4ZOLB

Crystal structure of tubulin-stathmin-ttl-tubulysin m complex
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 177
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zolB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zolB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zolB01
1RQ7A 2Q1YA 4O4LA 3JAWB 3N2GA 2BTOA 3JALA 4O2AB 5CA0B 4ZHQB 4B46A 4ZHQA 3UT5B 4FFBA 3JALB 2Q1XA 4X1KB 5LA6B 4ZOLB 4EI7A 4M8IA 5LP6B 5JQGA 3VOAA 1FFXB 5LOVB 5C8YA 5EYPB 1W581 5IJ9A 3RYHA 5ITZB 4O4IA 4KWEA 4LNUB 5LP6A 4I4TA 5EYPA 2VAPA 5LOVA 5IJ0A 4U3JA 4O4HB 3UT5A 5JCOC 3JARA 3RYCA 3N2KA 4ZOLA 4EB6A 5EZYB 4F6RB 2VAWA 4X1IA 4O4JA 4I50A 4FFBB 1Z5VA 3WGJA 4XCQA 1TVKB 4I55B 4X1YA 3N2GB 3JASA 4YJ3B 2VXYA 4X1YB 3N2KB 5JCOA 4ZI7B 4E6EA 4EI9A 4O4HA 1TUBB 4X1IB 4DRXA 3RYFB 3HKCB 3HKEB 5JH7B 4U39A 5CA1A 3C8LA 5IJ0B 3ZIDA 5KX5A 3RYHB 5ITZA 2RHHA 5KX5B 5CB4A 3HKCA 5C8YB 2VAMA 4TV9A 4EI8A 2RHJA 3VPAA 3VO8A 1OFUA 4WBNA 3HKEA 3JASB 3HKBB 3RB8A 3JATA 5M7EA 5JVDA 1FSZA 5EIBC 2XKAA 3WGNA 1SA0B 4O4JB 4DXDA 2RHOA 4IIJB 5KMGB 5MN4A 1SA0A 5IYZA 5MN6A 4YJ2A 1TVKA 4I55A 4YJ2B 5J2TB 2R6R1 5IYZB 5JVDB 4I50B 4U3JB 3CB2A 2BTQB 3JAWA 3WGKA 3RYIB 4WBNB 1JFFA 5LXTA 5BMVB 3RYCB 4TV8A 4O4IB 5GONA 5CB4B 3R4VA 4IHJB 4I4TB 5LP6C 3V3TA 3JAKA 4X20A 4X20B 3VOBA 5BMVA 3E22A 4O2BB 5FNVB 2GVIA 5GONB 4DRXB 3ZBPA 5J2TA 4ZI7A 3WGMA 5CA1B 4O2AA 3RYIA 3RYFA 4YJ3A 2BTQA 5JH7A 1W5BA 4X1KA 3M8KA 3ZBQA 4TUYA 5MN5A 1RLUA 4TUYB 5CA0A 2XKBA 3HKDA 4IIJA 5KMGA 5EZYA 3HKDB 5LYJB 4O4LB 1Z5WA 5EIBD 3JATB 1W59A 3HKBA 4HNAB 4EB6B 4F6RA 1W5FA 3E22B 4O2BA 3VO9A 3JARB 4LNUA 1W5EA 5J2UB 4TV9B 3M89A 5J2UA 5FNVA 2RHLA 4IHJA 1RQ2A 4HNAA 1FFXA 1TUBA 5JQGB 3WGLA 3JAKB 2R751 1JFFB 5LXTB 5IJ9B 1W5AA 5LYJA 5LA6A 4TV8B 4B45A
chains in the Genus database with same CATH superfamily
1GTOA 1G5QA 2OT3B 1SG0A 1TLFA 3LVRE 4UUAA 3L6EA 4G0VA 2E89A 2C5BA 3OOWA 2WTUA 1QG4A 4YUYA 4LZLA 4G26A 2FSVA 4J1SA 4GZ3A 4UM9D 2LIPA 1Y4SA 4X62B 1J2UA 1EGQA 1NPTO 4M2LA 1ENVA 4RORA 2XE8A 4UU1A 3ICCA 5AJHA 3USES 3RWRD 3S2GA 2YXNA 1NR7A 2B4AA 4NQZA 3PDCA 5D1HA 3PNVA 2IYQA 3ILSA 4R51A 1M34E 1SCNE 3ZWAA 5JJJB 5DNEA 5IKMA 3AUJB 3GLGB 1ONPA 2CJPA 3QH4A 3A4NA 4NOLA 4EFBA 1OWPA 1KWGA 1GYQA 3Q98A 1S3JA 1OTXA 1YR2A 5LKAA 1GU1A 1OC4A 1SVLA 1EK5A 3UJCA 3MT7A 3P0JA 1M1NB 4RJ2A 5F64A 1FX1A 3CXUA 4W7SA 1Q7TA 4DFDA 1O6GA 1FYJA 3Q2IA 4Y98A 4CMBA 3T3NA 1Y34E 4EELA 4OHYA 1N7IA 1LSOA 2V03A 2JLYA 3HCDA 2C5SA 1MJNA 1D2AA 4XA8A 1RJEA 4KPGA 4NY1A 2DH5A 4QYXA 2Y1CA 5A3QA 2YC0A 1P7VA 1YJBA 3D02A 3WYBA 4TWBA 4AICA 3OZCA 1G5RA 3HFGA 4JT8A 3TIGA 3VKHA 3HUUA 3VSAA 5I7WA 2I29A 4F60A 1P9WA 2OILA 3VPHA 4HZ3A 2I2CA 2R25B 1PE0A 4FTWA 3WIDA 1U1FA 4DJDC 2OM2A 5AP9A 4YVFA 3W4IA 4UBOA 4JFAA 2QLJA 3QJGA 5FPYA 2ZVYA 2YFQA 2WU0A 1LVGA 2XRMA 4MVOA 4EPYA 2GHYA 2H63A 1DXOA 5D6NA 5T8KA 5CGQB 1IJEA 1ZGGA 4BJ5A 4IRUB 1PR1A 3RADC 2HVJC 4OKNA 1GV1A 1U1CA 2YQ5A 3H42B 4B3HA 2A5DA 4A0SA 2XUDA 4NE9A 4UUBA 3VBBA 2FWPA 1OTHA 3MT0A 2M2IA 1JKXA 4RH1A 2KB0A 2G9RA 4AP6A 1SELA 5DN6D 3DPSA 4XGKA 4V2UA 2AC2A 2F00A 1GO2A 1EZ1A 1QIMA 2RHRA 1JWBB 3MCTA 1QR2A 1Q17A 2A9FA 2H92A 2P11A 1UBGA 2XQFA 1J20A 1P0IA 3GBPA 4W1SA 5B1YA 4QBKA 2QD1A 4QBFA 3CRRA 3H1JH 1MA0A 4NIMA 3RAPR 3VJKA 5D00A 3DLTA 4NU0A 4XTRA 4LR3A 3K09C 3ABUA 1K3FA 4RQTA 5ALWA 1NNEA 2YOHA 2HMVA 3SJBC 2H2IA 3P9RA 1U98A 1U8ZA 3THXA 4YRIA 4UC0A 5H3HA 3F5TA 4HQRA 1NKTA 2BF4A 1TUEB 3FWKA 1WE2A 4AO6A 1GLVA 1NZDA 2NACA 4N0EA 3I5XA 5MN5A 4LOJA 1BDBA 4NXMB 2NAFA 4P81A 4E21A 2WLLA 1CBUA 4WW0A 4BW9A 4BEWA 2GQ0A 1ZN7A 4YP6A 5K45A 1L7EA 4FE4A 1JB9A 4X61A 4DR7O 4DZTA 4JYYA 2GZ1A 3SFTA 5C32A 2EZUA 4LEIA 3O75A 3DS8A 1UKEA 1LJ8A 2FP4B 4MVJF 2HT6A 3KLMX 2OG2A 4ZCTA 2C2ZA 1EMDA 1JSRA 1OCZB 5L3QB 5AJUA 2VWJA 1E69A 3U60B 3SX0A 2R00A 1QK3A 4G5XA 4MA0A 5A62A 3FHTA 1JIUA 2B8WA 1GNTA 5ERXA 721PA 4HT3B 4TVKA 1N7HA 3K6RA 1RZRA 4MRMA 3NOOA 4PELA 2OYRA 1XTJA 3W5UA 3GDFA 1GTRA 3K9QO 5EP4A 5EZ5A 2ECFA 2HWXA 3EXAA 1ZCAA 5B2ZA 5SY9A 2P4KA 4O3FA 1RQNA 1WZEA 1CEQA 5ALYA 3S8EA 1JR3E 1O5OA 2CDNA 5KNBD 1W0JA 3D31A 1T2CA 3BN3A 1PUXA 4J7AA 1AKRA 2C29D 3JU3A 3OM9A 4A8PA 4BJ6A 5SZKB 5H9VA 4BQOA 2GLXA 2GK6A 3E15A 3L4JA 2EILB 2WM3A 1U7HA 1H2MA 1YDFA 3BCSA 3Q3CA 4IWXA 2HSWA 3WHLA 1URFA 4P5EA 5D7NA 4D56A 5KLVH 3PQ3A 4NULA 4AY2A 4M0EA 2Y1DA 4YROA 3WFIA 2P6UA 1Z2CA 1ZH8A 4BV9A 1Q77A 3ZDYB 2GCOB 2G9IA 5EHZA 3UT5A 1D09A 4NAUA 3STHA 2PRZA 3WO0A 2J9YB 2PFKA 3MPUA 4ZIRA 3DBOB 3AR9A 3ZCXA 2CXUA 2JJQA 5KVVA 4NCJA 2V97A 4X9QA 4B0OA 3HWRA 3MK31 1QIFA 2H2WA 4YC7A 4NCHA 2QI2A 2EGGA 2V5VA 1PL4A 3CCUV 3WNZA 3ZU6A 4C0XA 1T36B 4BZZA 4QDUA 2WPNA 4DK1A 1JEDA 3O8QB 4UNSA 3CH7A 1UZUA 4XASA 3C48A 3V8EA 4M1KA 2CBXA 3IQZA 4KNWA 3AVTA 3L7QA 3UFBA 5CD1A 4MV3A 1YIOA 4ZCPA 4PSUA 4U0KA 5BSUA 2D59A 1R16A 2F66C 2WAYA 4IVNA 3BZBA 4GE0A 3OJ0A 3SFVA 4F38A 2NO0A 4UDNA 1O6FA 3O94A 1P19A 1V3QE 3NTXA 5AW0A 3MERA 1XGKA 1ISSA 3BCUA 2C00A 1M66A 2VHUA 4WUTA 2GM5A 3B5IA 4D6PA 3N6XA 1B2RA 1KEWA 4OYYA 2B83A 2PNFA 1XZHA 3RWMB 1E5QA 3ZE0B 1HPLA 4EMSA 1GKKA 2OV6A 4MSUA 9ABPA 4MYTA 4UAGA 3KXPA 1Z8FA 1OF1A 3N6VA 4P9NA 3GIWA 3G2LA 4BFVA 1FMFA 2P90A 3A1NA 3DB1A 2UXXA 2PUBA 1QCZA 1SR8A 2Y76A 1LJLA 2QUAA 3ZOZA 1IQ0A 1H2LA 2YEVB 3CD6F 3T52A 2HIAA 4ZOAA 3T5GA 1N78A 1YCHA 2IYTA 2DWUA 3H4IA 3U3JA 1XVAA 2DR3A 4GLJA 3UKOA 3V9PA 3I9OA 2VTBB 4YRAA 4EHLA 4J7ZA 4ASUA 2ATCA 2BZ0A 4TLCA 1M1YB 3DYVA 1LWNA 1RI4A 3B36A 3TAUA 1VE3A 2CZQA 1JAXA 1Q81W 1E1RA 1MQ9A 1QXSA 1REQB 3CJHA 1NWCA 1VCMA 1XDSA 2EIMC 2BUCA 3KXDA 1DUIA 2WV7A 3KJFA 4D6XA 3ORRA 4OF4A 3RTEA 2CJWB 4MRSA 3SE7A 3H1PA 4DCUA 2QDKA 4KNYA 4R8CA 1F5NA 1ZD3A 5JI3E 4EB6B 1MCZA 2EBFX 3EXHA 4HS4A 3K70C 4JF3A 1O03A 2VWQA 3WMWA 2FZVA 1R0WA 4NEGA 2R70A 5FA5A 4YHHB 2V5AA 4EM6A 2ZRBA 5LHHA 2YS7A 4N12A 5CDUA 1BH6A 1Q7GA 1MMMA 2Z5UA 3LS2A 4MV0A 3RW0A 3SYMA 3WKDA 3HXMA 1YA6A 1CRPA 4WY5A 3CCMV 3SF8A 3D6HA 4YRNA 1HL3A 1JJ2F 2IRWA 4GPBA 5DCYA 2B6HA 3NT2A 5AUOB 4ZAFA 4KH1A 1HP8A 3U16A 1SVNA 4RLHA 2JI6A 3ZP4A 1JQ5A 5DNAA 5FKJA 5T8KC 3ACCA 2LCIA 3Q1KA 4JR2A 4TWIA 1I6LA 4Q9LA 1ZWIC 2FGYA 2Q5IA 1YTUA 4WIAA 3W2IA 3NB0A 1OAKA 1KECA 1V6AA 1YR3A 2I78A 3A6FA 3GUCA 3KNZA 5ALKA 4D7AA 3B9RA 2IPOA 1M7HA 3TPFA 4F5YA 1DJMA 4KP4A 2ZYSA 3KT6A 1JNYA 3C4QA 3U56A 3VH2A 3I1FA 4HGOA 1JG4A 4F3CA 1M83A 1USVA 4JWTA 5GV8A 4LWOA 4Q7EA 5DTEA 2CXOA 4CM3A 4EQZA 1W36C 2EBUA 1IK4A 1Z0AA 2BHLA 2DUUA 1NZJA 3BXOA 4L9SA 5B4TA 1OC2A 3FB7C 1PGPA 2EF0A 4K9PA 5HF8A 1GV0A 2OKGA 3F67A 3MAJA 4EO4A 4C07A 1C9JA 5TT1A 3VZPA 1V54B 4L4SA 4RV5A 5C1DA 5LR6A 2QKYA 2XUKA 2E9SA 4TTAA 1TA4A 5AW1A 4NB5A 4MS1B 2H7YA 3EYAA 2I6FA 1NW9B 1PF7E 2AN1A 1XWWA 4RWEA 4CKXA 2G83A 1RWOA 2NTYC 2H1WA 5GJBA 2IZ6A 1UP4A 2RK6A 1T3HA 4CZ2A 5P21A 4EF6A 2X0IA 2HA0A 3CNQS 2G7MC 1SXJA 4UVBA 4DC9A 1E61A 1KI2A 3H9UA 2JJ2A 2VNIA 4Q6WA 1QYIA 5FO1A 4DNXA 3EEOA 3KQKA 1NVPD 4LXHA 5IH3A 5DFAA 4DMLA 1ZWZA 2RHJA 3LXMA 2HP8A 3EVGA 1L4YA 1GR0A 1YVUA 4CHTA 2OL4A 4RTLA 3FNRA 3L4BC 1LNSA 3ZCUA 3ZBUA 4KMRA 3TCNA 5EIBC 2Z6AA 4G5RA 5KNLA 2F9FA 1G8PA 2N04A 3LNCA 1OUMA 2JHGA 1XUOA 2VH5R 3LLUA 2FRDC 5ER9A 2NSJA 1U2DC 3LK7A 2PYJA 4YDSA 2ZSDA 4R7GA 1WP8A 4ZK7A 2O2GA 3NBKA 3BAZA 2C20A 5BSGA 2VOJA 2PT5A 4B75A 3THRA 5F77A 2O07A 3PD7A 4Z7QB 5CNMA 3UXEA 1UJNA 3ZHRA 5ICCA 1SOVA 4QUIA 3KFXA 4UHHA 4KQ9A 3C4VA 1BE1A 3GK3A 3EARA 4QVIA 3U3KA 2IY9A 2UVDA 2VQFB 1E3TA 4H08A 4WESB 5E6RB 4J1QA 3AXTA 1MH1A 3GYBA 1UKVY 4BB6A 2ZT9B 1GFZA 1QWOA 1UKCA 2IT1A 2VYVA 3IV7A 1MSWD 4FUQA 4R83A 5EWJA 4DUGD 2QMOA 4QE3A 3K9LA 1X15A 3I6MA 1E9EA 4HZUA 4HWSA 5JPCA 1CNFA 2KI5A 3ZBQA 4OHKA 4ITUA 4JR1A 3FCCA 4ITRC 3LWNA 3E20B 2BLLA 1QVRA 1K6EA 2K5UA 3OLCX 1Y8ZA 3ZRVA 1RAGA 3BWEA 1Z6PA 2EQAA 4IPTA 1VYVA 3T7EA 4MV9A 3HXLA 1NJ1A 1VMIA 2HP3A 3PGA1 4QYTA 3R8XA 4IYJA 2B8JA 3GPLA 3C70A 1V3VA 2LZ0A 3M2PA 2Q69A 1WKVA 3Q11A 4F2WA 3OF5A 3CWBH 4MPDA 1KQFA 1K5PA 4YHHO 1RXIA 2PKCA 1Z5GA 1LI7A 2V6FA 4K26A 4BNHA 2ZSIA 4COOA 4DV2B 5BSKA 1FFXA 5K6RA 1QLJA 4C4SA 5KU7A 2J0VA 3KQQA 2I54A 1V8BA 5K0CA 3EF3A 3WFVA 4QBTA 4ZYUA 2QL7A 3BTSA 1SEVA 1BKYA 3LT2A 3HNOA 3PSHA 4UU7A 1CEXA 1FSFA 3FSEA 3OIFA 4CCYB 3FTFA 1EWQA 4UBJA 4WN9A 4AMUA 2L19A 2HL6A 4PV1B 2XBLA 3IEPA 3M1AA 4PU0A 2BFOA 4PGMA 1ADJA 2VRCA 2A3RA 1VKZA 3NKVA 2WA3A 1S4MA 2WV9A 4LNHA 3OP1A 4EUEA 2C1XA 4ARCA 1H2SB 3PA8A 2OYSA 5CLIA 3TTVA 3WVNA 3CTMA 1ZIYA 2YWXA 3OFSA 4JJ4A 2I7DA 2W6IG 4LHYA 1Z2GA 1TEVA 1PV2A 3T80A 4HJXA 3KJKA 5DVZA 3NHYA 1BHJA 1QHYA 5HPYB 4FM9A 2XT9A 2J87A 3AC0A 3QUCA 2ZTMA 5KHHA 2HY7A 4LY0A 2P2YA 3OQIA 1PWEA 2AWNA 1AD2A 1YB2A 2YXPX 3GNQA 2IZ0A 3AUSA 3L40A 4G0OA 4CUZA 4DCGA 3AM3A 1QTQA 4JMPA 4NPCA 1F0NA 1X9IA 2AIZP 1DIRA 4KQCA 1Q0TA 2ZCEA 2FPPB 4CDGA 1WF6A 4FFBB 1AJNA 1TVKB 1M2KA 3INYA 1Y1RA 1OV6A 3O4FA 4L78A 4DABA 3P4EA 3SQMA 3NUQA 3GVHA 4YJDA 4AWXA 3W1WA 3ML0A 2BFCB 5KYYB 5LZ2A 2O8CA 5ENZA 4KFTA 3SICE 3IKEA 8OHMA 1FRQA 1C3XA 3ZH2A 1JKFA 1F2DA 1T6ZA 4HNSA 5AHOA 1XCMA 4IIEA 1ZL0A 2YWEA 1W29A 5GJWC 1P45A 1KDZA 1UMDA 2FB9A 2FW0A 4FCCA 1FFBA 4L3OA 1FE8A 4EY4A 1G4UR 5EUQB 5KYXA 4HNVA 2CFRA 2JKYA 2GUWA 3OJEA 4FE3A 2GKOA 5HF6A 5IN5A 1VQKV 5CIQA 3STUA 4KUEA 3TNJA 1E9AA 1R66A 4KL8S 3RODA 4Q24A 3SYLA 3LX4A 4RPHA 2R6GA 3Q8HA 5CDFA 3R74A 1BL8A 2JCXA 2ZSFA 3ZD8A 4C7OB 3WYGA 4MQEB 4DWVA 1XVIA 4B7EA 3PUJA 3TGWA 3OPNA 4K9NA 4CKEB 3EMDA 1R4AA 3DBHB 3GC6A 1VKNA 4HEQA 2O14A 2OD2A 4L8WB 2WEKA 3NKLA 2XCRB 4MW6A 3SEQA 2VHWA 2HK9A 4H0LB 3CRNA 1AQJA 5BV7A 1VQ7F 1DUVG 3AFNA 1FVOA 3ESCA 3TQQA 1CQPA 1JEOA 2C4HA 3VPFA 4ZCMA 4G24A 4MTFA 5K0TA 1SC6A 5EKDA 4P5DA 2XNKA 2YXLA 1T1GA 5EKSA 4ED9A 3HB4X 3RVZA 3AG3B 2IDJA 2V7QD 4J0HA 2QGZA 3RIEA 5FLXA 2QTAA 1OI3A 3KL4A 4BO2A 2HA2A 1SD2A 2WF9A 4YTEA 1K97A 2DTDA 5GIPC 3V00A 3FMOB 5DTQA 3T9FA 3NX4A 3H2JA 2OFOA 1E7SA 3FFTA 3CCSV 2UXNA 3O2SB 3PEUA 3H8VA 2OMEA 2QLBA 2PGLA 2QTOA 3ZGLA 3Q10A 4BZXA 4ZCQA 1SCBA 4DCTA 2BTEA 4LQDA 2YV5A 1DJQA 3QBDA 1G38A 3MWEA 1L3IA 5L3QA 4DRYA 2HCJB 4RVNA 2FW7A 2RC5A 1NBOA 2XVZA 2VDUE 3LMEA 4Z1MA 3WLKX 5JD6A 4KVZA 4RV9A 2ZWVA 4CQLB 3PRHA 4KW7A 3M4SA 2AEFA 3D5QA 3FKQA 2YJ3A 4CPDA 3C1TA 1NR5A 5EVCA 1YHQV 1IXYA 5FPTA 4DQ0A 5AKLA 4Q16A 2ODTX 4ATNA 3F5MA 4OKSA 4B3CA 1X80A 3GMTA 4GYCB 2AQKA 2G09A 1TF2A 4HQFA 2CK3D 4JT9A 2C2HA 1KB9F 1V9SA 2I3BA 2QB5A 2ZBFA 2WJZB 4KDFA 2HDOA 4NKRA 5CHYA 4F72A 3CE6A 4MZDA 1BKDR 5GINE 7ABPA 2AXEA 2EJTA 5AW2A 3GCXA 3KEGA 3Q7PA 4ZVUA 4JUIA 2C9OA 3VOAA 4RQBA 5ERYA 3P30A 3GVCA 3H3XA 3I6BA 4IRMA 4CQMA 1E7YA 2XA9A 3H9QA 1N1DA 5JZMA 2PYDA 4A1FA 5TC4A 5B2EA 1UWCA 2VP6A 3DMTA 4I1SA 1QGYA 2Z01A 1RDFA 3NH9A 3GW8A 1DIHA 2A84A 4G4SP 4CVNA 4DARA 3T99A 1CQWA 1GAQA 4Q4DA 2OCIA 3AR4A 2QUBA 4H6XA 1K06A 1MABA 1UEIA 3K8ZA 1RCTE 1XDDA 1DAKA 2LBXA 1RJDA 1KHHA 1H2HA 1QKKA 2G04A 3A4LA 3QBTA 5FTLA 5EXDA 5L4NA 1BWSA 1DGQA 2QEQA 1NQAO 1W0JG 4PHFA 1Z83A 3VR5D 2VJMA 2CT8A 1EUYA 5J23A 1OJHA 4YJ3B 4RHAA 1FC0A 2RMKA 3I34X 1X80B 3NVDA 3QELA 4NP6A 4RCVA 1L7BA 1W5TA 4TLEA 3IQIX 2VS0A 5HBRA 2Q8QA 1EXDA 4E5SA 2Z2JA 3B53X 3RU2A 1YI1A 4RFLA 2JBHA 2YUAA 4MKXA 3CUEF 5K4AA 3FCYA 2VQ6A 4CQLA 5K1XA 4JP1A 2H3HA 4URUR 3I83A 3LJKA 3E9RA 3LDAA 1US6A 3D4LA 3MAGA 3NM5A 2CTWA 4L02A 3V32A 4B4UA 4QWWA 4AKIA 4M83A 3AOEA 2GTPA 1MC8A 5CXUA 4YV2A 3ZOKA 3LY9A 2A7WA 2O1SA 5B6JA 3TD5A 5A1JA 4B71A 4AWBA 1IY1A 1CZRA 4EJSB 4OXNA 1P3DA 4PA9A 3MWJA 3DKIA 3WR5A 5AUNB 3QF7A 4AS3A 1FL9A 4LSZA 3RASA 2ACKA 4I1UA 4I3GA 4AMVA 3S0JA 4IQ0A 5D3QA 3Q12A 4XJSA 3VGPA 4R40B 4OJMX 1ZI6A 1VE6A 2V8BA 3DAFA 3PJRA 2Z2KA 4UM9B 3UG6A 5A0TA 4F7DA 3SYRA 2Q27A 3DE0X 3HHEA 2K7ZA 5K3AA 2X86A 3L0YA 4YMTA 1Q14A 1YE5A 4X20A 1L5RA 1X6VA 1BN7A 3MYRA 1J8QA 3QIAA 4FHGA 4FWIB 3ZCPA 5IEJA 1BQEA 3GIDA 4L73A 3T4UA 1JDPA 4D9KA 2UZIR 2ZE6A 1YJ9V 1C7FA 2FVXA 3DMNA 3L7AA 3PXAA 4F3RA 1QX4A 2P6JA 4J91A 3WJ2A 4C4OA 4YJ3A 1QB7A 2IEBA 2YBEA 3VDXA 2C2AA 5HP7A 4H3HB 3A2LA 2J09A 3CX6A 3JQFC 5DBFA 2C0PA 5ESRA 1WCWA 2QRVB 4R5HA 5EJFA 5EWMA 5H82A 1IHYA 5EZYA 4QTUB 3RJ5A 4Z4HA 2ORED 2DQ3A 4LGCA 4UREA 2ZTSA 1EP2B 2EIKB 1OLUA 1ZC4A 3DW1X 3NOXA 4LX0A 4MQFB 1JA0A 2QTWB 4ZT4A 3WHKA 3KB6A 2M1ZA 3IR6A 2FC3A 1ZAKA 3ST7A 1G5TA 3KLBA 5J2UB 2FEMA 3NCTA 2GESA 3QVMA 4N8SA 2VGMA 1XEFA 3EPPA 5ALUA 4BFLA 5BT8A 2DB3A 4S1PA 4RQFA 1RBZA 4I5IA 4YAKA 1IN6A 1KQOA 1T5HX 1RPJA 2QJ1A 1WUJS 3VQYA 1IHPA 3QVLA 4IBOA 4XUEA 3B1JA 2MYNA 2ZM5A 3NHRA 3DCJA 4CS2A 2OIGA 1FX0B 4KIFA 4B45A 3UCFA 1XZCA 5T4HA 4WCVA 4EKGA 3T5PA 3W9BA 3UHOA 2BELA 2PMBA 2V4MA 4CUJA 3S2IA 1RRGA 2BFFA 3SZUA 1L5WA 4R41A 1SKUA 4E5KA 1R6BX 3CXCF 4TTVA 1JU4A 3BYQA 2CW5A 1Y33E 4G56A 4IV8A 3V7YA 3N39C 1H85A 4I1RA 3IP3A 5K03A 3ENKA 4NU6A 1N1EA 3O38A 4PTLA 4US2R 3DZHA 3BBPA 3HHPA 3QF4A 3HFSA 4RZQA 1G8AA 1YOVA 3IIEA 3EDCA 4Z1MG 3LV8A 3OIWA 3UT6A 3ILXA 4EWLA 1IVYA 2R11A 1SXJD 3F4BA 3FB1A 2DJVA 1NJ8A 3F0FA 4GVLA 3SQXA 4GZLA 2IS4A 1PJLA 1UEJA 2C97A 2FK7A 2ZRQA 1Z5VA 3B1ZA 2PX0A 2QSAA 3PB3A 3FW1A 3PQ8A 4FQ5A 3MFYA 4ZPXA 1X7XA 5CJJA 3TJTA 4FBMA 4ZALA 2LP7A 6AT1A 2UZHA 4RDHA 3LRXA 1ARZA 3BGSA 3DDNA 3NAZA 2WB2A 1M1NA 2I65A 5JXWA 3F2VA 4V1CI 3JW8A 3O47A 1GZ7A 2XH8A 1W57A 3CCVF 4BY9D 3LOPA 2X0FA 4Z2AA 1TADA 2OVFA 2QTGA 2YR0A 2VKQA 2V9YA 1MPTA 2ZREA 3LYLA 3L7KA 3PUKA 4LF6O 1LK5A 1R10A 3ZW9A 1BMQA 1ZUQA 1NW8A 3GMSA 2UZ1B 4V0ME 2GH1A 4WH0A 1DSSG 5KAPA 5LBTA 4HTFB 1K7SN 1W5SA 3TTSA 3UF0A 1ID8A 4H77A 3OE1A 4QBGB 3ME5A 4F3TA 3CXRA 3N27A 2O2SA 4I0WB 3K58A 1VGRA 3A6LA 4MKIA 4FCTA 2O1EA 2V55B 4W8OA 3C14C 3ND9A 2ZDHA 1E4OA 2OY0A 3LSYA 5HRCA 1Y4UA 3ED1A 1XXHB 3BRQA 2Q5CA 3BZWA 3G8YA 4YMGA 3THXB 3OCZA 4J0JA 1SHUX 3GEDA 4G2NA 1Q95A 4K9MA 1S5HC 3CKYA 5G4KA 4PYNA 5G3YA 3ZJ5A 3OO1A 3PU6A 2AVDA 4HEA6 4R1MA 1P4SA 4MO9A 1K2VN 1LX7A 2IHTA 1YVRA 3HVJA 2YRWA 3FZQA 2IF2A 5BSRA 3PYLA 3T7SA 1X87A 2IQ5A 1RWKA 1KFBB 2WFZA 1Q7RA 3M3PA 4WFFA 3QVUA 4YUVA 3RYIA 4EB0A 4YH1A 2GO7A 3LC1O 1ODLA 3FZNA 1F6WA 1ZJZA 2GF0A 2ZAUA 4UZEA 1Z08A 3PNKA 4AYXA 5M2QA 4H7FA 4RKWA 3ZWBA 2QR3A 3AJRA 2J5KA 5C8ZA 4TWKA 1U2GC 3I8XA 2HT1A 2OV1A 1UBLS 3U62A 3TR0A 3FCEA 4DC0A 5EIFA 5BVGB 3F78A 3WJRA 3R0PA 1QHIA 1F51A 1QPBA 1ZEMA 3KXKA 1GZ4A 2I9PA 4ZVTA 4LF7O 3JYQA 1BJKA 5B1DA 1Q3KA 1R8XA 2ZI5A 2NZWA 5L40A 5F2VO 4WFIA 5JAIA 1FTNA 3W2EA 3MQ2A 2ZIMA 1WVGA 3I28A 3AR6A 5LZ9A 1B0ZA 2OCAA 2EIJB 4PQEA 3F7NA 3W1EA 4BGUA 1SCJA 2JLSA 1Y6QA 3IHWA 1IBMB 5CYPA 3OPYB 3FUTA 2BDTA 1DEHA 5BPHA 2BONA 3JD2A 4W9NA 5F5NA 4D96A 1FDUA 3I92A 4D45A 1M2VA 4PAGA 2R6HA 4NI5A 4KUMA 5BO5A 2FZLA 4PG6A 4Y2RA 2Q7GA 4GYYA 4OGQB 2VSYA 4C3OB 5M5BA 2WNSA 2WTAA 2D7DA 2WPDG 5LBQA 1XALA 2RH8A 3L8EA 1AOXA 4G5GA 5AI0A 1DADA 2EJ7A 4Z51A 2R9AA 4K9QA 4TYNA 5JJEB 4AJ4A 3C8ZA 5DT2A 3T5DA 1NTZH 1QR6A 4LXQA 4OREX 2QD2A 2VHTA 4ZYVA 1GZ3A 2ZIXA 1HLPA 2NYUA 1DLBA 2VJCA 5HW0A 1SDSA 3FVTA 2GS9A 2ZWAA 3S2UA 3O8QA 4B09A 5C5IA 1YT5A 3CS5A 2V7UA 3AIIA 3EUAA 2FW6A 3PNBA 4KHZA 4ACAA 1PF5A 2WHPB 5CFNA 3RNOA 3W7BA 3U39A 3I55F 1J06A 1CNMA 1QSGA 2CJYA 2REBA 4J1NA 4PFSA 3SEAA 4PWZA 4ZKDA 4HB0A 3PK0A 4XCQA 1EVIA 1U7XA 1YAHA 4IOMA 1P3JA 3TBFA 1THGA 1Q6HA 1A8HA 1P4JA 2OHIA 2Y68A 3MWGA 4LC0A 4AG6A 1RP1A 2PLRA 3K72B 4OQEA 2BOBC 3DBLB 5NLLA 1E3DA 2NUAB 3R9KA 4DTCA 3I6IA 4J7CA 4EQ6B 4HJRA 4U39A 1EKXA 2HEGA 4H6PA 1ZK0A 4FOTA 2VA8A 4LUCA 4WUVA 1YJAA 1V9PA 3OCYA 1RR6A 4UTXA 3NAMA 5IF3A 1N1GA 3VVCA 4XYLA 4G01B 2YNMA 2QQ5A 1BWRA 3MJTA 4YN3A 3K8YA 1TQ4A 4KI0A 2HPVA 1G6Q1 4UEJA 5HKLA 1OFUA 1U3TA 3LDCA 1D2EA 2WSIA 1UZLA 4Z0PA 2CLCX 3CCUF 3ABLB 1O94D 1IB0A 3DOUA 1LTHR 3B2QA 2CJWA 5EKTA 1SA0B 1I6WA 4EGAA 1Z25A 1AC5A 1FTWA 2YHBA 1NM5C 1G6HA 4NJEB 5JMPA 4X5OA 4DV3B 4L6AA 1OIWA 2FE1A 2RB5A 3HH8A 1VMKA 3KKNA 4UHKA 3I5YA 4R1TA 1A1VA 3KOUA 3CCEF 5F3WB 2QV0A 5B7PA 1MX1A 3K1AB 3PLNA 2GPYA 3STLC 5BSTA 2I66A 1KE1A 1CDDA 1RYBA 1L5OA 5K3DA 3FHJA 3KQLA 1VL1A 1Z5ZA 1EX7A 3LWDA 3QU2A 3SLRA 3CPWU 4IZOA 2CFTA 2WD9A 4E32A 1P6XA 1TTHA 1Y7TA 1YDWA 1YK0A 2HA4A 3CLHA 3QFSA 4GYJA 4HLUA 2QLTA 2I6RA 2BKLA 1KJWA 1A8IA 4YGYA 2XHBA 4JVMA 4AILC 4RESA 3UPTA 2BI7A 4P3KA 5SV2A 3OONA 1KNQA 1MOFA 2B1QA 5H7XA 2RH5A 1IN8A 3P0IA 2GNOA 4BUCA 5KKNB 3ZVMA 4WT7A 4KFRA 5LXTF 1FQOA 4DBLE 4FDLA 4YCDA 2EBOA 4S3MA 1CX9B 2F8LA 4B0PA 4D0SA 2EFCB 4MKFA 2JCSA 1B16A 4GPIB 2FN7A 3WK5A 5CYOA 3DMRA 3R0XA 4EHNA 1Y6FA 2V0NA 1PBNA 4M9RA 4ZO6A 1QH1B 3OMNB 1ZXLA 2CK3A 2ZKIA 5AVTA 2W0SA 3LX8A 3SF0A 3IDOA 2EBWA 2JFQA 4LYYA 1C7ZA 2E1RA 4PLCA 4UBIA 4GG1A 5CD9A 2IS6A 1B8VA 1S2MA 1U3CA 2CD9A 4M98A 5KA6A 5CT9A 1TTTA 3DD1A 2XVXA 1S0UA 3DHEA 1FP7A 2R8BA 4G8DA 3OZIA 3PZRA 4X7PA 1YJNV 3BE5A 3QYAA 3QVGA 4R6WA 4OK3A 5IF9A 3DR5A 2CFSA 2CWWA 1UC9A 1J2EA 2E85A 4YS6A 5KVAA 2IS1A 5K3FB 5IKPA 3SPHA 2ZPTX 5GINC 2DMRA 1N0WA 2K1EA 1DBFA 1EGMB 4L50A 2BEVB 3SSNA 1SUPA 1YMVA 3WU2Z 1ULUA 3LWZA 3OPQA 3QM1A 4WWHA 3RK4A 3GRPA 5AKXA 2KLHA 2FW9A 4D4HA 5LBUA 2A1TR 3PITA 3Q3HA 5E6SA 1GDTA 1I7PA 1VOTA 2PKXA 4GX5A 2HHHO 2O2DA 1Z33A 3BVPA 1MO6A 1S8AA 2H16A 4AUKA 2NAPA 4TLAA 4Z4IA 3PJFA 3W8FA 4ETNA 2HHAA 2Z5VA 2XQVA 3CEIA 2D3OW 3AESB 4TT3G 3O03A 2FPUA 2RGDA 1U3UA 1P2DA 2DGDA 4HGYA 4NDNE 4WCFB 3T9BA 5JZSA 1L5HB 3S2FA 4WK4B 1CZNA 4ZOEA 4MWBA 2QVXX 1AR1B 3PFFA 4RHFA 4ZYTA 3ZZ0A 1T0BA 4IZIA 4ZHYB 4KDRA 3OZBA 2IU6A 2YV4A 2DAPA 4L74A 4PO3X 4B3IA 5BY2A 5F98A 1V16B 4G86A 1FPOA 1GGJA 2OUIA 3KQYA 3GUYA 4R2JA 5K8TA 4O4HA 2ZSUA 3K1YA 1VB3A 4FEGA 2I9KA 5B7QA 2F95B 5AXDA 1U2GA 3ANLA 2B99A 3CGWA 1SXPA 1Q1ZA 1H4VB 1TI7A 4ZANA 3TGUH 4FWBA 5EPOA 1XZQA 2OECA 5FQOA 3ZZ1A 5ITZA 5L7TA 1DKNA 3W7UA 1VSBA 3EQ6A 2C3UA 4H3VA 4U2KA 2KG7B 4ZI2A 1ZXBA 3G2IA 2IPAB 4I50F 3S3XA 4UASA 3DMYA 3M1LA 1NI8A 1P2FA 5K01A 1CUHA 2YJ4A 5C93A 2O50A 1I0IA 2G9QA 3AF1A 4N76A 3NT5A 2GEVA 5BMOA 3PQEA 4C6HA 2NZXA 3W4KA 2AE1A 1U97A 4FXPA 1F1JA 4C29A 1FW6A 1I36A 1HV8A 3MC1A 1C0KA 2WWIA 5HOQA 1F8GA 3ID6C 4HXEB 2FRXA 1VJCA 2BISA 3M0EA 4OHVA 1EA5A 1G9SA 1CG6A 1KJJA 3LT1A 1YRHA 3OEEG 3O31A 3VKVA 1PFKA 1Y9EA 2KYRA 1HFKA 4G97A 4HFNA 4PCUA 2P1DA 5BSHA 4MR9B 3FUXA 4E09A 4JGBA 1V96A 3DHYA 5JPDA 2ERXA 2O8DA 3G8AA 3EF0A 3IJEB 2A35A 3BG5A 3W2TA 4MI9A 5BV2P 3IXQA 4NOMA 1QU3A 1K27A 4FLYA 1N6OA 5TDHA 4XSHA 3Q3VA 3RARA 3ZGVA 1C9YA 2QD4A 2WKRA 3BIWA 1PJTA 1XD2B 2ECKA 2INGX 3GPIA 4XB1A 3AW9A 3ZGXA 4ALIA 5E6UA 4D1YA 5E79Z 1E6KA 4TL6A 1V7ZA 1Z3IX 4ANFA 5CCBA 5IFLA 3DOJA 2XQJA 4F96A 1T2EA 2AFIE 3LQ1A 2VWPA 3K9FC 5FJJA 1E18A 1K4DC 1RYHA 1XFAA 4GOOD 1C8KA 2Q5LA 4PZLA 2RH9B 4OOEA 2NU9B 1XBTA 1GQQA 3DEYX 3REQA 1WXWA 4RX1A 2XCIA 3N58A 4B3FX 4DMGA 1MRNA 4FOPA 5MFPA 1SPBS 1AK2A 1CRQA 2PT7A 4KDCA 2CDAA 1UFKA 2Q2QA 4NNJA 4L4ZA 1SPXA 2GTAA 4YCMA 2ZRLA 2FDCA 1A88A 4O5AA 3NHZA 5F7XA 3EXFB 3T1QA 3VR5A 2G8LA 3O21A 4CU5A 4C1NA 4MAMA 2JVDA 5HGJA 2D1RA 1O6CA 4QU8A 3DD5A 1FP4B 2WJYA 3LPAA 4MQEA 4NBNA 5EE9A 3JSLA 3E9EA 2JLBA 1RMTA 1FNNA 4MRNA 4KN6A 3UCXA 4XE5A 3A9WA 2VJKA 3HE3A 4RK6A 5ECYA 2PZJA 1YSCA 1HUQA 1WMAA 2LIVA 3SWWA 2HA6A 2ZRDA 3EIXA 2ZINA 4E2XA 2C5HA 2Y0DA 4EZIA 1VFPA 4P4UA 4BVFA 5LGNA 1EEXB 3BF7A 2P3SA 4L3VA 4MGZR 1A76A 2JASA 3V7NA 2AHYA 1O9HA 2GO1A 1C0PA 3UM7A 1HQDA 4DXAA 3OWHA 2H1LA 1MNGA 3K70D 3HLKA 3CLUD 3NRJA 4GOLD 1T0UA 5GV7A 2Q0HA 3W7WA 1N0IA 4YRLA 5TVKA 3F0DA 3RNLA 3D01A 1BMFG 2Q50A 1FD9A 4DA6A 4F4UA 5EIXA 3ZLJA 2WT9A 1Q7CA 4WCEV 4DV7O 1YC5A 2NV0A 4Q01A 3R7WB 3S29A 2XAGA 2WZBA 4KN9S 2Z2XA 3IVGA 4G4ZA 2OYQA 1B8PA 1P2TA 1DVRA 1A3CA 1TUIA 2QRZA 4FYMA 1KDPA 4E2FA 4Z1MD 5IJZA 4UARA 2BSXA 4X94A 3X1DA 2EWWA 5H80A 3EWIA 1PDWA 1W0KD 2D5LA 2IZ1A 3DAOA 3WISA 4D4KA 2FL4A 3CRW1 3W8RA 3MGKA 4MDFA 3U4DA 3H01A 4I19A 5U1PA 3ROPA 2D2VA 3FPBA 2QLMA 2R1VA 4NFYA 1XRPA 4MW0A 5KJEA 2L0XA 3ESQA 5TB5A 3SYPA 4LTNA 2AZ0A 3K4PA 4OEHA 5JPIA 3VPAA 3L1HA 1Z7WA 3EXG2 3L8CA 4Q9DA 1NXQA 5BVGA 5IUJC 2HQBA 3VYUB 1NRXA 5TT0A 3IMPA 4OSOA 1HXHA 3GN1A 3M4NA 4YACA 1R3JC 3SZRA 1XYYA 1KAHA 1NVGA 1VXOA 3NBXX 2E4ZA 1Z4QA 3AILA 3IT0A 4IX1A 4M9ZA 5KQGA 1T25A 5JBNA 2QT0A 1XA3A 3H6GA 1Z4OA 1Z6XA 1NP7A 1KVRA 2EEPA 2J3DA 4FYWA 4KSCA 3P9QA 1VQKF 1C0IA 1KBZA 3OMXA 4NH0A 5K0SA 2XKJE 1JJVA 1GPMA 2QIPA 1EB8A 1Y3DE 4GH5A 3TE6A 5DGCA 2A3NA 1NW6A 3S0WA 5EP3A 1LS6A 3E89A 1SQPH 4BVTA 3LAWA 1VMDA 3RSFA 3TSWA 2YIMA 5FNVB 1BNCA 3TZ6A 4YIHA 2I7XA 3V8RA 4C20A 3I2IA 2GF2A 2VDWA 3IAM1 3HJRA 4RQOA 1JR3A 3F9CA 4JLBA 4RPCA 3RA5A 4J0EA 3RE1A 1H7MA 3G88A 2IE8A 1RFGE 4LDRA 4DIMA 3SEZA 4F8YA 1KJ8A 2QYSA 4JGIA 4E11A 3H1TA 2WB4A 4O4LB 5C53B 5K51A 3QY9A 2OK8A 2VDWB 4BNTA 2IOYA 3G89A 4FC6A 3C74A 4IQGA 3VYVA 1T9DA 3IVMA 4LRQA 4MVJG 3O1HB 2QAIA 3D81A 1KJIA 2YCBA 1ANKA 3C3BA 1NVVQ 1C7QA 2QN9A 3HR7A 1JFVA 2CVHA 3GJZA 2ZIUB 3TW4A 1GNLA 3B6EA 1KI9A 1GO1A 1W4RA 3M6MD 4P92A 4UHJA 3KHSA 2V45A 2TMGA 3QBEA 4QGBA 1H0SA 3C45A 3RLFA 4Z99A 1HQYE 3F2IA 3PJGA 5HX7A 5HIKA 2BUAA 1IG3A 1GPKA 3X1KA 4GBJA 1L1FA 1I3CA 1A4XA 4PGAA 2F1RA 2GBOA 2WWFA 2A1TS 4RMJA 2P3LA 4WVFA 3W6ZA 1DTWB 1NVFA 5FL7A 3EN0A 1MO4A 2YY5A 3N2IA 1RHJA 2Q1WA 2WYHA 4CT5A 1M90W 3GAFA 2DWOA 3K1JA 2YXBA 5CU7A 3ER9A 5ELLA 5G0SA 3EZYA 2XWQA 1W581 1NU1H 1FYFA 4QFBA 1AIPA 3UB3A 2EZ4A 3B7WA 1WB5A 3E0QA 2B9EA 2QTCA 3AEUB 4QGAA 2X0DA 1ZISA 4AXXA 2UUBO 5K6AC 3OQMA 1WNSA 4JI7O 1SC9A 3DNMA 1E8NA 1VI6A 3AG1B 4U3JA 3O74A 4IDNA 4Y2QA 4ESHA 5FWYA 4HHEA 1K8ZB 1AMNA 3GEPA 4ND5A 2Q7HA 4RWUA 5CBHA 4FI3C 4MK4A 4RD0A 3U0VA 3ZQKA 5IU6A 2ZUVA 3RVOA 1EJ0A 1K8YB 1N5RA 2GCNA 5B36A 3AV0B 3S55A 4R7CA 1UT6A 4F0JA 1HOXA 2NVOA 5LGUA 4PDMA 3W79A 1VKHA 1O95C 1SVIA 4I1OA 5FP0A 2PYLA 1U2SA 5JJNB 2UVPB 1HNZB 1J4AA 2EFJA 1PG0A 1EG2A 1E1CA 5HK8A 3TQHA 1PCXA 3ZIDA 3THWA 2FPIA 4Y9DA 4WF9V 2PGDA 3VOTA 2ROQA 2ZDQA 3OLYA 2ZLBA 4QDKA 1NJIW 1IXZA 2AI3A 3FUCA 2ZE5A 4KZPA 1Z0UA 2VUHB 1MFPA 4ZC8A 3HBAA 3SSOA 4F4FA 3EXIA 1FSZA 1SBQA 3QUQA 4RF3A 3A6PC 4OBWA 1XNQO 3KSZO 3LI2A 4CIWA 2GWHA 4IIJB 3OETA 3GNSA 1O4VA 3A1FA 4DLTA 1ZJWA 4YJHA 4ZCRA 1HNNA 1CRLA 3VR0A 3HCFA 3L8FA 2MSNA 1AKTA 1T3LA 2HLHA 3KLNA 3QNUA 4Z1VA 2JGIA 2VCYA 2Y3IA 5I7OA 1BS9A 1E94E 1VF5B 2I34A 2WT8A 1AHHA 4D6YA 3E1GA 3KD3A 4WA8A 2G28A 1XTZA 2K6GA 3IRVA 4BO7A 2NU6B 1AV6A 2QZ9A 2YZMA 4MVRA 3RV3A 2PYZA 2WJ6A 5GM2A 2ZYTX 1E62A 2HGZA 2OSBA 4U9UA 3QPCA 1P74A 3UG7A 2JFZA 2OOKA 1B7GO 3O3CA 1EWRA 5JH7A 2CDRA 2QNRA 3M8KA 2D00A 1EN4A 2BY4A 2DTXA 4ZQCB 2VGNA 4B33A 4CM8B 1A71A 5DPMA 1I30A 2WAMA 1SBCA 2XYHA 1J7KA 2E7ZA 3A27A 2YIBA 4IDBA 5GGXA 3SVZA 5SZJA 3MUFA 4E15A 3L73H 1XD2A 4E5YA 4N5NA 4AZ0B 1F4PA 1NY5A 2BFDB 3U7QB 3C9TA 4KX3A 5E1DA 1LLCA 1ZMXA 1WMBA 1SIOA 2B5WA 2Z2IA 3HPQA 3VZDA 1R0YA 2JGDB 2AGAA 2C2WA 2VNHA 1VKJA 4KWTA 4EVRA 1G42A 5CCDA 4WA7A 2XYVA 3DFFA 3G2KA 4C21A 2PZSA 1SZXA 3CRQA 3WNCA 4BO1A 5U4XA 4TWAA 2IU0A 2D2FA 1DDOA 3R7BA 3X1WA 5IG2A 3DUWA 3SPJA 3ZCQA 2ZVPX 5AK3A 3NPMA 3IAFA 5H02A 4D8YA 5I9NA 4LMBA 3U9LA 5KB3A 4P3PA 2YBDA 1HA3A 3FDZB 4AKGA 4LXYA 1C9EA 2Z3VA 3DO6A 1DAPA 2DLDA 4HWPA 2C4WA 3AG1C 5I01A 2BFPA 4HH3C 1CY8A 2O7RA 4YRGA 4FINA 4IVRA 3D6TB 1VG8A 3CC7F 3FG9A 1DCFA 5TX7A 3S5JA 3T9DA 4AJEA 3JYOA 3MQ4A 5J2UF 1FA9A 4R0VA 1K8XB 3B1VA 2W0XA 3AVQA 4GMGA 2EW8A 2J46A 2IJIA 5BSMA 4YRZA 1TEHA 1R0ZA 4CM9D 4LY9A 2AX4A 4U6SA 1DAOA 1UXKA 2GAFA 4UHDA 3B89A 2DYRB 2JJ8A 3ENZA 2WJWA 3H2YA 2FDXA 4KR2A 1JS1X 3LY8A 2VF8A 3G2JA 1ODKA 1VJRA 1YB7A 4UVAA 3L05A 5TEVA 1MJGM 3LHDA 3S40A 2REQB 1FJGB 3ZU3A 1JPXA 2Q5EA 3W5CA 1HDRA 1IAVA 3DEHA 3PGXA 1Q82W 2FSUA 3DNPA 2R8RA 3ZX4A 3N2LA 4X1IA 4PX9A 4LI0A 3RRBA 1DG3A 1QDLB 1M57B 2XE7A 3HSSA 3SPIA 3KKMA 1DTEA 4ESEA 2HB6A 2IEYA 2J9FB 2MSEB 3NWJA 4PLTA 3TZQA 4PANA 5IASA 1QOQB 2ZFUA 2QZPA 4ZI7B 3KDAA 3N7AA 4X1IB 2WMOB 4NBTA 5AI9A 2V4UA 3QMPA 4ARSA 1X0XA 4J1TC 4WY2A 3WMFA 3HJHA 2Q1TA 1YU6A 1XNJA 2ECOA 1Y6XA 1THZA 4JKYA 4F4HA 5KSYA 4HH1A 1ULSA 2QN6A 5DHPA 5G2OA 4U02A 3WX0A 4CLRB 3SKXA 3AYZB 1WDLA 2RARA 5CNJA 4RM2A 3VAZA 5E6SB 1FNMA 5MHTA 4KLZA 2HBYA 4J0QA 4NTXA 2PD4A 3QU4A 4B6JA 2Q3MA 1HFJA 2BIFA 4IO1A 4ERNA 1I7DA 4FEYA 1LTQA 4WNIA 4JI6B 2W58A 1VQ5F 4RDCA 3P0ZA 3WGIA 2VT2A 2ZXEA 2PUAA 1A69A 3SDSA 2I99A 4II2A 3ZV6A 3FCAA 3I0NA 4ALLA 2XYGA 1JJ2U 4D81A 1LF5A 3RIXA 2Y05A 3U3ZA 3TLMA 4FYXA 5SYMA 4WBNB 1S2DA 4X3OA 2BR5A 2D0IA 4Q4LA 3RS9A 4NCBA 1QO9A 3GWKC 4IJQA 1WQ1R 5FTJA 1RXVA 4CKEA 4HFMA 1EQAA 3SQOA 1KNKA 2JRLA 2QLFA 4Y2UA 4F4JA 4BMZA 5JD4A 3PZBA 8MHTA 4X45A 2MDTA 3GA5A 1K9SA 3KTFA 4LX8A 4O6VA 3TNYA 1GILA 3MA0A 3LCRA 4EY3A 3ABQB 1EFDN 2WLIA 1ZNQO 3A1VA 2G9VA 2PCJA 2M7WA 4AO7A 3CO5A 1IPAA 1X0VA 2R9IA 2EGUA 3RHZA 2D2IA 5D5HA 2DVMA 4EF5A 2B5OA 3LFTA 3FR8A 2VDQB 3DYIA 2PT9A 1E66A 4C7OA 2WJIA 1IHUA 2ODBA 5FL3A 4XVCA 3J7AU 1DHRA 1R5NA 1E98A 3ONNA 1YCFA 1YS7A 2C3YA 2IGBA 4NFLA 4C0SA 5D1NA 1Z22A 2CL5A 4NZOA 2E5LO 2ZR8A 4ZVSA 1MTZA 2HFEC 1DK1A 4B3TO 3AHDA 5HWSA 3B70A 3U6KA 3B6KA 1ZOPA 4DOMA 1C4WA 3P2EA 3P0HA 2ODPA 1ODIA 4J7JA 1ODCA 3ND8A 5TE9A 4DZRA 5ALHA 4ESOA 4X66B 1Y0BA 1RYMA 3DKPA 4WJKB 1VRVA 5B4UA 1OH7A 3C6QA 2TSYB 5C80A 4YLYA 3TCUA 2NO1A 4OQZA 3OR6C 1SNYA 5CLFA 4PTZA 3X43A 2W83A 1KYQA 2JIOA 3W3ZB 4K81B 5CW1A 3V1UA 2YSUB 3ETGA 1NUHA 1P4AA 4FEEA 2IQIA 3RQIA 2OQRA 3FPIA 2WBLC 3ENWA 1EE2A 1YKGA 3EJ6A 2JFOA 3VPDA 2HK8A 1RWQA 1EXWA 1FS4A 1IOWA 3CMAV 1HR0O 3PENA 2BD0A 1GK9A 5KSZA 2YZ2A 4EI2A 5BN3B 1OX4B 3GELA 2FW8A 1ZL8B 1RJWA 5CVVA 2Z9CA 4UCOA 1CY1A 3LUGA 5FI1B 1BE3H 2GLTA 5E7JA 1K6JA 2YWFA 3T35A 1P7WA 3A0UA 2Z4SA 3WC4A 3UMYA 1G21B 4OV6B 4YAWA 2G9UA 1X7DA 2POQX 2NUTA 4RULA 1KYWA 1D6MA 3JZDA 4OSEA 2D4AA 4R01A 1Y81A 4AMGA 3KYJB 2B3DA 1E1CB 3L43A 2EZPA 1JA8A 3IT3A 1HDZA 1B6GA 3AZQA 3NVKE 2NUAA 3DBLA 3PFGA 5KNDA 4BP8A 3WA7A 4LJ8A 4MB6A 2OFXA 1OGJA 1II9A 4PR3A 3GLHB 1Z37A 2H06A 5DM70 1QQ6A 3H9VA 3BMQA 4LF4O 4BLOA 5IVKA 2HO5A 5KYGA 3FLAA 2NZYA 2M6SA 3RM3A 1KQNA 2J0UA 3VPXA 2F3UA 2WHPA 4UMVA 2CKMA 1N3IA 3KWJA 3M6WA 1XC7A 2AN5A 1PLLA 1USUA 2AFHB 3HJAA 3N8KA 3P4XA 4KRGA 3EFBA 2E87A 1PGJA 1G4HA 1N6HA 3OJLA 3X2QC 2DN9A 4MVZA 4YAIA 1OXVA 5JAOA 3PKJA 3V48A 4F1WA 1H8ED 3I55V 3K7EA 1AHNA 4FX2A 3EEBA 2YASA 5CB8A 3KT8A 5IVHA 5BQFA 5C8YB 2GV9A 4LC9A 3KQUA 3ZCVA 2XYQA 2D1SA 2GVZC 4Z8XA 1COWG 1TRHA 1WJGA 1ZITA 4G4VA 1B6TA 5LP6F 3EIFA 5JCJD 2QA4F 3O9VA 4HLCA 3HU3A 1W2WB 3IAAA 1I24A 1V5GA 1N9GB 5A4AA 3F1KA 2FTKA 4HQ6A 3L8HA 4RU1A 5DXFA 2LBPA 4U3JB 3ORYA 3PDUA 1U80A 4ZGWA 2FZ5A 4ABTA 3ZO8A 3QYFA 3LGAA 2OTLF 2PU7A 4H16A 1ZW1A 2BEUB 3M81A 4WXEA 5KNDD 1H2YA 2AUNA 3NV7A 1DT3A 3B52X 2ZIOA 3IDQA 2XTAA 3MTQA 4AMZA 4F5EA 5KDOA 3P19A 1TVMA 4UDOA 2QE7D 1AQYA 4KAXA 4MVJI 1ST3A 5HM8A 1RHUA 3EMVA 2UUCO 1C7EA 3EZXA 1CJMA 3CJRA 3IB3A 5EJ5A 3CN7A 4AROA 4MJXA 4DRXB 4CDNA 4V0OA 5BXZA 3A3YA 1SU8A 3K70B 1PFWA 2B82A 4OYRA 2ZUDA 4HLNA 4TLMB 1LEHA 1Z8NA 4RPLA 4ZVOA 3ZI4A 2DWDC 2JLVA 1V0JA 4KXRA 3G85A 3WWYA 1TE2A 5HXZA 4BRWA 5KNCH 4DKJA 3MW8A 3JVIA 4NF2A 2H6EA 4GYKA 4KRXA 4HN2A 3MSXA 2HH9A 2XWPA 5KTNA 1J70A 1SKVA 1VHQA 4MUFA 4ZQIA 4FZ3A 3CBQA 1CIPA 1AZTA 2I6GA 4HSGA 1WCXA 3V4VB 1B6QA 2ZBVA 3UA3A 3I61A 4EA8A 3P4UA 3AUAA 2WVGA 1JE0A 5J2UA 3IHLA 4FBLA 3IKLA 2EVWX 1PUJA 2UZAA 2X6TA 3OOJA 3P4YA 2DJ5A 3WGOA 7MHTA 4NCKA 3VAAA 2OO3A 2Q45A 2OXRA 3ZJUA 4X66O 2HVKC 3ZY3A 3L0CA 1SF9A 1T6NA 2QL6A 2ZD9A 4EHFA 2G1JA 4ZVQA 1V1MB 1EWYA 3U0ZA 3LF2A 5IM4A 4DLAA 3CCMF 1AR5A 1M1UA 2JLRA 3ELBA 1XLVA 3DPUA 1R9MA 1VG0B 2KS6A 3LSQA 2VPPA 3QKSB 4HN4B 4JZKA 5LMNO 3ZXYA 1IBCA 4AB1A 3DC7A 1MT3A 3NI2A 2HQ1A 4X1KB 2HQOA 3JQ9A 1OLSB 2ET6A 2XF8A 4KIGA 1SESA 5B6PA 1DARA 5AIAA 2PNJA 3QWHA 1KQSU 1SXHA 3AUXA 1W96A 4H44B 3WB9A 4RTNA 2LGJA 3I5DA 1BAPA 1Y76A 1YJNF 1RKUA 4HYTA 4EFKA 1N2SA 5D8DA 3GLIE 2DOKA 5KHJA 3OLQA 4UVCA 1SGWA 5BW4A 1KARA 1WSWA 2DPXA 3DDZX 3GMDA 3M34A 4Y0NA 4FLUA 1UINA 1QH8A 2PJUA 4JUFA 5BNFA 2B1RA 5ILOA 1BQ0A 3X1MA 4BWAA 1QUFA 2CNBA 3I23A 3KD2A 3CURA 5J4VA 1GD1O 1KI6B 3LNNA 4R3NA 5E2AA 3DP7A 2UU9O 4ESVA 4CS3A 1ZUNA 4RE6A 2QX7A 2XJ9A 1K7YA 2GN8A 1OT3A 1QOZA 2O5RA 2DEUA 1XMPA 4OJKA 3HRKA 3PRYA 3TBHA 4V0KA 3S5UA 3RYFB 1QJCA 1R9JA 4JK3A 2R48A 3ENNA 2J31A 3AP2A 2Q99A 3PLRA 4US0R 4WSOA 3VOSA 4A03A 3SPCA 1KR5A 1QS0A 4DR4O 1Q12A 1QGAA 2KPOA 2MMCA 4XW2A 4YGXB 2FG6C 2Z8ZA 4AVYA 3IR9A 5JXJA 1QFYA 2VP9A 3GVPA 4YAUA 5LL6P 2P6OA 4C9BA 4I99A 4IS2A 3UWOA 1ZHFA 4L57A 2ZW9A 3JYPA 3QHAA 4IJ5A 4OLFA 4EPVA 2QP3A 1RWVA 2EBHX 2J1LA 1NTMH 5IVDA 4IDFA 4W5NA 5EO3A 5KAFZ 3P32A 1YS1X 4PA7A 3KCYA 2AFIB 2PA3A 3D8BA 4IDOA 3PPIA 1XVUA 2YWRA 3JRNA 1P8AA 1BSMA 3I9JA 1GLNA 2XMQA 3SQDA 4Y0VA 3AR2A 4R84A 1ZKDA 5JS7A 2QVGA 1W4ZA 3IO5A 3LBAA 3P71T 4BFZA 2FWMX 4PY2A 3GFPA 3LECA 1DMRA 2YJ6A 2RGGA 3RS8A 5JRJA 3IX7A 2IJKA 1VK3A 5IT5A 1FP2A 3G9TA 5JJCA 5FNZA 2DCUA 3DUFA 1WM1A 2OBLA 2FF5A 2XUPA 3KLPX 4H0FA 5C4GB 4NVRA 3CCCA 4KWCA 5LMCA 4JN6B 3HBLA 4A23A 1XZAA 4YAOA 1IY8A 4J8PA 4D79A 1N2IA 1FDTA 4HGRA 3TG8A 2VYVD 2QM4A 4EO7A 1KVSA 4QYMA 3FWZA 2F93B 3WZLA 2WHXA 1O58A 2C8LA 1FAFA 4DSAA 1BJRE 2REOA 3NIGB 4ID9A 1HDOA 2EIKC 3V8QA 4OB8A 4H1WA 1N77A 2IYEA 4QUBA 4BX9A 2CUKA 4XFJA 1UFRA 2YQ4A 5B37A 4YUZA 2OHWA 1N34O 1VM6A 4OXSA 3DEJA 4V2IA 3MGGA 1X7XB 2H1VA 2Q7XA 2FN8A 3GRAA 1MB9A 1I0LA 3KT3A 1N6RA 3U3RA 4C4ZA 1POWA 3GQVA 1FFGA 2ORYA 1ZLXA 1CY7A 1DOZA 1FOEB 4UAUA 4CV1A 4YUAA 5JY6A 1E9SA 5AKYA 1H2GA 3QZUA 4LVCA 3ZNOA 4OFZA 2NNUA 4HP8A 3MOSA 1BIFA 1GTZA 1XEXB 2EFGA 1WAMA 2JKZA 3MF4A 4XARA 5YASA 3HWWA 4N0QA 5FXMA 1LBIA 4M0PA 5KYWB 3W34A 3G6EF 4DMUB 1XMIA 1ISFA 2Z1UA 3B7GA 3RH0A 2YFYA 2EL7A 4ICIA 3WRYC 2O0KA 1CXZB 4ZK6A 3NVIB 3AH8A 2AA3A 3QHPA 3PQ2A 3HMQA 1EZZA 1AUPA 2VAPA 3NK6A 3QRWA 1N2OA 5AXAA 1DBRA 1EP9A 5JROA 4R3WA 1AP5A 4GGPA 1VHAA 3KELA 4J3JA 2P1ZA 3U80A 2RAPA 2HRBA 1SO8A 1A2QA 1IXRC 1W9HA 4FZVA 1H2FA 1E2MA 4IYIA 1GGKA 2CLOB 3T1YO 2FQWA 2EDAA 1K7XB 3DDCA 5KTOA 1WW2A 1MHTA 5JJKA 2RGNC 1A27A 4RHXA 1QRUA 1MABB 2Z56A 1D5CA 3CMCO 3QKUA 1P7BA 1JBEA 1G20B 2BUBA 2WYUA 4LH7A 3NHWA 1VA4A 2JFFA 1FBNA 2ZWMA 4U7PB 3SYTA 2WHRA 2AYZA 2PUTA 3GRVA 5TGDA 3DSRA 2NU8A 1NMUB 1D1TA 4RL4A 4P2ZA 1USWA 3H4VA 1UPBA 3KFVA 4KE8A 1A9OA 3L04A 2EP8A 5FRDA 3ONWA 2W6PA 5JU6A 4GECA 4DR4B 2P1RA 2OCHA 4QBIA 3TSCA 2WUVA 3BMCB 5E7QA 1I01A 4F1JA 3Q3IA 1KMQA 1XX6A 2DT5A 3QVOA 2FP4A 2VQEB 2ATEA 4WGFA 3JATA 1HNZO 3QKTA 1S72F 1MBZA 1H6DA 1FUKA 1MKYA 3COPA 1W85B 4ON9A 5EMKA 1ZMBA 2KBFA 4ETWA 1KEKA 2FPPA 4B3MO 3RSHA 4I1PA 1JH8A 1LRKA 2FPKA 4GPAA 4MV1A 4YJ2B 1WQ4A 2IW1A 5AK4A 4C3UA 1TUEA 3JAWA 1KAQA 2BVNA 2OQIA 3H9CA 3K08A 5A7GA 4DCNA 4EG8A 4EZBA 5TMPA 3AXSA 2ZDGA 4RW0A 1L5FA 2QNIA 2QRJA 3B60A 1VBMA 3GPDG 3KQSA 5GONA 5HY4A 2AFRA 2IPLA 2W2MA 3DAGA 3DQZA 2G5TA 3I56F 3HYSA 1CJSA 4QPZA 5K0GA 5KYNA 1GZUA 2WD7B 5TQ2A 5IHPA 3LCVB 4EJ0A 3MZ0A 3GWOA 2WJPA 1KY5A 3K15A 4IH4A 4Q66C 4HG2A 1XQXA 3FWHA 3KXIA 4GMXA 5DGXA 4DQUA 4CL8A 3ANSA 4HYEA 2WKWA 2JBWA 1T0HB 2CHGA 1E6EA 2ODQA 3H83A 3TLJA 3T0GA 3ONVA 4DMCA 3SYAA 5CLGA 3GLIB 1CS0B 1LZLA 1VP3A 3F0EA 2GD0A 4G9BA 2OQVA 1YQNA 1IPHA 2J59A 4JAUA 2PTGA 3B4SA 3L1JA 1OFIA 1GHTA 3FYTA 5IM4F 3WB0A 4RIFA 2XDAA 3LUDA 5CVUA 5IDYA 3W6OA 3CLTC 1QE0A 3D8RA 3MHPA 3IR5A 5TPZD 1COMA 5EEHA 2IH2A 5ICGA 4YR7A 3CPHA 1LPBB 3DFKA 4Q9IA 1GITA 2Q8VA 1YB6A 3B2EA 2OLKA 1C9KA 5LM3A 4CI9A 1U3DA 4XD2A 3KVYA 5DOVA 4FB5A 1H8HD 3O8OA 3S28A 3OAAA 1QFXA 4Q34A 2VPZA 3AKYA 1AS0A 2YIAA 2V7BA 1G2IA 4JJZA 4L1KA 4ZJPA 2B4KA 1N34B 1JQ3A 1GADO 3JVVA 5KHOC 2GLZA 1YR1A 3FPGA 1VJDA 2Y2VA 1N25A 3OT5A 4PICA 3H65A 2ZUFA 5TPWB 1H48A 3L71H 1TYBE 2E2WA 4H7IA 2TYSB 4ZZ2A 1E0DA 1Z28A 2P69A 3EA0A 2P9QA 3H2HA 4J10A 3IGFA 1HL7A 4FMDF 3DC5A 4HRXA 5T57A 3RFUA 4C04A 1QR8A 2HI0A 2JAHA 2OGTA 2XD4A 2C9BA 3R4CA 3ZK9A 4CQMB 1Y7PA 1T13A 3WJPA 4HRYA 5IWAB 2ZJBA 3ECCA 5FULA 3R1IA 3X1YA 4BGEA 4K1XA 4ENTA 1ZNXA 3EQ8A 4PJ0Z 4F8JA 2ERCA 3GLHE 1X7OA 1DB3A 3VO2A 4YEDA 4CG1A 2HSEA 3U0OA 2HFKA 4OIFA 1W2GA 5DWVA 4P2BA 5HMLA 1D2GA 1N6IA 2EHDA 4ZZ1A 1DO8A 1ATZA 3MJRA 5ERGB 5K0LA 3U4HA 4CQNA 2VFAA 2UZ0A 3HBMA 3BSYA 4BP1A 3QE3A 3MB8A 4N6GA 3CCFA 1WMSA 1GAWA 3GA0A 2IHUA 4LVOA 2CHTA 1FJGO 1HE4A 2O9JA 2GEKA 3B20A 3EGXB 1W4LA 1II8A 2PN1A 3GFQA 4RHEA 1OWNA 5CXXA 1IN7A 1OB5A 1GNPA 3U4IA 1LLQA 3R77A 1I51A 1L7PA 4PXYA 4MYCA 1P77A 3BEOA 3G2MA 2LE0A 3ONEA 1F14A 1ZZEA 4MW7A 5H16A 4FWTA 3NR7A 2WZQA 1UQUA 4B2IA 4JI2O 4XQ9A 4ND4A 3A4MA 4HQOA 1RM1C 2Z3WA 2OR3A 4UW9A 5KTKA 3DWEX 3ZKWB 2BMAA 3D1LA 1GGHA 3RW9A 3TGPA 3I56V 3GYQA 4A0FA 3IE1A 4RMHA 2IEGA 2A7XA 1XB2A 3JWJA 4LJKA 4M46A 1FLAA 5CP8A 3WLQA 5BR1A 1G2QA 3A37A 2VAXA 4RY8A 3R0QA 3HCWA 1NAIA 4REMA 3DMDA 1WA8A 2BKVA 4ENSA 5JXGA 3NVMB 1JLKA 3HR0A 1ACJA 1H9CA 4QE9A 1VQ5V 2WW8A 1JWLA 5L6MB 1F4LA 4X54A 4DANA 4OQDA 3SDBA 3EPJA 1AMUA 3UENA 2MYUA 3VX4A 3OY7A 5T64A 4URYR 4QG3A 1Q43A 3SVTA 1JEQA 1K88A 4XEHA 3VNBA 1MG5A 3LWPC 4NCAA 2BMJA 5TRTA 2X0NA 1DIAA 4RK1A 4JEHA 1ZUWA 3CC2V 2VDPB 4LAFA 4CKCA 4GRAA 3EG5A 5JNUA 2IP4A 3BTOA 3GY0A 1OXXK 2QW8A 4WFJA 4X00A 3RUEA 2H1OA 3H17A 2EILC 4UV9A 4OUDB 1M90H 4Q4HA 4WINA 2XZTA 4KV9A 3T7TA 3K59A 1XV2A 3NATA 3L4SO 2VJOA 6LDHA 4J90A 3WL3A 1R6UA 3VHXA 3V33A 3DVAA 1JSLA 4BNIA 2I6XA 1V5IA 3FVQA 3MN1A 1RRCA 2WTNA 3MGBA 1SVOA 3LKDA 5EJGA 1XZEA 4LNUA 1PNLA 4RKRA 4HGPA 3ZE9A 1US8B 3KL2A 4NBLA 3NUGA 4UNPA 3UOAB 1RAHA 3I45A 3I7TA 4TTTS 4G5OA 4X8LA 5DJ5A 4B4VA 4O2AF 3N4ZA 2JB9A 5F2NA 1M56B 1U0FA 4CKBA 1G8SA 2CUNA 4LKRA 2PJDA 3B1KA 4IG4A 1VIVA 4RKQA 5LYJA 3IURA 4RPIA 2AW5A 2ZSHA 2RE8A 1DAFA 3CQ9A 4LJSA 3L93A 1E9BA 3G17A 3I53A 3VHXB 1RSOA 1PDVA 2L69A 2ZXFA 3E4CA 1G3MA 3ZN1A 3K92A 2CV0A 1QG2A 2IOFA 2W93A 3TW8A 1Q19A 2ETNA 4DV3O 4OA5A 1WXQA 4FPPA 1DJPA 3A9TA 1MP0A 1LTKA 5CW2A 1WMDA 3K5LA 5IBPA 5LC1A 4Q4CA 4J0IA 3VC1A 3LGXA 3BD7A 2XHZA 3QLVA 1G19A 1RFYA 5GZ6A 1VJ5A 3DE6X 3VYUC 5JD3A 4UEOA 4Y2GA 4YUWA 1Z0KA 1WD5A 4O63O 2XVYA 4XWOA 3PI6A 1Y63A 4CXMA 2PKQP 4GUDA 4TWJA 4HDQB 3V7EA 2CVPA 2DT4A 3W5JA 3V4DA 3D8UA 2CB9A 4FYYA 1XCBA 4W5WA 1VCIA 3WIOA 4J4TA 1VG9B 5JAZA 3P0FA 1AK9A 1T4BA 1XN1A 2PGNA 3EF1A 4MI6A 1QK5A 1J0DA 1SCUB 2EAUA 3AVVA 2JAOA 3PGMA 1W87A 4P4LA 5F2KA 4DEYA 4G63A 3VYRB 4DV1O 4BVJA 2NU7B 3IBGA 1X9GA 5EWLA 1EFLA 3RIYA 2OCYC 3IMKA 4EYOA 4NBUA 1A82A 2ALEA 2YOGA 1M2OB 3IE0A 3HKCB 1WCIA 4FMBB 2O59A 2B78A 4RUKA 4BX3A 1VJTA 2CHVA 1SB8A 3GLTA 4GSYA 4KKVA 1NXPA 4WKGA 5IJ0B 1CUVA 2JI9A 2X7JA 2J6CA 3KJJA 1WXIA 2QPOA 2POCA 3L92A 2EF1A 2DHEA 3AU9A 3FB8C 3V34A 4XVQA 2F1KA 3FDJA 5DM1A 3WKAA 4PYRA 2HF2A 1HTWA 4DLVA 1EFKA 1OV4A 1SXIA 3D7SA 1YITF 1DELA 2XKAA 3A1WA 3DTNA 4HXGA 4HWGA 2WF8A 5FLXM 3ZHOA 2NQTA 4ONEA 2YZ7A 5ENVA 3ZYZA 3URMA 2P5OA 4JHLA 5CA1F 1NDQA 3C16C 2GKGA 2J4FA 3MFQA 4UXJA 4D3FA 1PP4A 3ZWQA 1PJQA 4EAAA 4F4DA 1A5SB 4MXDA 3ZJ4A 4Z4GA 1WXDA 2CWDA 5FBQB 1Z56C 4EFLA 2VZ8A 4NC9A 2W00A 4M1TA 2EWCA 2CUTA 4LHSA 2JBAA 1L5SA 5KQPA 2ZJ5A 4M0DA 2HBRA 4OMUA 1ZICA 1KDYA 4J16C 1UXGA 1V25A 3QOYA 5AWFC 1XKQA 3ROEA 3WV5A 3H5NA 1M72A 1SCAA 1Y3BE 5A5FA 5G0WA 2WLSA 4ZQGA 4LQ4A 5B1AB 1P72A 2ZJFA 4D80A 3A04A 2NUPA 1UZNA 2QMZA 4JNCA 2C88A 4D02A 2GJ8A 3AEZA 2DWCA 3AG5A 2OAQ1 1PFYA 2NQ2C 4PM4A 2XMZA 3JVUA 1SVMA 1DCMA 2ACVA 2C04A 3ASZA 2IIPA 3JYHA 3KYIB 3BIOA 5AJVB 5B3AA 5JASA 1TYDE 5CDYA 2B2CA 4UVDA 1PZGA 1YBHA 2C94A 5F73A 1HT3A 3IEUA 2IYUA 3WHIA 1VQPF 1RMQA 1VF7A 4J07A 1ECGA 2DR0A 1FW8A 1RXUA 3L1KA 1UMBB 1XDGA 4YV7A 2ECQA 3E5MA 1KU6A 4TSFA 3S6JA 1JFSA 3IA7A 1SK8A 1QH9A 5F3DA 1Z63A 3O26A 2AMLA 4PQGA 4Q9NA 2WA2A 3WLLA 5JJ5A 2VJQA 3MJFA 3J7TA 1A8SA 1M33A 2VT3A 3AUUA 4H59A 1LR1A 3AG2C 4UNNA 3F7OA 2OUKA 1UMCA 3OZTA 4N03A 4YCSA 2PQ6A 3SIXA 3C3MA 2DPYA 1K73W 3Q40A 1UPXA 5CJ2A 2JLCA 3ODPA 4RA6B 1FFSA 2YRFA 2IYFA 1DC7A 3OE7A 3P8ZA 1NXSA 3HCBA 2RGEA 1ZCBA 2XXBA 2PIDA 3ND5A 2VP5A 2P4HX 1FZQA 1LBQA 4DMHA 4O8ZA 3EDYA 1PQYA 1F2VA 4DNFA 1L5ZA 3KWMA 2A5JA 4YMSA 3ZCRA 4BBZA 3JX9A 2VSFA 3BA6A 4MUIA 2FPSA 3CCQV 3PHHA 3BKXA 3SJCA 3I4FA 3L72H 4YASA 3HJNA 1R1BA 1ZH2A 5LZ5A 3AK2A 3Q2KA 5JYCA 2GVNA 4KXFB 3ZS9A 3DL4A 2AG1A 3MWLA 3OLZA 4MV5A 5JFTA 3FWNA 5F33A 1U04A 2JIBA 4Y2SA 4CTMA 4B3BA 5TXGA 1SQXH 4X1YB 2HRYA 4NWOB 2O8VA 3IOCA 2QPAA 3AF4A 4O1MA 3WLMA 1OCOB 3ABZA 4DNOA 3CTPA 4DR7B 3WLJA 5L53A 1E0JA 4GPEA 4HEHA 4C3ZA 2JGUA 3RVLA 3DT8A 1DBPA 5T4EA 5JWOA 2VDOB 3HWUA 3BDVA 4BUJA 2Z9DA 3F6PA 1JVNA 3NT4A 3B6MA 5CB4A 2HJGA 1BFKA 4AJIA 4AWAA 1VA5A 1XJ0A 3FLBA 4NYMR 2MSLA 5AOVA 1SWVA 5E0OA 4EVQA 5FFMA 1NMQA 2P6NA 1KH3A 2RMKB 3ASOB 4XFKA 2IV2X 3W9SA 4ALKA 4CBVA 1QQTA 2E21A 2GCGA 2Z04A 1XAHA 2P2GA 1QHXA 3CJHB 3AERA 3HA5A 3UK7A 3VHRA 3PPVA 2ZZMA 5TGZA 1ZOIA 4MYUA 1NQTA 3OLXA 3R3HA 3ZGOA 1KI4A 2ZYWX 3ASOC 3GLFE 3OQOA 2QVZX 4DRZA 3HYTA 3ZWVA 5FUQA 1XEWY 5KYWA 3WWDA 3B6ZA 3QUAA 1EFVB 3FMFA 1WTAA 4OI2A 3KT0A 3GGOA 2CXSA 3BILA 3FZYA 1WVMA 4H1VA 1XJWA 5EIEA 2ZCUA 4OTZA 4BFSA 5EJ4A 3CVXA 4BB9A 1HYGA 3HGQA 5IY5C 1L0BA 3QLVC 2WP0A 3LTEA 3R3VA 2KSDA 4FS3A 4E3WA 3R0ZA 1AB3A 4R9UC 2DTEA 4TYMA 1AJQA 1RE1A 4M37A 4URHA 1KH1A 4NONA 2V7WA 4WTOA 1YCGA 5LB2A 1VQPV 1N5MA 2QS9A 3IIKA 3VTAA 2ZIWB 3MWEB 4DA9A 1J2TA 1K75A 1I94B 2FTKE 2IP1A 2QMEA 2YYSA 5J40A 1ABFA 4I55F 4O2AA 1QIKA 2OV2A 3GRCA 3O3OB 4P7JA 1E2HA 5EFOA 1P7GA 4DDHA 2F90A 3CNOA 3NIDB 4FYKA 2OTLV 1B76A 2RKBA 4UVGA 4XDJA 3GD7A 1XEWX 5LYJF 1LU9A 3KSMA 4ABMA 1J56A 4FGSA 4TS3A 3ZEIA 4CM8A 7AT1A 2F1OA 5FOXA 3IQDB 5IABA 1E9CA 4KE7A 5JALA 4TRRA 3JD1A 3IVRA 3CEAA 3DSQA 1O0SA 1J5XA 1V9LA 4GSKA 2DECA 5EB1B 1DKQA 4AMYA 1DFHA 1E7QA 2CNWD 2WOOA 1P2BA 1ZMOA 3JQ7A 3K0KA 4PO8A 3SN6A 1KFKB 3OJWA 4TZ0A 1VZ2A 3OSZA 1ZR2A 1TU0A 1X7WB 1ZJ5A 2B37A 2Z30A 3DEAA 3NIBA 3A31A 4ZVMA 1VLJA 2FSVC 2Z4RA 1NU8A 1SC4A 4JBYA 4NE2A 3V8NA 5AIBA 4IW3B 1SKMA 4J2OA 1M54A 4U9HS 1F1BA 2O3QA 4N48A 4X65O 4QPKA 1TQDA 4UEKA 3TH5A 3T34A 3IGAC 3NK7A 3QJ5A 2H18A 5PNTA 1L0NH 1MU0A 2EG5A 1V4NA 3JQAB 5IHXA 2DBRA 1QF7A 2J4CA 4GEKA 2GPSA 2QV7A 4HYYA 4UZFA 2Y9MB 3TX2A 3ZNQA 4HL6A 4XPIB 1JIVA 2B9ZA 2OWOA 2Y9PB 3GG9A 3P20A 4GX2A 1DAIA 4J0DA 5AJZA 4DT1B 2RHGB 3BK1A 1Y5LA 3GDHA 3ICEA 4TKVB 2NU6A 3P2IA 1KQ3A 4RF4A 3HLTA 3A9VA 4ZJZA 2A06H 3T5AA 4OXIA 5K4HA 1U5BA 1FVXA 2L18A 3EH2A 2CLKB 4KDEA 5THXA 4N5LA 4E2LA 3ZWMA 4BJ3A 4CJXA 4EY6A 1TK9A 4OHWA 3SS9X 3OFNA 4XYGA 4KXVA 5TNXA 3M8AA 5IJ0A 2FPOA 3JZAA 3K2IA 3LFHA 3B8EA 4QAQA 4ZAYA 4DMMA 5HRUA 4YCBA 1SEPA 3U7RA 2PZ8A 2GERA 3SMQA 1UPGA 1J2RA 2GAAA 1X8JA 1EXMA 4LG1A 1V8ZA 5DU2A 4I55B 3VPGA 4E88A 1H2EA 2W37A 5C0OE 1YMUA 5LU8A 1RBQA 4N0MA 3FMVA 4MLCA 3ZP7A 2WK1A 5DP1A 2JCBA 5ALZA 4Z0TA 5BXYA 3HA3A 3VC2A 3UHAA 5GY7A 5CA1A 1A9XB 1Y89A 3CCJF 3G0DA 1X1AA 2YWDA 4BEJA 4WNYA 4CDRA 5KU1A 3BWCA 2OPBA 1ESMA 3C4JA 4RTKA 3PV0A 5TMEA 1I13A 1DZIA 3NBMA 3TM4A 1GCIA 2H0QA 3CKLA 4ENWA 1WP7A 1PM9A 1J0EA 4PRZA 5JRDS 5LQRA 3FPJA 2JGJA 4YFYA 3RFRA 2D1TA 1UCFA 2CLMB 1C0EA 1QK4A 4BB0A 1Q6YA 2WYOA 4A2QA 1JQEA 1A7KA 4X6XA 3W7VA 2I4MA 3H5OA 2OHOA 2OORA 1B0PA 4GQAA 2N1MA 5H5JA 1XDWA 3RSCA 5FORA 2VZEA 5GM1A 3FYCA 1E9RA 1IUNA 3MILA 2A9JA 4MPJA 3MJCA 3S2YA 4MMXB 4MW1A 1ZVJA 2X2PA 1FXVA 2VSXA 4B4KA 3S44A 1KYIA 3CJTA 4FR0A 1RXCA 2F62A 1E3QA 3BRWD 2NYVA 1CW2B 3W3AA 1MJFA 3PE3A 1LDEA 3RUPA 3Q5DA 1DLJA 1T1RA 3TTYA 4B6EA 4E03A 1FIUA 1VC2A 5H9CA 4JLUA 4QRHA 1GN3A 1OILA 1WHTB 2XUGA 3SLKA 3HSKA 3GGGA 1TCUA 4H7JA 4KXQA 5BMVA 2ZI9A 5EQDA 3UJPA 3CF4A 5KTPA 1H1LA 3GJ7A 3TVYA 3IOBA 4M1MA 3I62A 221PA 4JVOA 4FT2A 1G6KA 2F9MA 2ZF8A 3K9SA 1DBVO 3OR7C 1H1TA 4BO5A 1RADA 4CCYA 1L5QA 4KXXA 1NI3A 4GCZA 1Z2DA 1CB0A 1AN9A 2AZTA 3N59A 4H3KB 5HE9A 5TMDA 1DAGA 4EUSA 2QQ0A 3G23A 3QUBA 1MNQA 2HWWA 3B78A 3WMGA 4NDZA 2NSHA 4PA3A 5I4IA 5C7IO 4KFUA 2COEA 2W4QA 3R5JA 3ZUGA 2VPYA 3W9UA 1JA1A 3GX1A 3KOOA 2HMUA 3P5BA 3R75A 2CFCA 3EBPA 4TYPA 2Q49A 2OV3A 4F9GA 2IIVA 3PT9A 1D2NA 3U44B 1W19A 1US8A 4PG7A 2FPLA 2DJIA 5DBEX 2ZUEA 3CE9A 2EJVA 5CVDA 3EIQA 4RIHA 1TVEA 1CJUC 1DC3A 2VN8A 3NC1C 4IZHA 2QDXA 5L3RA 2IS2A 2UUPA 5DHSA 3TEMA 2P40A 1WN7A 3I09A 3LBHA 2HC9A 2GILA 4MQ6A 2PMKA 5FUMA 7REQA 3VBCA 3K9GA 1FRFS 5D5QA 2F48A 5DWDA 1BW9B 3WGHA 3ZR4B 1ISGA 3QHDA 1M6HA 2EL9A 4JITA 2AMJA 3PN1A 3LUFA 4W5TA 5COBA 4GBED 1PJSA 2QJOA 3AR7A 2XDQA 5IZCC 5CBFA 2FE4A 4ZOLB 1V47A 2EOAA 1LGYA 1OCRC 3AIMA 3CR8A 3TKAA 4B6FA 2O2XA 4BZQA 4DPLA 4R2HA 5DM4A 1JR6A 2DY1A 1ZA2A 4HNHA 5EE3A 2FPRA 4ARZA 1YZNA 2FQQA 1KZ9A 3ZDXB 5DKFA 1TEZA 1Q5OA 5BNIA 1WNFA 3L8MA 3D4PA 4OU5A 2AOUA 4AP9A 2QJFA 2RHBA 1D8TA 3INNA 1TMGE 4HGNA 1E2GA 2AB0A 4M1ZA 2QNBA 4NBWA 3MBMA 4FSXA 3L46A 4GD3Q 1KUQA 4CLOB 1DKUA 3Q3EA 3IUEA 3EOAI 2WFAA 4IEFB 4C03A 2DF8A 5AKGA 4RFSB 4IGIA 2VJBA 4EJFA 4PZ0A 1OGYA 2Y67A 4Z4QA 1NQOA 4KOAA 5LQJA 3UJ3X 2R8YA 2JGAA 1EFPB 1R9NA 3K5MA 3JQEA 2I1WA 3W5BA 3DOOA 2IAFA 4RFSA 2XA2A 3Q8XB 1GO0A 3E2MA 3PUHA 4MUJA 1ZDMA 4PYQA 2K2WA 3PIDA 3RHSA 3QLUC 4PGGA 1ZM4A 3E7PA 2GHTA 4D3YA 3K8OE 5JDCC 2UYJA 5K1PA 4CMEA 2I8LA 1J2YA 4K86A 3Q9UA 4DJFC 2D6FA 3HS3A 4JVLA 2DFLA 16PKA 1Z0ZA 2WWGA 3CX5F 3EQZA 4NXNB 4A91A 4EKWA 2FQYA 3R6DA 2BMDA 4H1HA 4J0FA 4QOSA 1KC8W 1NPDA 3E4DA 4XCVA 4ZMRA 5KWJA 5CYGA 1GFIA 1BQ4A 2I2WA 4IGAA 5THQA 4JV5O 3QPUA 3OQJA 1DCTA 3EPRA 4FNGA 3ROMA 4PCVA 3IP1A 2OA0A 1I7SB 2X9LA 3L82B 2QLNA 3W8DA 5JZ9A 4FFVA 3JXEA 3ROGA 2I55A 1ZJJA 3ZVLA 1RP3B 1XHOA 3ABOB 4XUDA 4X8HA 4OOFA 5JVDF 3VIUA 2EJWA 1Z0FA 3IR7A 3ZK8A 1Z82A 1OZ0A 1TYZA 4Y2VA 4CQJA 4GM4A 3ZHXA 4I1VA 2EKZA 2I2XB 1I7LA 1H3NA 1O9BA 4ZJYA 2CDYA 2BSAA 1GO3F 1R18A 2B92A 2BDEA 2QOEA 1NBIA 1QRRA 1E4EA 2AQHA 3K09A 2FK8A 4AZWA 2OBFA 3AG4B 4BN4A 3VTZA 1GG2A 3EEQA 1NZFA 1LK7A 3E2PA 4MRPA 4BX0A 4JB0A 3I76A 2OZLB 1JLMA 5FJIA 5FAXA 3WK7A 4C0AC 3H04A 2AD1A 1LY1A