STXA 1GSOA 1DFGA 2VQEO 3H2JA 3J81A 4X1IA 2GUZB 5BT9A 2VHZA 5ALQA 1R66A 3OUTA 2X0NA 3WK9A 2FQYA 3GN2A 3QUSA 2YNMC 3KO8A 1WIWA 2ZR8A 4X3PA 1ZC4A 1RBMA 1M7BA 2E48A 1C7IA 1IMJA 1OT3A 3ECSA 4PFKA 4X6LA 1XPRA 3FOZA 2CTPA 1Z4KA 1WCWA 3FPGA 4EP1A 2F3RA 2PTMA 1EXWA 1BHAA 3BDAA 4UARA 2ZUTA 3CLUC 5AVUA 3SJZA 5B1BB 1JQEA 1ODEA 4RKQA 3UMFA 4NHOA 2C2KA 1QX3A 3PVCA 3BGWA 4DLVA 3A3NA 2ERXA 2EBOA 1R8XA 3R5SA 1KI8A 1DAKA 3PLAC 2RBEA 3AR2A 4JJ6A 5K8JB 4PLZA 1KO4A 5CEEA 2FPWA 2DTEA 4PX2A 4IDNA 4FGWA 1GRCA 2BBOA 3KOZA 2BE3A 3RREA 4ZOBA 1P1RA 3ZIDA 4PLGA 1NKDA 4GE3A 2RGAA 1Z34A 3QTCA 3RSSA 2P79A 4UXIA 3NAQA 3NWEA 2P68A 3I76A 4I81A 5JRZA 1YDEA 2QAIA 3HB5X 4R50A 4JC0A 1PZGA 3I9MA 4DQVA 1YDGA 1D2MA 5T3UA 3HTXA 2Y9MB 2AOVA 1RNLA 1E63A 2J41A 2CSLA 3QK7A 2IJIA 3LLUA 3IBSA 2W6IG 4U8HA 1GM8A 2A0FA 2M6LA 4XJXA 2O8DB 2LWIA 4LF5B 4PC2A 2ZSIA 1M0EA 3KKPA 4F3NA 2IP4A 2CVLA 3MJDA 3FCEA 4UMVA 4RY0A 1P7BA 3NOXA 3CEMA 4MVJF 2O23A 3ZK7A 2O20A 1KI7A 2ANCA 3B13B 4EHJA 4FX2A 1JX9A 4LV5B 1VP3A 3J7AC 3B2QA 2BEKA 2ZUBA 4Q9DA 1RLGA 3R41A 4XTRA 5ITWA 2CNKA 2ZKOA 2UXNA 1JFSA 3ID6C 4AWXA 1OFUA 2CT8A 3TQIA 4PO8A 3K0FB 3DXRB 2O0JA 2J85A 3IB3A 4MA5A 3S6JA 2VP0A 3TJZA 3U9SA 4B3MO 1S4MA 2GAOA 2VK4A 3ZDBA 1J8DA 3EZLA 5KQGA 2CN1A 3GBVA 5LP1A 1WPRA 2JGEA 1US8A 2GYUA 1M73E 2XUDA 4YAUA 3A7EA 3C3JA 2VQFB 2WMDA 1QUFA 5AHKA 1FJ2A 2ZU6A 4QL3A 1S9DA 2Q7XA 2ISSD 3W3AA 3FTQA 4OIMA 4CKEB 1HXHA 5HY2A 2P6MA 5KVSA 2JS3A 2GHQA 4AMZA 4UM7A 4DQUA 1XE3A 1EZVH 1NE2A 3NJ8A 1AUPA 1PAUA 4R81A 4O4JA 5JO0A 1SBHA 3VR2A 3E53A 1VF6A 1ZP6A 2RGCA 5AI5A 3HCAA 2C04A 3W77A 1BVUA 2QD2A 1B42A 2FRXA 3W2HA 4PWTA 2EATA 4MGHA 1PFYA 4ID3A 3DEZA 3KLNA 3H8VA 1I7NA 5AUPB 3TUJC 2GZLA 3ND9A 5BO5A 2SCUB 2WILA 3RVSA 1ZS9A 2ZJBA 2IIPA 3DE6X 2FZCA 1VH8A 1W41A 3GFSA 1SCNE 3C4JA 3CG0A 4TRRA 1MN6A 1HW7A 1SXJC 2BKEA 5AVTA 3E1KA 3GJ4A 3CUVA 1FDUA 2CD9A 8ADHA 3I4CA 2FUG6 1X8KA 2WIJA 4F6RB 4RVGA 4RPCA 4CIXA 1H1LA 4P93A 1MRZA 3AG2B 4B6EA 2V65A 1E1NA 3D4NA 5G4KA 1Y5IA 3L05A 3S1AB 1OAAA 2R6AA 3EMVA 4JSTA 2I66A 1PL6A 3WGGA 2KTUA 3QV1A 2FMUA 4C3ZA 2RG7A 1RQXA 2JFPA 1P7GA 4HNTA 4TGLA 4EL5A 3HMKA 1QIIA 3IEVA 1C7RA 3FYEB 2ORED 5E3JA 4JLUA 2V6BA 1QRDA 1SK8A 1UFIA 4ND5A 3TNDA 3IPYA 3PHJA 3GFQA 3PU6A 1T4GA 1P5HA 2VUTA 1K8AH 2QTWB 1TADA 1ZL0A 1ECBA 3FB8C 2Z01A 5LDDC 1QHSA 3DLIA 4PIPA 5B3AA 1E5LA 5EOVA 3RA5A 3CH7A 4ZVOA 3UXHA 5FNVB 5CA1F 2VDWA 4YMUA 5AJHA 3L8DA 1PWYE 3JPYA 2HGSA 4K05A 4M8IA 3KXKA 3NC0C 3GVPA 5A7FA 5K3DA 1QYXA 2BMWA 4OHPA 3S2YA 3I45A 5H81A 3L8CA 2P1ZA 4GI3A 2EKDA 3WKDA 3A31A 4RZSA 2PUTA 2DQ3A 1V16A 1JG7A 5K3FB 2XUMA 2WRZA 3OEEA 3E22A 1DX4A 3ZLBA 4DCJA 3AU8A 3EVEA 3ZWDA 2LGQA 5K4GA 3HA3A 1G0NA 2YFQA 4L4XA 5BUCA 4WFQA 2PMPA 3E9NA 2Z2JA 1T9BA 1JBKA 4RJIA 1VHQA 3OCWA 2XWPA 3IOCA 3QG1A 4YJ3F 4INOA 3JZDA 2PNFA 2OXRA 3GXBA 1RKUA 3TBHA 1NPDA 3IA7A 2QBYB 1A7JA 4G6ZA 5BW6B 4LSZA 4EW6A 1KI2A 3ESYA 1VHWA 4AILC 4L3VA 3GLIE 4AZTA 3AHCA 2QAGA 5DSXA 1JPUA 3MD0A 1F8UA 3IAEA 4UUNA 3N3AC 1ZU5A 4LBEC 1T0KB 2H48A 4B4UA 2FNAA 3MWJA 5CBHA 1N4DA 1Q0QA 4MKIA 5AI9A 1ACLA 3ZTWA 2QMQA 4BB0A 3OCYA 1LFDB 2A9RA 4IPTA 4GXTA 3H4TA 3A58B 1GZ6A 4UDYX 3ZRVA 3RC2A 4QPCA 1OXMA 5F7OA 4M1WA 2MINA 2YWGA 2KGWA 2AUTA 1V0JA 3AWDA 1NPYA 1A9XA 1Z5UA 3L4BA 4CTKA 2P6PA 2XUPA 4K6GA 4RD2A 4TWRA 1KMMA 3IC9A 2ZUVA 2J9FB 3DC2A 4BFCA 2IYVA 5JIBA 2H1CA 1FYDA 3WHKA 3AC0A 3GH3A 1KNXA 5FLYA 6PFKA 1NV9A 2C7GA 2YW2A 1LK5A 1C4WA 4TSKA 1TCBA 3DTNA 4FU0A 1NQTA 1ETUA 1PPJH 4YT2A 1H9CA 1HDEA 4J10A 2JJ1G 1ISSA 1U8XX 4RX1A 4RGBA 3SPJA 1FMJA 1GG2A 5DP2A 1HE5A 3GBSA 2CFTA 1M2JA 3WAGA 1TO1E 4RMJA 4CLOB 4NESA 5L3ZA 5JAMA 1XNQB 2XUIA 2P3QA 2C57A 4NSNA 3A1TA 5B6PA 2FPMA 1XYYA 4JJAA 2WIFA 3D4LA 4PZ0A 4UNIA 5KVAA 4YP7A 1RYZA 1E1KA 2ZSBA 1Z0AA 2W6MA 2C2WA 1NSTA 5EJ7A 1GFSA 4OPMA 4L4YA 2OWOA 3SS9X 4NB5A 1NH2B 1YJAA 4CFSA 4H60A 1SBZA 3P96A 5FBKA 4DQXA 4ZU6X 3HM2A 4JNCA 2KLBA 3W6OA 3PEUA 4LFBO 2GT1A 1U2RA 2R9VA 4G1UC 4HTAA 4U2FA 3TW8A 5C7IO 1X7ZB 5BSFA 3ZDRA 4XIFA 2X9NA 5B4UA 3G2HA 4I4TF 1CSEE 3NJ4A 2WLHA 5J9FA 1N8NA 4QASA 1ODTC 3CEHA 3CUEF 3E23A 4JGSA 1TYAE 4U9HS 1Q57A 4Q4CA 3DNPA 4RVHA 1DUVG 1QLEC 1KMQA 3VTAA 1EFKA 2ID9A 3IR9A 1G1XB 4HAWA 1WKBA 2OHHA 2HOQA 2C5AA 1FNBA 4ZCSA 3EASA 2IEYA 2GM3A 3CO0S 3BF8A 3NOOA 3T99A 1XHZA 2PF4E 4NWOB 5C1PA 4OL0A 2KBEA 2Y69C 1T2NA 1VQLF 3ZCXA 5DXAA 3U4CA 1NFRA 4ZTUB 4L3WA 1WBJB 1CUXA 4EPVA 4PG5A 5DYTA 4P3PA 2C4TA 5LHHA 3K9LA 3H7IA 1GPYA 3K59A 4FYIA 1DIOB 3L0YA 1N6RA 4XH9B 1TECE 2O8BA 1YZ3A 1J90A 3OGCC 1RWOA 1JG3A 3DYBA 4W8GA 2DUMA 5FAXA 3INYA 3RQIA 4IR7A 1Y6RA 4RV9A 2DQKA 1N2EA 2BOCC 4NJMA 1UK8A 3S27A 1N32B 4KDRA 2HU8A 2RGUA 2WHPA 5AESA 3IAYA 1OX6A 2FMFA 1LPMA 1YJQA 4BNXA 2GBCA 4RGQA 5E8JA 2XYGA 3NUZA 1JJIA 4XI9A 2QR2A 5KAIZ 1QYCA 1F7YA 3W9UA 3ZBTA 2W6PA 1D04A 2H9YA 3IIEA 1KDTA 2V0NA 1NF9A 1M2KA 2WJWA 2JCYA 4LZAA 1NX9A 4G97A 4ZYXA 4A4DA 2ZRKA 2GGSA 5M2QA 4QGAA 4EBFA 3KHUA 2XIJA 2B98A 5CVUA 3JVEA 5JG7A 1GLVA 3ZV3A 1QP7A 4FYJA 3EMDA 4JX8A 4LXGA 5GZ1A 2B8NA 2NAPA 1IUOA 3VX4A 1XKLA 2G4VA 3BFXA 2XCUA 5EZYA 4C3OB 5L3SA 1RRPA 2Y4UA 3QKSB 3KLPX 4Q3KA 1H8HG 1J9GA 4EW2A 2A0LA 2I54A 4NYJR 3H5VA 3PWSA 1EB9A 4HVTA 3ABKB 3KD3A 5IK2D 3NGLA 2QWNB 4PSKA 1OA0A 2VH5R 1T26A 4RK7A 3ZLTA 2RIPA 4IXMA 4PQGA 2ZETA 3RTCA 2V3VA 1ZGJA 4B75A 3PKJA 2QVCA 3BF7A 1Y7TA 2YWFA 3C48A 2CLIB 2Y93A 3HPRA 4Y1EA 5D3MB 4DB2A 2DH6A 1LV7A 2H1WA 1FMTA 3U4QA 4JP8A 2EKZA 4QPJC 4KQHA 3SDBA 3X2QC 4LE0A 1DARA 3A05A 3K73O 4N5HX 4NYIR 4GDMA 2ZWAA 4X93A 4JVMA 1G7SA 1U3TA 1E3SA 3WE7A 3UCSC 4Q3NA 3GWGA 2NO5A 5AK0A 3WK6A 4AF7A 3HXOA 2BFEB 3VJLA 1SZXA 4NXMO 3T2MA 1PHPA 4UBLA 4Y0AA 4A6PA 2YZGA 3KZNA 1CT9A 4LFAO 4KMSA 3P2JA 4JI0B 3AL2A 1Z75A 5L53A 4YRGA 5L3DA 2FAXA 3TBFA 2PZ8A 4COOA 5KS2A 1G2IA 1JE0A 4LRTB 3WFZA 4ABTA 4XYGA 4NC9A 2OY0A 2R3SA 1R16A 3L0IB 1DDOA 1EA7A 3U7JA 2JI9A 2IELA 4HH4A 3DTVA 1BRTA 2P65A 5KSZA 1JF8A 4UREA 3ANMA 1ECJA 4O4LF 5JQWA 4FM9A 1VQOF 3RS9A 4ZI7F 1T4CB 3GPCA 1ZJ6A 5DRTA 5ENDA 1IN7A 4FLUA 5G0WA 3DZIA 1G8JA 1VQMF 5L3CA 3HBLA 4IYHA 4QXRA 1ZIYA 3WQQA 4DMKA 3IKEA 1QLNA 3QE4A 4CS4A 4RF3A 4CCWA 4YXFA 1WCV1 1ZVKA 2ZYGA 1QK4A 1CR2A 2I6TA 3BCSA 1MEJA 1FS6A 5EN4A 3SFZA 5IMSA 2G9RA 2HJGA 1B26A 4EA8A 5D86A 1FFDA 1DJNA 5JY1A 2J48A 3HGMA 4QKQA 1IJFA 4MKFA 3N74A 3W05A 3JAMN 3UT0A 2BM8A 1XTKA 2G5CA 2GMWA 3LHFA 3OA2A 3D8RA 5ED0A 4NPHA 4W4TA 2C5BA 4XVHA 3J80A 1DX6A 4JAUA 3NOQA 3OURA 1EUCA 2QGFA 3M89A 4L4UA 3IAUA 2Z6AA 3P45A 1BS3A 2IBMA 1U0BB 2QR3A 5B1DA 5IAOA 2Q07A 3ZPXA 1Y82A 4GO1A 1FDOA 4CVNA 4I4NA 3ERNA 2QM7A 4WKBA 4JK3A 3MTGA 3KVVA 3K1JA 1TX4B 4BEBA 3STWA 3KPVA 3HABA 4HC4A 1Q86H 4ED9A 4D2IA 1PJAA 4RAQA 2R8ZA 4NNOA 1TJPB 3MFYA 3KSRA 3RAFC 4KR3A 4JYMA 2PS9A 1W87A 3JRWA 4LYFA 3IQXA 4Z7QB 1AB6A 1IB6A 1QC5A 3GAFA 3ZWOA 3H1HH 3IMPA 1E96A 3LWQC 3F1KA 5K2MA 3DL4A 2G6TA 3NX4A 2Q7HA 1M54A 4BJ5A 5IYBO 3BAFA 3ZXSA 1KBZA 2C4HA 2VP5A 4BXOB 2FHPA 3ISTA 2BLLA 2VH2A 5KJEA 2QPOA 2W71A 4CLRB 2ENWA 1XP8A 3P9XA 5FLXM 2IW3A 1QXSA 3LMKA 3AR5A 3SN6A 2PUFA 3RRJA 2WR8A 3DYVA 3QV2A 2O3QA 3ABTA 4TWAA 1ZR2A 2X5KO 2HIGA 3T1CA 3TDMA 5B3KA 1RM3A 3QKWA 2OYSA 1J1ZA 1K8ZB 1R5OA 4UU8A 4U7NA 1AGYA 3HUUA 3KZOA 4IHJA 3JQ8B 2Q50A 2Q7OE 2WG0A 3CNHA 1NVTA 5DGTA 4YR7A 4YRCA 3ILXA 1FP6A 1YI2V 3KVRA 4UHHA 3EXFA 2A57A 3P52A 2IH2A 3PDWA 4G4XA 2WK1A 1HEUA 4G0NA 3ABLB 5DTRA 2CWJA 4WK6A 4JZKA 4FR2A 3C8ZA 2JGNA 2B2XA 2LW1A 3MZ0A 3DL2A 3JTEA 2FR8A 2IUFA 4GD3Q 1IAQA 3H17A 3QLTA 3U56A 4URZR 3KQYA 3S06A 4KXXA 5BY1A 1BW9B 1D2DA 3OEYA 4CIAA 4LRXA 3FTCA 1M34E 5IN4A 3Q9SA 5JVDA 4JEUA 3ZCPA 4HD8A 3T3OA 5FEMA 2HB6A 3QX3A 3W5DA 2ACVA 3UT5A 5LD2B 2VEDA 3RV3A 2CVZA 1U3UA 5CXXA 1XCJA 4CMEA 3CH5A 4BVJA 3RT1A 3BL8A 2OFPA 4PG8A 1E9AA 3EGWA 1JQ5A 2EBWA 1V6CA 2AWNA 4EJ2A 2XEDA 4AMVA 5KOHB 2HEPA 1Q19A 2XWQA 2VDJA 4HNUA 4IFTA 3AY3A 2YHAA 3T7EA 1WUIS 4ZVNA 2XCLA 5HGJA 2I7CA 2PO5A 2Z5FA 3PITA 3FI9A 4E32A 1PT5A 1Q3KA 4XIGS 4MXDA 2H2IA 4DIFA 5GVRA 2VRBA 3GAMA 3UC9A 4LRYA 3C3BA 3EPRA 3ZVMA 2DEUA 1DAOA 4XGNA 4KH1A 1K92A 2ZYIA 3DFFA 1HA3A 2R2AA 2W42A 1HBJA 3DVQX 4Z51A 1F7UA 3T15A 4LV6A 1ODCA 1R73A 2HCTA 3SYTA 2OVFA 1YHZA 4MV8A 5BN4A 5LMCA 4K03A 2W2VA 4OSPA 1PFQA 2DP4E 4LIPD 4ZAYA 4JLKA 2HKOA 3G0BA 3AEKB 1YXMA 4OOFA 2DVMA 4HLUC 4J76A 5BOSB 3UPTA 2VT3A 2QA5A 4KYVA 5CN0A 4HTFB 4L0CA 1Z12A 5BSEA 1PGJA 2CLSA 4QIWF 4H15A 4RTNA 3WQBA 1AM4D 1EWRA 2RHHA 4DADA 1XCGB 2GPSA 4KXUA 4IHAA 3CISA 1OD6A 3IUJA 1UEJA 2FU5C 1SZTA 4A73A 1FTSA 4UBIA 2EEPA 2HCBA 1URFA 3KSMA 3WK5A 4I50B 3PT5A 4JBWA 5ALYA 1MHTA 1U3WA 1ZU4A 1SHTX 4LSGA 2VWQA 1B1CA 2QIPA 1D6NA 2J6CA 1GCAA 4D9CA 1YITV 1WCXA 5ALGA 2CB9A 4WXPA 4HBNA 3S1LA 1E1CA 3OQNA 3T9BA 4OHOA 3ZS8C 1YZQA 5TX7A 5AK5A 2DX7A 2CZGA 3DT9A 3D0QA 3SY8A 1CY2A 4HGQA 5TISZ 1M67A 4JBYA 4RHUA 5EPEA 3DLHA 2EVWX 1ZMBA 3EDQA 5B4TA 1O94C 1U7OA 5CLGA 4QQNA 4RNDB 1B06A 1MQAA 4JA2A 2QNRA 2UZ0A 4J42A 3IEKA 4HB3A 1TD1A 3ZY6A 3EAGA 2AJTA 3EQ9A 3A37A 1YFZA 2PMKA 4RYDA 1EGHA 4DCMA 4KQIA 4UUAA 2CE2X 3PCTA 4QJFB 2ERYA 4AN0A 2LJ2A 2W00A 4H6VA 4BB5A 5EYPA 3PHBE 3VUEA 3JAWA 1B6GA 5ILGA 3ZHYA 3DHEA 3KB8A 2ZVPX 1A82A 2XUGA 1Y3CE 1PNTA 3GLVA 5FLKA 2W4QA 1NBOA 4I3GA 3HZZA 3I05A 4NCBA 4MIYA 4ZOEA 3ZIAA 3UQYS 2C84A 1MA3A 1JJFA 3HL0A 1F8XA 2VHWA 1IOLA 5GADl 1V6SA 2P8SA 2IKQA 2LKCA 1N6IA 3C43A 2BGKA 2DY1A 3SHOA 2IF0A 4Z1MG 5IVIA 2FSIA 1ZZEA 1ZC3A 4WPGA 1ZSPA 1E9CA 3PRJA 3QYFA 1MF7A 1N8SA 1WB5A 2YXZA 3DMFA 1MOSA 5AHRA 1C3OB 2Z1MA 3EOAI 1WZEA 3LD9A 2ODBA 1OFIA 1Z22A 4MQFA 3AVVA 4C4PA 3I2GA 1KBHA 2V7XA 4U5XA 2K5UA 3NHAA 2OAEA 4H7KA 4HWRA 4OJMX 4BVSA 4OLFA 4BX9A 4LK2A 1E1DA 1PGNA 5DBIA 1M1YE 2FPPA 2O8CB 4WCDA 5J4YA 4CU2A 4NTZA 3GGPA 5D6OA 5AWFC 4MTFA 4DJTA 4MS3A 4RTPA 3MUOA 4KWTA 4TWJA 3D3EA 5KYXB 2C7PA 2P75A 4NMXB 4JQSA 5DTJA 4JXKA 1RLJA 1QLEB 5B1AB 1DQYA 2QTBA 3TQTA 1N7GA 4W99A 1QCCA 5J5VA 1E62A 4GPBA 3GUCA 4JJZA 4RIHA 3UEOA 4NYMQ 3PNKA 6YASA 4LMPA 1KD1H 3ZNOA 1T5OA 1E79D 5CCXA 2UXCO 1EK6A 5TC4A 1XQWA 4TV9B 3DUFB 2YFKA 1XKQA 1YFKA 4I1SA 3WWOA 5C1OA 1X87A 4WHMA 2O5CA 1W5SA 1CF4A 4X91A 3DOHA 1ZA1A 1WLYA 3ASYA 1U9IC 1Y3DE 1WMAA 1EZ4A 5A62A 3SKXA 5AW5A 3KEOA 3AKYA 2VCHA 5KU1A 5I51A 4EYKA 1I2AA 5HQJA 1OJHA 3I92A 4DG9A 2Z9CA 5CX4A 1Y48E 1BHJA 1JN0A 3B60A 5IJ0B 5KDOA 1EJ0A 1Y8AA 2G3YA 2ZATA 1RQPA 1N77A 3A6LA 2PCLA 1XAHA 2FMKA 1N2SA 5EUMA 4ZYZA 1W47A 4BWVA 2Q8VA 3N6VA 4ODIA 2AQKA 3OTHA 4ER7A 4BLSA 3ESJA 1ZEJA 3SYOA 5ARDA 4P30A 2WAXA 1WXDA 4JOQA 3PHLA 1DQNA 3SFVA 3ZQ4A 4RK0A 4XD2A 3MT0A 1QFJA 1ZVMA 2LR0A 2O0HA 2VPPA 4Y9TA 2P78A 1B73A 5EO3A 1I5RA 3LA6A 5A2QA 4P58A 1KJ8A 4NKGB 1LJUA 2IVFA 1V4VA 2GYVA 3R6WA 4LBWA 1BYIA 1CUUA 2NTYC 2JLYA 4S1NA 1I32A 2B4YA 4JHXA 5MFZA 3IP8A 2XA1A 5LOVF 3V4PB 1QR2A 3EQ6A 3THXA 3T34A 1ZWKA 1W35A 1L8LA 1H0HA 1MFZA 2ZULA 4ZK2A 4KPFC 1U2GC 1ZL8A 3CY6A 3UJ7A 2AOUA 1YB7A 1DS6A 2B83A 1OAOC 1NG1A 3E2PA 1IVNA 5K03A 2O48X 5EMMA 5BN1A 2PGDA 1R00A 3OZDA 3TZLA 1YD7A 2EWCA 2RKWA 1QV6A 4EY7A 5HJ2A 9GPBA 1YQDA 2YC0A 3OX4A 1QIDA 1XEXB 4E5DA 2EAUA 3ZHXA 3QNWA 3N9IA 3D8CA 1O6GA 2IXAA 1WG8A 2R72A 1YZBA 2OTLF 1L6RA 2GZMA 1KC8H 3FJOA 3GUVA 3N6RA 3K5IA 3MCUA 2DERA 1RLTA 3H4IA 2VJMA 3EBLA 1FPOA 3X2QB 1FQKA 1JIUA 3DB1A 5LQAA 2LP4Y 4JI6O 3P71T 2A88A 2D59A 4J16A 1Z0SA 4Q20A 1IM5A 4B3GA 3BYZA 2D3OW 2PUAA 4QARA 5GIOC 2VSXA 3G2PA 4YCCA 1QCZA 1KYOF 2GKSA 3I0ZA 2FCRA 1Y5LA 1N0VC 1HF3A 1PV0A 1BZKA 5EAIA 3TGWA 1GL9B 4BMVA 4B3TO 4S24A 3G9ZA 1P2TA 4B8WA 5CDTA 4KUHA 3WRYA 4RA9A 5KUKA 2QTHA 4ZJUA 1SKYB 3HU3A 3IP1A 4HDQB 2WHQA 1R0KA 3VHXA 3PGLA 3HCEA 1U5AA 5JI2E 3EPLA 3IP7A 1FS0G 4II2A 3ZCQA 4R2LA 2ONYA 5JDIA 1NR1A 3ZMSA 3TVYA 1YHYA 4MTOA 4HGYA 1BCCH 5AIBA 4TKLA 2X5NA 3COPA 3BAAA 3FGPA 3M3PA 4K8XA 1T2AA 4MARA 3QJYA 4V0LA 2Z2KA 3I9V6 1W85A 3LKVA 4B79A 1UJ2A 2C2BA 4R01A 2CZQA 1UT5A 2C2MA 4DLTA 5I9SA 3MGGA 3JQ9C 5BR7A 4RUFA 1SIOA 3MCWA 4GBMA 3VR4D 3ZQ6A 1LH0A 3ABOB 2GZRA 4CJXA 3I1FA 1LA2A 1MABG 4O1IA 3IXLA 5ALPA 3H2IA 1SK9A 1O9HA 5C80A 16PKA 5CPFA 2PKXA 3D4PA 3KUCA 4QWWA 5J1SB 3NBXX 1NYQA 5AM2A 4WOKA 5DGDA 1FMCA 3FFMA 1PNVA 3BIOA 3MGBA 3CX4A 5ESXA 4DABA 1UUFA 1A9QA 3EXEA 2VDNB 2IYEA 3V46A 3T7DA 4XBFA 1QS0A 1QV9A 4JN6B 1Q0UA 3K5HA 1N4AA 1RC1A 1IQ0A 3DQPA 4LMBA 2Q0XA 4KQ9A 3VZSA 1WMFA 3BFJA 4FDVA 3CZRA 3OE7D 3ZHTA 1GZ0A 1AO3A 3THWA 4MVYA 4U9IS 3V6MA 3RBXA 6ABPA 4Y6SA 5TQ0B 1C3VA 4UUQA 2P9TA 5AW8A 3ZWXA 5KNCH 1P0CA 2ZI6A 4G86A 4S1PA 2IZ7A 1KYXA 3AETB 1OH6A 1N2BA 1RC8A 1PR1A 4L78A 3I0NA 3MVEA 3VISA 1NVGA 4ZT2A 1X4TA 2FPKA 4TS4A 4OXQA 1VQ7F 2O2HA 3ZHCA 4KU4A 1GQRA 3EYAA 3LGXA 4BQSA 3D3WA 3RUAA 3QNEA 2R65A 3LDEA 2PYLA 2BD0A 5KTTA 1G17A 4P9PA 3BH6A 3P2EA 3SEFA 1FMFA 1X7XB 1MOPA 4DM3A 4M6WB 1A4IA 4NZOA 5IAJA 2VA8A 2PZGA 3R0PA 4GKBA 3QOXA 1UXIA 4MI9A 4N7JA 2YVUA 1CUWA 2A9QA 4K7JA 1KZYC 3NTUA 1X7GA 4YJFB 4IZ6A 5DKFA 1HETA 4MV9A 2Q1XA 3FD8A 3RYHA 1I13A 1I3CA 4X64B 3U81A 3ODGA 2IPXA 2NNWB 4YRPA 2DUWA 1RADA 2VNKA 3K5PA 5A3VA 3L93A 3U44B 4L5JA 3F4BA 3H0CA 2VS0A 4ALIA 4NABA 1T0JB 2IOHA 1NAIA 2AGAA 4D3YA 2A1UB 1D4FA 4P3OA 4Z2WA 1T9CA 3S8YA 3HMQA 2QUJA 2WAMA 4CWAA 3GUUA 4EX7A 1BSMA 3KCXA 4BL5A 2AF3C 2ZBFA 1IZ8A 4NJOA 4ITUA 2C03A 5KREA 3PQ2A 4EG7A 5I4CA 3K2IA 1GGJA 421PA 2WSSD 2P6UA 3IGAC 5CBPB 3AVPA 1EP2B 1L1EA 1JDVA 3FSJX 4DR2B 1DELA 1XTQA 4CIWA 1Y81A 3IUYA 1G9TA 3F0TA 2RB9A 3OQHA 1HTWA 2Z56A 4EAAA 1E1RG 1GG5A 3UENA 3W7SA 4LF4O 3NDRA 1U63A 4MVRA 3KAQA 1KNJA 4B3XA 1ZA2A 3OIDA 3O8DA 5B6JA 2EEZA 2QNBA 1B8OA 4OIFA 4JYPA 1KMIZ 5FWYB 1QGAA 1DUSA 3QE3A 1X9HA 2XVZA 3KLOA 3ILSA 1NNI1 3PTZA 1QTNA 3L1JA 1NI4B 3HB3B 2PUBA 1DBPA 4BZZA 1W49A 2PT5A 5T6BA 1UBOS 4BVRA 4JMPA 1ETHA 3CC2F 4G0VA 4HNAA 5FPQA 2D7CA 1GPMA 2O2IA 1IBRA 4HDCA 3QUQA 1W0CA 3L74H 1FUEA 1R6DA 1RJ9B 5EZ5A 4QODA 4XOIA 5GJVC 1CB0A 4GLOA 4MVZA 2GX6A 1WSAA 2QTVB 2KPOA 2CAZC 4HPWA 2NSYA 3KYCB 4M7PA 5D3ZA 4K9LA 2P6OA 4WINA 1ZESA 1N6KA 2R60A 2ZCJA 5TVGA 3T7AA 4R1SA 2DG2A 5J47A 3LECA 3VHRA 2VWPA 4F0JA 2WJAA 2R85A 4UCVA 3OP4A 5ECYA 2H07A 3K0BA 3V8QA 3BHJA 3M0EA 1U8FO 1XJ5A 3OU2A 1FRFS 4EDFA 1OIXA 3IUSA 2BI7A 3UHJA 2Q21A 5H9VA 3OUZA 2JD1A 1ZUNB 3WVNA 3OEHG 1U43A 2VRCD 4N48A 1EESA 4C6RA 5DM1A 4LE2A 4Z9AA 2OWDA 3PI7A 3TLGB 3D6TB 3OT4A 3QOFA 1SDSA 3EA5A 3TZKA 2VHEA 2WJ4A 1ZD4A 2LPMA 2ZJ8A 5EKSA 1DBIA 2R9IA 4I1RA 4JEMA 4RYLA 2Q3BA 1W34A 2BLNA 3ZKWB 1I4LD 1J07A 2X2OA 5EXXA 5CD9A 2D5AA 1WXXA 1OLUB 5IJAA 2EJWA 3WYAA 2FCAA 4U2BA 4ZYWA 4U7TB 3O9VA 3L7IA 2COEA 3GJQA 3SR4A 1S3GA 4FHFA 5DBFA 4F4DA 1SQQH 3KEMA 1O0SA 3DBLB 5IDWA 4B2IA 3W4KA 2R9AA 1UBHS 3I9LA 1SOVA 1XMOO 3I28A 3W1EA 4FP9A 3JQRA 5IUJC 4B3JA 5EXTA 3EVFA 5ETJA 1KWKA 4LDRA 1XRMA 5HMMA 1CNEA 3PICA 4M36A 3GGDA 4TMWA 4N5MA 3WHIA 3DWIA 1W4RA 1NFQA 2WJVA 2QM0A 3BXOA 2OYCA 1SXPA 1IXBA 5IT4A 3PUHA 2JI6A 1U2PA 5LM3A 2NUPA 1WUTA 3SJQC 1K2VN 3AX6A 1VSQA 4BO3A 4FZ0A 2WWXA 5JCJA 5JYDA 3R9IA 4DDWA 1G8HA 3QBEA 1H2GA 2EJTA 3VU9A 3SWWA 1JR4A 3EARA 3S44A 3KUUA 3SIUA 4Z4CA 3ZXUB 4ZAWA 3STYA 5EI5A 1XRJA 2IEDA 3SXPA 1OW3B 1JSLA 1XCBA 2PMDA 4DDMA 3EHEA 1V96A 2P3LA 1XNRO 3CLHA 5HZHA 4DV5O 1L7OA 2NSHA 1JFLA 4IRMA 1OSNA 1X9GA 3VSDA 1G21A 1AS3A 3EBPA 4QA9A 1JIKA 4AKGA 2PKEA 4MV1A 4TLCA 5EPOA 4ZZ0A 4JFRA 5HQ3B 4UNNA 5L4NA 1XVAA 4MULA 2AI3A 2MMCA 2RC6A 5LDHA 3G5TA 3O8NA 1O58A 2WIBA 1ANKA 5I01A 2P2DA 3BY6A 3LYHA 1CP2A 1G8GA 2DBYA 4QJ5A 4LYYA 2G6BA 3JATB 2GNOA 2YL2A 4L02A 3DE4X 1JVNA 3ICEA 2ZXEA 4E3WA 1J95A 3ESXA 2QDKA 2YYSA 3B1XA 2PD6A 3B52X 3O4JA 1O0BA 3ZZ0A 1J5XA 4IH1A 4ALKA 3DMHA 4UHKA 4WLOA 2LXNA 3L7KA 4DJEC 3QGMA 4HFRA 4AS3A 4B44A 3NRBA 4XIJA 4YRNA 2BSAA 4UFNA 3DB2A 1PM9A 3F96A 1Z83A 1ZIDA 1JIIA 1NNSA 1QANA 1OXTA 2DOSA 1SOWA 4DMRA 1RR6A 1KJNA 3RA6A 1JYFA 1PFKA 4CUJA 4F4JA 1Q82H 1M2VA 3SR0A 2FSGA 1KYYA 4TYWA 5AM0A 3IKJA 2R79A 2ODQA 2V6IA 3OF5A 3DULA 4W6QA 1DKPA 4NR1A 4GC9A 1V54B 2A6PA 1EK0A 2JIDA 5CDFA 4BOYA 3IBTA 4QYWA 1FUUA 4K3VA 3FPKA 4OI4A 2MQEA 3LF1A 2Q45A 2Q5HA 1T1SA 5C3UA 2WZDA 2R70A 3ZXYA 4OSEA 1QMPA 1L1RA 2HLDD 3KQVA 3NTXA 4O5OA 4TMXA 3MWDA 4WJKB 4Q7EA 2B78A 4NE2A 5AHXA 1KEVA 2IY8A 3LHSA 2EERA 1OLXA 1N2ZA 5E3IA 3FKSA 3LJKA 2ILMA 3GJYA 3MGKA 3ET5A 4TYNA 3KJQA 5JD6A 1B76A 1JR3E 3CD6V 1NVKA 4OQZA 5G0SA 5JAIA 4AZ0B 1YZYA 1K73W 3OD1A 4D3SA 5K1XA 1TXGA 1CR1A 4CQLB 3BB3A 5KI6A 3NIWA 3AVXA 2ATCA 2Q5JA 2XIQA 2QLTA 3D8UA 3S0HA 4H1WA 2B7BA 4FQ5A 2BTQA 4FB4A 5DX1A 5HILA 2O1SA 4ZP1A 2PNJA 3HADA 3KEFA 5CB0A 3UQZA 4MRAA 1IAVA 2J8ZA 1KSHA 4ZCLA 2YXHA 3RYFA 1J7HA 3WGYA 4LJ7A 3R6LA 1RYNA 2IHZA 1QDUA 5JCPA 4D4GA 4J6EA 5CH8A 2OHFA 1R37A 3SQNA 4BZPA 3ASNC 3JYQA 4IDBA 5LP6C 2AV6A 2FEKA 2XOKA 4PLHA 2HA6A 3TS1A 5TT1A 5IYCO 2CH7A 5JJJB 3DBRA 3CCFA 3VTZA 4E12A 4E33A 4QG3A 2QE7A 2EYUA 3WY9A 5BUSA 3KSDO 1RWBA 4ZT3A 2G9VA 3TOCA 4DA8A 2VHXA 2W6CX 1GKFA 1YU9A 4Z0NA 2QOEA 2YYAA 3QEMB 2VA9A 4F4FA 5JNRA 1VBMA 3OHSX 5ALOA 2GXUA 3GN1A 1N6LA 5CCDA 2X13A 5DXJA 1YQUA 1QQTA 4UEWA 1IHYA 1A7UA 1H94A 4HWOA 4UU0A 1MV5A 4BNYA 1JHDA 3SEZA 4AI6A 1E2JA 4I9GA 3DZ8A 1Y4ZA 4CTJA 4IJWA 1TD9A 3BHPA 2O5RA 3MMXA 4WK0B 3JARA 2RHJA 1QYDA 3RB8A 2SICE 4GW3A 3H01A 3DZGA 3FX7A 3KD2A 4RKEA 1CQIB 1GT91 2ZODA 4DSOA 4MR7A 2C7BA 2O2EA 4LWSA 2ZF8A 4OK6A 2EL9A 5KUTA 1XVVA 1GYRA 4E15A 2P22C 3QF7A 5F3DA 2C7VA 4JLVA 1JB1A 1E18A 2XTMA 3B6JA 4N7BA 4QUJA 3DMRA 2HT6A 4DCGA 5K3EA 3OUFA 1XHXA 2JC3A 1QORA 4QT4A 3HP4A 3WMGA 1N7IA 2CV2A 3CWQA 2OO5C 4MSUA 2W0XA 4Q19A 3P0EA 5TJHA 1H93A 5DN6A 4QBGB 2QVXX 4GPIB 3CCEV 1V5WA 1RLIA 3T1TA 2PUWA 2CJPA 3OPVA 1QU3A 1JJAA 2GK7A 1OY1A 4IWXA 2X1LA 4QGGA 2DW4A 1LV8A 2W22A 3PNLA 2JFQA 1DEAA 3MXOA 1GRVA 1U1FA 1UPAA 4ZFNA 4G88A 5CR9A 1O7JA 3K9BA 1J99A 1N8KA 4GI2A 3C7KA 4WK2B 2LKDA 2ZU0C 2L2QA 3MW8A 4JMLA 2YV2A 2R62A 2HUPA 3UW1A 4PNEA 4TL9A 3OSZA 4UXHA 1E3EA 1DAHA 1ENVA 3JSXA 3B6ZA 4FE4A 1S2DA 1XRRA 5FORA 4JFAA 1TAQA 4EZIA 1Z5OA 4TL6A 1ZNWA 1QRTA 2DWPA 3K70C 4BFYA 3GVXA 3F5TA 3EE6A 1ZCBA 3ANYB 1R10A 4BVFA 3HK2A 2IJGX 3GLGA 3NDBB 2KQXA 2XE4A 3ZP7A 3IILA 2VAMA 1PL7A 4TPKA 1S1MA 1WXWA 2AHOA 1T6NA 4NUTA 1TGYA 3GELA 3RDPA 2CYCA 4I5EA 5JDCA 3VR6H 1D4OA 3FNBA 4YJKA 4LF6O 3NHLA 3U4IA 4TTJA 4D0GA 5AJUA 4KFCA 4BRUA 3UAYA 4C4ZA 1X42A 1W2WB 2QI9F 4CEIB 3S2FA 1AG9A 4N39A 3MB8A 2QSJA 1I3NA 2Z5LA 4LWZA 3HUEA 2JGUA 3HC7A 2EJRA 3KETA 4YBZA 3HM9A 2HI0A 3A26A 3UPDA 2IU6A 1Y4DE 3AKCA 4PIMA 1C80A 4G0QA 4ENUA 4F5EA 1Y67A 1U0FA 4J07A 4WOCA 4S04A 2IU0A 3CYFA 5HWEA 2AR9A 2YC2C 2HPZA 3WZLA 2O2XA 3QVKA 5DX8A 3CXCF 2B21A 5AI4A 2R6GA 1N34O 2I7XA 1D0VA 5CK5A 4GBJA 4LYEA 4HY3A 3NVMB 4ND2A 3TTYA 3ETLA 1U2DC 2NP6A 2QKYA 3G2LA 2O57A 2QX7A 3RH0A 1YMQA 4BVAA 3IE0A 3LDUA 3DM5A 4FXPA 3U19A 1H22A 4ARSA 5JANA 1S2GA 2NZVG 1OJLA 3N2EA 1U96A 1KGDA 2NN3C 2XT9A 2AQHA 4RCYA 2VP6A 4JI8B 1EX7A 3H8JA 4HNGA 4CL8A 3A28A 3NASA 2IHJA 4WLUA 1M6YA 1ZQ1A 3EDMA 2VRZA 2A78A 4DLUA 4U63A 4IEIA 4YDQA 2YY6A 5CK4A 1OXUA 3PB3A 3IPXA 3OZFA 3KQKA 2YJNA 2Q69A 2ACWA 2IH1C 3WICA 4IDEA 2I7DA 4IQFA 4HDNA 2O19A 1HNZO 2FTKA 4QOSA 2DSNA 1EBFA 2XNKA 1USUA 5AXDA 1NC3A 3I9V1 5J1TB 1KJQA 1UDCA 1IUNA 4AP6A 4JBGA 3P3NA 4O2BA 2AK3A 3V5NA 3IQIX 3SXUB 4EY5A 2IL1A 3RS7A 3KOXA 2PZSA 4FD3A 3HBFA 5E7MA 4F3TA 4MINA 4C6HA 3DGEC 4D9KA 1FRZA 3LGSA 1EWVA 3Q3GE 3EZ2A 5CVCA 3ISJA 1HLGA 3ORRA 2OGWA 4X1KA 3OUSA 2BH2A 1P2BA 3A0UA 2H85A 3AUYA 2ODAA 1GAJA 3E27A 3C8HA 4P83A 4LECA 5HM8A 1G18A 1YKSA 4ZHWA 3MS2A 4G4SP 3N6XA 3GBPA 5KVQA 2H06A 5I48A 2BGMA 3M2TA 2F8SA 1EHCA 1JI3A 4IMPA 4F9GA 2IEAA 3B6EA 1B0AA 1MVNA 1M7HA 2CFSA 1L6IA 2PSEA 2GO1A 1OFHA 1SURA 4YIPA 3U48A 2GJ4A 4A15A 2QN1A 4Q9NA 2TS1A 4L2IB 2NZYA 4M1KA 5HBGA 5K51A 4K5QA 4WUTA 3G59A 2PJZA 3U3OA 4HDSA 2EU8A 1ZWIC 4Z2YA 4WKOA 3KVOA 3MHPA 3DD5A 4MKXA 3P2YA 4MUEA 2ZDIC 2ZSFA 3UMGA 1H8HD 1C0IA 4H1UA 4IKOA 1R3LC 2AFIA 4MRRA 2ZRMA 4BNGA 3H86A 3ROFA 3KJZA 5GGYA 3G2OA 3LC2O 3LUDA 1EZZA 4U7GA 4MHTA 1F2DA 4Y2UA 4OD0A 1H23A 1JMKC 4PSAA 3V8NA 4PX5A 4E6PA 2XRZA 4C4RA 5J2UB 3TLCA 1V26A 5GPBA 1W2BF 1BWQA 2IPNA 3WLHA 2CL7X 3QVGB 4AG5A 1SN7A 2RGNC 3FGZA 3MINB 5K45A 3HGQA 2BGGA 5B7QA 2ZITA 3RU2A 4MKRA 1HT3A 1D1TA 2JHAA 5IHXA 4HAUA 4G4YA 1PK7A 3VYTC 1RTTA 3K0CC 5IAAA 1LS6A 3C3DA 3TD3A 1YF3A 3U6BA 1MOZA 2BFCA 1HYHA 2XTJA 3WJPA 3KQHA 3CIFA 2HCRA 4WASA 1ADYA 1H05A 1SR8A 4JLWA 4KMOA 4Z0TA 1NVFA 3NGXA 4UQLA 5KCZA 5SICE 1MG0A 3I23A 5HRCA 2EWVA 1Q21A 1JBEA 1ND5A 3I1JA 1TQ6A 4TWIA 1W4AA 1S2LA 1COWA 1WWKA 3CZMA 4YI3A 1XTPA 4B3BA 1J2EA 1E6MA 3MQWA 3T9FA 1Y42X 2PGOA 4N9WA 1YUMA 1TM4E 1TU3A 5HE9A 1HNWB 2JRIA 3PC7A 4OQEA 4LJSA 3TQQA 1YVWA 4TOIA 2FPIB 1G1AA 1IURA 3OU7A 4C03A 4LMAA 1FL9A 2IH3C 3ITEA 4DA4A 1KP9A 2OXIA 1IQPA 1XWFA 3BGVA 4AT1A 1KO1A 2VZ8A 4HZUB 1F06A 4PZZA 5T8KA 4BO7A 3IMCA 5A5GA 1CU1A 3L6OO 4UJ5A 5EUBA 5E2BA 1UJ6A 3AUJB 1GUDA 3ZW7A 1DUIA 4J11A 4RZ2A 2HJFC 3GFBA 1DXHA 3OAAA 4JLJA 2PUEA 2QIOA 1VL6A 3K2XA 3G17A 4ABMA 1ZD8A 2WU4A 1RHJA 1NFFA 3NDPA 4J0FA 3OOJA 3B78A 5HOEA 3C9TA 5AMXA 3KZCA 4RZIA 1EVLA 4M53A 2C97A 1DXOA 3B5IA 2GTPA 2EXXA 5BSWA 2IHYA 2X7JA 3F0GA 3R6GA 2QZ9A 2F1IA 5A7HA 4BVEA 3KB6A 4ZV4A 3T5PA 4DAEA 1HLPA 5CEJA 2AGVA 2P7HA 2VDRB 5DB4A 5FWDA 1BGWA 2GZ3A 2ZRHA 3F6PA 4RM3A 2VJNA 4TQ9A 2RGRA 4L8YA 5EP1A 2PS0A 3S2ZA 4KYIB 4DNQA 3KXIA 1EU1A 1IJBA 1ECFA 1DBFA 3CTPA 1K98A 1L3BA 1VPEA 3NIDB 4G36A 4ZVLA 1WW2A 4K8RB 3FOBA 4KBGA 1XEWY 2AC2A 2HO4A 2ZJ0A 2EX4A 3L5OA 4JLPA 3C9SA 3QVSA 1AGPA 4RV5A 4N54A 3Q7EA 1AUVA 5DLYA 4P0PB 1JKFA 1SXJB 4FFBB 4Y6LA 5DF1A 4BBZA 3OY2A 2HFJA 1MC4A 4N40A 1TI7A 3HNPA 4MH0R 4MV7A 4RVDA 3UK1A 1R88A 2EZ4A 1DG9A 1MA1A 5AVMA 1O2DA 4OM8A 1Z7WA 1XCLA 3PIRA 3DDSA 1KQPA 1PU2A 3CRQA 3O92A 4MS1B 1AO0A 2O2CA 2VAVA 3IIIA 2IX3A 5EZQA 2P4VA 2VYCA 4I0XA 5HKAA 1XUQA 1H5NA 2A2ZA 1Y37A 3OM0A 2PJRA 3VO8A 2BI4A 3F0DA 4TTVA 1GNTA 3WS7A 3W9BA 1KNKA 2MYUA 3W9SA 4H6PA 4W5JA 1XZIA 2DPHA 2Q6KA 4MTLA 1GA1A 2PIAA 5DYIA 4Q6WA 1MCZA 3FNEA 4HZIA 3S3WA 2IV7A 5EB1B 3CXUA 1PS8A 4HMPA 4Y9SA 1BMFD 2PX0A 3GCWA 4ZOLF 2VPTA 1GU7A 2WE7A 5DM2A 1A1VA 1KPGA 1UDRA 2QJFA 4NMMA 3G4SV 2IW1A 2BFOA 3GT3A 1VARA 4JZGA 1UZAA 5COAA 4R7CA 4AYTA 4Y0VA 3T41A 3ASNB 2E89A 2QKSA 3UCFA 7MHTA 2DMRA 4C1NA 5JO9A 3EY9A 2LD4A 3A10A 1ZBDA 2VYND 3WLRA 3W2EA 3NHSA 4WEQA 1YDHA 4PWZA 4YP1A 1GZHB 3HFRA 2EFJA 4PO1A 4H7JA 2D2CB 3LK7A 1Z9BA 1QQ5A 2P9ZA 2CCGA 2FEWB 5CTJA 5PGMA 3LF2A 3KJGA 4MTXA 4UCTA 1T35A 2FMXA 3OJCA 2E21A 5DI3A 3RRBA 1PJSA 7ADHA 3CH6A 5J4LA 2E1RA 4AICA 3N2KA 1KYZA 2FH5B 3D5QA 4DEXA 4IXDA 4R41A 1J56A 1PZNA 2WKQA 3A6JA 5FDFA 3VI6A 2E1PA 3V7UA 4IQ0A 3HXLA 4M37A 4GQBA 1BCRA 2EP5A 3Q8XB 1AZSC 5COBA 2HRUA 3R3SA 2QHXA 1X7YA 3CYOA 5EHXA 4ZVKA 3W0LB 3AI3A 4RMNA 4NBSA 2VJAA 1OZGA 1QYVA 5FOSA 3MF4A 2P06A 1XZQA 1QGZA 5FRDA 3KZIZ 3GL9A 3QELA 1BDIA 3PKIA 4M21A 4IDCA 5JZOA 5DSTA 3A0BZ 4BNFA 721PA 4HUTA 4I7ZB 3X2SA 4YHHB 1XDDA 2AFRA 4LF5O 4OAPA 4EY4A 2HHHB 2EFEB 1F2UA 4W5QA 4B82A 1U0OC 1B2RA 1TVEA 1M90H 2EZPA 4ZMBA 4FR0A 1GR0A 2CB0A 2ADFA 3R9WA 5FWXA 3CX8A 1WSWA 2IYPA 3O8QB 3TGLA 5KDLA 4TRJA 3IVXA 4FSHA 4CM8B 3I34X 4JQOA 4PNHA 3UWKA 3OPNA 4YQEA 4WF9V 3L7YA 1I7QB 3JVUA 2A0XA 1WTAA 4EL0A 3QBVA 5T5QA 2YX1A 4LOKA 4CV3A 1SHJA 1PNQA 3WRVA 1PVVA 3WWCA 3BH0A 3WGLA 5SZHB 4MYHA 5L3GA 2HBQA 2YWXA 2P11A 2CBZA 4EKWA 4ABYA 1N0IA 2I4TA 4MJLA 4K6HA 1VA4A 1LF5A 4LHEA 2H2FA 2Q9BA 4GQIA 3MUEA 1ZN9A 1W4CA 3KSZO 1Y7HA 2FUG1 4DE5A 2Q0AA 2OTMA 2QZ4A 5G40A 1O6ZA 3BWDD 2VQFO 5LMUB 4GYJA 5EWJA 2IEIA 4PYMA 1Q81H 4C01A 3ILVA 3QPVA 3R0QA 1VLMA 1T2EA 4MVJE 3OFNA 1YQGA 4J9YB 2WU8A 2XY4A 5E1OA 1P8JA 1N25A 2ZXFA 3WXMA 1VQ9F 1AXGA 4EHBA 3CWCA 2NYAA 1NOKA 5DXFA 1D6JA 5M34A 2IH5A 2JBAA 3TEJA 3NVDA 3HGTA 3MBIA 3X1JA 3BJZA 5KEIA 3UO3A 4GOJA 1XEWX 2O9JA 4HX9A 4DLPA 4GVLA 4RETA 1RRFA 5JAPA 5DLDA 2ZBEA 3L4BC 2J31A 2PEYA 2QRJA 2VKQA 5HKKA 1J5PA 2Y69B 4ZEVA 4Z1MD 4R84A 4DMUB 2OENG 4KFSA 3VC1A 3L5KA 1D6SA 1SUWA 4MUIA 5IBPA 1VQNF 1CUSA 3WI7A 1UDXA 3G71F 4JBIA 4PHZA 2E82A 4K9MA 1Z6YA 3WRXC 3HY4A 2GKOA 5DFAA 3HDHA 3DH0A 1XTZA 4EEZA 1P9WA 3T9EA 4E11A 4ZPJA 5I6DA 2H4JA 2JFHA 3PFHA 1TAGA 4TL7A 1BEEA 1DDGA 1JDTA 5JAHA 3ADBA 4DA7A 1C3EA 5MDHA 5TMBA 1KC3A 1JHPA 3ZCRA 2VSQA 1YQ9A 4C7OA 2C9BA 3FAZA 3WWPA 1L8QA 4GX1A 2IBTA 4WFKA 1Z0IA 1Q3HA 2OAP1 4LC0A 1M1KW 3P20A 2RE8A 3HN6A 1FSPA 3IEIA 3KXPA 3ZE1B 3LWBA 1Z2GA 1XB2A 2I3BA 3ZU2A 1ZJJA 4JQCA 4JS0A 3ZE2B 2P3SA 2PPLA 1DL5A 4R1MA 3W8NA 5FOVA 3W8EA 1CEYA 4F6LA 2DLNA 1HZJA 3QKUA 3MAQA 1THGA 4BKOA 2VPQA 1YIOA 3RVMA 4AMBA 1T43A 4TKMA 3OFVA 4Q9AA 1WXIA 1IV3A 4BVQA 1T5DX 5JWRA 1RMQA 2QPLA 4B3HA 2PX4A 4BLWA 3DE3X 5FPHA 4B5LA 3KPJA 4MVCA 1H8ED 4FC6A 5IKXA 1W52X 2D1SA 1FRVA 5DWVA 5EXEA 2P5YA 1T15A 1CPYA 2X7XA 3AHIA 4OXXA 4Q24A 1X1CA 5AIAA 3PQ6A 3I5XA 3V3TA 1N6OA 1JCHA 5TPWB 4QGBA 1E59A 5KTSA 4DCVA 4MDYA 1M8FA 2I78A 2WHRA 3PQCA 4V1CA 5GINC 3T54A 4EGFA 4XRRA 3RT7A 5JT1A 2PSFA 4A03A 4AK9A 2DTXA 1VG8A 1WO8A 4V02A 1TAEA 4JEIA 4IIJB 4UVIA 4CLEA 2FQQA 2CSUA 2FEOA 2QD4A 5G3ZA 3RWRD 3BCUA 1OROA 2GV9A 2WLLB 1GQFA 3UAGA 3KG2A 1BNCA 2ZYTX 3WGUA 2IUYA 3BBPA 3G8AA 5AH0A 3AL3A 1BS9A 5DW3A 2H4XA 4H3HB 4NPAA 1YCFA 4ZU3A 3FLBA 4MVJG 3A0HZ 3DV2A 5L51A 4BVTA 1MJGA 1FYVA 5SZJA 1R0YA 3IESA 2VSYA 1QKJA 2Z09A 2TMGA 3AK3A 1CHNA 4HHEA 3HJUA 5LJLA 1EXDA 1ZX1A 4BO6A 4Z6KA 2I6UA 4JI5B 5I45A 4PXYA 4BX2A 4OP3A 4WGGA 1O87A 1SUEA 3MOGA 4ZCMA 1KAMA 3U7HB 5BW8A 4URHA 1JEQB 1P7CA 2HP0A 4I1OA 2X3UA 5CMLA 4PYNA 1KMHA 1PLKA 4KO8A 1KFEB 4KWEA 2JGFA 4QBTA 3LQ2A 2OBFA 1FJXA 4WSOA 4FM2A 4AJHA 4QSHA 3E7DA 2WDPA 3ZCSA 3R7WB 1NXSA 3UK0A 2REQB 1KP3A 5KNDA 2BFNA 5LQRA 1VQ6V 2CXOA 4D9GA 3MS4A 4KPEC 1Z4IA 2ZSUA 3A6ZA 4DWJA 1RU3A 4ARUA 4W9NA 1MD9A 3IR6A 5BMVA 1Z7EA 3ND7A 4F11A 1XNQO 4JR0A 1R12A 5JJEB 2N42A 4LWPA 2GNAA 1XF9A 3LVBA 3M6FA 4F46A 2R1VA 3QFFA 5SY6A 1H3NA 4RL4A 3IRVA 3UO2A 3TK1A 1Z06A 1Z73A 1W73A 3FFXA 3DMTC 4BP1A 4D0SA 3CO5A 2H2AA 2ZI3A 2HSJA 1A8SA 2DU8A 3AF1A 5F23A 1GPNA 2V59A 2LUOA 4DLZA 4OLBA 2YXPX 1ZTEA 2REOA 4IUYA 1MV8A 4OQMA 2VL7A 1MENA 4XM1A 5B57C 4G26A 3MPOA 3Q2OA 3DPIA 1RRKA 1WX1A 3VR5A 2YV4A 3JRNA 4H7FA 1XG5A 3NP7A 4UDNA 4HVLA 1CRLA 3O2NA 5K3SA 1BE3H 1H48A 3DZKA 2ZK7A 2E5WA 3OQIA 3C9RA 2OQVA 1ZI6A 2M6YA 2X7RB 4HFMA 1FDTA 2GTAA 3INGA 3G5UA 2NO6A 2YCBA 3VZCA 4AKTA 3ZCTA 2G0TA 4L74A 4ZI3A 3MJSA 1R0ZA 1KY2A 2PA0A 3IOEA 4J7UA 5CHEA 3L43A 1PNLA 1AF4A 1KZ7B 4PSDA 3C3SA 3IBCA 3DOOA 5C8YA 3IKMB 3E8FA 3SX2A 1DV1A 3FHLA 2RHLA 1H2WA 1Z5WA 4K9OA 3RGBA 4WBXC 1JN1A 4C4XA 5LA6A 1NM5C 2B8WA 3L49A 4KOAA 2VWKA 1VK3A 3ELCA 4LE1A 4JAVC 3REOA 2A0UA 4IDHA 4AO8A 1V1JA 4CM9D 1IEWA 5IVKA 4X7BA 5F77A 5T4FA 1EDOA 1A4XA 1N32O 1ADGA 3GD5A 2ODMA 2POQX 3G9UA 4MWSA 4O63O 2P91A 2E49A 3CP1A 1Y4MA 4RXTA 5BRJA 5I9MA 4RPIA 5JAZA 3E61A 2C94A 2JAPA 4HDMB 1E2BA 3PGXA 4GWKA 2BFAA 1IOWA 2I6QA 4PG4A 2H1RA 2ZWIA 1I3OA 4IIDA 4X95A 2GZDA 1Y9ZA 4XIIA 1Q90D 2WD8A 3MD9A 1RPAA 1UPTA 1OPXA 3PXGA 3FMPB 4IX1A 1DEHA 3T3EA 1AA6A 1XBLA 1A97A 3OJWA 3O94A 3CPWU 2ZYHA 1CJUC 4QSMA 4JB8A 5C31A 4PQEA 1Y98A 4YNBA 1ZONA 2C20A 2A59A 2PL3A 2TSYB 1Y7IA 1T5IA 5BNWA 4LCBA 3BZWA 3CMMA 4CKBB 3ZW8A 3MTDA 4R1UA 2O6LA 5AR1A 5EIBC 1Z0KA 2AG8A 1YVDA 2WSYB 1WHTA 4EYQA 1SXGA 2OHVA 2VR1A 4GP7A 4YLEA 1CS0B 1HYEA 1XYVA 2BTUA 3JASB 3RF6A 1FLDA 1U2SA 4R7TA 2AOTA 1PVDA 3P5SA 3PL5A 2JIZG 2X6QA 1VQ4V 1P1IA 4JBNA 2D62A 3LFHA 1N8RW 3DLPX 3TWOA 1UODA 4DBLC 1I30A 3BFVA 2DT4A 2G28A 1AK1A 4MV3A 4PONA 5FL7G 2IBZH 1QD9A 3RTDA 1CUVA 1W0JD 2Q3CA 3HJAA 3T4DA 4IGIA 2GJKA 2VTBB 2G83A 5IDYA 1X86B 1IN6A 2BEWB 4PZAA 4XD7A 2MSWA 3URKA 5CW2A 4JI3B 4B76A 3WYFA 1NSFA 1KQNA 5HRAA 2ZTVA 1PSWA 4ZI2A 4NJEA 3R40A 1JDPA 1NQ5A 1J2UA 4TZZA 3OZEA 4UOZA 1GQYA 3CCSF 3UXEA 1R6NA 3TLYA 3BMQA 1I1OA 3X3HA 3L72H 3FF4A 1W6UA 3T5AA 2UYHA 1QQCA 2CSXA 2P4UA 3KZMA 3RKUA 3AP1A 4JI0O 4M8LA 5IUNC 1K68A 2VP2A 3MERA 4YAIA 1MB0A 3PNPA 5GP1A 3SJAA 3WNVA 4IRXA 1CZOA 4FR5A 2X8AA 3VZPA 4PS1A 4Y9RA 2DWCA 1XRGA 3HWWA 4P0TA 4RHCA 3EOBI 4TM8A 5ARCA 5HUHA 4LV8B 2DFKB 5JSFA 4BT3A 2CUKA 2EIXA 3CSDA 4UJ3A 3RSHA 2CNNA 2BFDB 1PNMA 3B7GA 3FOCA 3CB2A 1TYDE 1SVLA 2PVPA 9ATCA 2VQ3A 1NW9B 1FP1D 2WLSA 3NTLA 1H2AS 1ML3A 1PSDA 1SOMA 4NL4H 1WEHA 2CYBA 1O9BA 5HJ7A 1PDOA 4QAQA 2JH9A 2J67A 3R24A 2BF4A 1AB3A 3DBOB 2RJOA 2FSHA 3AEUA 4JYZA 1DB3A 5TT0A 2CZCA 3KKEA 4Z4HA 4C3VA 5DBEX 3SYKA 3F5MA 5KHAA 4A8JA 4AXXA 3AY6A 1DZIA 3OZIA 1Q44A 5LL6P 4CTOA 6Q21A 4EHLA 3MM4A 1JWBB 4BBPA 4QX6A 1M6VB 4WBNA 2ZBVA 2GCGA 2KW5A 1Y6JA 1JFFB 2IHUA 1NURA 2VHCA 2WICA 3FSGA 3QBDA 3W90A 4JQZA 4J80A 2XBUA 1OLSB 3GYQA 3CRRA 2IYXA 4WOBA 4RD3A 3OT5A 5ILOA 2XR1A 2PMFA 1G3MA 3OO1A 3PUXA 4ATNA 2FRDC 2ZDGA 4FIZA 5LFAA 2I4LA 3MPUA 2AD1A 3GDFA 3DPUA 4IICA 3SBEA 3GI1A 3WBKA 3LW8A 1KYIA 4E4TA 4UU7A 3DVAB 1MDFA 1OZ0A 1Y74B 4FDLA 1QRSA 2Z2IA 4M1YA 4Q4AB 1B14A 4AF8A 5KOJB 1QH8A 2DFLA 3OEHD 2WA3A 3L7LA 1LD3A 2V58A 3PC8A 2OD9A 1EINA 4IV0A 1AV7A 1W2HA 1H5UA 4ZQGA 5COQA 1IXRC 1RXIA 4D79A 2O50A 1MOFA 2ZNJA 4OAQA 3AF6A 4DMGA 2ZUSA 2C4KA 2ZJ3A 2G38A 1M2NA 5I8PA 1P4SA 2Y77A 3LX8A 4KSCA 3Q3EA 2R00C 4XVCA 5I8WA 2HWWA 2B6NA 3KLBA 4PPGA 1NXOA 1MIOA 1N9GA 4EKYA 4Q4DA 4TWKA 3G49A 3TQRA 4KE6A 3BD6A 1Q1ZA 4P84A 5JJNB 1GZ7A 4XDYA 3D6JA 3LZDA 7REQA 2CGNA 2C95A 3O8RA 5BRNA 1GKYA 1AP5A 4NFYA 1U1CA 4C87A 4BAGA 4R40A 4MYRA 2ZIXB 4LEIA 1U5BA 3CBQA 2W2TA 3AMVA 3FZGA 3R5XA 2B8JA 1K4DC 3SYLA 5AXAA 5G4LA 1THMA 3IMGA 1D4AA 3KT8A 3S2IA 1BQZA 1K33A 1T8YA 4Q18A 3JZIA 2O2YA 2Q27A 3NV7A 2VI5A 2JFGA 1XZGA 5IC4A 1S5HC 1ZPDA 4EOGA 3UTCA 4DV1B 1WDMA 1PI3A 4WMLA 4C43A 5FNVF 1WD5A 4Z9XA 2FYUH 4YRQA 1ZNZA 3K6RA 3QJ5A 3DVSX 4Z0PA 3D3KA 2Q1SA 1I4WA 3N2ZB 4Y6RA 2BL4A 1T0HB 4EWLA 4X85A 2IP2A 2W6ID 4A0QA 4YC7A 4DRYA 1P31A 1YAJA 3UWPA 4ZK6A 2G1PA 1JPJA 1NI5A 3R6DA 3T5CA 5E9QA 4GX0A 1W3EX 3PN1A 4UEKA 1N3BA 4HBGA 5TV2A 2N48A 1X1RA 2DUJA 2XQVA 3R23A 4KQEA 3PAFA 2H92A 1TQ8A 5DNEA 4G5FA 2NYUA 3BRWA 1LR1A 5M7EA 3QTYA 3CCJF 4GPTA 1RYEA 4CKWB 2CJXA 3F6SA 4RC9A 4LF7B 1DIHA 4F1JA 3LU1A 2Y68A 4TQGA 5CH3A 4MYSA 3WBBA 1BWSA 1X7DA 4LQCA 5AUNB 2BFBA 4BS9A 3AVQA 1T1IA 3C7TA 3DFKA 2ARHA 2WLNA 6REQB 2GARA 4XYLA 4LX0A 4AJ4A 1P0PA 4I4IA 4N6NA 2JLVA 1R4NB 3GFRA 4KR2A 2HRRA 4DV2B 1B3RA 4R2IA 3V7WA 3AT1A 1GPLA 2XOXA 3I53A 1X80A 1ZSVA 3F5QA 5AYVA 1P5ZB 2WB4A 1Q0LA 4IIVA 1V4NA 2VNSA 3M1XA 3FPSA 1T8UA 3RIYA 3M6MD 1Y66A 3WIVA 2ACEA 3AESA 3LBHA 5JRDS 4TXJA 4QEDA 1Z4LA 3HKDB 4ENVA 4R3NA 1YIAA 4X6YA 3UKOA 5I4BA 3JVDA 3N2LA 3A4VA 3W4IA 5B30A 1CUFA 4UFPA 1LJLA 1NATA 1K89A 1AURA 1Z16A 3AI2A 3BWBA 1L5GB 3UG6A 3M4SA 1C8BA 2DPYA 4MKGA 4B45A 1I4TD 1G7CA 4CGYA 2OCDA 3ZWQA 1SB9A 4D9EA 3SS8A 1JRLA 3BAZA 1ACMA 2JIBA 2WP8J 4EHIA 4U2CA 4FS8A 4NE9A 1XTIA 2PT7A 4ZVQA 2Y0DA 1MW9X 4OB6A 1DEOA 4UNQA 5ED4A 1WY7A 4EUFA 4JASA 3ZO8A 3PFBA 2BOVA 2CJYA 3KTDA 4BZQA 1VMDA 2BUAA 4HUQA 1V71A 2QWPB 3LKDA 1UPFA 4O2AA 1QQ7A 3BRSA 3AKZA 1CJKC 4KXYA 3PYXA 4RHXA 4I08A 1H47A 3KOOA 5AW6A 2VUUA 1XDUA 4KQ1A 2QLMA 1LDBA 3FPHA 5K6TA 2PWZA 1F1JA 3HBJA 4DIBA 2AFHA 1ZOSA 1WABA 2DCUA 1TLTA 4JPRA 3ASOC 1XHFA 1K6IA 4X61A 1XU4A 3WADA 5DNDA 5H7XA 1Z5VA 1OX4B 5FWNA 3ICPA 1HDOA 1RWKA 3U4GA 2PHNA 2D5LA 1E5XA 1JTVA 4C2BA 1D4ZA 2GF9A 1KOLA 4D0NA 7AT1A 3K0TA 1ZN8A 1ZW1A 3NBQA 5I9NA 4KN9S 4PPQA 3B2EE 3IX7A 2WOOA 4R1LA 2JD2A 4H0NA 2FSFA 1RYFA 3H1EA 1E3JA 2QENA 1QFZA 5GTIZ 3IHWA 1TRHA 4Z7NB 3THOA 1Z37A 5KTRA 2AOWA 3QU7A 1YBAA 4LNUA 4MR8A 3SR3A 3EVBA 2ZZKA 4ZO7A 5DHTA 4X63A 4WESB 4CT0A 2FQXA 3OQ1A 2CL0X 3CX3A 4W5OA 1WU7A 2GA8A 1Q7GA 2HSWA 1KI9A 2OSBA 3UAZA 4CFYA 4N18A 2C4NA 3PEWA 1WB4A 5EWMB 2KSDA 4J1TA 1YZTA 4M8NE 1A2BA 2KG4A 2HF7A 3H4VA 3K16A 5LMUO 2PGLA 2WQ7A 4CMGA 2J09A 3RPEA 4DR3B 3HI4A 1KERA 1PQYA 4LS3A 1Q3TA 3ILHA 4QE3A 3ORYA 5A5VA 1AJQA 5AK6A 3RNLA 2DKFA 1QHIA 4BIOA 1ZCAA 3D6MA 4EI9A 3HJGA 2I4IA 3T0GA 3KBBA 2NO1A 1SRQA 1QH1B 2HR3A 1PR0A 2Q7GA 1S2NA 1SKQA 2NUAB 1N5IA 3NXKA 4MR9B 1J23A 4XDGA 1OGJA 1HO3A 5CURA 2O3UA 4IH4A 4DFDA 3NHKA 3WMXA 5IANA 3L70H 1CETA 1T36B 5EHQA 1HYBA 1CB7A 2ZKIA 4Q4HB 1SKBA 4K81B 1NSYA 4ACAA 4LOIA 3HAXD 1FP7A 1OH8A 4UHFA 3M83A 1L5YA 3WSVA 4F4CA 4HCJA 5JDIC 2Q3MA 4HDRA 4YP0A 4Z5XA 1GGNA 1XSEA 3FRJA 4L76A 4AL4A 5DBHX 3EDYA 1GL3A 3EJ6A 1YJNV 3CLRC 1QCDA 4HDAA 4G27B 5SYNA 4HH1A 2L26A 1KVUA 3VVLA 4RTKA 4B2PA 1FDRA 2LGJA 4ZDKA 4FHDA 1DAPA 4XZ3A 2QMEA 1BOFA 3LM8A 4RUEA 4M0UA 2C31A 1KDZA 1KDOA 4GUNA 4FINA 3M9WA 4LY9A 2Q0QA 4F6CA 5KBYA 1HSZA 1ODSA 2Q1YA 4PYQA 2JJ1D 1EDDA 1XAJA 4C6TB 2BBSA 4EG4A 3FB4A 2VJQA 4F96A 1TJ3A 3V1TC 3A36A 4H77A 4OMCA 2UYQA 1VJGA 4KV7A 2Z6UA 1IEQA 2IZ1A 3GZNB 3STUA 5EGSA 1XMIA 3T3DA 2I2FA 1WNSA 1XVIA 4XGQA 2JIRA 1JG6A 2KWIA 1U7WA 5HBRA 4YRSA 1KKUA 4MW5A 1GRQA 5ALIA 3R3ZA 3JAMA 2O7VA 4HMQA 4QD3A 1LDYA 1JR3D 3EEFA 2W98A 3AJDA 5I4KA 1ZM4A 5IT5A 2FPOA 4HEJA 5TXGA 2IVZA 1QK5A 1P2VA 2WJ6A 3RSCA 5JYCA 3IV6A 2WWWA 3KCQA 3WHPA 4Q01A 3QH4A 1VQ8V 1SRYA 2CE7A 1A04A 5HPYB 2GDSA 4JB3A 2HSDA 4DZTA 5DM70 1SETA 4ZD6A 5L8VA 1P33A 1JHOA 3UJ6A 4BV3A 4IYIA 3VOAA 3FPBA 5KNLA 2ADQB 2R25B 4QXMA 4UBMA 3WLQA 1C7JA 4KW7A 4WZAA 4KKXB 4S3MA 1NJIH 4OF4A 1EHYA 4EJSA 4EG6A 2IPLA 1VRCA 2V7QA 2C9YA 3FNQA 1Y4AE 3R5TA 1IE3A 2FY8A 3ZHZA 3MA0A 5A9TA 2RGDA 2FUNB 3JWHA 4F5YA 4B81A 3V2HA 3BFRA 3HYLA 2O07A 2CMGA 3UMCA 1R50A 2GASA 4KQMA 1F48A 2RI6A 4PM4A 3C9UA 3BGOS 1WETA 4RZUA 3KAKA 2BEJA 1MLDA 3C2QA 2OL4A 3WYNA 4CBVA 1SVUA 4GMHA 5MFPA 1P4HA 5B5EZ 4B2LA 4BC1A 1XL6A 2XOEA 4HH0A 4REQB 2NU9A 4CTMA 3H5LA 3LWPC 2WLTA 5M29A 4JI5O 4DUGD 3K0KA 3PPXA 3Q88A 1D09A 1VMEA 5DOZA 2CXSA 5CA3A 2W2LD 3QW4B 1YQTA 3PR1A 1XQ8A 4N6GA 3SHVA 4RTJA 1UBFA 1O0CA 4M87A 3ZHBA 4P5EA 2RHRA 3QKTA 3E8GA 2BFPA 1W8DA 4HFNA 2PQ2A 2C7OA 1XN4A 1WXGA 3RKRA 4B31A 3UAXA 1Q6HA 5K0CA 5IK2A 4MWGA 3GQBA 1CE8A 3FDFA 2GN0A 5IYZB 2AMYA 1KZ1A 3MIZA 3O4RA 2ZP1A 1PJLA 2VWGA 3RVZA 5J9PC 1P0FA 5JMOA 3LC0A 2QZSA 4GI5A 4PI2A 2FK8A 2FHSA 4Y7DA 4KZKA 5EUQB 3C1AA 4HAOA 3JQ7A 1O54A 3QLJA 5E9AA 1EG2A 3T5TA 3JS5A 4U2KA 2VHYA 2OXFA 5A6VA 3T7TA 2VOEA 1QFXA 4HGRA 3DUWA 1G3RA 4NF2A 1WPGA 2UYGA 4XUEA 4YRZA 3MT9A 2MR6A 3FMGA 1NBME 2ECQA 2FZ5A 1Q0TA 3QVXA 2EWMA 3DQQA 3SC2A 2V7TA 4Q02A 3NHRA 3N0TA 2FOLA 1FRNA 5C4IA 1TZMA 3C39A 3M9XA 3PDIB 1K6JA 4DUYB 5B53A 5ITZB 1W88A 2FGJA 2WNIA 5PNTA 3MSXA 4IIEA 3I52A 3G67A 2OILA 2XLCA 1ZIPA 3H6KA 3IDZA 3WPWA 2IYUA 3HA2A 1JP7A 1YU6A 3HH8A 3O4HA 2NXWA 2NU6B 2YICA 3CT4A 4EQ6B 1I4OA 1PUJA 1RE0A 5D5PA 4BFVA 1GNRA 5TS2A 3BHIA 2QRVA 1WZCA 1DC6A 4BKQA 2NLJC 4LZLA 5LXTA 4ZYYA 5A4AA 2WTBA 2F9LA 2XGOA 3RU9A 4QM7A 2ZJ7A 4ZO8A 4OQXA 4OA5A 1ISPA 1VHJA 5CAEB 2FDXA 1JHYA 2XYRA 2ARKA 2Z1TA 4FUQA 4A82A 3COWA 2RK6A 2TMKA 1CEQA 2P0YA 3HJHA 3MTBA 5JTUA 3CPSA 4WCFC 1TQHA 1RLUA 3V80A 4CPDA 5B7GA 1SIUA 4DT1A 1N3IA 2PRSA 5DM4A 4FOLA 1IVYA 4N7RA 1Q0SA 3H1FA 5EE0A 2FFJA 3A6EA 5D84A 4K2HA 3Q9UA 3IA2A 1NAHA 1OGIA 1L8AA 4B4WA 3WAKA 1R0WA 4AY5A 4X64O 1DG1G 4ZCTA 3KJJA 1T24A 1Z6PA 2Q4PA 1VB3A 3AIOA 2HJVA 1E3DA 3VJMA 4V38A 4RLQA 3TTXA 4XSGA 4XYBA 3Q1LA 2I22A 1N2XA 1XNJA 1WA8B 3GP5A 3REFA 4C7MA 2ZI4A 2AR0A 1K5PA 1RACA 1UOPA 4NHEA 4YECA 1WUYA 4FLXA 4R1QA 2WVHA 3BMCA 3ZGXA 3A06A 3QYAA 4ZJPA 2IG8A 3SZMA 2I33A 3ZJZA 2XAJA 1GU0A 2JAHA 3I2KA 4PAQA 1NQOA 4YRDA 4G0MA 1TEVA 1P8AA 4KV9A 2R8BA 5C18A 1DQRA 1GG9A 4N8DA 3BE4A 5JBQA 3OQJA 5FFNA 3V2UA 4L6AA 2N3ZA 4I50F 4M1EA 4PSVA 5L6LB 4EY8A 3AEYA 1C30B 4DR2O 2ZKLA 3ZC3A 1N6NA 4F86A 3LO8A 3V4SA 3OHPA 1KU9A 4RL6A 3WFJA 2D4AA 2GAFA 3N0RA 3VMMA 2PGXA 1JJ2U 3EY4A 2XMGA 2QI2A 1NYTA 3EAQA 3OESA 2AZXA 3SKYA 5KWVA 5KWJA 3QU4A 5CNKA 5KUMA 4I7EA 3F6EX 4N3AA 4HYYA 2GAIA 3CC4V 3KTAA 3SHQA 1Z0FA 2DHCA 1OI4A 3KJNA 3NNNA 2P2GA 2WTEA 1NBMG 3CCUV 2LIPA 4L08A 3TIIA 5J3JA 1CFZA 1P6UA 4F1WA 2QX8A 3NFRA 3MCVA 4XRGA 2RJ3A 1IQRA 4Q48A 3IBYA 4KN5A 4YUYA 3OFKA 4JJ8A 1NUTA 2DFPA 3P2OA 3M99B 5ER6A 3CX5F 5LHGA 1ZRSA 4B87A 4DR4B 3H11A 3EHDA 1ID8A 1I24A 5AW9A 4A6EA 3D8TA 1VKOA 2F43B 1N36B 5L7YA 3GMDA 2R1ZA 2C5EA 4KRYA 1MQSA 1TT7A 3ONVA 1XROA 4QYXA 3CM0A 3I1YA 4OGKA 2P9GA 3MIIA 3MHHC 1W36C 4XPIB 3H2KA 1SC1A 4Y1RA 5EIOA 3ZDAA 1HY3A 2XZTA 4LRQA 4LSWA 3K31A 1OH5A 3ETCA 2VP3A 2QGZA 2QL5A 1GTG1 1QM5A 2QN7A 2FPRA 1BDBA 1W76A 5AOAA 4PLCA 3DO8A 1VLJA 3C45A 1DPGA 1VHAA 4MGEA 4QUEA 5J2TB 3AM4A 4D9FA 3E86A 4WKNA 1FE8A 4B2YA 4I99A 3QEAZ 5I7SA 3D36A 4UTNA 4Y6OA 4HS9A 3FVQA 3PUZA 4FFSA 1G42A 4UMEA 2ZJZA 1ZITA 4PZUA 5JQGB 1DTOA 2G9QA 1VF6C 4IW3B 4QYTA 1Q2XA 2OK7A 1D1QA 4MAFA 5AJYA 5HIAA 3TMKA 2H3EA 3NMUC 5LP6B 5F12A 4BIIA 1X1EA 3GROA 1OYOA 1P62B 3GHYA 4P4SA 1MX5A 4GI1A 1WL8A 2O7QA 5AD1A 3MGCA 4C78A 5CG2A 3LLSA 2QUAA 4XIYA 4ZHYB 5K6AA 1IIBA 1IY1A 5E6UB 5JFGA 3A4MA 4ZCRA 1NMUB 1GN4A 3K20A 2C5FA 5FUBA 1TIPA 3ELBA 2G76A 2V5AA 3CXRA 4PGHA 3DW1X 2Z4SA 1C7FA 4EMUA 3G5MA 1E6KA 3L75H 1H42A 1UT6A 3RWOA 1HFWA 3CUYA 1L5SA 4PBTA 1EDEA 3K58A 1F9EA 4PX3A 3WMEA 4DOMA 3RD5A 2HXGA 1IBLB 3WLOA 2VLBA 1A4RA 1N2OA 3FDJA 1RQLA 3I5MA 1CYEA 1MUUA 3ZW9A 3VDQA 3GB7C 3ND8A 3O93A 4YJGA 2CMHA 1GUYA 3NCHA 1LVUA 5DNCA 1B41A 1RDFA 3CF0A 4EGSA 4CEHA 3Q7RA 1U81A 4OYHA 2CTRA 4H2DA 4F3KA 1JG1A 1SG6A 4UM9D 1EFDN 3ENZA 1LSUA 3M4JA 3CS5A 4O4HA 4MQLA 1DIBA 3H65A 4TV9F 2HHJA 3FFAA 3SK0A 1YQQA 5B1SA 2OG2A 5DVZA 4DLXA 2C9DA 5BVHB 4H17A 2TYSB 2WF9A 2VZEA 3KR0A 4ZVMA 1ZUHA 3ZV5A 3A2FA 1ZDMA 2GF0A 3E05A 1FPMA 2DWQA 2XHEA 5TQ2A 4V3BA 3WBJA 4EITA 1AI5A 1TGOA 4O2LA 3CNQS 2ZTLA 1MB3A 3B6NA 2ISCA 2IAFA 4JWKA 3Q6NA 1U1EA 3EQZA 1ABBA 2NO9A 1MEEA 2NPOA 1OWMA 1U7DA 3WJ7A 3LFTA 4HDKB 1H3EA 4JI1B 2BWJA 2AH5A 4IYRA 4JBLA 4Q1DA 4ZMSA 3MT8A 3LV8A 2IHNA 3MWKA 2F1JA 2VQSA 1NJ8A 4Z1OA 2NYRA 2ZAUA 4FYYA 2AE2A 1U94A 3HVRA 4NENB 3K70B 4R8RA 2KBFA 4DV1O 2GDJA 2ZDHA 3AINA 3RVBA 4RLHA 4YO7A 1XXHE 4WFAV 4QECA 5FJJA 3T9DA 1KO7A 2QXUA 1IPEA 1FS5A 5G53C 1G2QA 3THYB 3TN7A 1HRKA 5DW0A 3ZP4A 3KHTA 3ZGNA 1XDZA 2Q4OA 5G02A 1ZIXA 4FEEA 5IABA 1Q6UA 2UVPA 3L1VA 3ERCA 4QNNA 2QAGC 1E89A 4YB8A 2CXQA 1RPZA 3HVJA 1RJFA 4EEQA 5CP8A 1UH5A 4I46A 1ZXLA 1Q91A 2JAQA 3Q9LA 4K9KA 2UXBB 5GJBA 1YNSA 1LQTA 2I3GA 5KQPA 1EZJA 3U4HA 1ORHA 4K0RA 1U9JA 2EYQA 1TVKA 5DJ5A 2JGIA 4A1OA 4JEHA 3ESDA 4UMDA 3FB1A 4AJ9A 5E1BA 4LF7O 1KI6B 3BTSA 3CF4A 3BSFA 3I9KA 2AC7A 2QTMA 3DHWC 1R0BA 1YIDA 2ORYA 1D2RA 3VPHA 1JWAB 2Y0PA 4KIUA 3ESAA 4JUCA 1G20A 4KRFA 5EJ9A 1M9NA 4HPXB 4BMSA 1J8MF 3K3PA 4MV6A 2FPSA 2CK3G 5DK4A 2I8CA 3QOWA 3ZE8A 1P49A 1T5SA 3D7LA 2YQZA 2LNDA 1Q0PA 4FGSA 4ZCIA 2X5JO 1P4RA 2FZEA 3I12A 1UK9A 2FQ1A 3MWLA 4EW1A 3J81M 3EXIA 1CEXA 5BNFA 4GBED 2K7FA 4LVUA 1FTNA 1NLUA 1E79A 4LVCA 4MW4A 4Z53A 4WQMA 2RKBA 4M1MA 1L4HA 5DCUA 1S5PA 1Q1AA 2QYSA 4YREA 5EHZA 4JV5B 4OXSA 3MTEA 4QDKA 1Y1KE 2C58A 1H0SA 4N8EA 2O7RA 4AMGA 1L3CA 5EINA 5EXSA 3GAZA 3WSWA 3F6BX 5AUOB 2X2PA 5JDCC 1AY0A 1U11A 3LLMA 3D8NA 2M6RA 4JZYA 2Y67A 4IXNA 1WXEA 4B3SB 4EA6A 1U9CA 4KDCA 3TXQA 4CYMA 5IDQA 2D1FA 1SVNA 3FUXA 2Z3WA 2FW8A 4RFSB 4W8HA 1M2OA 5CMUA 4HATA 5D3QA 2P7IA 3LOUA 1YS2X 2XRYA 1F38A 5EC8A 1C2YA 3IFSA 1UF9A 4J0GA 3B82A 2AZ4A 3P0ZA 2DPLA 2J9RA 4TVOA 4R98A 1EFPA 3QO7A 2OB2A 1BC5A 2XUQA 4WNYA 3IE1A 4Z7JA 2AEEA 3QPCA 2BKVA 1Z08A 5CNJA 1SJ9A 3HVUA 3OSUA 3OWHA 3MAGA 4H3VA 4LDAA 1UMBB 2NU8A 5MN4A 1E0DA 3SOPA 2H94A 3IDFA 5F3WB 2HDOA 4R4JA 3MJFA 1S2MA 4Y1GA 1NF8A 3W5VA 4ARAA 4WZBB 3SF8A 4N4AA 1GN8A 4I9QA 2G9IA 1F0NA 2JGLA 4F3CA 3S29A 3UMVA 1ICIA 3IULA 1G8MA 4WEOA 1TKCA 3A3PA 1GKKA 3D54D 4OCZA 4L0MA 4D0LB