4ZOLB

Crystal structure of tubulin-stathmin-ttl-tubulysin m complex
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 177
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zolB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zolB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zolB01
4IIJA 4YJ3B 2RHOA 3RYCA 5MN4A 3WGMA 5CA0A 1FSZA 4EI8A 4EI7A 3HKCB 5J2TA 1FFXA 4KWEA 1W5FA 5JCOA 4HNAA 1TUBA 4TUYA 4O2BB 2VAMA 3N2GA 5JVDB 3VOBA 5ITZB 5LP6C 2Q1XA 3VO8A 3R4VA 1JFFB 1TVKA 3JARA 4I55A 3V3TA 3HKCA 4XCQA 1W5EA 3RYHA 5JH7A 4DXDA 3JAWA 4O4JA 5KX5A 5IJ0A 3N2GB 5J2UB 2BTQA 3HKBB 4IHJA 4TV9A 5LXTA 4O4IB 5JCOC 5CB4B 2VAPA 1FFXB 2RHHA 4I50A 1RQ2A 1TUBB 5LYJA 4X1IB 5GONB 5KMGB 2GVIA 4EB6A 3C8LA 4X20B 1SA0B 4LNUB 4FFBA 5J2UA 5JQGB 4DRXB 5EZYA 5LA6A 5LOVB 3HKEB 3JATA 4YJ3A 3RYFA 3RYHB 1OFUA 1W5AA 3VO9A 5M7EA 5KX5B 3RYIA 5CA0B 5MN6A 5J2TB 5LXTB 3ZBQA 4EI9A 5JQGA 4O2BA 4E6EA 3UT5B 4F6RB 5EZYB 3HKDB 5LA6B 4ZI7B 5LOVA 5ITZA 5KMGA 4YJ2A 4U3JB 1RLUA 3WGLA 4X1YA 4LNUA 2XKBA 4FFBB 1TVKB 1JFFA 3JARB 5MN5A 4O2AA 2RHLA 4I4TB 3CB2A 4M8IA 3HKDA 4IHJB 3E22B 4TV9B 3N2KB 4WBNA 4YJ2B 3JALA 2VXYA 5CB4A 1Z5VA 5EYPA 3WGKA 5IYZA 1RQ7A 5EIBD 4X1IA 5GONA 3VOAA 4ZHQB 5JVDA 1SA0A 5IJ9A 3RYCB 4X1YB 3M8KA 4U39A 2Q1YA 4X1KB 3JALB 4O4LB 3RYFB 3VPAA 4I4TA 3RYIB 5IJ0B 1Z5WA 4ZHQA 5FNVB 5C8YA 4O4IA 5EYPB 3RB8A 5IYZB 4I55B 4X1KA 1W59A 5JH7B 4EB6B 3JAWB 4IIJB 4O4JB 4B45A 3ZIDA 2R6R1 4O2AB 4ZOLA 4O4HB 3JAKA 4I50B 1W581 3E22A 4WBNB 3N2KA 1W5BA 5CA1A 5BMVA 5LP6B 3UT5A 4ZI7A 3HKEA 3JATB 5IJ9B 4TV8B 2XKAA 4U3JA 3ZBPA 2R751 3M89A 3JASB 4O4LA 2BTQB 3HKBA 2RHJA 3WGJA 4ZOLB 5BMVB 4TUYB 4HNAB 4O4HA 3JAKB 4F6RA 5EIBC 5FNVA 5C8YB 5LYJB 4TV8A 3WGNA 4X20A 5CA1B 5LP6A 3JASA 2VAWA 4B46A 4DRXA 2BTOA
chains in the Genus database with same CATH superfamily
1PDWA 3WFVA 3A4YA 3LP6A 5KDDA 3RYCA 1O5TA 2QYHA 3S68A 3OTWA 3C5EA 3HFJA 2Y1KA 2FPRA 3BBLA 2ILVA 2ON6A 3WTBA 3CCBA 4IO1A 4P2ZA 2QOEA 3TLYA 3ICXA 2YZ7A 1C0PA 1JEAA 2BFDA 4G0MA 1XTVA 3UAYA 3FROA 2X15A 2GTAA 1E0JA 3AJEA 1MLDA 3P9RA 4K8XA 3RD5A 2LCAA 2CHTA 3M4NA 1TU0A 4B3XA 1T0KB 4DM4A 5EJ4A 4IT5A 2P9QA 1V1RB 4MO9A 2A9HA 1NHWA 1SD1A 3NANA 4PYNA 3DT8A 1FFWA 2FP4A 3J80M 2IS4A 2MR5A 5CBPB 3ZEAA 1TU4A 1JWAB 3LUPA 1S8AA 3K0FA 1IUOA 2N04A 5IWAO 1WR8A 4YRLA 3TCUA 5IN4A 1XL0A 4KGZA 3TE7A 1OI4A 3BGIA 4EARA 3HV2A 5LKRA 1V45E 5GMOA 3UKDA 3ZD9A 3R41A 3OD1A 3LU1A 3TFQA 2KB0A 2IZ6A 4GOJA 3KSDO 4Q1CA 4UZSA 2B2XA 5ALQA 3UH1A 2ZB2A 3HSKA 4P93A 4PONA 1M4UA 4WOCA 1XKXA 3O90A 4E32A 5IFKA 2L0XA 3TO5A 3GZJA 3Q3VA 1KIAA 1SPXA 1O96A 4NH0A 3RANA 1QSGA 2PMFA 2ZBPA 5BYBA 3NG1A 1VQNF 3TBHA 3WGLA 1QUEA 1VQ5F 4KBGA 2WJPA 1RQGA 2P4VA 3L41A 3K9SA 2ZTVA 4N3AA 3R6WA 3LPNA 3P0FA 3QVWA 5LGNA 2X2FA 1VFPA 2PL5A 1II9A 2ZROA 4G9BA 1UBJS 3HKDA 4ETMA 4GR4A 2WZBA 1ZJYA 3IAAA 4Q02A 3JALA 4KR0A 1YZYA 3EQ7A 5DYIA 1NONA 3CUWA 3EVBA 3UUWA 1E9FA 4KH0A 4HNRA 4WXPA 3CRZA 4RJTA 2PI5A 4YJ3F 1TZKA 4C4PA 4CIYA 3WWCA 2WU3A 5JBNA 2OFFA 4EKEA 1RXEA 5KREA 2QWPB 1TKAA 1JR9A 3Q72A 1SOAA 4KLRA 1NE2A 2GR9A 4AG3A 4LRYA 4N6GA 1CXZB 2HK8A 3OJXA 4FHGA 4RHTA 2LJ2A 2R85A 1E1QD 2DGDA 3PD7A 4DEYA 4CKYA 3EIHA 3K8YA 1PJ3A 2DTEA 4D4GA 5EZSA 4PG4A 1SU7A 1IBLO 4OI4A 1E2FA 2HWXA 1N32O 3KQSA 4UNSA 5L3SA 3FFTA 1Q82W 2JH9A 4Q1AA 2JCXA 4L75A 4CLEA 4RHXA 1EDEA 4P3OA 4P2BA 3N8KA 4W7SA 3VNVA 1P2FA 3AFIA 5FBHA 2ZGVA 3E81A 1BS3A 5AI5A 4RVSA 5F2OA 2G63A 4A9AA 4MP6A 4DR4O 3OFND 5KZMB 2J45A 3HZRA 4MR7A 1NAHA 4LZNA 2IF2A 4RZIA 1I7QB 4LF8O 1U3UA 4LHSA 3CLKA 5FUMA 1VB3A 5IVDA 4KB5A 1N0IA 1F7UA 2NUAA 2ZSDA 1UFVA 2QJOA 1XDZA 1D5WA 3W2HA 4HPXB 2CHUA 1XVUA 5GV8A 4E46A 4C5CA 1RRPA 4Y7DA 1PR3A 1E4YA 1M0EA 3MCVA 5L3VA 4XTRA 2FB5A 4IJUA 4TTIA 2WLNA 1N1EA 4Y8VA 1YAJA 5EP1A 3G9QA 1W57A 3D0OA 4D9GA 1A8HA 1E7RA 3GRKA 3NKVA 3QJGA 3W4JA 7GPBA 5I7RA 4DYLA 4MQEA 3NC0C 1IOWA 1BXRA 2HXSA 3DV0A 4TWKA 3EWIA 4NOJA 2WA4A 1GUAA 1E3SA 2Q8PA 3IPCA 4I4TF 3RNOA 4BU0A 3P30A 4AF6A 4F21A 4JXJA 1WSBA 4N0PA 1KQGA 1G63A 4DCTA 4CYMA 1W0KA 3ENZA 3B1ZA 1XPJA 3A3KA 1ZL8A 2E37A 4IHJA 3OZSA 4DA9A 1LD3A 2ECOA 3H5NA 3O74A 3RUHA 3LC7O 4BT7A 1T13A 4EO4A 4V39A 1ISJA 1OCRC 2H6LA 1P4HA 5GAPK 1TO2E 2B99A 1R64A 1CX9B 1PJCA 1RI5A 1DV1A 4N9WA 3E8HA 3HWUA 4K28A 2IV7A 3Q1KA 2JC3A 3SAJA 2BSKA 4C29A 2ZYTX 1OFUA 4MVXA 5KTOA 3G5UA 5IAOA 4QZVA 1NI3A 3REFA 2AZ2A 2QLNA 5JLJA 4TMYA 4I14A 4WESA 3X3HA 4BX2A 4J03A 4TL7A 2OXIA 4BIZA 4TYNA 1N9ZA 4RTRA 4O63O 2ZODA 1I4EB 1PQUA 1AZSC 1GQSA 3GJ4A 4C0XA 5ADUS 4EUHA 3S99A 1GXSB 5FA6A 3UN1A 1DC4A 4KP7A 4NENA 5CX1A 4K9MA 4RQTA 2AWOA 1BD4A 2X40A 3RREA 3WGYA 2C61A 4F56A 5IJWA 4YRAA 1BVRA 4IILA 2GVZC 3MAAC 3VR5A 5HVNA 3OMNB 1H5UA 5KA5A 2VHXA 2V7QA 3A6FA 1ZGAA 3H87A 2A9PA 4ZI7F 2Q1SA 1R8XA 3QX9A 3T5AA 3HMQA 2BM0A 4ZHQB 1WPRA 3IE1A 1CDEA 4RD6A 4BAYA 4EG5A 3H97A 1F12A 3LWVC 2EKLA 4NXNO 2VNSA 2XUPA 2ZRPA 3BORA 3INTA 4Z9BA 3WL5A 1ELOA 1I5OA 1AX9A 1U5BA 1SOMA 2PPLA 4NBRA 3EA0A 4IR7A 1H5NA 5B1OA 1NJ1A 1U8XX 2ACVA 3GEGA 4KR6A 4QGBA 5DGXA 3OPYI 4FJCC 2ZRKA 5DW3A 1BAPA 4WZAE 1KQPA 5KYVA 1COWA 2OFXA 1UWKA 4OMFG 2RGXA 2XWSA 3S2SA 1R0KA 3GMIA 1SXGA 2O8CA 1K9MH 1GL7A 4E13A 2ZIMA 1F2TB 1KYWA 2UAGA 3NWOA 4JI2O 3LNCA 3VO2A 3NVMB 3ED1A 3RLFA 3PD1A 3ZHTA 4GEGA 2YIJA 4KAXA 3EXFB 3WLHA 4ER5A 2FPOA 2NUPB 2ZJ1A 3FPBA 4KXYA 2G36A 1PUIA 2RGWA 2ZSIA 3LT1A 2HC9A 4YX9A 2LQTA 1XJ0A 1CQIA 1Z68A 4OU4A 1CEXA 3TZCA 3WL7A 4DIOA 1EJ2A 3FZYA 4BXOA 4BIMA 2F55A 1Q86W 4KFMA 1JDBC 1Z37A 2NSDA 4MAMA 3AL2A 4MS1A 3MMNA 2UYJA 5ESDA 1I36A 2IVZA 1BE8A 2IZ0A 5FLEX 1EEXB 2QE7A 1NNI1 1NXPA 2OCYC 4KE8A 3S1SA 2QB5A 4LYJA 1T3HA 4P0PB 2YFKA 5CM9C 2C5SA 2GK4A 2WT4A 4HNAB 2IOYA 4WFAV 1N7GA 5EJIA 1L5HA 2CJWA 4KN8A 2J9ZB 4M54A 2HTFA 2FSHA 2IHYA 3RA6A 3B6IA 3T9CA 3H2JA 1ISMA 2FSUA 3T94A 4E5DA 4BLVA 3U4IA 4GMHA 4G25A 4ZMBA 3GFGA 1H6CA 2ATIA 1WDMA 2O2XA 1ZMTA 2JFOA 1YQNA 4ERHA 3KPJA 2IH5A 5ALJA 2YH2A 5LKAA 2GUZB 5FUWA 1QZ3A 2YVKA 1VRWA 3GRUA 1FKAO 1DDGA 4DW0A 1IHYA 1PIWA 3D1JA 4CE6A 4DV5O 4L85A 2P22C 1B0ZA 1I33A 2LP4Y 3LC1O 3LUCA 3QU7A 3CQ9A 2X23A 3ET5A 3OLCX 2QT1A 4FMTA 5AVJA 2WPNA 2ENUA 3BE8A 4GOOD 4ZANA 2PMEA 4DGSA 5BUZA 4MCHA 1W0JA 3HKCA 4GO1A 2C2OA 3KUKA 3WY9A 3ZHYA 2E75B 4GKJO 1T8YA 3KRTA 4DUYO 2QM0A 3B5JA 3F8TA 1TAEA 3NEJA 1XDSA 4MTCA 4OFXA 4WRRA 4DANA 4F5YA 5ES4B 2W6OA 3QTTA 3EW9A 4R1QA 1KJZA 1OZFA 2L6LA 4FZRA 2BEJA 1WXHA 4NQ3A 4I50A 1IZYA 1Q81W 1V8PA 2F3UA 3O26A 1A5ZA 3ASNB 4H33A 3CZQA 4OXYA 4NULA 1H2MA 2C7RA 1FYXA 2NYAA 2XCUA 3MT8A 4QGHA 2W48A 2DPXA 1AKWA 3NV9A 2C8VA 2PIAA 4M0PA 4YR7A 1LV7A 2HFJA 5IVPA 4RTMA 2OHXA 2APJA 3U11A 2C2BA 2WMDA 1GYPA 3O4JA 4Y3UA 2WICA 5DHSA 1RYMA 2D8MA 2V59A 1ZY2A 4FOOA 4E3ZA 3CWBH 1WQ1R 3OQOA 2C4WA 3DFMA 1RSOA 2A3RA 3LZCA 1J42A 3UV6A 4XQCA 5KDOA 1VHAA 4OL0A 2C9YA 4B74A 3RRJA 3OECA 3BAZA 2AOUA 4CT0A 1JI3A 5FL7G 4JLBA 4MWDA 5LMNO 4XFJA 4M1YA 2VHVA 2Z2KA 3BL5A 1KSGA 4ZYWA 3MG9A 3PLAC 3O21A 1E1QG 4WZAA 1JIKA 4JDUA 4WBNA 3SJ7A 5DT2A 2OT3B 3FTPA 3HO1A 2QRVA 4FUQA 3KVRA 4AXBA 2M6YA 4FX5A 4UVIA 1EXVA 2VQ6A 3NQ41 3R8FA 1SC4A 2GBLC 1UXHA 1ZOSA 1E3MA 4JC4A 4TYMA 4A7PA 1YI2F 5J5AA 1Z56C 1JA0A 5DJ5A 5L7YA 3SHFA 2V7TA 5CLGA 1O6FA 1EFLA 3HSSA 1UEJA 5JARA 3ROQA 4CC6A 1GG2A 3D3NA 3KP1A 4HAWA 1GCGA 5AYVA 3ZTYA 2O0LA 5EI5A 4AO6A 4DDWA 1SZQA 3ZQUA 4AL4A 5J63A 1HZZC 4NKRA 4V38A 4RDIA 2Q3LA 3ZLVA 2RIRA 4L6IA 1H4TA 4QOIA 1GO2A 4AXXA 1EG2A 5BUSA 1MEJA 1DQNA 1PS8A 2DTXA 5TQJA 1G5QA 2BGUA 1FY2A 1X7HA 2WV9A 3HNRA 4DK1A 1FSFA 2BEWA 3LDAA 3PNLA 4NCJA 4YAEA 4ZVKA 4TGLA 5E7JA 4CJXA 2YY7A 1E2EA 1DLBA 3JQ8A 4FFRA 3WL3A 1NBIA 4AF8A 3P8ZA 1XSEA 3B51X 4K8ZA 1MEOA 5CU7A 4TVOA 1RHRA 4GMKA 2BCEA 3F5DA 1XHOA 1AA6A 3Q2IA 2G70A 3BFRA 1QO9A 4CM3A 1Y74B 5JC1A 1Q15A 1Y9ZA 2BTQB 4Z3DA 1Z0SA 3NTOA 4P7BA 1JKFA 2WA3A 5K03A 2ZBVA 1NUAA 5TISZ 5HJEA 3P3PA 3RFRA 4LGMA 3R5SA 2ASEA 2I3DA 4TV8A 2VDOB 4MS3B 2W6QA 4YJ2F 1C8LA 4KO8A 4Z7QB 3OQJA 4NCBA 3WADA 2AR7A 4EGFA 3LW8A 1DMRA 3BXOA 4B46A 4YECA 3VMMA 2F1OA 3CZPA 4PAWA 1B76A 3TJZA 4AIIA 5ER9A 1EBUA 1K6EA 2JDID 1HMPA 4HDRA 4KNWA 4YP6A 5LLDA 1N92A 1RQXA 4WFEA 3AP2A 4PS0A 1ESNA 1NM5A 1VHDA 3FOWA 4MR9A 5GANK 5HFLA 5ANRB 5C1BA 4MOWA 1EDDA 2C8JA 2OV2A 1ESZA 3CO5A 4O3FA 1ZGBA 3DOUA 4LFAB 5A4AA 1RABA 3HZHA 4UHDA 2PGGA 3L05A 4B79A 2W83A 5D3MA 3N4ZA 1IXZA 4GH5A 4OYLA 2NUTA 4D57A 5JXIA 1UOOA 3P19A 4C2UA 3NIWA 2I91A 3ADKA 3DM5A 1KDPA 4PSKA 3KZCA 4DUZO 2QLTA 3RVOA 2A5YB 3UTDA 3LFHA 5JCOC 4JI1O 2B5OA 1IXRC 4DF3A 1XWIA 4M98A 1CJUC 4H1VA 3DVAA 4N6NA 3W6NA 2V74B 3OPQA 2GZ1A 3Q7RA 4GZLA 2Q9UA 2HBRA 5G0UA 1DC3A 1MORA 5IE9A 1G6OA 1N2EA 1OZHA 1LX7A 1RBYA 4CR7A 3IVXA 3HB3B 3ESAA 1L5KA 5BN1A 4WJKB 5B3JC 2ZRDA 4FPXA 5HM8A 5BY1A 3P9KA 3HWSA 5J2TB 3B7GA 4WFIA 2NZYA 2HOQA 3IKMB 3VTFA 4BCCA 2XDWA 5K0BA 7REQB 3O1LA 3GHYA 2EYQA 3PQ6A 4JGBA 1OAPA 2P6MA 3S2GA 4CMBA 1E61A 1H6DA 1EVZA 2ZW9A 4G0ZA 2YYAA 3ON5A 1TXGA 4ZU1X 2KLHA 1QLEB 3GLIA 3P0JA 3JQBA 3OIGA 2PAFA 4G4JA 1YI1A 2BSAA 1Y5NA 3OIFA 3H1HH 3KE1A 4D8WA 5B7QA 1TB4A 2R68A 4YJFB 5C52B 3EIQA 1Z13A 1CLEA 3RU9A 1H9AA 5IF3A 5H9CA 2EIJB 1C80A 4OU5A 5GAJA 2HJRA 3CUKA 3LX5A 1DGQA 1W4RA 2BFMA 3RJZA 3OTQA 3ZYZA 5FI3A 1KMNA 3SVTA 4HQ6A 2XVZA 1XCBA 5M04A 2P3QA 4L15A 5DOZA 4FC6A 1HTWA 2VK8A 3P2MA 1RAHA 2OTLF 3CJHB 1OLSA 1Q6IA 3P52A 2VLBA 1XR3A 1N9KA 4BV3A 4D3ZA 4GMFA 1ECPA 1TAQA 4EPVA 4WFKA 1BN6A 4CUZA 1BEUB 2N1MA 3HR7A 4MLZA 1I0HA 3IP1A 3PF8A 5TMBA 2HHAA 4A8JA 1Y3HA 2IZ5A 1V11A 3HA2A 5C4GB 2VH1A 2ATEA 4ARSA 2GARA 4BVSA 3M6AA 4GQAA 3NS7A 5FEMA 1QLWA 2WKPA 1ONPA 3IKLA 5AXBA 5K2MA 5IBCA 4JKIA 4Y18A 3EASA 4H3KB 2AN9A 1NVXQ 2Z1FA 2I3AA 2R6GA 4DLAA 1T2UA 4N5NA 2ERYA 2IXFA 4V0SA 3CW2A 4BLRA 3LPDA 2EEPA 4INOA 3P4YA 2DYRB 2GKOA 1E5TA 1V5FA 2VJKA 1AHHA 3GXBA 3RS8A 3ULKA 5LOVF 5LQJA 2VYND 2BGWA 3I01A 2F59A 2YRWA 1O2DA 1JLLA 1FF9A 1H1TA 2CK3D 2GBFA 2BM1A 2FPLA 4UM5A 3T7TA 3HUUA 3OUUA 4B4UA 2DXIA 1GNPA 3PVCA 4ZCMA 5F9HA 3HRHA 1XVTA 1ZI8A 2A1TR 2FVYA 1XT6A 1VI2A 3C8UA 3FMPB 5F51A 1QYCA 4ASUD 3Q2KA 4JJGA 2CBGA 1BW9B 1B3QA 2HBQA 3I9FA 2WYIA 3KR1A 4HYTA 3F7OA 4N01A 4TV9F 2RAUA 1KMCA 4X20A 5CYFA 5FNZA 1H1DA 3T7CA 1U96A 1SXJA 1ZH0A 2FQ1A 1DK1A 1M72A 3MK31 1OC4A 3NX4A 1ZI9A 4FEAA 3WA6A 3WLNA 2JFVA 1J56A 2PYDA 2ONJA 1HY3A 3VQXA 1I1QB 1IQUA 3MBKA 3L0SA 3AX6A 3ZHCA 1P2SA 4OI0A 1MB9A 1U0SY 2F4NA 2XJ4A 4EECA 1XP8A 2EW2A 2ZU0C 3IKEA 3ZNQA 1IZ8A 3E18A 1PR2A 1H48A 3M1IA 3E89A 3W5VA 5EHNA 4Q24A 2EILC 4J7JA 1KVUA 1PT8A 5BYKA 2PS9A 3IV7A 4Q9LA 4TYPA 4DSUA 4DUPA 1QV7A 1NW6A 2FG5A 3R4VA 2P78A 3SYTA 3SYPA 5B5EZ 2BHNA 4WA8A 3H86A 3KOWA 4YI3A 4FSDA 9MHTA 3UT0A 2E4ZA 1G2OA 4IW3B 4UUBA 2A1TS 3LX4A 3J81M 1BVUA 3SPXA 1W4BA 3UWMA 1LJ8A 1FRZA 3NM4A 4HUQA 2NADA 2O23A 5L3RA 1L7EA 1AMUA 5BN4B 3A70A 3SX2A 1I80A 3A9RA 3SKYA 1QG4A 4UTXA 2BFOA 3ZGVA 2WB2A 2AJ8A 4RJ2A 3ZCVA 4H08A 4HCJA 4A3SA 4AZWA 1AJPA 2XMRA 3QKRB 4BO9A 4MQFB 4N5HX 2R2AA 3T61A 4BQEA 4C1BA 1VL2A 3OY7A 2I99A 1HFWA 1LTKA 3MJDA 2RCNA 3UMJA 1P0QA 4G97A 2WHPA 1KC8H 2Z4RA 4W1RA 4F9TA 1AGNA 3GFQA 2OOSA 1G21A 2BJWA 4BTLA 3P71T 4L4YA 1I2MA 1XYVA 3PQDA 1RM3A 2CTQA 3G9ZA 5K0LA 4WSOA 3W77A 1JEQA 2LD4A 2MSLA 3G8YA 5K1ZA 2JS5A 4PPGA 4EIWA 4YXWD 5K8IA 3BFPA 2VF4X 2I55A 5LQRA 3G0DA 2PYJA 1DSSG 4D1YA 1TC1A 3ZRXA 1G8AA 3LLUA 4HQLA 4RKQA 3BMXA 1VKNA 2WTNA 3R24A 4UTVA 4JVNA 1JHYA 1UK9A 2EKZA 5I8WA 5E0OA 3CPQA 2Q3BA 3HJHA 5BNFA 3V2IA 1UFYA 2AXQA 1JDTA 3K94A 4YUAA 5DN6D 2VHCA 3ZZ0A 3RUFA 1J7HA 1LS1A 2JGFA 2ZRGA 1IPHA 2UVQA 3AEUB 4PV1B 3D4OA 4OMUA 4UARA 4AZTA 4EFMA 3H3FA 3C45A 5CYOA 2IPNA 3BL6A 2WM8A 2PGAA 3O75A 1JSXA 2W6IG 4YCNA 1DPFA 3C5HA 1WB8A 4UMFA 1FNSA 1J2JA 3QPUA 5JQGF 3B1WA 4J9UE 1E1DA 2CNOA 4ETNA 1KH3A 2R8EA 1VBNA 3QLTA 5ISMA 4YY3B 2OWEA 2YTZA 3O84A 4PEVA 4JP1A 4UCWA 4E03A 2ZB7A 2E87A 4I4NA 3THXB 1PO7A 2DWPA 3W7XA 2EJUA 1E1CA 2H00A 4KYVA 4C4AA 3BYQA 5JS7A 5JWRA 5JJIA 3R77A 1RYNA 1XL6A 1PUJA 2V6BA 3MAGA 5C93A 3I2JA 2GPWA 3PWZA 3UMSA 5CG2A 1PT5A 1QIGA 3ROEA 2G6TA 3WWYA 3WJPA 1E60A 3NEYA 4J1TC 3SSOA 5IJAA 3T4XA 5MDHA 3TQTA 2E4UA 3LT0A 4D43A 4KPFC 1CEZA 3EVKA 4JI5O 2H1HA 3CLUD 1WCV1 3FTQA 4EDFA 4MVUA 3BD8A 4I0WB 4H15A 1F14A 1NI4B 7MDHA 4FLVA 2C5GA 3HNPA 1D5AA 4NCHA 4NL4H 4X6XA 3ZE2B 2C4MA 3IOEA 2F9FA 1MA1A 4QREA 1WUIS 1CCWA 4RHFA 4DLZA 1W0CA 4ID9A 5JYEA 2YJ5A 5K3DA 5GY7A 2DBRA 5BR8O 3R3SA 4LBVA 1MPTA 2ALEA 2I7TA 5G4KA 2MJLA 3BC1A 2VF8A 3IV9A 4NPHA 3NYIA 1AKNA 3T4ZA 1LLUA 3NHSA 1J22A 5B4TA 3KZKA 1C9KA 2NN3C 1U0NA 3Q40A 5D8DA 4Z49A 3NTVA 5JXGA 2FUCA 2JH8A 1NI4A 2Z58A 3HU1A 2QRLA 3PQEA 4BPBA 2IXGA 3PHJA 1GT91 3HTXA 4DT1B 2VTVA 3GJRA 3LSQA 1P2GA 1KZ9A 4YIOA 2ZIUB 3EGVA 3IHLA 5H6QA 2VQ3A 3PJGA 4W7IA 1NVTA 4XUCA 4JYAB 1VLMA 3H9VA 4UDYX 4B4VA 2BIFA 3K9AA 1P4SA 3IC5A 1Y0BA 2IPOA 5HY1A 1E1CB 3N6VA 3QXGA 5D85A 2YV5A 2IIBA 2JHPA 4XB6B 2R8PA 4LSZA 4Z1MA 5HRCA 4HNGA 2Y4TA 1Z2PX 5HX7A 2HB6A 3QXXA 4TZ0A 3RUIA 2XE4A 1Z3IX 4FWIB 2I34A 1OWPA 1P0CA 5F33A 3W7UA 3LD9A 1VLHA 1HE5A 4PYJA 5CB0A 5JD6A 4M9QA 5BPFA 1SA0B 2D1RA 1RFGE 3IGFA 5U4XA 3RVDA 3ZKAA 2H2AA 2O50A 3HXOA 1L5OA 4ZO4A 1T8PA 4TQ9A 5FYQA 4E7OA 4KAFA 2WWGA 3DLBA 2ZR7A 3KLOA 2V7QD 3DTVB 4H4EA 3QTCA 4UQPA 2C92A 1LLQA 1EJ6A 1P72A 1QGUB 3HBAA 3EIWA 1K4YA 4I6EA 4IIYA 4KXXA 1TAGA 3GY0A 4N7BA 5I8ZA 1HQDA 2PU5A 4RK0A 3V8BA 1PLKA 4CZZA 2ZSAA 4DLUA 1Y7HA 4GDMA 4HZUB 2IV2X 2JFXA 1OKKA 2ETXA 1PX0A 3D7KA 3ROFA 4HBNA 1PL8A 2FYUH 3CRRA 1D4FA 5GJWC 2O6HA 1DF4A 3E3OA 3EUAA 4JLAA 4O08A 2BFCA 3T38A 4AROA 3LIPA 3H3JA 4WESB 3MTGA 4ZN6A 3UK6A 2QN6A 4MQEB 4TXMA 1NW5A 1E8NA 3A2FA 2C82A 3NYRA 2C5BA 1H2AS 1XTJA 5I9SA 4LHWA 1BL8A 3PX2A 3VAYA 1KYYA 2LFSA 2DFDA 4NZOA 1GZSA 3EG5A 3IX7A 1E1QA 1SUBA 1S01A 2G9VA 5KWVA 3A31A 3MBMA 3RYFB 3E7WA 2DQ0A 1JDBB 4TSRA 3VTIC 2HPHA 1BS1A 3G2PA 2HA7A 1LVHA 3QVKA 2DE0X 1WXXA 1X1SA 2Q41A 3JTEA 3PCXA 1PJ8A 2IYYA 3C3EA 1QRTA 1ISGA 1U94A 1UR5A 3OQIA 4FK8A 5KTMA 4W5NA 4M1TA 4WKGA 3RS4A 1P81A 2JGRA 1NX9A 2J3JA 4RPIA 3SD7A 4Z4HA 3TM4A 4D8XA 2JLVA 3AY3A 2IOFK 3A4TA 2ZU6A 4A27A 1KK3A 3NVKE 3WFJA 4R2HA 1AC5A 4IX1A 4PYRA 1XQXA 5TEVA 3K5WA 2UZHA 3KYIB 1CJCA 4GX1A 3LQ4A 1OHHG 1NF8A 1UDXA 3MGBA 2R7KA 1JDSA 2YV1A 1T4CA 1L7NA 4UCXA 2ZCEA 2XODA 4Y98A 3TLEA 4D8VA 3MNFA 1RHJA 1X7DA 4JI7O 4LRXA 4UVEA 1GZ4A 4RY2A 3C6XA 4Z4FA 2QTNA 2ZUWA 1QU7A 2ZM6B 2GUWA 3CC4V 2K5UA 1A2KC 1PD1A 4F93B 4UPVA 4H77A 5DTIA 4NTZA 2VP0A 4PX2A 3RC7A 1XHEA 3BGDA 3S70A 3TI9A 3CMMA 4FU0A 4JYZA 3AK3A 3KYDB 3NXKA 4DAEA 2H3HA 4GL2A 4DNFA 3PYXA 4E14A 4QHYA 4PO9A 1NW9B 4PNPA 4QJIA 2GGSA 1QS0B 3TNJA 1XL4A 3PL5A 3WQQA 5IEJA 1QP7A 3L70H 2M2IA 2P9CA 8MHTA 3PDUA 4HX9A 2ZYGA 1NU1H 4E88A 4G2TA 5H70A 2IYLD 1R18A 2YWBA 1SIUA 2PGJA 2WYOA 3K9CA 3ZGXA 5H83A 4K9KA 3FRIA 1NBOA 1A4XA 1ZMRA 1AVMA 1JU4A 2HRBA 3N2GA 3VR6A 3LC0A 3WV5A 1OCCB 5G1OA 1Q21A 4LWZA 1PVDA 1YDXA 3KJGA 1PK9A 4HXEB 4ESVA 3AF6A 4EJSC 2CXSA 4WCEV 3ZJZA 1U97A 2G08A 4PFQA 4HF7A 4ZEOA 3PHBE 3ZKWA 4HZ3A 4JC5A 3L75H 1GZ3A 3NRCA 4MKFA 3BZWA 4IOKA 4YCBA 1L0NH 4DV1B 4RIIA 5GJVC 3VBBA 4W6QA 2QRKA 3SX4A 4YRGA 3KFVA 3HM9A 3MQWA 2ZWMA 1QYIA 3T3HA 2OA0A 2J3LA 2W6PA 2ZYDA 3WHPA 4R68A 4WFGA 2VPQA 1YBHA 1ZBQA 2E5WA 2VP6A 2UVPA 2QQ0A 3A3OA 5IZCA 3MJTA 3D7LA 1JAXA 4DBVO 3W06A 3HLTA 2BF7A 2V96A 1E2JA 2Z2JA 3AOGA 4WK6A 4OV6B 2L2QA 1TUEA 3U1VA 1LH0A 4U2CA 4W8GA 4FFPA 2EJCA 3TPZA 3ANNA 4HSGA 1NLZA 2DUWA 3U39A 1MABG 2BHSA 3W9BA 4MSWC 4CEIB 4ENRA 3DUFB 4IH1A 3OHPA 4PGHA 2HRYA 4FFBB 3IPYA 3TN7A 4D9CA 2VTBA 1HL3A 3HI4A 2FFRA 2ZWIA 3E27A 4GXQA 1SG0A 2M6SA 1R0WA 4LXUA 4C0QC 4FM9A 3L4JA 2PX8A 3GLHE 5FPPA 4A6XA 2IDMA 4JENA 4Q3DA 2JAWA 1Z73A 2V1XA 3OSUA 4RNDB 1PS9A 2OXEA 1RQ7A 2ARHA 4O1MA 5HJ2A 4M87A 5JCJA 3RRZA 1OILA 3MWEA 3CWZA 3T0GA 5IASA 5AHKA 4C14A 3OWHA 1P7GA 3JWGA 1JQBA 2CGNA 1Y3IA 1NXQA 4GNKA 4CEIA 5CR9A 4Z1MD 2CY0A 1MP0A 2AD5A 2IUFA 2AA3A 2BR5A 4PD4F 3L4KA 1EVYA 1JIXA 4MJ7A 4OFZA 4JJKA 1SUDA 2RHCA 2YWFA 3U7EB 4B87A 4LJRA 5E9QA 4BZXA 2H4ZA 3CD6F 2WU1A 1CHNA 3OCUA 5EE1A 2YCLA 4RPGA 3GFSA 2FP4B 5B3AA 3SQNA 3T3OA 2H9AA 3ITEA 5FHQA 4Y6RA 4KITB 3PICA 2JCYA 2FUKA 3UMGA 3K6JA 2UXDO 5ALSA 2WW8A 3QWHA 4F4FA 3HCDA 2PE5A 4MYDA 5JMTA 2YSUB 4UUPA 3UMCA 1B16A 4OB7A 3S2YA 1IQRA 4DJAA 4EVIA 3BJEA 4HGZA 2IDZA 4BGVA 1P8AA 2CW4A 4WNAA 5CA0F 1B43A 2X5JO 4CCSA 2W8BC 5IEBA 2REXB 2XTAA 2I65A 3HCNA 5E79Z 1QC5B 4F6CA 1M1KW 4JAUA 2GAIA 3UATA 5I7VA 1L5ZA 5DNYB 1NG1A 3URKA 3T95A 5IARA 2VKQA 1RP3B 1A1SA 4TV8F 2G04A 2ZP1A 4JASB 1UXKA 2C4NA 4B3CA 3K8ZA 4YQYA 4CC5A 4ER3A 3ISTA 4ZI3A 4B3MO 3A10A 2I0FA 2CYCA 2GO7A 4ERXA 4F5WA 5BWCA 4WZBA 1A8QA 4JODA 3ZD8A 2W70A 4LY3A 1VECA 3ZVRA 4KPEC 1QHYA 3LKZA 3G7SA 1FTGA 2VHQA 2Z6UA 3WLAA 821PA 4V1CA 4ZAVA 5JZSA 4YRDA 4YY3O 1HNZO 2NACA 2Z9BA 4M3NA 5G1NA 3IPRA 3LM8A 4D9FA 3DZGA 2JIDA 1XJ5A 3AJ9A 3E8BA 2NU6A 3B1VA 4GCZA 1K7XB 3HCCA 4QBKA 4X88A 2GD0A 1U2SA 2O1SA 2O2DA 2IM9A 1CETA 2EERA 2GRUA 3ICOA 3OI7A 4I5FA 4UD2A 2DT8A 4FNMA 1MAAA 2FPXA 1J33A 1XLTC 1ES9A 1DAEA 4E5UA 1RAEA 2A9OA 2CLDX 3KAQA 5DHFA 2VDPB 1OLXA 4RVDA 4YRQA 5L3GA 4KXMA 4GWKA 3DAFA 5HCUA 4CQNA 2IVFA 1K0FA 1QVFF 3VR6D 2O2GA 3IAHA 3UCXA 2QMHA 3ZHXA 2AJLI 4LQ4A 1GYRA 2XCLA 3GPDG 2X3FA 3OOJA 3FJOA 2VPXA 4H0FA 1NVKA 3K0DA 1QV9A 1Z6QA 3MGGA 1R74A 5JCPA 2CLMB 1GARA 4M76B 2UKDA 3AUTA 3BVPA 3IAS1 3UQZA 2Z95A 2ZJ7A 1OJ7A 3TTWA 2RKBA 5DW0A 3V4FA 3HSYA 3IBFA 3SEFA 2YHUA 3ZV3A 4AN4A 2E9SA 5DZSA 1EWRA 2DECA 4UULA 2KG7B 5EQFA 2PCLA 5KTPA 1WP7A 1N2GA 2V8BA 3OJEA 5CEEA 1ZRMA 4L8JA 3QPVA 3TQIA 3A1WA 5IMSA 3MIZA 4YYZA 4B3TB 1B0AA 1Q3TA 4HGQA 1MZPA 2FFQA 2J6BA 2Z5VA 3I05A 2ODEA 4YDRA 4ER6A 3BXZA 2LW7A 1NDUA 4RY0A 4JITA 4XRRA 2HA2A 4WNIA 2FZKA 2ZJZA 4UPDA 5KYKA 4DV2O 1M1YA 1XDCA 2CXHA 1RBMA 4CU5A 2G80A 3C3YA 4XAQA 2D8AA 1VQ8F 1Z5VA 4KXNA 5LHGA 1QYXA 4PO1A 4L8LA 2FWIA 3V8RA 3ABKC 1I8TA 1UBMS 4WAUA 1K9MW 4RTSA 1KRWA 3SY8A 5AOBA 5H81A 2VJDA 4HVAA 4PRZA 2NU8B 5BSWA 2VJBA 2IPMA 1K98A 2JEYA 3EIXA 4ETWA 2NUPA 3RC3A 3VYTB 1VIMA 4YWHA 1SO8A 1M1YB 1I32A 2H4YA 3C3XA 3CYQA 2V7QG 1ZSPA 1WNSA 3O3CA 4I1VA 5H3HA 4U3FH 2Q0QA 3E3NA 1F2UB 3QKUA 1EK6A 5FF9A 1VQ9F 4Q6WA 3SX0A 4IS3A 2E55A 4CFYA 4XM0A 4LH7A 1K68A 3L6OO 1W59A 1KR5A 5EXPA 2MOKA 2AMJA 2QN3A 2VLIA 3AG2B 3K0CC 4FDVA 3VKGA 5B2FA 4Z7NB 4RK7A 1JSZA 4JJ8A 3NBXX 4PSCA 1IV4A 3BFXA 1ZCBA 4MQLA 1MZFA 3R0IA 3PC3A 4C4ZA 5A7GA 4I08A 4YUXA 3WLLA 1PZXA 2A2ZA 4HT3B 5JZVA 3W05A 3GUYA 3H17A 4FR5A 5AI9A 3L07A 4COKA 2YASA 5CVEA 2Y05A 4Z3KA 2F48A 4C4OA 2ZAUA 5JJBA 2M6RA 4RUEA 1LFAA 2XD4A 4QPNA 5G0TA 3IFXA 1EWKA 3RV4A 4B6EA 2FSGA 5LQKA 4UV9A 2PLRA 4NENB 5CX1B 3W4IA 1CE8A 1D4AA 1KTVA 5KCMA 3UJHA 4N8EA 4PG8A 4EHDA 1SKUA 1UZUA 5EVCA 1HDZA 3D3EA 5HRAA 4XSHA 2RKOA 1Y3CE 5K09A 5LNK6 1FU8A 4YJFA 4D4JA 2CNWD 2FKAA 1H2EA 2JK0A 3GEEA 1SCBA 1VZ2A 2EC5A 1QZTA 5LZ7A 4D98A 4LPSA 3UFXB 3NKLA 3H2YA 4MYSA 5FLXM 3EF0A 4R3UC 4IG9A 2X14A 4NFYA 2IDKA 4ETIA 4D80A 1ODEA 3PIIA 2HFKA 4R31A 1EE2A 2YFYA 3SEAA 4I9WA 4ZQBA 2XHZA 2HVYD 5F23A 4KQMA 2YV3A 5EMMA 1WPQA 2B6NA 3KXKA 4UUOA 1I4OA 5D3KA 5BSRA 1XQWA 4C0WA 2YOFA 1CZLA 3S7TA 2N46A 3W9UA 2FWJA 1P39A 3EXEA 4AJJA 4ALKA 1I5YA 3HNOA 5J58A 1QYRA 3WIVA 3DMRA 3X1JA 4CLOB 4O8CA 1R0SA 2HRDA 3CX7A 4UMDA 4YV1A 1H4VB 3K70B 4XDKA 3KNZA 5E7IA 5AI4A 5DIFA 5GZ3A 5AXCA 3C3AA 2O8VA 4X61A 3RT9A 1BJRE 2RHRA 1YJAA 2E7ZA 3EFEA 4HH1A 3HVHA 1PR0A 2NNLD 4H27A 3U3OA 2O8FA 2QJFA 4BYGA 2CYBA 2ZRMA 3A9UA 3CCFA 1KTIA 4FZ1A 1XRSB 4QOEA 3H11B 2B7CA 4XVUA 1FMLA 1MHPA 1O8CA 2P9EA 3NJ8A 3TJTA 3VSCA 3EH2A 5REQB 6REQB 2PX5A 3WKDA 3CZMA 3FHOA 4LRUA 4BQIA 4HLDA 1G64A 3T4PA 4DGQA 1XF1A 3OAAG 1VHLA 1IEWA 3CR8A 3DL2A 4MJXA 5EJMA 1NULA 4X45A 3QHDA 5MN5A 1IJEA 3TIXB 3QKSA 1RCTE 1YS4A 3JQCA 4LSGA 4Q4CA 3BILA 3IOYA 4KPUB 1MGOA 4PSDA 2QSJA 2FKNA 4PR3A 5CHEA 4A26A 4CQMD 4EHFA 3JAMA 4MIEA 3MTDA 1MC8A 3NCHA 3SSNA 1V9SA 2HWWA 5HKBA 5AKHA 2O9JA 3IB3A 4IDEA 3OAAA 5IUNC 3P9CA 1NXSA 5AIBA 4XUDA 4L9AA 3U7JA 4MVZA 1CN7A 1WU7A 5KAIZ 1C9NA 4HDQB 3WYEA 3PC2A 3GVIA 5DYTA 5EJ5A 1FUKA 3W5CA 1GYQA 4DTCA 4DJFC 4QE7A 2UVPB 4PICA 1WUKS 3K7EA 4QDUA 1JD1A 3V4SA 2OPBA 3ANYB 4D6XA 4RZUA 3N1UA 4WNCA 5LGTA 1OV6A 2I4LA 2P0AA 2X13A 4R81A 1DFIA 5EHGA 1GRNA 2EX0A 3PWTA 1K5SA 4OLHA 3EULA 4QE9A 4D4HA 1M83A 5TMEA 3H8WA 1GN8A 1LBIA 3TNFA 1PN3A 1V4VA 5GV7A 3A1EA 1IIRA 1E8MA 1PJAA 3CIFA 3SXUA 2PXCA 2X3YA 2ISCA 3LV8A 1YJNF 2ZBDA 4DCPA 1WZEA 4AMUA 1JQ5A 3IVCA 2AH5A 221PA 3T1YB 3OZUA 2RARA 2WMYA 3UB3A 1LVUA 4M6WA 5THXA 3KETA 2P6YA 3L6DA 2PFKA 2Q49A 3ICWA 1GTG1 1NYTA 3H5IA 4YA6A 3SG0A 4LKRA 3U0OA 4NU6A 3LYBA 5ERGB 4E30A 4G5FA 2G38A 3H6GA 3L7QA 1SQXH 3PNYA 4WL0A 3ZS8C 1DIAA 2O6LA 2QAGA 4RO0A 1RAAA 1YQUA 1UKCA 2VHWA 3FRJA 5A9RA 3S8EA 2AG1A 5DHRA 4DV4B 3NHUA 3WLFA 4DDHA 1ZGHA 1P0MA 5BMOA 2BI4A 2D0OB 3CZ4A 1DRWA 1FFCA 4UM9D 3ZC3A 5DLQC 3MUNA 4Q3KA 3M49A 2GVIA 2D5CA 2X77A 4YCJA 2HW8A 3VM6A 1GKFA 2GN6A 2EX3A 2HMSA 1QZXA 4CN8A 1GZUA 1MFPA 1KD1W 2FUG1 3HKCB 2WJHA 2ZLBA 2ZKLA 1GEEA 1FC0A 2YWXA 1EX1A 3BB1A 1PD3A 3DL0A 1X7OA 1S2MA 4GUAA 4DA7A 4Q48A 5KYYA 1RRFA 4K6GA 5DNEA 1SBIA 4NU8X 1F51E 1JMYA 5EB0A 4PWTA 4M1WA 1HG1A 2H59A 2NWQA 1YVRA 3KU1A 3UAGA 1UFQA 2PKEA 4Q9JA 4F1JA 1EEHA 2H9YA 2WALA 3ETLA 2QT0A 4JL8A 2VQEB 2ZR9A 1JKJA 3D2CA 3GCDA 4ML3A 2Z3WA 1N2SA 5LBUA 3GLIE 3ABMB 2CKMA 2ODTX 4D3XA 3CEHA 3LQ2A 4RL4A 2FLKA 4LS3A 1K06A 2XGMA 3BH6A 3KPVA 3HP7A 5FOVA 1WRBA 4NG5A 2ZDIA 1NNSA 1WB9A 2J32A 1QONA 1S89A 4GX5A 3WB2A 1GZ6A 1M6EX 1P60A 4O1IA 1VYUA 4QRIA 3HJBA 4D56A 5LQMA 4ZJYA 2AOTB 2VT7A 1ISRA 2WD9A 1YQEA 2WOJA 3UJDA 6CHYA 2XCRB 1ARZA 1JUDA 2B34A 2GWRA 3FBAA 3OJCA 4OHFA 4JUIA 4LCUC 2KG4A 1R4NB 5BN4A 2H8PC 3FCSB 4WCVA 3EEOA 5I7OA 2ZWOA 3JTMA 4G5YA 4KBYA 1N6HA 4GPZA 4I2VA 4S35A 2VK4A 4XQ0A 3ZWKA 4NBLA 4EFLA 2UZ4A 1G5TA 3BMNB 1YCIA 1S72V 2FZVA 2V45A 3JSLA 4AW9A 3OPYB 3NB0A 3FNHA 2QMYA 3UTCA 1LBEA 4MB0A 1GNVA 1K5DA 4YDSA 4BB6A 3X2QB 1BCSA 1LB1B 2ZAGA 3L40A 3NHLA 4P9NA 4S2UA 4AZ0B 3TVYA 2XGOA 3FZNA 4TTAA 4H1WA 3C6BA 1TCVA 5T5QA 4OAQA 1BKSB 4YJ2B 3CCVV 2OMEA 2K87A 2RD2A 4W4LA 4ED9A 3GVCA 2OQRA 5AJWA 1AO3A 2QP9X 3A1VA 1Z36A 1U0JA 2V65A 3ILSA 2KS6A 1I7LA 2XMCA 3OT5A 4A8HA 5L45A 1RYBA 1ORHA 1UJBA 2ZETA 3LF1A 4GS5A 5SYMA 1ODKA 4WK0B 1LA2A 1E58A 1K0UA 4JDPA 5HA5A 4O4LF 1ZK0A 2HXYA 4F8JA 4DXHA 3D6TB 3H5AA 4Y9RA 4HFJA 3RGGA 5KCZA 2DULA 3ABLB 4IICA 5JAZA 2P6RA 1CEQA 4G1VA 2O05A 1V3QE 2Z1DA 4H3SA 2YWDA 4S1NA 3SR4A 1PGNA 5IG2A 3JQAB 3I12A 4XYBA 4PX9A 4HGNA 5BWBA 1KOLA 5L3ZA 4BAUA 1IM8A 3F97A 2OECA 4MULA 2RH4A 4FHDA 1YVUA 2HU2A 4X60A 4EG8A 2NP7A 3I5DA 2Q28A 3ER6A 1Z7GA 3D7SA 1V4NA 4F9FA 2PY6A 1K6XA 3TW4A 2Q3EA 4ZCTA 3QM1A 3CD6V 4CZ2A 2GF0A 5JYDA 4B08A 2LPMA 1UAYA 3WO1A 3IHTA 3PF9A 4ZKDA 1W48A 1LRJA 1XTTA 1Z75A 2BFBA 2PM8A 2QX6A 1NN1A 3AWIA 3B2QA 3IPAA 3LA8A 4LDJA 1J0AA 2C88A 2XUIA 3CE9A 1NBMD 1PJRA 2CLHB 2X6QA 3L04A 5DDIP 2Q7HA 5CJPA 1O95A 5FNVA 1P3JA 3G4SF 1VQVA 1A5AB 1G4UR 3D31A 3WYDA 1ORDA 2VZ8A 5B53A 1F06A 3VKFA 4WLFA 2YBDA 4BGIA 1F2TA 4I1IA 1GKYA 3KSUA 2GA9A 2W5UA 3VU9A 2XVYA 1C3XA 1POWA 2B1IA 1R8QA 2H1FA 1WNTA 2D2FA 1G21E 3FNRA 4NRDA 4WXRA 1NQWA 4FLWA 2I2AA 3FRHA 5JISA 4RTPA 5K0SA 2A59A 1GU0A 2UZ0A 2B94A 3HDVA 3PEYA 1P7WA 4R1TA 2PL1A 3JYCA 4IXDA 5A5VA 3FTEA 3LWZA 3C8MA 3OEHD 2IPXA 3HBMA 2DPYA 5K51A 3UJ9A 4M0DA 3PKZA 4I55A 4UCTA 1TTPB 1GN4A 1SCQA 1G6UA 1R2QA 2SCUA 3CIOA 4EA6A 4FNOA 1G21B 2B3DA 5E8RA 3WXMA 2XZDA 4JXXA 3JQEA 2O8EB 3C43A 2ZDHA 4EB8A 4I66A 3BRQA 3UW3A 2F4VB 4QOGA 3TW0A 1DX4A 3OD4A 3LBIA 4GP6A 4G4SP 4TN1A 1OGIA 1CS0A 2X8JA 3I9LA 3ME5A 1U8CB 1P5ZB 3R40A 3KZIZ 4C7UA 3T3PB 1RU3A 4JR0A 4BNUA 2H5IA 2ZT7A 2HHCA 4NBVA 4HGRA 3WGHA 3M6WA 3E53A 5CPFA 4ZVOA 3HUEA 2RDMA 5KSWB 3W5AA 3VJRA 2EKBA 3ESZA 3WQRA 1JLLB 1WLSA 1EB9A 4KAAA 4EF4A 3CCRF 1KFKB 1NZFA 3WYAA 1VQMV 4OGWA 3H4VA 4EBBA 5A02A 5HXZA 1GITA 2Q9AA 3E5NA 3FHJA 3R9KA 3OIVA 3P2YA 2XEXA 1MMFB 2BGTA 2XMGA 1YR8A 3EMDA 1VYTA 1SBQA 2EDAA 2OILA 2W6CX 3LE8A 3OU2A 5DRTA 4EHBA 4XJTA 1LRKA 4Q34A 2O8BB 3IAM6 1N5LA 1WDWB 3JWHA 4AMVA 1YB7A 2YWHA 1SVNA 4E5VA 2AMYA 4A10A 2NR5A 1NMYA 4TV9B 2NTNA 1JTEA 2QRUA 3ILVA 4GEKA 4NCNA 4YRIA 2VXYA 3Q7PA 4QUGA 5TQ0B 1XP5A 1CZUA 3A37A 4RL6A 5B6JA 4JQYA 4X1IA 5GONA 1FLDA 4IFIA 2I7VA 3BKXA 3NHBA 4OA8A 4Q1EA 5EXEA 3TCXB 4JBHA 3AONB 5G3YA 3N6XA 1KC1A 2AN1A 1FRQA 3FOFC 1QP4A 2WYWA 3R6DA 1MVOA 3EXHB 4DJ5X 2PT7A 2ZRBA 5A04A 1KZ6A 3KS9A 4L6AA 5HIKA 2YWCA 4R69A 3P2OA 3MN1A 1HE3A 4J16C 4WBXC 3SNKA 1RCUA 4XQ9A 4WGFA 3MWKA 4ZVQA 3T7KA 2VJYA 1EHIA 1QGDA 1YDEA 3GK3A 4U2BA 3EN0A 2V9CA 1X80A 1HDYA 2G0AA 4C87A 4FDLA 1HE2A 3ZIUA 2PHZA 4BVGA 2QG6A 3LC2O 1C8VB 2OVFA 5JTUA 2OFPA 4PGMA 2IYNA 4UVCA 1J21A 2PKYX 1X7PA 3HFSA 2AK3A 2Y1CA 5G2OA 3WHKA 5L3QB 4QG7A 2RN9A 1CEEA 1NRXA 1J8MF 2YW2A 1BIFA 2H17A 3QUWA 4UBJA 2CUNA 1X2BA 4FXOA 2R8RA 5G41A 4ZXPA 5LVAA 1OZAA 1QUFA 2FF7A 2JCVA 3DUFA 4ZI2A 1PZMA 1WXWA 4J1SA 3QVLA 3SYLA 1ZUQA 4PTLA 2VTBB 5E1OA 2O3QA 4TS1A 4DCOA 2W6JD 2JEOA 1QXSA 4WKCA 4A6PA 5KVAA 2DKOA 4Z6KA 1JJ2F 1CULC 3RFFA 1CUBA 3MILA 4ICIA 1ADGA 1JKXA 2GBCA 4UFZA 2NV2B 3L0IB 4AT1A 4RM3A 4AZ3B 5C7IO 1RQRA 1MQAA 1WS6A 4CV1A 5JMWA 2JI4A 4V02A 2VRZA 2XYGA 5KI6A 1GM7A 5JD4A 4K2AA 5B12A 5IY5C 2HS0A 1M1YE 4LOAA 1SK8A 1O6CA 4QVKA 1W9MA 3O9ZA 3ZIAG 3F74A 3VAAA 3CC4F 4JLKA 3FDIA 2GN4A 2B0CA 3IEKA 4QRHA 2DTDA 3SLRA 3PFNA 1DAPA 5D86A 3ZJUA 1CXZA 2GASA 3L46A 1OIWA 3A9SA 3FR8A 4EG0A 3U16A 4IYJA 1KI8A 1XZEA 2BZGA 3K0AA 4FXPA 1DJLA 1PJBA 5SZHB 1G8JA 4BO3A 2Q5EA 4RK5A 1KQSU 1GM5A 4KDRA 3BCUA 1RHUA 1UBUS 1YH3A 1U8FO 1WL8A 3DH0A 1KAHA 3HQ4O 1WPXA 4L73A 4M9RA 4ZEWA 1XK7A 1YA4A 3U61B 1Y3FE 4O4HF 5FWXB 3DBHA 2RHDA 3C8LA 4OHUA 2AW3A 4G6ZA 4XGRA 4L22A 3LZ6A 3UOGA 3E8FA 1H7MA 5K0JA 4EA8A 2L42A 3AL3A 3FMGA 2VUTA 2XITA 5J1TB 2WYHA 3A14A 1GCOA 4OKNA 1CR1A 3V8EA 1HP8A 1W9HA 3O9OA 2D0IA 4JZYA 5CH5A 1KS2A 1FDTA 1VCHA 2JFUA 5COQA 3B2EA 2HA6A 1OHHD 1LKZA 4EABA 1DJPA 5AJVB 4E1VA 1U0FA 4P1ZA 3UGQA 4G5QA 4H7DA 2QA4F 16PKA 2VIIA 3VV2A 3NMUF 4QEZA 1BWSA 3V3KA 4C9BA 2YIBA 1QO7A 4RGVA 1GA6A 1FTSA 4TLCA 5KQSA 2ZCUA 4D7TA 2HJDA 2PMBA 3W2IA 3U1BA 1CIVA 2I1WA 4JOCA 4KXWA 4XIYA 2UYOA 1ODJA 5AM5A 2I33A 2IU3A 1THTA 2YFHA 5HIIA 1OFUX 3D6VA 1E79D 4M7PA 4Z7OB 4WKBA 1DVRA 4J4HA 5EERA 3OPMA 5HFMA 5JHGB 3PT9A 3IA7A 4KQIA 4EKDA 1T5IA 1SQGA 2DYYA 2A58A 2OENG 1QO0A 4U2DA 5E6SB 4B4OA 5ALVA 3A4LA 3AZQA 4N39A 5LLSA 1REQA 3GQBA 4IJVA 4L27A 4OREX 1G16A 3GGSA 4LI3X 3SM3A 4D0NA 1G59A 1AUPA 2ZI5A 2XAAA 2R6AA 4EYKA 1DKNA 2C7GA 4BGUA 5T8KA 5LHIA 3A6DA 4IIFA 1P1HA 4E2ZA 1LDBA 2MT9A 3VHLB 1Z4OA 1ATIA 2JAHA 2ZE6A 2VP3A 2VOJA 2UXDB 4ICGA 3ZOKA 2LO1A 2PZSA 721PA 5D6OA 2ZUBA 3DC5A 4XLLA 1WMEA 1LTQA 1NLFA 3KXLA 4BX9A 1DLJA 3B89A 3STWA 1ECLA 2ZJ0A 3VVBA 5CBPA 3GGDA 3QG5A 4FJ1A 4K9RA 1U2GC 2ZYWX 3S40A 4YV2A 4LOHA 1S2LA 1L5SA 2YJTD 4FVMA 3BTSA 2K2WA 3LBAA 4LE2A 1O7JA 4NFSA 3RSCA 2HSGA 1OXVA 3DF7A 1ONIA 1GQFA 1BMQA 2BV3A 1JPUA 3SIPA 4G0UA 1TYEB 3E70C 1NR7A 2IYAA 3ICCA 5HKLA 4Q4JB 2RC6A 2LGQA 4AJ1A 1JHPA 1Y37A 4IEIA 4D42A 1WMSA 3D8CA 2OUIA 1OA1A 2Q6TA 3KV3O 3LPAA 3DP7A 4MS4B 4P53A 1OVGA 2BM9A 4KX3A 2PZMA 2Y69C 1N5MA 1KAOA 4GICA 4G85A 2ZUTA 2QDXA 2ZNJA 4TWRA 1PTJA 3OQVA 3WK5A 4HFNA 4ROSA 3TGWA 2C58A 2WFMA 1OZGA 1CQZA 4X24A 1JVNA 2ASVA 3ER9A 1I24A 1WV1A 3ORRA 1KVTA 1T3ZA 4FDUA 4FJ2A 1XV5A 2IY8A 3QO8A 1XNRO 1VPEA 2GDZA 2D5LA 3MS2A 3IOMA 2WNSA 3VO8A 4YK7A 4YHHO 1USVA 3UVEA 4E5PA 2FUNB 4PBRA 1VQOF 3WSWA 3N86A 2HF9A 5LQDA 2JHCA 3ACBA 3QVGB 1RWBA 1YU9A 1CP9A 2QEQA 2BGNA 3U3MA 2EXXA 3I6MA 3HU5A 1WCWA 5FPSA 4BNVA 1O03A 1TNDA 3K16A 2DJ5A 1Z45A 1EFTA 1DHTA 2HF7A 3ASVA 4XLZA 2X9QA 3NM5A 2CLEB 4PAGA 2EGHA 2ILTA 5FFFA 2NO0A 1FPMA 2G3YA 2GKSA 3N5CA 3SMVA 3IXMA 1N9GB 3W5BA 1V5GA 1KNKA 2VT3A 3QVSA 3DT9A 3HBFA 3IVMA 3GD5A 4GHWA 4AUMA 4UM8B 1VA4A 1HKHA 3NASA 1HKUA 1L0BA 3ASNC 2SBTA 3AOEC 3BDVA 3QVGA 2XPCA 3CZAA 4LJKA 3M3DA 5CFLA 4LJYA 5LZ2A 2V7VA 1ZUHA 4H31A 2LUOA 5E9WA 5ARDA 1W1UA 5DBFA 1KAMA 1KAGA 3QLJA 4B62A 1UMDA 1WCIB 3SJAC 3I56V 2X4LA 3W5SA 1I2ZA 3O8CA 1H8EA 5LN1A 5A1JA 2ST1A 2Q69A 3MWGA 4A4DA 5KC8A 4RHYA 5DKFA 3F3YA 5L53A 4Q6GA 2HLDG 1IV1A 3L71H 3ORYA 3GLHA 2KI5A 2TS1A 1QH9A 3KKLA 2VXCA 4FM2A 1A72A 1WLYA 1XEWX 3L4EA 4K1LA 3V7FA 3FD5A 4HSEA 4PZUA 4YRFA 1ZIXA 3GWGA 1I7SB 1U99A 2XNKA 4FYMA 3UT6A 3P9PA 2L17A 3BT7A 1JI0A 3F0EA 1NAIA 2QSYA 1DADA 4YASA 5HFJA 2G67A 5LD2C 4UTNA 4X3OA 3G71V 2FGKA 1XDDA 3FMVA 3HA3A 4H17A 5BSUA 4GRDA 3O92A 3FB6C 1LRLA 3FYUA 3HDHA 3OAAD 1LK5A 2AT1A 3EFOB 3BX1A 3OQIB 4IXTA 4UHBA 3SLKA 2GBOA 3CVOA 3UJ7A 3JD2A 3OLVA 5CBFA 2H5LA 4O4LB 4KE7A 4OJQA 4LDRA 3A9CA 3H9CA 4EX7A 2O0MA 5GIOC 3HEMA 2OXRA 1OJLA 4AX8A 3ON1A 2BGKA 2CVHA 3Q9SA 3CRVA 5IH7A 1AI4A 3IUJA 4RCVA 2CGOA 4DMFA 5KX5F 2H8KA 1A27A 1L5FA 1SG6A 5T4HA 3T3GA 1OAOA 1WHSB 1KC8W 3L9XA 3SK0A 3G8CA 1C41A 3TAXA 2ERCA 3HL4A 4DCSA 1QRSA 4O2AB 1BMFD 2E49A 3BFVA 3R0XA 4OP3A 5JPIA 2VFAA 4BR6A 4GLXA 5C1IA 3B3FA 4RVGA 2OZVA 4A6DA 1BSMA 1V54B 2UXCB 4OM7A 5CT4A 1CUSA 1VIAA 1G7RA 3HZZA 5F7JA 4C4TA 2WIDA 4DCVA 1EVLA 1K7YA 1Z4LA 2QV0A 3KDSE 4RV5A 1KO4A 4QJFB 2FH5B 4HQRA 4U3JA 2J5QA 1W88A 1E6CA 3PC4A 2HMTA 4I9FA 1C1XA 1KMIY 2I67A 1JG1A 2FOIA 2RMKA 1ZWLA 3B8EA 2C0PA 3IOBA 4ESHA 1VB5A 3OX2A 4BY9D 1O6BA 3I6IA 5EG5A 3ROZA 3U9SA 1GD1O 4MW6A 3RSZA 3S29A 1FFAA 2X0NA 5LYJB 4WX2B 4J3NA 1S72F 1KVRA 1YR3A 1QU9A 2YMMA 1XEAA 5LP6A 3QHAA 4KVZA 4YONB 2IUUA 3PQ3A 3BA8A 3LMEA 3AR3A 4PM4A 3C6MA 3Q12A 1I51A 1UJWB 2YXHA 4LOIA 3L7IA 5CCDA 2ZIZA 4BMYA 4EI8A 2V6JA 3HCBA 4OHCA 5FWYB 3RU7A 1GZHB 2CVFA 3GH1A 3LUAA 4MDFA 5HZGA 3DMYA 1T5LA 3DBHB 3VDNB 5IHPA 4V3BA 3K72B 1PR6A 1E6UA 1YUMA 4E94A 3F7YC 1AI7A 4DXWA 4ZK7A 2C2ZA 4BO5A 4IVRA 4IQ4A 5AESA 5CX4A 4HQFA 3PXAA 2GJ9A 5H80A 4LF8B 1I5RA 3WQBA 5JS8A 1KEEA 1X7GA 3C48A 3FCYA 1RWMA 4RFSB 1DIBA 2AGAA 1HBJA 2CLFB 4PDMA 2WJ3A 2VDWB 2BEUA 3KCXA 4MVJI 4EPWA 1B8PA 5HW0A 3AG3C 4ZEVA 3HDTA 4ZOEA 3D6JA 3JVEA 5TE9A 4CKCA 4LE1A 3EVFA 3G2LA 3FWNA 2FWPA 4K6FA 1VARA 3RVYA 2OO3A 4XH9B 3LKBA 1GXSA 1XNHA 3W1WA 3WGTA 5C7OO 3RIGA 1XAGA 4P6VF 1OFGA 4BDSA 4OGFA 4KAJA 3ADBA 1BOOA 1WDTA 2PXHA 2RI6A 2G71A 3JZAA 4I55F 1YQXA 3DBVO 4MQMA 5TARA 3T3NA 1SXPA 2VEOA 3KZVA 1N2IA 4TN5A 1L5GB 3ZIAD 2QVCA 3NHJA 3KOUA 3HR8A 2G9NA 4EL5A 4OX9B 2R1UA 1USWA 3H16A 4C06A 3NR7A 1MV5A 3JZDA 1SCNE 1WQ4A 3SPCA 4EUSA 4RMNA 3EJ6A 2VG8A 4WNYA 2AZDA 1TVKB 1A8UA 1OBFO 2CW5A 3KHKA 4G24A 2WF8A 1HSOA 4JCCA 2Z1EA 3M7MX 1S1MA 1DT9A 1C0EA 1NVMB 4LF4B 2I29A 2NXCA 2VPTA 2GYYA 5CP8A 4EYGA 5I48A 1JOYA 1PEYA 1RMYA 4BLOA 1ONNA 3WBFA 2LP7A 1KE1A 3WBJA 2FJPA 3P20A 5KOJA 3SFTA 3G6KA 2QKCA 1WUHS 4PLFA 4RW0A 2QL5A 1G17A 3HY4A 4RA9A 4X8OA 1KQ3A 5KYUA 2ZFUA 3DDCA 3AUFA 1BD3A 3L8FA 4WY5A 4IM7A 2AE2A 2OGWA 2ZQ5A 3E83A 1GTZA 3KL4A 4JLVA 1R3IC 4RFVA 1RAFA 1V5EA 1M0WA 2CUGA 2GEDA 2X2EA 5DGIA 5B6PA 2XWBF 3O3OB 2W6ID 4ZHVA 2BW0A 1E9RA 3LHFA 4IKOA 4ID3A 3PUXA 1JDZA 1KJJA 3D6FA 2JF0A 5DE3A 2ZB3A 2BEUB 3D64A 1EFPB 1KGDA 1EBBA 5C7YA 1IOZA 1KDRA 3RBAA 3QOFA 2Y76A 3HK2A 2W6IA 1ZGJA 3AHDA 4YPFA 5C81A 5G0SA 3DS8A 3VZQA 2GVDC 1ZHOA 5CFPA 4XYGA 2CWJA 3PA6A 2Q7DA 5DM4A 4CCAA 2YNMA 1BS9A 1H0RA 1G8FA 4J4TA 4C05A 1Q1QA 1U0HC 2R86A 2HV9A 5CLQA 3R7WB 3W1EA 1NT2A 4TMVA 4DNQA 4YXFA 2I4OA 4TQFA 4RM2A 5IYCO 3PDIA 4B48A 2O0JA 4DCGA 1JDNA 1QH0A 4CF6A 2OBBA 2J7PA 4F1KA 3KB6A 3W7BA 3I72A 1OTYA 1WX1A 1NXWA 1YITF 2QI2A 1G7SA 2ORVA 4I4LA 2BAGA 2DHEA 2B98A 1XOIA 4CQLB 1LPBB 1XILA 2P1DA 2D00A 3PPYA 3CCCA 1XEWY 3VU1A 3RFUA 3H5LA 4BO6A 1S77D 1L5VA 1E3WB 4KXQA 2OLKA 4MJ3A 2H8EA 2I8LA 5FL7D 4G23A 4LXGA 4URHA 4AG5A 1RIIA 2ADOA 2P79A 2WK1A 2RB9A 1ZICA 3AI1A 3NBAA 4RXUA 5CDGA 4RK6A 2HUPA 1IZ3A 2MQEA 3VPXA 2CV2A 1HUQA 2PZAA 1NV9A 1Z0AA 3EPPA 3Q5DA 2AWNA 4X97A 1X38A 2CNWA 3VR5H 1SKMA 3EVGA 4R8LA 2PQ2A 4JJZA 2ARKA 2DSNA 1YSCA 3SIUA 1Q6YA 4C43A 5I4CA 2YHIB 3OY2A 3P1JA 5DP1A 3RGWS 3V7WA 4FOSA 4RD3A 4DPKA 5CLJA 3IKTA 1F4NA 1V6SA 4QUJA 1JAYA 1VL1A 1TCCA 1IEVA 3HWX1 1M7BA 2WIBA 4X0EA 4PG5A 5LMUO 1JPNA 2DFVA 4ZVTA 3V7YA 1NG9A 3L02A 3PG5A 2BGJA 3CR7A 4X6LA 1JJOA 5IZ4A 2PSFA 2KJQA 1QPBA 2W37A 2XOKD 3HCAA 4RGBA 5BOVA 1BE1A 3TGLA 5HZHA 2YN0A 3I55V 3I39X 2WINI 4YR9A 1UJCA 3H1KH 1YL5A 3BXHA 4C22A 5B58T 2QTLA 5EZYA 4RZ2A 4KPUA 3UG7A 2YR0A 3HXMA 4X7MA 3OCZA 1K8RA 1EE9A 2ENWA 1XBLA 3VJLA 1H2FA 4NC9A 4MTXA 1JQ0A 2CL7X 2FW9A 3O93A 1GKUB 3PEFA 1JXQA 3DCYA 4LX8A 2O2SA 3ZBQA 4P92A 5BR4A 1RXSA 2XOXA 4DV4O 4EATA 3TVTA 2IYQA 2WWTA 4QICA 1SVIA 1D2AA 3BK7A 1NKVA 3DB2A 4U6QA 4NCIA 4FQ5A 3RE3A 3KQTA 4FN5A 1F9AA 3GGCA 5GWXA 2GAOA 3G3EA 4BMOB 2XNDA 3AIIA 3CNOA 4ZJZA 3MGKA 5KAPA 2J3KA 5G40A 1NVVQ 3UFXA 4LDPA 5KHAA 5IULC 1NVUQ 2YRXA 2WI8A 2QKAA 4OLBA 3VVCA 3AJDA 3FUVA 3LKDA 2DHRA 1AKRA 3F90A 2JLAA 5TMDA 1T1EA 2WSSA 4BNYA 4KZPA 2JLXA 2EZOA 2CMKA 4U39A 1I6WA 4R7TA 3NDIA 1O3YA 3OQ1A 5DI3B 4B0PA 3IPLA 4JN6B 1ECGA 3WAJA 3T5DA 1K88A 2QI9C 1HURA 3KXIA 3VR4H 4FYYA 1SKYE 1JLMA 1HYGA 3ETHA 4TQGA 1WDLA 4UBIA 4CG2A 1ZIDA 5HJ5A 1UOEA 1Z0IA 1P0IA 4HUTA 5EC2C 3LWDA 3OMWA 1MN6A 1T0HB 2HDNB 2BCCH 1X1TA 3NC1C 3OX3A 4FYKA 4PG6A 3CVXA 2AQ8A 4GBED 4UBMA 1SVOA 2YCBA 3GCXA 2Q8NA 1U63A 1AMNA 2DQYA 4YAOA 4OF4A 3R7LA 1OOEA 1WVGA 2G83A 3GG9A 5JFTA 1OV4A 4BRSA 1QRUA 1COMA 2H92A 3VZRA 1NUQA 4NXMB 3OW2F 1X25A 1YS1X 3BRCA 1B8OA 1II8B 3MWEB 2PVCA 1DU4A 1T9ZA 1Q11A 2N75A 1E2UA 3W4KA 1JPVA 3L8DA 2XKAA 1VHJA 4YUZA 2I71A 3GLTA 1GCIA 4IF6A 3FF1A 3HKBA 3IAYA 3GA5A 4DG5A 4ZOLB 1T25A 5LDGA 1X3LA 3ZBTA 2VNKA 2XB6A 5F64A 2CZGA 4S1VA 1EWVA 3M6IA 1J8FA 1B0UA 3IBYA 5TVKA 3IO3A 1D6SA 4IHJF 1IN4A 4HN2A 3V8NA 2QZ9A 3GLSA 4QULA 5C46F 1PFGA 3B8HA 4LHXA 3IXQA 3R1IA 3TF5A 1QAHA 1T5OA 3O9VA 1JQ3A 4HTFB 2Q6IA 4CKBA 4PZLA 3I6ZA 3EMVA 4WN3A 3I2KA 4TTSA 3T5GA 3AY0A 3DBLA 1UJ4A 5JXWA 2XGJA 2CTRA 4OYHA 4B40A 2WWIA 3G9XA 4IWXA 1O94D 3TJRA 3BK1A 3QTLA 4UQLA 4IFEA 4RANA 4IDHA 1RWNA 3GLFB 3A6LA 5ENZA 3TR6A 4ZGWA 3AEIA 3QZUA 1KAQA 3P45A 4K6HA 1I2DA 1PNRA 4NONA 4QKQA 2EWCA 4CKEA 3N74A 1NC1A 1DKUA 3VOTA 3CF2A 1NBAA 1MHTA 1JSRA 1MDBA 3AYZB 1V25A 1W41A 4LC9A 4UUJC 1MC1A 3PUWA 1RC1A 2ZXFA 1N36B 2AVDA 3I6BA 5KJCA 4M6WB 2JGMA 2IBSA 3D5TA 3HYLA 4BEVA 5LDHA 5IW8A 1JB9A 1UBEA 3U17A 3FDJA 4YMTA 2AI2A 1L7QA 3EGCA 1YS2X 2O7NA 2F95B 3ONDA 2JCGA 3BY6A 1S7GA 4C8GA 1HDGO 1NLMA 1KPIA 1OU0A 4FKZA 3GN2A 4KN5A 4X3CA 1TIBA 2UXBB 4LEIA 4RV9A 2DPLA 3ABIA 1AP6A 5A9SA 4BC1A 2JNWA 2V6MA 4ZDIA 1DGSA 3OE1A 3QEAZ 1FFTB 2OCXA 3ZXIA 1KQOA 3BIWA 2P6NA 4DUGA 1BXRB 1W30A 1N36O 3ZCPA 1T29A 3QELA 2E4WA 5IP5A 1RLUA 4JOSA 4LNUA 3MHPA 4PBSA 3D2LA 2WJAA 1J7JA 4RF5A 5ESWA 3SHQA 5JNSA 3DC6A 5KVVA 4FJ0A 2GM3A 3K35A 3D8HA 2Q2WA 3DVSX 2HMVA 5DM6V 2O0KA 3JZMA 4OUDB 4IHJB 1QHGA 4G2KA 2QD1A 4CLRB 2PUFA 3PEVA 3ZWVA 3MJSA 2QK4A 1N8RW 4P54A 3DPUA 1VKJA 2EBHX 3CUTA 4LG1A 3WDSA 1XZGA 3OTOO 3KR9A 4B3RO 3PQ7A 4CUKA 3JVIA 2ZBFA 1XZBA 1GIAA 2I66A 3E58A 2VP5A 1KY3A 5D5HA 5C2JB 4M83A 4OLAA 2HDHA 1NKDA 3ZH2A 3B8NA 4QYTA 2HV8A 5J4VA 1PJQA 2YXBA 4LYDA 2V9PA 2Q5HA 4BKQA 1YB4A 1E2IA 3WLEA 2NVOA 2RJNA 2WP8J 2A5JA 2QD2A 4AKHA 5JBQA 2D1TA 2M7WA 3ITKA 4BT4A 2A4MA 4US1R 3ZWBA 2DUMA 1K6MA 3AFNA 4EO7A 4BNFA 1FXHA 2H7XA 3MINB 4E3WA 5DTQA 4BWVA 4D5EA 3DW3X 1K97A 3NEAA 4B3IA 3A0RB 2V7PA 3BHJA 1SBHA 1VF6C 2NVUB 3PNMA 5K8CA 1C9EA 1M2EA 3ONNA 4I6JA 3L43A 3N8GA 3PCTA 4Z2YA 1W5BA 3WIDA 1KBZA 4DBLE 1YTFB 1DJQA 5E6UB 3UMBA 4CL0A 5IAGA 2FMLA 4ZZ3A 1NN3A 1B06A 1RXWA 1I13A 4Z4EA 3CPEA 3GVHA 1KMMA 3GELA 3ZW7A 2IXEA 1B3BA 2GPJA 5HG0A 3PNKA 3FB7C 5JDIA 1QIKA 4KLZA 2ZQMA 1TGYA 4Q20A 1T3GA 6AT1A 4JJAA 1HT0A 4JVSB 4FE3A 2PSEA 4RYLA 3CY6A 1X59A 1WPGA 4F2PA 4NTWA 2Q7EA 2OZPA 3ZWNA 1DG1G 1Y5RA 2BSXA 3IIKA 3PDWA 4AY3A 1Y98A 4KSBA 3PXUA 4PWYA 1ULUA 3OCJA 1RMTA 1B6RA 3W6PA 5IC6A 4LISA 2PLAA 2CLOB 1E3TA 4JAVC 3GAFA 3ZQKA 3LF2A 5CDHA 4JI6B 1VQ4F 2KM1A 2PUGA 4PA3A 2XT6A 3DAOA 4GYKA 4PZEA 5FO1A 3N28A 4MB6A 1E20A 5E2AA 5HOEA 3SYNA 3FVWA 3ANTA 1SCUB 3E86A 1E1LA 1IUNA 1KECA 1HOXA 2WU0A 4WN9B 2BEKA 1H8HA 3T41A 3S27A 1H4SA 1Y4ZA 3IH5A 1P2DA 2Z1NA 3UIEA 5TF4A 1S0VA 1CQPA 1MD9A 2GS9A 3EC7A 3X1YA 4ARBA 5B1AB 2NPFA 4QUIA 1AGPA 1VG1A 3WSTA 4BKUA 1IHUA 5LQUA 2VWKA 3UK2A 4EJSB 1T15A 4O0LA 2R44A 3UAWA 2B5WA 6YASA 1KNJA 4JVMA 2YZGA 2YWEA 4ROTA 3KKOA 4JZ2A 4MUMA 2QRNA 2XNJA 2G1JA 1J49A 1Z3CA 3NHMA 3KOYA 1U28A 1DTEA 3DEFA 4WLEA 4YJHA 9LDTA 2G8LA 2WDZA 5IF9A 5B37A 4RPKA 4QARA 4LVOA 1C14A 1SUCA 2XWQA 2FEWB 1CYEA 3OZEA 2W98A 4YJ2A 1PT7A 2R70A 4RIEA 1E1MA 1JFFA 4MARA 4PXAA 1DRKA 4MUGA 1KKLA 1QOZA 1O5OA 1K3EA 2EYUA 4QX6A 4UUAA 4J11A 2FMFA 1KWGA 4N65A 4HYEA 1R12A 5AUPB 4GUNA 4NYIR 5LBIA 3C90A 1M8GA 1APBA 3KO8A 2NO4A 5IDWA 3CKYA 2LDXA 3N07A 3PQ2A 3D36C 4DIMA 5L3FA 2X8BA 1QB8A 1V54C 4HTAA 1NFRA 2HX0A 2FFHA 3B1YA 2WOOA 1OYOA 3LUGA 4KQKA 2GJ8A 4BNWA 4DLKA 4ZHQF 2V9YA 5KYYB 1Q90D 4LFAO 1W25A 2GJKA 2F3PA 2CHGA 3KUCA 5LC1A 1QBZA 4RHAA 2EGUA 2G1KA 1K7SN 1JSLA 1Z5WA 2BMEA 2Q07A 5C8YA 4YCSA 3K92A 2QTSA 5ADWA 4MR8B 1B00A 5IH3A 4BFLA 3WE7A 2ADQB 3MFYA 4QXQA 2PR7A 2H07A 3FWYA 2D2IA 1G1AA 2B9EA 3U6KA 2V1UA 2C77A 3FYUB 4NE9A 3NEPX 4IHKA 4LJ5A 4IYHA 5JROA 1V4BA 5EY5B 4W5RA 4N03A 1RKQA 5IDVA 4BE7B 2B4AA 5EMNA 1BMFA 1SN7A 2Z8YA 2R0QC 1YOVB 1P8JA 3IP7A 2XAUA 3TD3A 1NW4A 4I5SA 2DYKA 2ZRAA 3GMDA 2JVJA 2Z04A 4FW8A 3WK6A 3A6KA 1BW9A 3NBUA 2HK6A 1A9XA 1KSFX 1ZM4A 3UJAA 1FU4A 3OT7A 5G1PA 1WHSA 3BF8A 3WDKA 3NI2A 1GLGA 2HZ7A 3UJ3X 3WMRA 3THWA 4HPJB 3DKPA 4LF6O 2IC5A 2QU7A 1TKCA 3GVMA 3IHWA 1GPH1 1GGKA 1GU1A 1Z22A 3QX8A 4QJ4A 3UUEA 1CF2O 3OTFA 4BQRA 3BB3A 4F9GA 3SBEA 3R09A 2QLLA 1UEIA 4CTNA 2CKDA 3I2GA 2PRJA 2GEBA 3H75A 1PWZA 4OJYA 3UM7A 2YXDA 4ZVMA 1YZHA 3QE3A 4QQFA 4JTCB 1ZD4A 3Q4HB 3B9QA 2C0CA 1H2KA 3B78A 1Y7IA 2I22A 3BQMB 4JB8A 4M0EA 2OV6A 2W2MA 3CNLA 3EFOA 3PUVA 4LJ4A 4MI1A 4YB8A 1HPLA 3OEHG 4H0NA 4IIHA 3ZCXA 2RAVA 4EZEA 1GGMA 1QVAA 4PTYA 3L7YA 4YCDA 4WLUA 5JVDF 4U8GA 2CBZA 1EFCA 3M6FA 4M9CA 4TUYA 4E1BA 5BVGB 5I4KA 5KTYA 3ZGZA 3ABQB 1UZLA 1E2QA 3GIWA 2B5UA 4INJA 4P4NA 2JGAA 4IZ6A 3SM9A 2K2QB 4QA9A 2H29A 3TKAA 3W3AH 1GAJA 2JIMA 2Z1UA 1DDIA 2V7UA 2B0JA 2C2YA 2QLJA 4C4WC 4U8HA 2BO1A 2CSUA 4BZPA 1GPDG 2ZR0A 2QLBA 3M4XA 1PGOA 4O33A 4B2IA 4M8NE 1U9IA 4FMPA 3AVWA 2YFQA 1UM9A 3PT5A 4QPKA 1ZSVA 5K0FA 4J7ZA 3G2KA 4A73A 1XV2A 5I8PA 4LDQA 4LVUA 2CH7B 1EX9A 4CGZA 3AU9A 3QY9A 4WZBE 3P9SA 3RAPR 2A4KA 1W4AA 2V5UA 1W0JG 3HJAA 1VHWA 2WIFA 3OSZA 4FYVA 4INZA 4BNHA 2JIZA 2P9HA 4RA6A 1EXMA 4BTVA 4EGSA 3VHXA 2PZ8A 2XA2A 4NR1A 3UHJA 4IQGA 2N1BA 1CRZA 1X13A 3QBEA 2QRPA 2F3RA 1ZVQA 4EA7A 3VR1A 3Q9LA 3PJDA 5LZ8A 2Z5LA 3SR0A 4M46A 3AO0B 4PFSA 1W94A 3CVYA 2O8DA 1Q19A 4FK5C 2P4KA 4CS4A 4I1YA 4M38A 1GEGA 2GD2A 4H35A 5IJXA 4DC1A 3VI6A 3BA9A 3OZTA 1V6AA 1PKEA 2BCJQ 4WZBB 4BWFB 2X0LA 2BGRA 2FPSA 4BNZA 2C03A 2FZ4A 1PS0A 4BNTA 1ZWIC 2GLXA 4RTOA 4RKFA 1GZ0A 1FOEB 3CUVA 2YOHA 3K0HA 1AD2A 5I5EA 1NOJA 2P4UA 1Y1QA 3H83A 3NHWA 1WUYA 2MMGA 1JYSA 1WZCA 2G9QA 1ULBA 1Z6TA 3DVAB 2YQ5A 2YZ2A 1YI2V 3IC9A 4GE3A 3VSAA 2Y1WA 1GGHA 2VF5X 3W5HA 3BE4A 4JMLA 3NNNA 4XPIB 4CGYA 2V4UA 1EBFA 2PO5A 1NVEA 4FGKA 2WPDA 3RWOA 2QJ1A 4QGSA 3RYIB 3L0BA 1VM6A 4X62B 3KSRA 1BQ4A 2NZUG 3T80A 2FI1A 2HKOA 4FQ8A 2VWGA 1GG8A 4O4JF 4Y2RA 4ZTBA 5JD3A 3SJCA 4BVRA 1K08A 4BO7A 1R10A 2MIIA 1OWMA 2I2CA 3OZXA 5ICFA 2DH5A 4EB6B 1T5EA 1ZL2A 3TQFA 1LDNA 2AX3A 3L6EA 1ZINA 4GOKA 3ZCTA 1X39A 5TC4A 2AJBA 2B8WA 2XI4A 4DCNA 3EPHA 1J8QA 4WBNF 3LL4A 4FTWA 4B4WA 4GOXA 3NVKI 2LCFA 1YI0A 3OOSA 3OWXA 3GR6A 4HWGA 4DB4A 2EG9A 2OAP1 2I9PA 3ET4A 3G0GA 5B30A 4OVKA 4FGWA 3U26A 3FYCA 3FGOA 4N82A 3C3KA 3RBZA 3MBOA 4Y9DA 1SBZA 3FKSA 1HNXO 1KY2A 2D2XA 3KU4A 3NW9A 4J75A 2Z9DA 1GTRA 4AKGA 3FFXA 4ZPXA 1CFJA 4B82A 4DLLA 1P17A 4KQGA 4PQFA 2Y0IA 4RHEA 1M5UA 2C7BA 2H16A 2HMUA 2OHFA 3EBLA 1TZJA 4HAVA 3VNBA 4FFKA 3KSBC 1D6JA 1XCJA 1JQEA 2F1IA 3C8DA 3CH4B 1PQWA 4QYSA 4KL1A 1E6MA 1M76A 1RWOA 2OPHA 2OIGA 5FR2A 1GNQA 3R7SA 4EY4A 3MAJA 1L3BA 3TXXA 2XB9A 4BV2A 3HB0A 3TDMA 5H7XA 2ZQZA 5CLIA 4AK9A 2QQGA 1OI3A 2ORED 1I94O 3P7MA 4WJLA 1V1MB 2WLLA 4Q93A 3V48A 3S3WA 1P1IA 4JKOA 4RZ3A 2P6JA 4QU8A 4ZGBA 5F2KA 1F20A 3K5OA 1JE1A 4HNAA 1OCZB 3FDZA 5IHXA 2XUDA 2VBGA 3MB8A 1YGPA 2OD2A 4RSMA 5FT9A 3KHTA 2B4YA 2Q8QA 3NGXA 5IK2A 1TU3A 1VE7A 3C7CB 3GZTB 1XWFA 1PG2A 2NW6A 4WMLA 4EJ6A 1CNMA 3AP1A 3TLXA 1O9BA 4P3NA 1QR8A 1L7PA 4XEHA 3LCRA 4YJHB 5EWLA 1WMDA 2I4NA 1SZCA 1C1YA 1UI9A 2C7QA 3GLVA 1U7PA 1A76A 3WOHA 1BJTA 4YRTA 4Z0HO 4DEVA 1ODTC 3NDRA 3S2EA 4G0WA 4XWAA 2W4QA 4GBGA 1YHQF 2Y92A 3L1VA 2JFWA 3CMEV 1CC1S 3B6MA 3ITNA 1IJKA 1MVLA 4UVGA 4YALA 2IU6A 5I7WA 4ARZB 1ZVVA 4LYYA 1OXKB 2NO6A 3WWOA 3SLGA 3K70C 1L3CA 3DAHA 1JB1A 3E3MA 3H42B 3BAFA 2LXNA 3INGA 4ALJA 4U7TB 2H5EA 1QTQA 2E4AA 2XGGA 4X89A 1MB0A 4RQUA 4R71A 5B4UA 1TYCA 3FYDA 5HOQA 2PUDA 1LUVA 3LUDA 3CSUA 3MW8A 4MGYR 2X8WA 4G1MB 1R6DA 4B75A 4E08A 1QR9A 3BIFA 1Z4PX 5E9JA 2DLCX 3ZNNA 1VYVA 3ETEA 1H8ED 1GZ5A 1JAZA 3N87A 2YJ6A 3JAMM 3L2OB 1A2QA 1I3KA 2I4TA 4J0HA 5KJEA 3FB8C 1W7AA 1UBRS 1UBTS 1RE0A 3ETQA 4TSFA 2BTEA 2A0KA 4Q4LA 1COWG 5JVDA 1NXXA 5BMVF 3PXDA 3K6RA 5A3RA 4KQ6A 2ZT9B 3O4GA 3IE0A 3BMQA 4UEQA 3PXCX 1J5XA 1DWUA 4X1KB 1X1AA 2BELA 2V3WA 3NLLA 1MV8A 2AG0A 2XNCA 3EBOA 4MX8A 4ME6A 1Y4DE 4CLDA 4NHOA 1TD1A 2Y0BA 1JVBA 1S2DA 4UV8A 3BREA 3BGVA 3CUUA 5L8VA 1J99A 3SOZA 3UUFA 3CSSA 3LCUA 3GT4A 3BXPA 2VCEA 5EYPB 2H1LA 4R6ZA 2AIFA