4ZOLB

Crystal structure of tubulin-stathmin-ttl-tubulysin m complex
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 177
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zolB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zolB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zolB01
2VAMA 4X20B 4TV8A 4I4TA 2RHOA 5IJ0A 5LXTA 2R751 3WGKA 4O4LB 4I55A 4O2BB 3HKDA 5BMVA 5JQGB 3N2GA 4WBNA 4TUYB 5CA1B 1TUBB 5LP6A 3HKEA 4O4IB 3WGNA 3E22B 3VOAA 3ZBPA 3RYIA 4F6RA 4E6EA 4TV9A 2RHLA 3JARA 4TV8B 4I4TB 5IYZB 4I50A 5IJ0B 4U3JA 5LXTB 4B46A 4IHJB 4X1YA 4XCQA 2Q1YA 2R6R1 3HKDB 4IIJA 4YJ2A 3ZBQA 5BMVB 3N2GB 4WBNB 3HKEB 5C8YA 5CA0A 3RYHA 3RYIB 5EIBC 5LP6C 4F6RB 3R4VA 4M8IA 4LNUA 4YJ3A 4EB6A 3JAKA 4I50B 3VO8A 4O4JA 1TVKB 4U3JB 1W581 4X1YB 4EI8A 3HKCA 4YJ2B 4IIJB 1W5AA 1RLUA 1W59A 3JAWA 5C8YB 5CA0B 1W5EA 5JVDA 4LNUB 3VPAA 4FFBA 2BTQA 4EB6B 3JAKB 3JASA 4O4JB 3HKBA 3HKCB 5JCOC 4EI9A 5ITZA 3JALA 3JAWB 4I55B 3RYFA 5FNVA 5J2UA 5LP6B 5J2TA 5KX5A 5JVDB 4FFBB 4X1IA 2BTQB 4B45A 4KWEA 3JASB 5CB4A 4TV9B 3HKBB 1FFXA 3JARB 5LOVA 5EIBD 4DXDA 5JCOA 1Z5VA 5EYPA 5ITZB 5KMGA 3JALB 5IJ9A 3RYFB 2VAPA 4ZHQA 5FNVB 3M8KA 3V3TA 5J2UB 5J2TB 2RHHA 3RB8A 5KX5B 3RYCA 4O4HA 2Q1XA 4X1IB 3RYHB 5LYJA 3ZIDA 1JFFA 1RQ7A 5JH7A 2BTOA 3JATA 5CB4B 5LOVB 1FFXB 4YJ3B 2XKBA 1OFUA 5EYPB 4X20A 5KMGB 1RQ2A 5LA6A 5IJ9B 4ZHQB 4EI7A 4DRXA 3WGLA 4O4LA 3RYCB 4O2BA 4O4HB 1W5FA 5M7EA 2GVIA 5EZYA 4ZI7A 1FSZA 1TUBA 5LYJB 5MN5A 1JFFB 5JH7B 3WGJA 3JATB 3VOBA 3UT5A 3M89A 2RHJA 5IYZA 5LA6B 5MN6A 4IHJA 4DRXB 2VAWA 4ZOLA 2VXYA 1Z5WA 5GONA 3N2KA 5EZYB 4X1KA 4ZI7B 4O2AA 4HNAA 4U39A 3UT5B 3WGMA 3VO9A 1SA0A 3C8LA 1TVKA 5MN4A 4ZOLB 1W5BA 5GONB 3N2KB 3CB2A 4X1KB 4O2AB 4HNAB 5JQGA 5CA1A 4TUYA 2XKAA 4O4IA 3E22A 1SA0B
chains in the Genus database with same CATH superfamily
2Z5LA 4MZXA 3KT0A 1ZL2A 2LRHA 2L26A 2VHYA 4KKVA 1H2BA 2WMDA 4PGGA 2Y2UA 5C5DA 3QXCA 3RSCA 3PFKA 1Z4QA 4EFNA 5C7IO 3M2PA 2HIAA 4ZMSA 2RGNC 3K5IA 4GW3A 3NRCA 5HYVA 2JAQA 1KH3A 4QHSA 3O4JA 3GRUA 3SC2A 3ML0A 3PQ2A 5GWXA 3ELUA 2AE2A 3L4BA 3K09A 3GGJA 5EJ5A 1UK6A 3HC7A 3RW0A 2K7ZA 4HEJA 1C30A 1QLEB 3GFFA 1TEXA 3ZCQA 1SU8A 3MHTA 1NF3A 4TKVB 4DMFA 3VPXA 1TIKA 2X6AA 2AI1A 2J3DA 2UXBO 1LBEA 4NTZA 4YO8A 3C3SA 2C0CA 3KLPX 4YPFA 5BW5A 2I29A 4BN0A 3UFBA 1AHHA 3O8CA 3KAJA 3O3NB 2PQ6A 3GXOA 1DKQA 4QC2A 1H2RS 4UUQA 1EFDN 3R4VA 3IKJA 1GG2A 1YKFA 1TYBE 2W0MA 1RLUA 1F0PA 4N7MA 5CFQA 4NS1A 3X43A 2NSHA 4M1OA 1I0HA 3T7SA 4TRRA 3MZ0A 3TN7A 1XNGA 3TAHA 4X54A 1FQWA 4JI7B 1GT6A 4MP3A 4EPWA 2FN8A 5FI3A 1PBNA 3OO0A 5FLYA 4PPNA 2QJ1A 1HDJA 4QJ4A 2GTIA 2EZ4A 4DM4A 5JAOA 2RJZA 3S2EA 3CCRV 5LBTA 4Y9UA 4US0R 4Q4AB 2CL5A 1QYWA 2JIOA 4QDJA 3GBPA 4KPGA 5B1SA 3NUGA 1HZJA 4HD8A 1Z38A 4D0GA 4D7SA 4GNKA 2V7GA 3UJBA 3EZLA 4KAAA 3TQTA 2EJ7A 4LY6A 2XDQB 4YY3B 1Y1LA 4MR7A 2HS0A 4ESHA 2QMUA 4INZA 2A2ZA 3EEIA 4FFWA 1TZBA 4C6HA 5B2FA 1VLMA 3LAWA 2JK0A 4L9AA 2W42A 2WKSA 1XV5A 3BJIC 1YRBA 4WFKA 1GTJ1 7REQB 1LI7A 3K9BA 3O1JC 5BNIA 1L5VA 2QTAA 2JI7A 1VHWA 3SFVA 2O23A 1KAOA 1W4ZA 4AZSA 2VDQB 3ESXA 2GEJA 4KG7A 4N01A 4C5AA 1R8XA 4POOA 3E3OA 2OOKA 4E4TA 1SK9A 5KOIA 2C2AA 1Q7CA 1RWBA 5TISZ 4FZ3A 4G0PA 4Y2QA 1WB9A 1K8RA 4YUZA 4XIJA 4AMZA 1BOFA 5G53C 3TJZA 1MX1A 3BJMA 2O0HA 3SDBA 4J1NA 1G17A 4TRMA 4M0DA 3HXLA 1P60A 3I04A 1XQ1A 4X8MA 3MSCA 3QU9A 1FUUA 2YRXA 3UUEA 1UBHS 1IMJA 2CNWA 2HPAA 2QRLA 2ZIMA 2YHAA 3QWBA 2Q8QA 4MS4A 5BWNA 1EMDA 5LDDC 5EBMC 2QL6A 2WW8A 1GH6A 2EZUA 5BWOA 4XRRA 5EO3A 2FUNB 4K86A 3E2IA 3KUXA 1Z16A 2QPTA 4J7UA 1G7TA 4D98A 4IJMA 1JIQA 3FNBA 5JVDB 4I6GA 2JF0A 3I37X 1LRKA 3BK1A 4EEXA 3P5BA 1E6UA 3EEFA 1ND5A 3VSEA 2HGZA 3LKVA 2QHXA 5HF5A 1VE1A 5BWMA 3ZIAG 4WD3A 3ML1A 4AZTA 4OK3A 3HTNA 1M1NB 2BI7A 3S70A 3RRFA 1DEXA 3EFHA 1XV2A 3LZCA 2CDYA 4YHHO 2WG1A 3EHEA 1IYZA 1CJKC 3BWEA 3ZXUB 4EFBA 2WIFA 1FLVA 3U60B 2QX8A 4AC9A 3IOCA 5THKA 2W6MA 4N7JA 3E53A 4H4DA 1Q12A 2UDPA 4UVDA 1GL7A 3SJ7A 2BDEA 3OT1B 1GQ2A 2YV4A 4PZAA 3R7WA 1ZM3A 3EIFA 1L4HA 3LY9A 1AKMA 4CBCA 2BGKA 3DKRA 1EWRA 3F6RA 4P4TA 1CUCA 4FK5C 2CWDA 3UEOA 2CNWD 1JEJA 3N74A 2Q0QA 1G4AE 2ZJFA 3Q10A 4YASA 1H5NA 1IJEA 3A2KA 1H6AA 4X93A 1G7RA 3BWDD 4QJ3A 1JQEA 1UWLA 5KX5F 4LJSA 3SM9A 2G4LA 3JQGA 5B1DA 3KFXA 1VBKA 2WIKA 5BNWA 3MLBA 1XFAA 3DKVA 1H2MA 2FZWA 2GZ1A 4QECA 1KQ3A 4TMVA 4YJKA 3TBKA 1P2TA 2B82A 2XUHA 1OT3A 1RM0A 3ZLUA 4Q1VA 1QHNA 521PA 2Q3EA 4JYMA 4ZAFA 4C43A 1JJ2F 2B4KA 4Z53A 4AT1A 1SZQA 3A6PC 1QCEA 1ZU5A 2IEGA 3TIFA 4F3RA 3LJKA 2O8DA 3CBQA 3GDWA 9MHTA 3RSQA 2FSVC 4MV8A 1XVTA 1Q5OA 5DEIA 3EGXA 5ERXA 4Q3KA 1E8MA 4PELA 4PEVA 4NCJA 3F7VC 5HJ2A 3UJ3X 1UP7A 4CS3A 2JL1A 4QPJC 4TWKA 2XAJA 4K6HA 1VBMA 5B58T 4H7FA 3E05A 2CTPA 1MQ9A 4HNHA 1GFIA 4K0KO 3RUDA 3K32A 1YB2A 3K2QA 5EG5A 3G2HA 1X7WA 2CWWA 2H0AA 1Q57A 4CLEA 2WLMA 4RZIA 2BP7B 4K6KA 4ABTA 2B30A 4CTMA 3LBNA 3B8HA 1HK7A 4B71A 2CZQA 2V1DA 3AF2A 5CDHA 3PHBE 1PJ3A 3C8LA 1V1MA 1BL8A 5JLJA 3RG2A 3CZ5A 3TPFA 4FU0A 1CF9A 3BY6A 4R4JA 3WTBA 3B6NA 4CGYA 4II2A 1XMOO 3DM5A 2R751 4C7VA 4YRFA 4D3YA 4H3HB 5E9WA 3LVRE 2WLKA 1ZGZA 1RVDA 2P4QA 3RJMA 1YUMA 2NPIA 3KOXA 1N6HA 4BFXA 4LYDA 3UF0A 1IHOA 3WIDA 2C7RA 4FDUA 4O08A 4H0LB 4RF5A 2YWEA 4ESEA 2WJ4A 3ETJA 3ANLA 3CRCA 2FHSA 1BYUA 5ALJA 4HPXB 4NZZA 1KDRA 1KIMA 3VJRA 1YQWA 1NPTO 1MDBA 3K53A 2R8ZA 4E5VA 1Q86H 1KZ1A 3TGLA 1XXLA 2FX3A 1VSTA 3FAZA 1MX9A 1N8TA 2FK8A 2FP4B 4Y7CA 3IS3A 1T3HA 2HXSA 2HDOA 3OY2A 3PVZA 1RXUA 3GJ7A 4UFPA 3WKAA 1P39A 3VU0A 2I7DA 4ZDKA 3A3KA 3S1SA 2Z1MA 1XEWX 3LSQA 3A04A 3G82C 1P18A 4MQ6A 1PZNA 3ZK8A 3VNBA 1JDVA 1K9SA 1MJFA 4JUFA 4P9PA 4EG0A 2XKKA 2E4AA 3CSXA 4OF4A 2BHNA 3HFSA 1G42A 5D1HA 4ZVRA 3W77A 4D82A 1N25A 3E1YA 3GEBA 2ZREA 4IDOA 3WZLA 1C14A 4DG5A 4CWAA 2OGSA 4ZI2A 3W8RA 3WGTA 5LUAA 2UYKA 2YYYA 4MRRA 4AJ4A 2JJYA 3W78A 4PAOA 2WU1A 4WKNA 2HX0A 3E9NA 4LF5O 2WLLB 4C05A 3HU2A 5HMLA 3P0ZA 1I1QB 5F5XA 4YGXB 1TJNA 4CQNA 2I87A 3I73A 1LPSA 2RG7A 1KKDA 5EJFA 1J23A 4YMLA 4N03A 2O8BB 1JXOA 3QHAA 4N12A 3GFQA 5KTYA 5D3MA 4M98A 2ZWVA 3V9PA 3PZBA 3H13A 3M1YA 4QPNA 2ZXWC 5FLXA 1H93A 3N8IA 4MW0A 4G5HA 4E15A 2A9PA 3BULA 2VK4A 1UFKA 3FI0A 4BB9A 8MHTA 2DFPA 3A1VA 4P7FA 3OC6A 3CCSF 3ZGZA 2FSVA 3CC4F 2JBAB 4ZVSA 1OYYA 4UQOA 4IGKA 1B73A 1GZVA 1IZ0A 4KQGA 3V9AA 1Z6PA 3OY7A 4JLSA 3PFFA 1Q0QA 5B1BB 2C8VA 4BT6A 1BDJA 1WCIA 2ATVA 1EVKA 3OQIB 1PL7A 5KZMB 5DNUA 5B3SC 4XVRA 4ZCTA 4QE7A 1YJ9V 1BXRB 3CO0S 3QQPA 1H65A 4ER7A 3QLUC 4UDNA 1D4AA 2BH2A 1PYDA 4X1KB 5THXA 4DM7A 3HZHA 4JYPA 1JG2A 3ND7A 1JN0A 2FEAA 3BE5A 3BBPA 3S2GA 4TV9A 2HUNA 1M0WA 4YJ2A 4C1NA 4IHAA 3ZH9B 2NW6A 1U1FA 3KOZA 5ITVA 1BMFD 3LYUA 2EWVA 1PD3A 5TXGA 2MR5A 1KJJA 1Z5PA 5KHHA 4OMDA 2P3LA 1TCBA 4OXQA 1NUAA 4J7KA 2V3VA 2C2MA 4Q7JB 4JJGA 4YMWA 2Q4RA 3PLRA 5FORA 3PNLA 1QK3A 1CJMA 4DFDA 2Q67A 2F62A 4JQSA 2H17A 3TQSA 3M6UA 1QAQA 2DU8A 4B40A 4RVOA 3U2QA 2EKPA 3IR9A 3BE4A 1P1CA 1IBCA 3SYRA 3VZCA 3BGDA 5LQJA 2OTLF 3MQ2A 3OEHG 3UJPA 1QKIA 1RIIA 4GYKA 2WUEA 2G38A 2HG5C 1SA0A 4HQRA 4D8XA 4JLUA 3DAGA 3E6AA 4ZMRA 1GTL1 4Z0PA 1DRWA 4KGVA 5A5GA 1QOQB 1I3OA 1P62B 5D84A 4OQEA 1A9PA 4HGPA 5E95A 1K75A 4QT0A 4XPIB 2K1EA 1VQ7V 4I8DA 3EG9B 3GQVA 3IR6A 4UD6A 2AFIB 3Q1LA 1PO7A 2YVQA 4F97A 1Q22A 1MZEA 3W5JA 5FBKA 2NU8B 3HP1A 2NTVA 1NVKA 4M6WB 1HO3A 1DIOB 2ZVDA 3U11A 2FC3A 4CEJA 1EXDA 5LBUA 2EATA 2YHUA 3IKTA 2E76B 4QRIA 2NO9A 4I2NA 1GAWA 4JJ7A 3UXHA 1NTRA 2IQQA 2PMEA 4GPD1 1X86B 5B1NA 4IW3B 1QZZA 2UU9B 1HYQA 1DAEA 3QPUA 2GCPA 3GLFA 3MCWA 4ECAA 2WWFA 2B0CA 5AKJA 2XDYA 1ZJ6A 1T35A 4YX9A 2X3YA 5EA2A 4XM0A 2LGQA 3ELYA 2ZNIA 3ESZA 2YIBA 1BXGB 3C97A 4MWEA 4GLJA 4TWBA 2VA8A 3ZS9A 3TRFA 1ZM7A 2PS3A 2X23A 4K1XA 2P4EA 3LQ4A 1KC8H 4TTSA 4OQQA 4ER6A 3DXFA 1RP1A 5KSYA 1MC4A 2B98A 3B4SA 2PGDA 4BMCA 1XAJA 4MPRA 3PGVA 2WSBA 3UIEA 1IU9A 3KC2A 2HMVA 2Q4OA 4MVZA 2BHRA 3N0VA 3TSWA 4I8IA 5E7MA 4JF3A 3AYZB 3K9NA 1L4LA 1M2OA 4YJ3F 1U7OA 3KDSE 4J16A 5L3EA 5LIPA 3ZWDA 1W2GA 3RGGA 4JASA 1F6BA 4DXDA 2YFKA 3GD5A 2JGUA 2VJCA 4B7AA 2HKOA 4NBNA 3ROMA 1II8A 3CC7V 1QHXA 1PJ8A 1JBQA 2G9RA 2X4LA 1CERA 2I7CA 4KMMA 3LPNA 2WJ6A 1WABA 1XCJA 3QPAA 4BMVA 3MILA 3FKSG 3MIIA 1GZ3A 2Y1EA 1WP8A 2A7XA 3GGCA 4D4HA 3OQHA 1HE8B 3MHSC 1DINA 1NLMA 3PPYA 1QYCA 4YCDA 1U1EA 3QLUA 5MGNA 4FLYA 4MYSA 4MLDA 3EAQA 2YIBD 3P9IA 3T1HO 2V0CA 1MB4A 3R8XA 1Z47A 2FPLA 3G2PA 5A0FA 2WNHA 3AKDA 4KBFA 1XG5A 1SUSA 3L8FA 4Y6RA 4C0QC 3P2EA 2FUKA 5C80A 4H60A 4LCEA 3QSGA 2C5LA 2OAQ1 2Y4OA 3TUZC 3LNCA 4D3SA 2Y1WA 5KQGA 4KUGA 4FILA 4Q12A 2ZT8A 1M2VA 3MT8A 2AT1A 2Y6UA 4IPTA 1WVIA 2QRPA 4J0EA 3S27A 4GO1A 3E7DA 2IV3A 2A94A 5K4GA 2DH5A 1WUHS 1HMYA 2GN6A 3FUCA 4G4JA 5A3RA 3D3KA 4EB3A 2DKFA 2Z8YM 3PA6A 1H8HD 2D3WA 1BOOA 1V5EA 3HY4A 4E14A 2NUAB 5E1DA 1SURA 2C92A 4FHZA 5EEGA 2JPDA 3L43A 4LZPA 4RYDA 1BYIA 1I01A 5K0SA 1ODSA 4PYKA 3CY6A 1CETA 1E3DA 4FMDB 2PYZA 1DKRA 5BQ3A 1KI1A 4AJHA 3WMWA 4Q4JB 2YEVB 4Y18A 1ZS9A 3RBVA 1ZSPA 1PJ2A 4MICA 3TXXA 3ZLTA 3ZBTA 2NG1A 5BMVF 4Z7NB 3K1YA 3RHZA 1E2GA 5AJTA 4AQ7A 2QVLA 1X7OA 1K7XB 3GMSA 3I6IA 1KFCB 2NVBA 4P33A 1J06A 1I1NA 1QGUB 3C3JA 4CDRA 1JY8A 3V8PA 2X1HA 3DZIA 4UAGA 4MR9B 1UP6A 4L6IA 5NLLA 1JG1A 1OH8A 1ENPA 1Z33A 5K3BA 3VR5D 4TLMB 2C2ZA 4DV3O 3BWBA 4MMYB 4DPLA 1EFPB 5EXDA 3F5SA 3IT0A 2CMHA 4P9NA 4WA7A 4GM4A 2J6HA 4JI5B 2OHWA 4AF8A 4LC0A 3TQIA 5GIPC 2IYRA 5CBPB 1NR7A 1AJQA 1MHTA 5JALA 1JUDA 1E3SA 1KY4A 3VMMA 4J1QA 4II7A 4ZEXA 3CHXA 1VA4A 2JGAA 1K2VN 1MB9A 1WE2A 2OKCA 4UV9A 3FPCA 1KDTA 3IVCA 4KIWA 2OPHA 4OKNA 2OYRA 3IVRA 4RFLA 3AG3B 2QORA 2QTRA 4U3FH 4DUZO 3MW8A 2WOOA 2MYNA 2B92A 3WG9A 5EP2A 1H05A 1L4KA 2AMVA 3I09A 1OLSB 3N75A 1QBKC 1Y3AA 1YCHA 2HO4A 4Z8XA 1PQ4A 2RGYA 3GVIA 3B1JA 5J4YA 2PLWA 5EPUA 5T8KC 4OQYA 4XQ9A 4YFVA 4BHTA 4EB0A 2WBLC 4R51A 1A2QA 1Q3KA 3ZXSA 4BGIA 4ND8B 1KD1W 4QFDA 5EJ2A 3CISA 3RUIA 5FAKA 4J10A 1Q95A 4FIZA 4EW3A 5BUSA 5FT9A 1L3BA 4QYIB 3H3XA 4L5BA 5ENZA 3TD9A 4J6EA 3AO0B 3OIVA 4REQA 5IAOA 4BW5A 1C7JA 2AFHA 1FRQA 1NVVR 2GARA 2OGTA 4K6FA 5M5BA 4I5DA 1OV6A 3TQCA 3QEAZ 2R6R1 4D4MA 1N5OX 4HNTA 1PD0A 2C4TA 2R8BA 4PC7A 4R41A 3LF1A 4YP6A 1CUDA 3OE7A 4GOND 2I2DA 4FHFA 1ES9A 1PTJA 4PRZA 2PZFA 3ZHBA 3TLKA 1VG0B 2CDAA 2H4HA 1E0JA 2GD2A 2XB6A 3QE2A 1KOLA 3WMFA 1B06A 2E37A 3IT3A 1VQ8F 2AF4C 3B7PA 4ILEA 1TXGA 2DOKA 1KOFA 3ZDZB 3EPKA 1F6WA 1SC3A 3RUFA 1NQAO 1N32O 1LPNA 3QF4A 2WFMA 4RXUA 5DNAA 4B7KA 3O4VA 1HRDA 1EGQA 2D1QA 3BDIA 5TF0A 1IMOA 2H1LA 1LF5A 3QKRA 3K0FA 1PLLA 1BZYA 2CNBA 1I10A 3OLXA 1CHDA 4NJEB 4ZKDA 2RQ6A 1NL3A 4R2MA 2RB4A 4CM9A 1KI8A 4C4SA 5DBIA 4N48A 1X7DA 3TOXA 3OE7D 3ZKWB 4PW0A 2HD4A 3TGWA 4R01A 2CKDA 1TLLA 1IB0A 5GP1A 1RJEA 3ZE2B 4YQZA 4ECEA 2C4MA 3SIVA 2QK4A 2ZDHA 5JPCA 3SMVA 1M1YA 3IJ5A 1YI0A 4O29A 4P98A 3DHEA 4HDAA 4JTCB 3M70A 2O2XA 4HYEA 4EFDA 4Q4DA 1PYGA 3FCXA 1WULS 3TWOA 2YMMA 3P1JA 2LVBA 4PLYA 2GEUA 4Q9DA 4F8EA 1VYVA 5JDCC 1U9CA 4RTNA 2HP0B 1CY2A 2R00C 5CIQA 3WWOA 4DC1A 3GLQA 3FYHA 1GL3A 1U7DA 4CF6A 2VSYA 3DD5A 4TTQA 1IOLA 2A0FA 4GLFA 4L8YA 2CCJA 2ZFUA 4JI4B 2A9OA 1R18A 3H11B 3AG4B 1ZH2A 4J7JA 3RYFA 1FA9A 2YVUA 4JEIA 4MLPA 3CEPB 1KQSF 5ER9A 1ULTA 4OI0A 3L6BA 5T8KA 1YRLA 1QOPB 2WTNA 1ZIOA 4E13A 2C04A 1NU1H 4MWBA 2GUWA 2XRMA 3SOPA 4Y2YA 1SZCA 2NYVA 4U2KA 1JZSA 4HDRB 4MW4A 1WVGA 1QZUA 4QU5A 2ZRQA 2LFSA 1O08A 1NJ6A 2YJNA 2PUDA 3NETA 1F4NA 1W7AA 2ZAMA 5LU9A 1JT9A 4KNWA 4UASA 3NATA 4E88A 1OCCC 4ENRA 1AI7A 3PVSA 4DLTA 4TVBA 4CM5A 4RTOA 5K2MA 3F0GA 2ZTLA 2I4TA 2OQ2A 4YUYA 2V54A 4D3DA 2ROQA 3F74A 3MAAC 2X8BA 5CAEA 4GXQA 1H23A 5BV7A 1MJHA 2QRVB 3MQFA 3S2IA 3JASB 1Q0HA 3S8MA 2YYSA 3IQFA 3D36C 5BXYA 1JAYA 2ZT6A 5IAGA 1INLA 3VI6A 1T9BA 3HVJA 3FGPA 1YDMA 4K6OA 2RGAA 3TL3A 3Q8HA 4X62O 1Y8RB 2CDNA 2ZUCA 4KL8S 1Y33E 1OROA 4A3SA 4EKNB 1KY2A 3EIXA 1H8EA 1FXHA 1AKRA 1C7IA 3KKZA 1EUYA 2X8JA 3J81A 2AMYA 4YR7A 3FW1A 1WOMA 3FMFA 2FTKE 4Z9FA 5HEKA 4EW2A 4DSTA 5LB4A 2PCLA 4Q47A 1QFJA 1WR8A 2CVHA 1UXOA 2XADA 3GLHA 1VG8A 4OGGA 1OXBB 4WZBE 1WWKA 1SUEA 1YQTA 3ZBPA 3QUBA 3DE6X 2PCJA 4E7OA 3UK6A 4RY9A 4RY8A 3G6WA 3OJCA 2VJBA 4OQDA 2QLFA 4ZEWA 1LS1A 3WYCA 1W5AA 4MVJH 2V8BA 4G4SO 4JKYA 2PY6A 3NV9A 4IUCS 3M7MX 2BFPA 3HEAA 3NZEA 1GCGA 2ZSIA 2XJ4A 3JR3A 2B9ZA 1NTMH 4OP3A 4B7ZA 3G85A 1RI3A 5CB4A 1A4IA 1PJRA 3JALB 2I3ZA 4YAGA 4BTVA 2F9FA 3FX2A 1K1EA 2W2XA 1EVZA 2C5GA 4R83A 2W2LA 3K73O 3NV7A 2R6DA 2VNAA 3EFFK 4PHCA 2HLNA 2A84A 2ONKA 4L22A 3BE6A 4LVCA 4BNLA 2YDYA 1PV4A 1JR2A 2V7TA 1GPKA 4HNAA 2AKEA 4XWYA 3NS7A 3E7XA 2OMKA 3ILHA 4MWCA 3WWCA 3TZLA 1YJCA 2ZE7A 4C2AA 1KVUA 1LLDA 1V16B 3INGA 3UO3A 1H8ED 2WPDA 3RVPA 4XDJA 1UPAA 1IWPB 3L0BA 3A2LA 1U2TA 3U7RA 2W43A 3OX4A 1R4MA 2Z6VA 1UBSB 4DSUA 4G2TA 2R00A 2DQ4A 2GSMB 3B6EA 5JBIA 1U0SY 2BSQA 1UK9A 3L8MA 3IEMA 6PFKA 5EIFA 3EJWA 3MTBA 2I55A 5FBLB 1YVWA 2D2VA 4WPGA 1ENYA 1A04A 2GZMA 1E8NA 3EVDA 4ER3A 4MGZR 2HNAA 4KDRA 2GWRA 2HJGA 2DWPA 4I1YA 5LP1A 3D6HA 4UJ3A 3FTQA 2JLSA 2QWXA 1YZQA 5IBPA 1UOOA 4G23A 1T2AA 1X1BA 3LPMA 5IDWA 3IAS1 4EFMA 3SFZA 3P9NA 2QD2A 2FU5C 2RDMA 5E0OA 2W2LD 4LMBA 1NUHA 3OFNA 1T10A 2ACVA 3TTWA 3COJA 3A32A 5AOAA 1UFQA 3INTA 1B74A 1EDDA 1VKHA 2XMCA 2ZSBA 2H5EA 1VJ1A 2QKCA 2NV0A 3UPUA 5BSEA 2GD6A 4RDIA 5HZGA 2AZDA 2MW2B 1OTXA 4MJXA 3L84A 4CMCA 1Y37A 3UUGA 3K16A 3SF0A 2ZJ8A 2WAXA 4UEOA 1ADCA 4KLAA 4MVQA 2GXQA 4EGFA 4J91A 4L5AA 1VL0A 1PJTA 2GSDA 3PITA 3KCQA 5GQSA 1XN1A 2Y9MB 5ESRA 2H2DA 5C8DA 1DF5A 1KEPA 1CDDA 3U44B 1VE9A 5BSWA 1RZ3A 3LWRC 2W2KA 1XMVA 2H07A 5IJ9B 3NDPA 1YI2V 4IV0A 5HGJA 2YMPA 4ALKA 4HR7A 3QMMA 2Q7EA 1KS9A 4K9QA 4PCUA 3KEQA 2A1UA 3VHQA 3PEEA 3IBYA 3CIFA 4N0QA 3WB9A 2G4VA 3H4VA 4LCBA 3L6OO 1C3VA 3L2OB 3F8SA 3PDIA 2EBUA 4KQCA 5I01A 3B9BA 2AGAA 3IAHA 1DB3A 4JIMA 4ZZ0A 4N49A 1V8ZA 1V7PC 3P9XA 4WKGA 2I66A 1NQXA 4ID3A 1K3FA 4JJFA 2F9LA 3HZOA 1TA4A 1LTQA 2P41A 3GAAA 3CEJA 3JQ9C 3V00A 5TGDA 4LWZA 2SBTA 2FETA 5JCZA 4HZGA 2HZ7A 3LWNA 4C0WA 3IQHX 2IXEA 3FFAA 3O75A 1GG5A 4LDRA 1YQEA 4MKGA 3ZD7A 4JV5O 4Q1CA 3VDMA 4QQFA 3X2QC 1IDN1 4V0QA 3GEEA 3PGKA 2W4IA 2DUWA 2PUHA 5JXGA 1M2JA 4X9QA 1X7YB 2BMAA 1YQGA 1II9A 5CLHA 2WF7A 4IKOA 3ZHZA 1SCIA 4CKBB 4M46A 2Y3IA 1IZ8A 3KT6A 1D6SA 4YT2A 5LL6P 1MABG 5KAIZ 2B94A 1U2SA 4QDTA 3DCYA 5PGMA 1NH2D 1RRVA 5K51A 1RPAA 1RJDA 4PSCA 2P77A 1KI9A 3UO8B 2UAGA 4JI0B 4DDVA 4U3JA 3QFHA 2BKLA 1HEUA 2HRBA 5JWPA 3KUDA 2HEPA 2KSDA 2AZXA 5TQJA 1OCZB 2J0VA 3UMFA 5AHXA 4D26A 3O0DA 1N6RA 3SE7A 3FBTA 2JLZA 2X0DA 3NOVA 4M9CA 4KW7A 3TGPA 1CQZA 4WUVA 2YRWA 1C1DA 4XQGA 2JD0A 2VSXA 4IDFA 4NOJA 4INPA 4PGAA 1LV8A 4DB2A 4XFJA 4P53A 3QELA 1N2CE 2EFDB 2WJJA 1SELA 1L7BA 2VNHA 1OIVA 6NULA 3T2MA 5K8TA 4DR4O 4KFRA 3TIVA 4ZK2A 3D8UA 3H5RA 3WLLA 2XXAB 2B1RA 4QDOA 2NADA 3GLGA 3A0HZ 2ZBQA 3GJ6A 4LQDA 1DO0A 3AJEA 3K8YA 4E2FA 5EAIA 3NVAA 4BAGA 1RAAA 1Y63A 1TPZA 2R4TA 1U5BB 4EYKA 1JE0A 2CNDA 4L5IA 3EXIB 2MCFA 3P3PA 1XVAA 4ZXFA 1FDUA 3LECA 4RPGA 4RIIA 3R5FA 1QYVA 3LRXA 3IAAA 1VQLV 1QQ5A 4ER5A 2X14A 2C5FA 4RQEA 2P68A 4OQ4A 4BEBA 1N33B 5FOTA 2KBEA 10MHA 4D9EA 2RHGB 2R5WA 3AZOA 4X7RA 3UHOA 3FLBA 4KXFB 4DV5O 3SICE 4TKZA 4AI8A 4LXUA 4BFTA 4FSDA 3EGOA 3CMAV 1LBHA 1QM5A 1XZBA 3WGMA 1QBGA 3M5PA 1AK2A 3DR5A 5JQGA 3PXUA 3EDYA 4QSHA 2IUTA 3ZVNA 4TLCA 2BVNA 2R6CA 1MJGA 3K2EA 1E0SA 2RBGA 2DH6A 3CCMV 2QRJA 3R0JA 4YAIA 5IYZB 4R5HA 3KL2A 4LK3A 3TLGA 2HV8A 3R8CA 3RU3A 4QTXA 3MXTA 3MJCA 2AVNA 4XAQA 3FX7A 1K4CC 2GNOA 4KO2S 2RGWA 4WZAE 1W5EA 5LMUB 5CITA 2SHKA 4DJ5X 1OYOA 1PS9A 4BO2A 3HCNA 4ADSG 1XEAA 4MCHA 5HVNA 4PXYA 1QQAA 2C9YA 4HBZA 4NCKA 2ZOSA 1RWNA 3O21A 5JD6A 3G02A 2Q7XA 3D1VA 3E1SA 5CJPA 821PA 1E92A 4BT5A 1E1QA 3H16A 4X3MA 1IN1A 1H0RA 4BGUA 3U4HA 1O4VA 1ZD1A 3G9UA 3TYXA 3UHAA 3PJDA 3Q6IA 1K6XA 3QYPA 1RD4A 1T0HB 1WCYA 1IEWA 4F5DA 2XQJA 2PBFA 2C7PA 1C4OA 5SV2A 2WILA 4PLCA 3LUDA 4EPTA 1PR6A 2J9XB 3U0OA 4BCBA 4PWZA 4P4UA 1S3SA 2ZBDA 4XVCA 3EB9A 1JAXA 3TBHA 2J0UB 2NQTA 2CLHB 1M7BA 3R8FA 1O6BA 5B4VA 5H4HA 4H3VA 2W6ZA 3HKBA 4BO3A 5EBLC 3BS4A 3KUUA 3LT2A 5EN4A 3HB4X 3WGUA 1DXYA 2ZYIA 4FBGA 3MGAA 5COBA 2NXJA 3V3TA 2HOQA 4GF5A 1JLRA 4KQEA 1VSUA 2WAAA 3RSZA 3RF7A 2UYGA 1R1MA 4AQDA 1CE8B 2JS5A 4RO2A 2G72A 1U2PA 1VYUA 5E79Z 1SAYA 2YYZA 2IIQA 2VJAA 5HJ7A 4TYNA 2JS3A 4U1RA 2QE7D 5T5QA 3SM3A 1E1QD 4KE8A 1Z68A 4DWWA 1PJBA 1XF1A 1W96A 4M9UA 5CDSA 4AP9A 1FX1A 4W1PA 1BWSA 2GBGA 2X9QA 4PA3A 3PD1A 4Q3CA 2GTPA 3DVQX 5BR1A 4UTOA 1WQ1R 4WX2B 4YDSA 3O7MA 5EXEA 4OFWA 1C0LA 4K9LA 2RCYA 4ZPXA 1QH0A 4BEWA 4ZFNA 4MQEA 4GC5A 1M7GA 2OOSA 1EUCA 3AI2A 2ZUDA 2BE7A 5G4KA 2F17A 2IYTA 3E18A 1I3MA 3KJNA 2FMHA 1LFAA 1D2CA 2ONZA 4J7AA 1TQ4A 4MV4A 1ODJA 2RCNA 1XL0A 1XQWA 4PSKA 1NW5A 1Q0RA 1F0NA 3PJRA 2KBFA 5DU2A 1E9SA 3S5UA 5EE5B 5CBFA 2VP6A 1YGYA 5HFNA 3OFKA 5J9PC 5AXAA 2QSUA 2HDWA 2QWNB 3RHTA 2YXZA 2DYRB 4ZVMA 5ANRB 3A8TA 3CZ4A 1KMIY 2X6RA 3VFDA 3L02A 5CA1B 1A77A 1GYQA 3D8RA 3AHFA 3OEYA 3ISJA 4C0BA 3B7GA 3HKEB 4G27B 1GG8A 4PQEA 4OHYA 2A9QA 3PTZA 4ZRMA 1ITZA 1UMDB 3SJBC 3EEOA 2H52A 2OUIA 3CX5F 3OMAB 2DT5A 2CN1A 2QWOB 2LWIA 2Q0SA 1N2ZA 4NCNA 3ZOPA 4Z4IA 1ZNYA 3LKZA 1MSDA 3TOZA 1KKLA 3ES9A 3D54D 3TLMA 2FQ1A 3LQQA 1SC5B 1L5GB 5CW2A 2QN9A 3LHFA 3BMCB 1HDGO 4W7IA 2KB0A 5FOWA 1XEXB 5AI4A 2CTQA 4XJXA 3VU9B 2F3QA 3DLBA 4OA5A 3ZGNA 2PSSA 1W8IA 2D0DA 1ORTA 1UJNA 2WJVA 4DLVA 1Y7PA 3STXA 1ZVJA 5C35A 4UVIA 3FUWA 2GSWA 4FYJA 5JFOA 4HOYA 1HQCA 3AHGA 5KYUB 4MKHA 3M4JA 1YDXA 2Q27A 2FUG6 2DFDA 4O1HA 5JT1A 2X0IA 2YWFA 4HS4A 2HB6A 2FZKA 3M1IA 3ABKC 3KEMA 2XMQA 3RRZA 4ZREA 3IBCA 2CSLA 5ALWA 3V6LA 1NF8A 2XE7A 2D7CA 2CZGA 2ZUFA 4B3TO 1GA1A 1IOWA 1NNUA 3P7MA 3KSRA 4GMKA 2FXVA 3GZTB 1U28A 2IEBA 3COPA 4BKQA 2C1XA 4FSXA 2VRBA 3L5OA 4L8FA 4HGNA 4V1CB 3OCZA 3QW4B 1Y4DE 4K9MA 2PU5A 2XWPA 1W42A 1M33A 2N0SA 1S5PA 4QIWF 2HFEC 3SZUA 2GCOB 5K0TA 1EUDB 2QRZA 1K8XB 4IILA 4Q00A 3PC6A 3AUSA 3NYQA 1IB6A 2H4ZA 3OPNA 1BXKA 1RAGA 2VP9A 2AUMA 4QE9A 3R3WA 2A0YA 4OJKA 5DHUA 4D0NA 1QR2A 5I48A 1NBMA 2F93B 3V1MA 1T5IA 1MZFA 5I9SA 3X44A 3UMSA 4XKJA 4C6TA 3Q8MA 3FHJA 3T1YO 3FIJA 2Z1TA 2JNWA 3D59A 3Q9NA 3MWDB 4FOPA 5HMMA 5DN6G 3NR2A 4I0WB 4B09A 1XDSA 3WTCA 2GZHA 3LY5A 5BNZA 3AY0A 5KUKA 5E2IA 2Z2JA 4WBNB 2Q6AA 2VNKA 4RWUA 2RGNA 2ZIZA 2DFKB 3V8QA 2JAWA 4TZZA 1TQDA 1FJXA 5I8PA 3THRA 5JTTA 2G5PA 2H2HA 3KHNA 3SSOA 1V3VA 3N07A 1X1QA 2CNOA 1FXUA 2WG0A 1AO3A 2V96A 4TMFA 4WK2B 2Q4PA 3AESB 1U6JA 4IUDS 1E3IA 1ZRSA 1VIDA 3AVXA 3OCYA 4AN0A 3ZGOA 1U0EA 1N7IA 1MQSA 1GQYA 3ELDA 2Z1EA 2AN1A 1EFVB 5IY5B 2C57A 1N3LA 1USUA 2H11A 3AJ8A 4EM6A 1BDHA 3NCTA 1JQLB 2JJ2D 4Q1BA 4UNIA 3EDOA 3LF2A 1POXA 4MB0A 1OXMA 2RGXA 5AVYA 1NBMD 2GGSA 4GICA 5JPIA 2NMUA 4I7EA 4G0VA 3PDUA 5ADUS 3BCRA 1SUAA 3OKCA 5DGXA 5JMTA 2Z2XA 2MK3A 4NFHA 5C5CA 5JBQA 4U7TB 3QU7A 3LZ6A 3VH2A 3BZWA 3CRMA 5D86A 3TVDA 4ARBA 3B2QA 3HJNA 4BVFA 1KYOF 1I4LD 3QW2A 4IOKA 4J9UE 1WNSA 3CCUF 3H6HA 2YTZA 2EIMB 3SJBA 4UCTA 4OX9B 3NT4A 5IFKA 2D5LA 4AK9A 3KZIZ 1H1LB 1YOVB 1QONA 3OGCC 2AJBA 2Z0MA 5CIWA 1FQOA 4RTPA 4ZT6A 1E5QA 3R3VA 4ZVUA 2J3EA 4CMJA 4FVTA 5LYJB 3BQ9A 8GPBA 4DR7B 4BASA 2O3UA 2MSCB 1T2DA 4PG8A 3L1HA 5F2VO 1GZ7A 3ROPA 1Z82A 1I0ZA 3NKVA 2K6GA 1RAHA 3KZOA 3UHJA 1Z39A 3IH5A 3SK0A 3QI7A 4U7PB 3WRVA 3WLSA 4CKCB 1W4CA 2F4VO 2HV9A 4MA4A 5EXSA 3TO5A 4EG4A 4HQLA 1GPJA 1E79G 1YHQV 3OOJA 4UXHA 2QDOA 1CUBA 2C9OA 2LQTA 2FPMA 1R16A 1O6FA 4TM7A 4XJTA 2CHSA 1SQ0A 4YRGA 2HXGA 1NW8A 1XZQA 2OK8A 2IV7A 3O4HA 4C21A 4N0DA 3LDAA 5JAIA 1E61A 4C1BA 4ZEOA 3STHA 1FDTA 1FU8A 1SXJC 1PFYA 3C6ZA 1H85A 4N0PA 2XGSA 4DMGA 1TADA 1HQKA 2EP7A 1OFUA 2A0XA 5LOVF 3S55A 1QTIA 4IYIA 5A4FS 5TF4A 2BHTA 4EFKA 3I2IA 5JC8A 3EVZA 1PQYA 1F17A 2PL9A 5FUMA 4TTAA 4C8EA 2VBIA 4LXYA 1JEQB 4KHZA 1J2TA 1MGPA 4PLTA 2IH2A 3WRXC 4P0QB 5KDOA 3SF8B 4BMZA 1XF9A 5CP8A 3T1VA 3E3NA 5FPQA 5FDFA 3ETEA 4V0OA 1CUWA 4G1FA 1ZICA 2XE6A 4PN3A 4JTAB 4MNTA 4YJFB 2QYSA 2DAPA 5B7GA 4H7IA 2PN1A 1ODCA 5D5HA 2M6SA 1EM1A 2YV5A 2FSIA 2GAAA 3P2IA 1DBRA 3NTVA 1V96A 1OJLA 2RI0A 4FCVA 1A2KC 5E9AA 3H5AA 5G0VA 4M2LA 1GA6A 3NTRA 3ZZNA 2OHIA 4M37A 2AYYA 9ATCA 3PQFA 5JS8A 1RI1A 2YUIA 3UC9A 3FPAA 3WGYA 1ZD5A 4H7EA 1W55A 1ZLYA 4H15A 1RTKA 4D97A 5KNCH 5FIUA 4LXXA 4CG3A 3TMYA 5KWEA 1H3NA 2ZULA 4ZO8A 3BG5A 3CX3A 4L0DA 1K73W 3OM1A 3V8RA 5D8DA 2WI8A 2WYOA 1L8XA 1OLUA 1S3IA 4YRBA 1Z4IA 1ZMTA 3DMNA 3PXXA 3IEPA 4EAQA 2NO4A 2XZPA 3RS0A 3MDSA 5I4CA 1MRNA 5LP6C 1TYDE 2IOYA 3ZHXA 3SX2A 4MWSA 1L7VC 1L5ZA 1Z2NX 1YSCA 3URMA 5HDQA 1IJKA 2QP3A 3ASUA 3H84A 5L3CA 2QEXV 3OEEG 3I9V1 1HE2A 5B7PA 3K8ZA 3F4KA 3OI7A 3QXSA 5JS6A 5EYPA 3TKLA 3HBFA 1C3EA 3CCJV 4Q3LA 4BV3A 5J2UF 3NM6B 4RFSA 2GX6A 4OHFA 1NX9A 1I5EA 4G0XA 2QR2A 3DAHA 2R7KA 1OXKB 2V3WA 5DBEX 2PWPA 1A98A 1N2SA 1BMFA 1KU0A 1PNKA 5L4SA 2YWDA 3OU7A 4X7MA 4LTNA 1Q90D 3O4IA 4AJKA 1VI6A 1YXBA 1T43A 2H9AA 3OPQA 1MO2A 3AR6A 4DV6B 4WNAB 1UPXA 3UGQA 3Q4GA 3T1CA 2J59A 1H9BA 2ID8A 4WZZA 4MI9A 2YN0A 1ODEA 2GCGA 4RTQA 1CULC 5JMPA 5FJ4C 4QPJA 5DPMA 1P1JA 2VNSA 3L70H 3AIOA 5CVCA 1HY3A 5IU6A 3JAKB 1SCAA 1CLUA 2AR0A 2ZT9B 3OCXA 3RS5A 4P2BA 4NBUA 3AL0C 4KXVA 2FMFA 5ALLA 3AWIA 2FKNA 4G1EB 4V0NA 4QQNA 2AR7A 1ZUQA 2D5IA 2ZYVX 2W6QA 1CR2A 3OM0A 2VHTA 3ZLJA 1YWGO 1VQOV 4HXGA 1SXJA 1KSJA 3NHRA 4ZYUA 1Z35A 2XF2A 2NO7A 1KTIA 4CQMB 3G71V 2QN3A 3SS9X 3UFXB 2HXYA 3PLNA 3CZ9A 5LVAA 4JLOA 4H2DA 3A37A 1QIDA 5GMOA 3WRXA 5I7SA 4P7BA 2BKUA 3B8EA 1ENVA 2ZTUA 3KQTA 2G82A 1RBMA 1HC7A 3X1WA 4DPKA 5IH7A 1G18A 1Y9AA 1KH2A 4CIYA 4B46A 5HY0A 1Z8FA 3DC6A 2VHCA 4JPRA 1IQUA 3ABLB 3EVCA 3JQQA 2J67A 1K3EA 1N1EA 4J3NA 3DE0X 2WDZA 1K3UB 5FP0A 2YL2A 3KJEA 4C4AA 5BN3A 2I62A 2QOEA 1J49A 4D4KA 3N6VA 4CVNA 3JX9A 5BV2P 2ZJZA 3GPLA 4BNNA 4S0ZA 3WBKA 5C7OO 1YASA 4NZPA 4LY3A 2PGGA 1CV2A 4MA5A 3L0IB 1IZ3A 3PNVA 3MTDA 4JODA 5IWAB 4DJDC 1IV4A 1VQ9F 4GFDA 1Z5WA 4CHTA 1SXJD 1VIMA 3L92A 2BFMA 4UMFA 2O5CA 4MTFA 2AD5A 3L7NA 4DNOA 2XKAA 4OL9A 2IYUA 4GIBA 3A4TA 5GJWC 2V7WA 5KYTA 4LHWA 3PQ5A 5EKTA 3TSZA 1M57C 1EWYA 4IDBA 1DG1G 4DR3B 4QXOA 1GZ6A 4X64O 2EZTA 4BKUA 4WQMA 4X0EA 2P3SA 1I7QB 2O2DA 3VNSA 4UMVA 3ROXA 3QU2A 4RTMA 4MMXB 1JTEA 2R48A 4BB0A 1MIHA 5D00A 2HUPA 3DDUA 1R6TA 5L9AA 2QL7A 2V4MA 3DJFA 2FEPA 5CD9A 3FPIA 4QTZA 1GNQA 2X9VA 3ZI4A 3D02A 5CCDA 1C3OA 2ILVA 3EMKA 2AW5A 1BRTA 2RKOA 4BS9A 1JTFA 1GN4A 1XBIA 2H59A 2CZCA 4KMOA 1M6NA 1TEZA 4HDMA 1U8FO 3TGUH 1KZYC 2BGWA 4J1TC 4EG6A 4EF6A 4JLPA 4MDYA 3JRNA 1BQZA 2IODA 1JWBB 2VDVE 1U3UA 2E2WA 4BU1A 2QT1A 1VJ5A 1X70A 3EZFA 4XH9B 3GPDG 1H8HA 4AJ9A 3WHPA 4W5RA 4O4JA 5A0VA 3CF4A 4FLVA 5CBGA 2QRUA 3GQBA 1HUQA 3VSBA 3K0HA 4M54A 4RMHA 5EHGA 5IXJA 2XT6A 4LNHA 3PLAC 2BUBA 2FEKA 1P9OA 4LTMA 1OPRA 3M49A 3PUVA 2OAEA 1Z5GA 4IDNA 1MF7A 1QQCA 5BSHA 1KI3A 3JWGA 1IXSB 4A36A 3RI3A 3ZJ4A 3HDGA 2EHDA 4W5WA 4YAUA 2PL1A 3N4ZA 4LA4A 3B3AA 4ZOBA 4TT3G 2P2NA 3JTEA 2OO5C 2CHGA 4HFRA 4B5KA 1SIUA 2A5FA 3KJZA 3DQPA 4ZYZA 1H2NA 3A14A 2W9XA 2A3QA 5E3JA 4O5AA 3ZU6A 1NMUB 3ZMVA 3WGNA 4OQLA 4AY2A 4WAUA 2OC9A 4EQ6A 4NU6A 3VR5A 3TLAA 4WLOA 1W2HA 3DCNA 1K86A 3HP4A 1GPBA 1R12A 4I50B 3HWSA 3AI1A 2JHAA 2PYJA 4IIDA 3SSAA 2WVGA 1OFIA 1YNSA 1SKVA 3LP5A 3IQXA 4AJJA 5FNVA 1M8PA 5BYKA 5K0JA 3PQ6A 1SVWA 1HWYA 3WQRA 2MSEB 3L93A 4NTXA 4FZ5A 4Y1GA 3F73A 1KAMA 1NUSA 2GFHA 4XXHA 2GMWA 1USKA 1YGPA 2Q3FA 1YZLA 4BFLA 4MGHA 3HCCA 2P3OA 3BFJA 4JYAB 1BEZA 1TK3A 2OTMA 3NBYC 4J42A 4IS2A 5GONB 1L8OA 1TO1E 3CEIA 1T0AA 4CNBA 2ZRDA 5E8RA 4CE6A 3OAAG 2GPBA 2PO7A 2CFRA 3B5IA 4J0FA 4UU0A 4HWTA 1RKXA 2VJPA 4RMGA 4KFMA 2G67A 1RAEA 4PC6A 1JL3A 2Q2NA 3O8NA 2IQ5A 3B85A 3B3JA 3SIXA 4RBNA 3CYOA 1ZSYA 2DHQA 2QUAA 5DCYA 1UJBA 2YXLA 4Q37A 1ZSNA 1VQKV 2XUDA 3D4IA 4BT2A 1YE5A 1JVNA 5B53A 2OWDA 2QBYA 2HJHA 2Y69C 4R1TA 2NXWA 4ZVTA 5DBGA 5F1PA 1OASA 4QO8A 2BAGA 4WFJA 1IONA 3MEQA 4QU9A 1ZCFA 3H1GA 1VBFA 5TEVA 1OH6A 1A5BB 2FFRA 1RKQA 4CT0A 2VUHB 5B3AA 4BTLA 3QOYA 1F2VA 2FNAA 1OH7A 4BMYA 3OJOA 2FYUH 4CLXA 5JAZA 1CVRA 3C4QA 4WY2A 3JWJA 2P30A 3OZFA 4PG5A 4TUYA 1V35A 1KEVA 3LA6A 3IDQA 4MRSA 1JQKA 1KMHA 1MN6A 2ZB8A 5ALEA 1PT8A 1UXGA 1QD9A 1BEUB 1DEHA 4JVMA 4J1TA 2ZLBA 4OA8A 1FYDA 4FD3A 3JQBC 1JLLB 2G5CA 3HKCA 2IZ1A 3QE0A 2J4FA 5TVGA 3BFKA 4RTLA 5CLIA 5HTOA 3NVMB 3PX2A 4HADA 4HZUB 2ZTHA 1LXCA 4AB1A 2H9YA 1U0NA 4Z9AA 4CM8A 4X6LA 3TTUA 1EVIA 2KW5A 4Z9XA 4L74A 3PR3A 1L7DA 4FS8A 4KCGA 2WJZB 3VOUA 4AMUA 2LNDA 1SU4A 5I5EA 4CN9A 4A27A 1X7XA 5LNK6 2XRFA 2B2CA 3HWUA 1REQB 3R7NA 1CQPA 2WM3A 2OO5A 1RIFA 1QRAA 2DUJA 4A2CA 3B1VA 1N6PA 1NW7A 3G0GA 2YC0A 4E46A 2ZGVA 4FXPA 2CHUA 3UY4A 3R1IA 2A59A 2CF5A 2R96A 3WHKA 2AF3C 2VPIA 1MT3A 2C29D 5KYYB 4QAQA 1KRXA 4AJPA 1T6YA 4C5BA 4Y98A 5HF8A 1H94A 2QTVA 3V2GA 1PUXA 3WLTA 2D3TA 1JJFA 1C2TA 2PX3A 4GZRB 2D62A 5KYXB 2C9CA 1ZR2A 1D1PA 3DPUA 1WSBA 2R1TA 2IYVA 4OB6A 5DCVA 4FZRA 4MLZA 3F1KA 3M6XA 4FFDA 2RJNA 1A5ZA 4JI8B 2HNKA 4WN3A 2EL9A 1AS2A 1T4DA 1F8YA 3AR8A 2QR4A 1WEKA 2DPXA 1ZBQA 3B2EE 1XKXA 4B3HA 2NYUA 4MVJM 5JHGB 1JXAA 3HR7A 4MGEA 3FFQA 2RH8A 4KWIA 1IBLB 3DSQA 4M1KA 3ESCA 2E4ZA 3F1LA 5COQA 1ZI6A 2HI0A 2PH1A 2XZTA 3NW9A 1LVGA 1AQLA 2Q9CA 1XZLA 4IJWA 1HOXA 4CF4A 3KX2A 3ASOB 4FTWA 2WLNA 1B6TA 4P0TA 3ABIA 4U02A 1G2PA 3MUOA 1SC1A 3EFOB 3ZG6A 4BW9A 4GP9A 5GJCA 3VR0A 5BUCA 4NBRA 1P5FA 1P73A 2FB9A 3CF6R 2PYDA 3UYLA 1JVBA 5H3LA 2FZCA 4DLSA 4L3OA 3HB1A 1BHJA 4FZ1A 1W4RA 4G28B 3BXHA 5E7JA 4FQ8A 4HFMA 3OZVA 3R74A 2PMCA 1KEZA 2L42A 2F23A 1RI5A 2F43G 3KKNA 2BSKA 4DZRA 4AO8A 3Q4HB 4A8TA 4PDLA 3E7WA 1JPNA 3OECA 2IZOA 1OU0A 1KJNA 3TNFA 3TZBA 2NVOA 5M34A 4I55A 1GRCA 3N3AC 3KXLA 3RSGA 1Q84A 4IOJA 3KT3A 3E0QA 4E21A 3HZRA 4ICIA 4NPAA 2ZATA 2YIVX 3P9YA 4UUMA 4DGSA 2LR0A 1WDMA 3L77A 1DTOA 3WGQA 1V71A 2VN8A 1L7RA 1VL8A 3I55V 2Q6VA 2Q7DA 3AEQB 2O48X 1L7EA 1UFYA 3BCSA 1VHDA 1DDOA 3W7UA 2L82A 3C8UA 1RADA 4IDEA 4CLRA 3COSA 5AMXA 5TQVA 1EM8B 4EUHA 4YAOA 4LFAB 5EC2C 4Z1MD 4IAOA 1MMMA 1Q5PA 3NNDA 4LXTA 2VQFO 1O0SA 1E2FA 3LBHA 4JCOA 1NQWA 4YECA 4I1PA 4BKPA 3W5IA 5K9ZA 4YH1A 1CQJB 4OLBA 4A1OA 5CDTA 5FLEX 4COKA 2XZDA 5CPFA 3KJJA 3CX6A 4PX9A 4ZVPA 2JCBA 3TW8A 2IRWA 1FQJA 1I3NA 1GPDG 4KIGA 2IXDA 1RLOA 3OR7C 3ZCCA 1JQJC 1ZOIA 3I58A 1KFBB 2FOXA 3PDWA 2LKCA 4BB6A 2PFGA 3RFCA 2P69A 3E5HA 3GNTA 1Y76A 4MKXA 1XQYA 3UB2A 2WWHA 1FNCA 5U4QA 1XFDA 2Q1SA 5CXQA 3JS5A 3B12A 3F6CA 3QNWA 3H5WA 1WMEA 3WMXA 5JRZA 4B6FA 5T3YA 5GTDA 4UZEA 3WGGA 3BYZA 4IDPA 3QEMA 4KEAA 1S9HA 4IQ4A 1JRLA 3JQ7A 4PINA 3N9IA 2E4VA 3EIUA 4HWSA 1UAGA 1DAOA 3PUIA 2PEYA 5JO9A 3ZXIA 1P74A 2PGAA 2PH3A 4DCGA 2CHEA 2WV9A 1YIJV 5LBQA 2O8VA 1DC7A 3LUAA 1P5ZB 3VMFB 3H5NA 3UG7A 2FYTA 5FTWA 3W8FA 1V26A 4JI6O 4X41A 4TN1A 1TU4A 3C3EA 4TV8A 1GUAA 1G6UA 2BCJQ 4HFJA 1ISPA 3QWAA 1G8KA 2HCTA 4GGMX 2BE9A 4QM6A 2AGVA 3M6FA 2CXRA 4G8JA 2XLCA 1YT5A 2PBZA 2JCYA 3O3OB 4N54A 2PI4A 3I5MA 3UAXA 1C9DB 3AG4C 3BA9A 3DVAB 3RNOA 3TSYA 4HRAA 4BJ3A 3OD5A 4EG1A 1DX9A 4ZKIA 1W93A 1NONA 1R10A 1YCGA 3FVRA 3N2IA 4RZHA 1SXPA 5F7OA 1MW8X 1RJ9B 3TSCA 5IAJA 2FZGA 4YDRA 3P9PA 4BZZA 1Y34E 2VSOA 4TTRA 1A76A 4S1VA 1ORHA 3I9MA 1K66A 5JDCA 4YXFA 2O0JA 5T6MA 3JZIA 1YE3A 5C8ZA 4E4RA 2EAUA 2RG1A 1UK8A 1Z9BA 1TVCA 5GVSA 1OU4A 1HEYA 3KWJA 1A9QA 1OI2A 1TGOA 3WL8A 2O5EA 3SN6A 1RWKA 5FQNA 3FETA 3CCVV 4LSZA 3MAJA 4P4LA 3LQFA 4AKEA 3G49A 1Y3BE 4CKWA 3QJGA 2EU8A 3CGGA 4EMTA 2YXEA 3QTCA 1XPJA 4QUHA 2WF9A 3WLOA 1JCHA 2SCUA 4X8OA 5CDUA 4KAXA 3FWYA 5ICEA 2PUWA 1RE1A 2JS7A 3LCVB 3NTOA 4Q16A 5BURA 4MUXA 4YDHB 3DZFA 3CT4A 1SUBA 2BWJA 4DXWA 5KVCA 1FP6A 4LVUA 3C41J 4EUKA 3RUPA 4R7CA 4EYOA 1LF0A 2YHIA 4E7PA 1Y4MA 4RULA 5ALNA 2CFTA 1CRQA 3KKKA 1QS0A 4TYQA 4WACA 3Q7SA 1AKQA 1GLVA 4H7PA 4QDUA 3AEKA 1K34A 1XMJA 3DPIA 3G9TA 1ZD9A 4B2LA 2IHVA 3NORA 1R50A 3D36A 2CXOA 1X92A 2FJPA 4IWYA 4FZVA 1M90H 4W63A 1ZL0A 2WD7B 1S1CA 2WMNB 5AHKA 3OOWA 5DF1A 4P30A 4ZTUB 5FFNA 3HJHA 4KWCA 5AW5A 4UCQA 5LJIA 3KSBC 4B82A 3LUPA 2R8YA 1L5HA 1RJFA 2AYXA 4LR3A 1SKYE 3RVKA 3W3AH 3TXAA 4CNQA 4K9SA 5BXZA 1MVOA 2AX4A 4AY5A 3Q88A 4Q9IA 4ZQIA 1C8LA 4GRIA 3NEJA 3BMQB 1JPXA 3NHYA 1ISGA 2Y67A 3VJKA 4MS3B 5DTMA 4RHTA 2GILA 1F5NA 3U3RA 3KTAA 1QCYA 5CDFE 1UBJS 2HQRA 4BPBA 1NKTA 3REQB 3CG0A 3RIXA 3GB7C 4JC0A 3ORQA 1AGXA 1Z29A 5CXSA 3NTLA 1AGYA 1X39A 3C3YA 2B7LA 2AW3A 3VYSC 2X2EA 2W2VA 3RUEA 1J2EA 5KAMA 3UW3A 3JZMA 3JVEA 1GO1A 4D46A 1ZD4A 3UOGA 4GAEA 1Y9ZA 2W6IA 4UAUA 3IVGA 3IBSA 4B3MO 4IY1A 4QUGA 3EZYA 1WLEA 4X65B 3OTQA 1OAOC 1TF5A 3QPWA 3TR6A 3T3EA 5AICA 3HLTA 3WWEA 2QQEA 3Q1KA 1KKUA 4DW0A 2GHQA 3Q7TA 1NVPD 2X3FA 5EC8A 3NHBA 2X2OA 2GJSA 4JSYA 5LJLA 1Q15A 2FF7A 1J0BA 7MHTA 3L8HA 3LQYA 1N0UA 3J7AC 1KZHA 4WZBB 2CSXA 4U2DA 3BHPA 3SYAA 4PS1A 2JK1A 3L8DA 1CJSA 3T15A 1YDWA 2FE1A 3NUQA 3DBOB 3B48A 4IKEA 1AZSC 4HAXA 2EXXA 3MAQA 4MHTA 1ZX3A 4NZYA 3SPCA 1HT3A 4RUFA 2HA3A 4UVAA 1XXHA 3IV6A 2YIDA 3DEFA 1M0TA 3S06A 4YP5A 3KLOA 4YJ3B 1AI4A 3EXFB 3TPZA 1GSAA 3G2OA 4Z51A 4X94A 1XPRA 5LHGA 2W6ID 4WJLA 3R7FA 2HS3A 1Z36A 4ZOLA 5E0KB 3CNLA 4CETA 1YVEI 2ZAGA 3WAGA 1AVTA 1XNRB 2FZEA 2ZR8A 1CUXA 4YAFA 2D5AA 3CNNA 3UH0A 3O3MB 4RMNA 5D3ZA 2PMKA 1DCKA 4LYEA 2VO1A 3CXUA 2I6SA 4W6QA 5BR8B 2Z43A 3Q41A 2AOXA 1L8LA 5E4TA 3ASZA 1G41A 3RYHA 4YYZA 3MLEA 2W22A 4XM1A 3F5WC 3FPBA 2V0NA 1HURA 2YJ6A 3HWX1 1PU2A 3SIRA 1C0EA 1ZRHA 5HP4A 5KO2A 3F4BA 5JASA 3HRHA 1ZK1A 1EZ4A 4MYHA 2QAIA 5CVUA 2NVUA 3V4SA 3RYCA 3L9XA 1QBZA 3OZRA 2JLRA 4NEGA 4R7ZA 1HKUA 1QIKA 4P81A 2WA3A 4IGFA 5BNFA 4YWHA 2AK2A 2HLDD 3BJZA 2E4XA 3E1GA 2P2YA 4R7GA 4YROA 1PX0A 2QGZA 1JYEA 2Z0AA 4DSAA 3TB6A 1PIWA 2TYSB 5LM3A 1F9AA 4IIFA 3I9OA 2LBTA 3JQ8B 5JLAA 1SOVA 1LPBB 2VBCA 4WOBA 1IEXA 1S76D 2P40A 3CA8A 1S2DA 4S24A 3JQ9A 4FOSA 1EJ6A 2AQIA 2WC1A 3OIUA 4EDHA 1H2AS 2B4AA 1DG9A 3PS9A 1TYEB 3NWBA 3K14A 2A1TR 1W40A 1QGOA 2W2OA 3MDOA 4IIJB 2H2IA 3ZDCA 4Q24A 1F1JA 1M2KA 4F21A 1MBZA 3V4VB 4DLNA 3U1VA 4JAAA 4YLEA 1E4OA 4MS2A 1VHQA 3EWNA 3LCCA 1M1XB 1RWPA 2FMLA 2E0IA 1P9LA 4B3BA 4U7FA 2QE7A 1T8SA 2P90A 4NPHA 3ERNA 5KHAA 4CMKA 4QYXA 4Z8YA 1IC6A 2XYGA 3AK3A 1KBOA 2Z95A 3G23A 1L8AA 2GK3A 2RHBA 2XAFA 1YZGA 3AEUA 1OAOA 2YWRA 1S4QA 4B43A 1ZVMA 1RXEA 1XK7A 3ONNA 4AUKA 3T54A 2LDBA 1WV0A 4H0CA 2DTDA 2JI6A 1SKYB 3QBDA 2VF4X 4TSFG 1V0JA 3TDNA 4CL2A 5LKAA 1N6NA 4UBMA 2ZSUA 3M3PA 5G0SA 1JJAA 2GJ4A 3IUMA 1UFIA 3G8AA 2VDRB 1WAMA 1U63A 2Y48A 1QH1B 1AOXA 5KKAA 5BUQA 3BXXA 1WMSA 3B9PA 3QGMA 4KFTA 3BHNA 3GLVA 4DCSA 4BBPA 3A3PA 4RVHA 3NNNA 2I5PO 5AW0A 2Z2YA 4JT2A 3FGOA 3GFVA 2AHZA 1SC4A 3K6KA 1Z17A 1AQJA 5A1JA 1RE0A 3LK6A 1HORA 2ZUUA 4UCOA 3F6PA 1MGOA 4O2BF 1MAWA 1M8JA 5L40A 3O0TA 1VJ0A 3KYCA 4AZWA 1Q3TA 2P5SA 5CX1A 3LHIA 2X77A 1E3EA 3KYDA 5H5NA 1GMGA 4JUDX 1Y6ZA 1JU4A 3VNRA 3ZD8A 1YH3A 4U2FA 1JSCA 4L72A 3D54A 1W1UA 1DBSA 3ZW7A 5H8WA 1RWWA 4Y6PA 3KHUA 2H3OA 4LRUA 5TPWB 1VE6A 4CEIB 3U13A 1EVQA 3ZNOA 1Y7IA 3IDFA 4QNMA 1QR6A 1B15A 1HDZA 4PICA 4I7ZB 3GCXA 4MVJG 5U9CA 1Y81A 2IKQA 3MWKA 4MW5A 1XZNA 4RKEA 3H9VA 3O90A 4RH0A 2EX0A 1AROP 4BX2A 2WSIA 2P1ZA 4MVSA 2ZAYA 4Y2RA 4U00A 2DG2A 3MTGA 4BO4A 4GR5A 2ZAOA 1RQGA 1R5JA 5DHQA 1KOGA 1AXRA 1K7SN 1N2CB 3G0BA 3A1SA 3WPWA 4TXNA 3L6RA 2PSHA 2CLSA 5CXXA 5DTJA 2C61A 3VU8A 1DT9A 1KNXA 2XT9A 4F4LA 1OXTA 4MKZA 1Y3CE 3QKUA 1NV9A 3UV7A 1I3KA 3I2YX 2WKPA 4O02B 3F6MA 4FDAA 3VOSA 2WAMA 4NXNO 1L5QA 4BVRA 3GL9A 1A88A 2GJKA 1NLUA 3WLAA 5GANK 1SBZA 4MTXA 1JKIA 1T0PA 4CMBA 3NMUF 4W9NC 1BZKA 3RS4A 1XWWA 4AG5A 2AXQA 4H35A 1KP3A 4V0MA 3S1AA 2C4HA 2J5QA 4IS3A 4KMSA 4EJSB 5J2TF 1NSTA 3U4AA 2VR1A 3NDIA 1FYFA 4MZDA 4FN5A 1J07A 1N2GA 4IJKA 4IG9A 2A78A 3ZOZA 1QYRA 4R5MA 4RK4A 3CW8X 4BJ6A 2Z5FA 1ZFNA 2BGUA 3LYBA 4MAMA 3OEWA 2XQFA 4KKXB 1PQPA 2VP0A 2ZM5A 4HX2A 4Y2VA 5FWAA 1OAAA 1OFHA 4RPHA 3N8DA 3N2GA 3GIDA 1IUOA 3FVTA 3UCXA 5AM1A 4H3SA 2Q5IA 3DKPA 1P7ZA 4UEJA 4JI1O 2PMPA 4YMSA 3HKDB 3B1ZA 1E1RG 3VR4D 3EUAA 4F1JA 4LZAA 2OSBA 2HDNB 2PMFA 2WG2A 4Y2PA 1QIJA 2XA9A 4WZAB 4KL1A 2JJ2A 2AHRA 1HYBA 1K7YA 4NQ3A 4U9IS 3HUFA 1EXMA 2VLBA 5HQ3B 1R0ZA 3CMEF 1FFCA 1QLEC 1TRHA 1G5PA 2C7GA 5DOZA 4F12A 2XHZA 2FPPA 2D7JA 4V0SA 3ZOKA 3S68A 3BXEA 4IM7A 5CVJA 4U5XA 5KMGB 2P8JA 3MTJA 5K0EA 3HDYA 4A26A 5EZYA 1JG6A 2FH5B 1SIOA 4B7EA 3WIUA 1YQDA 4PQYA 4ITUA 3HXKA 1L1QA 4X61A 3WZ2A 1P5RA 4G0MA 1MJ5A 1KMCA 1XZIA 2ID7A 4MJ3A 3OU2A 4YCNA 2G80A 2Z5UA 1KYIA 3FD6A 3K9QO 1BGXT 4FMCB 1UAAA 1SKUA 2GO1A 4J7XA 1ULUA 1C29B 5EUMA 3C16C 1M5IA 1X4TA 2Q7HA 1MTZA 3N27A 1W85A 4RMJA 1IE3A 4FLZA 2HPVA 5CYFA 2JC3A 1GIAA 3ZNPA 1C9MA 3V1YA 2UYNA 3QWFA 5C52B 3OH8A 4MAAA 4OPHA 4P0PB 1ZVKA 4OHKA 3A6DA 4RJTA 3DXZA 4G36A 4JZKA 5F9FA 1RPTA 3SYNA 2GM3A 1S7GA 5JYDA 1FBNA 5ISMA 4R31A 1ULZA 2BTOA 2QV7A 1KMMA 3HUUA 1X1EA 4PHGA 1T8YA 4FJ1A 1JHXA 2ERXA 4YC7A 1QLHA 1BD3A 3PIDA 4LV8B 4Q19A 4G4VA 4BCCA 1NLYA 5AKGA 3K9SA 4FFLA 4PCVA 3QXXA 2JANA 5A03A 3C0KA 3LSYA 1R0RE 4B83A 4R9UC 3BMOB 5TARA 3EC2A 1PRYA 1OXXK 2DKOA 1GFSA 1G3IA 3ECSA 2Q50A 5KTSA 3V8VA 4CMHA 2LCAA 3UCEA 1VLQA 4JXJA 2VNIA 3FNIA 4LQ4A 3CCFA 5CB6A 1SHJA 4E2LA 2ZIEA 5EIAA 4ZGBA 3CF0A 2PO5A 2VQ6A 3JYOA 1WPBA 4KQXA 1X7ZA 5CA0B 4DXAA 2RHMA 2JA1A 1D5CA 3HU1A 4E5KA 3NVIB 1PNMA 3EAGA 3JAWB 3EZ9A 3CVYA 4RZSA 1V11A 1Q0PA 4QUKA 1F6DA 4YUAA 1F51E 3FBWA 1YC5A 2GAFA 2V6BA 3D2LA 4TLLB 1FXSA 4PIPA 2ZODA 1S8AA 3P0FA 4JFRA 1CJCA 5ER6A 3GZNA 3WO1A 2Q1TA 2ZEJA 2ZCJA 2VAWA 2Z1FA 4RZQA 2FXIA 5CTJA 3HV0A 4E22A 4DMMA 3G5MA 1DMSA 4MYTA 3SYQA 2QRGA 4HX9A 4X20B 1YNOA 4AKTA 2PUAA 4BWYA 4OSPA 1GZ5A 5JZBA 1CVIA 1SVUA 1QVZA 2RAUA 4UC0A 3V55A 1ISJA 4X66B 5G4LA 4BU0A 3BTSA 2CCGA 3JPYA 5JXJA 2RK6A 4MGIR 5J5AA 1NZ6A 1YITF 1O54A 1YJNV 1V55B 1U9IC 1MDFA 2NAFA 3DYVA 5AVMA 2G9QA 1GGKA 2E6UX 5ELXA 3Q85A 2XNDG 1M5RA 3VSDA 4IHKA 4TKVA 2NU6B 4BGDA 1RRPA 5IY5C 2QTMA 1Y80A 4MEBA 2D0OB 2OGZA 4LG1A 4RPCA 4OKIA 4B9AA 3RN4A 4BMNA 2X13A 4NXMO 4CR6A 2XX3A 3U4IA 4DARA 4ASUG 3T3MB 3VQYA 2VWPA 1AP5A 4P3KA 4RDCA 4NUTA 1ZW1A 4GEKA 4XUEA 3LO8A 3AU8A 2O1WA 1CRZA 3UQZA 5BQFA 3GUCA 1SWWA 3C5EA 2A0UA 1WUKS 5DHPA 4MV6A 2IEYA 3PKIA 4GR9A 5I9NA 3W5CA 1D6MA 5DXAA 2I3AA 4F46A 2I8CA 1S9DA 9ABPA 1G98A 1F2TB 3G5TA 1NQ3A 5JYBA 4IIXA 5F2OA 5BMOA 1DQRA 4CV2A 3OCJA 3SQWA 1XZCA 3KTOA 5AXBA 3KFVA 1JA9A 1F2DA 1OW3B 2VHEA 3WQSB 2YWGA 1NJIW 1N34B 4KPFC 2ZJ3A 1BHO1 1B41A 4Q4AA 4Z0TA 3R7LA 5EK0A 2ZB7A 3MM4A 4DCMA 4HDQB 3PFHA 4B4UA 4LXHA 4PC1A 2B9EA 3C3WA 2XTJA 1VB5A 3G5UA 4BVJA 5ILQA 3EODA 1NP3A 3IE0A 3OF2A 4E2WA 2I4NA 2W8BB 2XDQA 5JARA 2Q4BA 3BJEA 3VOAA 3ABMB 1AT1A 3TD6A 4JGBA 1ZIPA 4B3CA 4JELA 1IM8A 1TJ4A 3RBXA 4AXXA 1HGXA 3GG2A 1AV7A 5JCXA 4Y8VA 4P08A 4JUBA 3GJ4A 1ZUNB 4M0EA 4OYRA 4M86A 2GVNA 3SBOA 1K0UA 5DISB 2B37A 3VTIC 1I7LA 4WKPA 5DM60 2PA3A 3AL2A 4Z2AA 1QOZA 1RQ2A 4ARIA 3ND9A 4FGUA 2PLAA 1JTVA 1P6QA 4RDXA 4EVSA 5T7BA 3RNLA 3LLMA 4W8GA 2I7XA 1KC3A 2V9ZA 2NSLA 3MBOA 1QVAA 3W5AA 1EIWA 2WWYA 2M2IA 3LVFO 1A9RA 2IY8A 2Q6KA 4RVCA 3WK6A 4ISBA 4G37A 3S6JA 1YCFA 5F5NA 3MJVA 4ZIBA 1TF2A 2CYAA 4TL6A 2DN9A 3I9JA 1DBPA 4KXLA 4M1SA 1N0VC 1A8HA 1VB3A 2ZJ1A 5KCMA 1ZOOA 4Q18A 4WESB 4YRTA 1NVGA 4N41A 2NZWA 5I9BA 5JVDA 1KR2A 1BX3A 3RC1A 2B3DA 3M4NA 1I1HA 1X9GA 1U9IA 2FSSA 3RC7A 4B7UA 4JB0A 1R0SA 5IM5A 1OWMA 5KS2A 5JZVA 1YAJA 2N75A 1BVHA 4ITRC 1P2VA 1M1NA 1WP4A 2CGOA 4MULA 2YZGA 4YP1A 4O4HB 4F91B 1FE8A 1V9LA 2WR8A 5JY1A 1SZJG 1YFKA 4HMOA 2QIOA 2JCGA 1R0CA 1Z4MA 1VZ2A 5K0BA 3H1PA 2NN4A 3C3AA 2QDKA 2DXIA 3QPDA 3KVRA 1HT1E 1ZAYA 1PHRA 3OT1A 2IW3A 1DELA 1E64A 6GPBA 1MX3A 1SZDA 1QFSA 2JGRA 3C7CB 5GVRA 2JJ8A 3G8DA 1SUFA 2PFKA 4G4XA 1PUIA 3T3HA 1ZWZA 3AVOA 2IXAA 3SSMA 3H7AA 1BFKA 1MT0A 3UCSC 2QZSA 1O0CA 3OZWA 1PEYA 4MYCA 1IG3A 2NGRA 3BX1A 2FX5A 2VTVA 4JL8A 3FZYA 1PFUA 2FFHA 1T9KA 3KE8A 4GKBA 3LVBA 1XAGA 1E99A 1Q1NA 2UXDB 3G0OA 4HH4A 5SZKB 1E1NA 3FPHA 1WY7A 5A3JA 2F59A 4U5QA 2JCXA 3KJHA 3WLNA 3CVVA 3AM5A 4IEEA 4IMPA 3AV3A 3BGOS 2MSNA 3DL0A 4R6WA 4JLJA 2H9IA 1H48A 3TD2A 2GM4A 4IHJF 4HYOA 1Y1QA 2QQ5A 3CN9A 4RXMA 2FMIA 1N5KA 1T26A 3DEZA 4F04A 1LS6A 3EY9A 3ILSA 5LP6A 4R1UA 2H16A 1U31A 3EMVA 2RGRA 1NULA 1SKAA 5EHQA 2ZZKA 3D3WB 2HS4A 3CUTA 3D00A 3QMPA 3SXPA 3TI7A 1V39A 3HY3A 2BBWA 5H02A 5KI6A 5B1BC 4QDXA 1QO0A 2OBFA 2F1MA 1XZ8A 3PHHA 4CLHA 1G8GA 1JLSA 1HETA 1GN2A 2YW2A 3JARB 3ZWWA 2XEDA 4QEZA 3A3OA 1VPDA 3KJIA 2P4UA 2ZDIC 3RWBA 1RCUA 3GU3A 1HDIA 1R37A 2GXUA 2Y0CA 3PFWO 5A2QN 3BGIA 3EW7A 3M8AA 5A7HA 8OHMA 3GBSA 3ZS8C 1J90A 5FYQA 1E1YA 2LIPA 4O5OA 1W44A 2BKAA 1YZHA 4EEKA 3I2FA 3CJHA 5TLSA 3I7TA 4PV1B 3QKSA 1UT5A 2ZJOA 2G0AA 1EBUA 2YBEA 3R6TA 2OGUA 5COAA 2OP1A 4MQBA 5EPOA 1U9ZA 2UYHA 4PA4A 1GNTA 2BFBB 4S1NA 1ISHA 1JSRA 2OV6A 4RIGA 4TM8A 1NSFA 2QXYA 3PHCA 2RE8A 1L7NA 2B6NA 5CG2A 2JAPA 2GN1A 1ZX1A 3OBYA 2CLOB 3RABA 1CEEA 2FN4A 5BY1A 4ZO4A 1TU3A 3BC1A 2JD2A 1N0JA 1X1SA 4HDKB 3GVHA 2HMAA 3VC2A 1CLIA 1PQWA 5F51A 4DSOA 2PLFA 3E8BA 4HAIA 4IF4A 1QO0D 4UNQA 3BTUA 2C78A 5CD1A 3OF5A 3IILA 2DR2A 5IDXA 2EJBA 3STLC 4TKLA 3EXEB 5BN1A 3IP1A 1AF4A 2CZWA 2FP4A 4NAHA 4Q5IA 1GZ4A 4WKCA 3U80A 2HYDA 5L3QA 4FC6A 3KNZA 2GLUA 3PXBA 3AL3A 1YQXA 2G1AA 1DHRA 2OBLA 4BC0A 2DQ3A 4DAEA 4PSVA 2JZCA 2IDMA 3WJQA 1M72A 1U0GA 1I9CA 4JR0A 1I30A 1OC4A 3R4CA 4HNGA 1AUOA 1J9EA 3H1AA 2JVIA 3QVUA 1U99A 3P96A 5EVCA 5DM6V 2DJ5A 3TNJA 1E60A 2PLRA 4LC9A 5HGXA 4X00A 2VOJA 2HCRA 5C8YF 3FOAA 2YI8A 4C5CA 2BM0A 1Y1TA 3DDCA 5A7GA 4C4ZA 2NZ2A 4AYXA 4KQWA 1NFQA 3M5WA 4JGSA 4N5MA 3Q15C 1RS0A 1LJUA 2VLIA 2WLLA 3ED5A 4UXNA 1CF4A 3S0HA 4ZODA 2XKBA 4KWTA 5EJ8A 4ZV7A 3N2ZB 3W7VA 5KNLA 4M3NA 4JMPA 4N3AA 4A82A 1X8JA 4C06A 2CDRA 2B1IA 2Y99A 3QVXA 3ORFA 5DOVA 2YJ5A 1M1KH 1W5BA 5M3BA 1YZBA 2BCGY 3WLRA 1W49A 3SR0A 3GLSA 2BOBC 3OM8A 1RYDA 4KO3S 4TXMA 3HXTA 3E22B 1H2LA 1GNRA 3QFCA 1JHOA 4FYIA 4FGKA 1COWG 3N6XA 3OLYA 2JBAA 5CFMA 2DVMA 4QIHA 1G64A 3LZDA 3ZKAA 4B4OA 1YACA 1TVMA 5CM2Z 1NBEA 2O59A 2I1WA 4NMLA 4UVHA 4PYNA 2G70A 3A10A 1LU9A 5FOSA 1T5EA 3LPLA 4RD1A 4OHWA 3BXOA 3RTBA 2WF8A 2WP0A 4WLFA 3BYQA 2REXB 1YA8A 3OQIA 4OVKA 1E0AA 3AG2B 3S8YA 3TVYA 1BXRA 2QM8A 2PX6A 1WOYA 1RYBA 1CSEE 4X1KA 4H4EA 1R9GA 2O14A 5G1NA 1WB4A 2ADMA 2BKXA 3EE6A 4OOEA 4IV8A 1FRVA 1V4BA 4LSWA 4ZQGA 5EQJB 2JIRA 1A8PA 3WZMA 2HY7A 5CK4A 2VQSA 5C8VA 1TKAA 3WIEA 4AICA 1E1KA 3E8SA 1QIGA 4YJHB 3DD1A 2P7IA 4BX8A 1NQVA 3O8QB 1FDIA 4UBJA 2HBZA 5IC6A 4PA7A 4FKMA 2X8WA 1RQNA 1W59A 2DFVA 1T9AA 1CLEA 1Z0JA 2NXNA 3C3XA 1SB9A 3FYUB 1QHIA 1GLNA 1V3QE 3K8QA 1XCGB 2G25A 3AFMA 1HNXB 1J39A 2VAPA 1PI3A 4DIMA 3DHVA 1ORWA 2RB5A 4IMIB 3FZNA 4PFSA 3BEDA 4CMEC 3F0TA 4HB4A 3ZMTA 2PWAA 4O0LA 4CLOB 4ZHWA 3LC2O 3CQ9A 1U90A 3VPFA 3ACCA 5IASA 3A6HA 4FGSA 3IPCA 4RHUA 3IAM6 4NPCA 2IP4A 1QNMA 1H9AA 3ISVA 4FT2A 4KP7A 2JGDB 4XPIA 3KZXA 2REQB 3RR2A 3I56F 3IQEA 4BO6A 4RD2A 3EG9A 1AKYA 1AJEA 3M4YA 2AFIA 2EDAA 2KTUA 1VCOA 2FKAA 4PY2A 2NU8A 1XPOA 1G20E 4G0YA 4EQZA 3H04A 1ZI8A 4M6WA 3W6OA 3CXCF 3RIYA 5EMLA 1AZTA 1RCTE 4HS9A 2AEMA 3RSLA 2B33A 1OBFO 4HGYA 1G16A 2Z1NA 4ODIA 4G6ZA 2WICA 1AK9A 2C88A 4ZCSA 3QFTA 2ORVA 2QD1A 1Y7LA 3D4OA 1ZJ4A 4Q3AA 4V1CI 3TCXB 3EC1A 3HXQA 1UPFA 2GFIA 4Q3NA 3ZCPA 3NEYA 1DQSA 1SGWA 1DZIA 2ISSD 4JT9A 5CYOA 5ENVA 1BXGA 4FOOA 5LLTA 2VH1A 5KVVA 5JI2E 1J8MF 2NM0A 3K94A 1GARA 4DV2B 3AG3C 3IA7A 1BG6A 3AVPA 1CN7A 2J41A 2X0KA 2JAXA 1P2SA 1TUBB 1OMOA 1AUVA 1RC0A 3N8HA 4NYMR 4LX0A 5CFOA 1J1UA 3W9UA 4Z1MA 2RBKA 5AVKA 4YXWA 5FFMA 1YULA 3IC5A 1TJ3A 2EKLA 2QG6A 5K6RA 2FUEA 4UQPA 1G8YA 1PR4A 1E4VA 2AX3A 2C2XA 2FLVA 1TPYA 4D4GA 1SWVA 3HVRA 2QW8A 4RYLA 2QW1A 3VAZA 5DNCA 1M73E 3ZJ5A 1EA7A 1TFRA 2YR0A 3GMTA 2O8EA 1H47A 2UYPA 3GLRA 1QP4A 2FY8A 1ZR4A 5KX5B 3SZLA 4V0LA 2QX7A 2FW6A 5ALZA 2QTTA 2BBSA 3OD4A 4GI2A 1Y1KE 1TAGA 2ZJ5A 4B6RA 1K98A 2K7FA 4O0MA 1WX1A 3EYWA 3PPWA 4R9RA 2FRXA 3KSDO 2V6IA 2GA9A 1WZNA 3L06A 1WB8A 4FE4A 4XE5A 3UMMA 1MNAA 3HYRA 1EEHA 2RAVA 3BHJA 3JQBA 5B12A 2M9MA 3AHIA 1V8OA 3L72H 2H0QA 4MVJP 2R5FA 2ORWA 5KJ6A 1NIJA 2DWEC 4FNAA 4GWGA 3LDDA 2JI8A 3F6YA 4IINA 4DVGA 5IZCC 4LWOA 4UM5A 4NFSA 1JKMA 2Q21A 5F21A 1IZ9A 3A58B 3H2GA 4YXWD 5G2OA 4ANFA 1IPEA 2NT3A 1T1EA 5BORA 2O0MA 1ESEA 1S2LA 3N2NA 4XB2A 4URXR 1OA1A 3OWOA 2Y0EA 3WXMB 2NUAA 1YMUA 3KPWA 4HLNA 1JJOA 1U97A 5DTQA 4G4SP 4CMEA 1I94B 4FW9A 4DLPA 1U8AA 4LF7O 4H44B 2JFNA 3Q7PA 4K0RA 3A1FA 2AJTA 2QA4V 4JI3B 3RSSA 2XB4A 1DHTA 4ROTA 3CJQA 3H2JA 5ADVA 1W9HA 4DCPA 1VGQA 1RYNA 4KR2A 2YEVA 5L4NA 1Q7YW 3WKDA 4PNHA 2VJMB 3FOCA 5I9IA 1VJGA 1LPMA 2J6BA 5AK4A 4BVSA 1NLZA 4DSZA 4Z6KA 3VNVA 1S01A 3ZWQA 1NXVA 5EMJA 4B5CA 1QGUA 1AUPA 4YT5A 3ND5A 1NVBA 3U19A 1RACA 4KV9A 4MR9A 1O95C 1PTKA 2GNAA 2HRRA 2QI9F 4MVRA 1AI5A 3F7YC 2BF7A 4FYVA 4G85A 3DBLB 4GOXA 1NMZA 1EFPA 1E58A 4YAWA 3IURA 2E5LB 5K7SA 4B2PA 3K20A 3K57A 4MVMA 1C8KA 1RLGA 1CY1A 3A7EA 2XPCA 1IEQA 1JW9B 2HF7A 2IA5A 3PPIA 1NPDA 1QFZA 3RGWS 1CEZA 5A2QA 4BWVA 3AJDA 1NZJA 3SC4A 3C3KA 1UEIA 2MYUA 4ND5A 2BELA 3D6TB 2H2FA 3WB0A 2Q3HA 1V7ZA 1A1VA 3DMFA 3MRXA 1E6WA 3Q8WA 3KB2A 5BUZA 2PZGA 4J9VA 3T7TA 4E6EA 3EOBI 1RHKA 4EO7A 3ZZTA 3VSCA 1ML4A 4DB4A 3H1FA 1X15A 1TUIA 3DOIA 1L5LA 1NA5A 2OCHA 2EEZA 4W5OA 1JA0A 3GYQA 1L9KA 3QENA 5AW1A 2POCA 3EFEA 3LWZA 3FYSA 4F4FA 1G20B 3WKCA 3M3HA 3A31A 4CFZA 2AN5A 4ACBA 1PN3A 1J09A 3ABQB 3T4PA 1RKVA 1KVRA 2RGUA 3OTOO 5JNUA 1MU0A 4ZK7A 4WH0A 5LA6F 2EZ8A 4LF6O 3IIIA 4EA6A 1ENZA 4QRHA 3M99B 3SR3A 2QKAA 2JIBA 3L0YA 3MTQA 5K6TA 3WK7A 3GB9A 1CNFA 3GDHA 1SHKA 2EYUA 5HS4A 2Q3MA 3PUZA 3VH3A 3FWNA 5FWXB 1BFDA 2G28A 2IELA 4CDGA 4BJ5A 5E7IA 2D00A 5A7FA 4G5OA 1QP7A 4M0CA 4LJ4A 4EY5A 4N18A 4B7CA 4A91A 3AERB 3OX3A 3IQDB