4ZOLB

Crystal structure of tubulin-stathmin-ttl-tubulysin m complex
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 177
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zolB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zolB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zolB01
4FFBA 4O2BA 5KMGA 2GVIA 3JASA 4F6RB 5ITZA 4X20B 2BTQA 4LNUB 4I50A 4X1KB 3ZBQA 3JAKA 3RYCA 3HKEA 5LP6A 1SA0B 3ZBPA 4XCQA 2XKBA 4U39A 3C8LA 5JH7A 5IJ9B 4YJ3A 3UT5B 4B45A 4TV9A 5GONA 5FNVA 4TV8A 4EB6A 3R4VA 5EZYB 4EI7A 4ZOLB 5JCOC 5LYJB 3RYIA 5JVDB 1FFXB 2VAMA 4YJ2A 3HKCB 5IJ0A 3JARA 1W59A 4TUYA 4TV8B 4O4LA 1W5FA 4I55A 4KWEA 3UT5A 3VO9A 5CA0B 5LYJA 1SA0A 5J2TB 1JFFA 3VOAA 5MN6A 4TUYB 4EB6B 4U3JA 4DXDA 3JATB 1FFXA 5LOVA 4O2AB 5IYZA 5CB4B 3VPAA 3CB2A 3RYFB 5CA1B 4WBNB 5C8YA 3JASB 4X20A 5JQGB 1JFFB 5KX5A 4B46A 1TVKA 5LP6B 3JALB 5BMVB 3HKBB 3JAKB 3RYCB 1W581 4IHJB 3VOBA 4IIJB 1W5EA 3N2GB 4LNUA 4TV9B 4X1KA 5GONB 4F6RA 4E6EA 2RHLA 4YJ3B 4DRXA 3JATA 4ZI7A 5LXTB 3E22B 1OFUA 5KX5B 4O4IA 3RYIB 2RHHA 1RQ7A 1Z5WA 5FNVB 3RYHA 1TVKB 4DRXB 4ZI7B 5LXTA 4I55B 3WGLA 4X1IB 4ZHQA 4IIJA 3N2GA 3HKBA 1Z5VA 4IHJA 5J2TA 5MN5A 3V3TA 5ITZB 1TUBB 3WGKA 5CA0A 4O4JB 4U3JB 1RLUA 2XKAA 4O4HA 5MN4A 3WGNA 5CA1A 5IYZB 4WBNA 5CB4A 5JCOA 3M89A 3JAWA 4X1YB 5LOVB 3HKDA 5JQGA 2Q1YA 4HNAB 2R6R1 4O4JA 1W5BA 5C8YB 3RB8A 4EI9A 3HKCA 5IJ0B 3RYFA 5EIBD 1RQ2A 5IJ9A 2BTOA 5JVDA 2VAPA 4EI8A 3JAWB 5EIBC 4ZOLA 1TUBA 5EYPA 1W5AA 2VAWA 4O4LB 3VO8A 4O4HB 5LA6A 4HNAA 3WGJA 3JARB 3HKDB 4I4TB 2RHOA 3E22A 4YJ2B 5J2UB 4X1YA 3N2KA 4M8IA 3ZIDA 4I50B 3WGMA 2Q1XA 2BTQB 2VXYA 4X1IA 4O4IB 4ZHQB 4FFBB 4O2BB 5LP6C 5KMGB 1FSZA 5J2UA 5JH7B 2R751 4I4TA 5M7EA 3RYHB 5LA6B 3HKEB 5EYPB 2RHJA 5EZYA 4O2AA 3JALA 5BMVA 3M8KA 3N2KB
chains in the Genus database with same CATH superfamily
3K08A 4DEYA 4C2UA 2BTUA 4DV2B 3B2QA 1EVYA 3L7IA 2IS1A 2H7VA 2P0EA 2ZREA 4QNMA 2EINB 1UZNA 4E5YA 1GU0A 1M2EA 3OMXA 4RTSA 2K1SA 2A79B 3HP1A 4FMTA 2YHAA 2BFFA 3UT5B 3L41A 1FYEA 3MCZA 1FQOA 5SZKB 1O03A 2B2NA 3L9WA 4DV6O 4ZOLB 3QIVA 4J42A 1OU0A 1A8IA 1NXWA 1NVVQ 1PR5A 2PMFA 4UVBA 4TS1A 1T1JA 3GELA 1JDTA 1KYTA 3MSXA 1BQEA 4AZ0B 2QTLA 3ESXA 3KE1A 4ZK6A 2H2WA 4TMFA 4BO6A 3L4KA 1SVOA 3BSSA 1YOVA 4GOLD 4HUJA 3HB4X 1GFIA 1JXAA 1PNKA 1ZEJA 4PLFA 1QH8B 4U1RA 4IYIA 2PRZA 5DTMA 3PFNA 3I83A 3KO8A 3TXSA 1M34A 4DLTA 1NA5A 3U7RA 5HRUA 5B37A 3ETDA 2O2YA 4EYEA 5HUJA 2BT4A 2XEXA 4GPZA 4TLBA 3GJ3A 1ZH6A 4M38A 3AONB 4JC8A 1WB8A 1KIFA 5EE9A 3ABMC 1DJNA 2HDHA 1YUNA 3GCXA 2P9HA 4LSZA 4MCAA 1WV0A 3SYMA 1OPXA 4Y2HA 4UV8A 1FFDA 4D99A 5KHAA 1V48A 4ZAGA 4HGPA 4L0MA 2W2TA 4BX8A 6AT1A 5D86A 1D9XA 4MI6A 1E7YA 1SB8A 1W4RA 2G80A 2HRUA 2O0MA 3DB1A 2WJVA 4FMBB 5L3GA 4L75A 4FYWA 4K8RB 1GGNA 4YGYA 3ZXYA 3C3TA 2Z5GA 4F4FA 1GGFA 1LS1A 2R4TA 2IY9A 4WW0A 3K5MA 2H4XA 2XUGA 4B3CA 4DFDA 2HWWA 1RVDA 2QTFA 3CUVA 4LKOA 4P4UA 4TZKA 1WX1A 2ILMA 4PSVA 3H1AA 1USGA 4TKLA 5LB4A 3IKJA 3OM8A 3EOZA 3M7MX 3TQHA 4JDUA 2WF7A 4Q05A 2PUEA 3OFKA 3LQ2A 3SPIA 3I4CA 3EFOA 1HF3A 4K05A 1JWLA 2BFCB 4LV5B 1YQQA 1CUZA 1G8MA 2PBFA 4QUDA 5DDIP 3BMXA 1FRZA 1IM2A 5ILGA 3CX6A 3H83A 1JEJA 1H8ED 1SXIA 1UXOA 2Z1NA 1BCRB 2FGYA 5EHNA 4AP6A 3KOZA 3JD0A 1EVQA 5B1EA 2G28A 1FRQA 1GTJ1 4AJ4A 3GEEA 1WP9A 1E3MA 1X1EA 1F20A 1UJ4A 3PNKA 1DV2A 3AF3A 3ML0A 3C7AA 3FYUB 3O4GA 1OI7A 2PR7A 1VKNA 5ALXA 4EY7A 4BFYA 3QNEA 3S4YA 2C7PA 1DG1G 2OP0A 3FHCB 3JZDA 3TQSA 2GJ4A 4U2BA 2PS0A 3LYBA 1CY6A 1G8HA 2VEOA 4DNPA 1VMKA 3BZWA 1BW9A 1B6SA 4FPXA 4PVDA 2OTJF 4NOJA 1A50B 1DX4A 5F23A 5IVKA 4GE0A 5FORA 4F4LA 4QVIA 4X3MA 1TAQA 1RQGA 5B3LA 4X8MA 1FQJA 2IEZA 2IS2A 3ZVRA 1KJ8A 4JLVA 1U1EA 1WL8A 4FYKA 3K9CA 5IE9A 3OPYI 4LP8A 2Z1UA 3AWDA 4KQCA 4PONA 3N2KA 3KOUA 1KI9A 5ITWA 1NYLA 2EF1A 3ZJUA 3PTLA 4KREA 4RPLA 1JWAB 5AXDA 4CMJA 1NN1A 1U2ZA 4B3RO 3ESZA 3IR5A 2JGFA 5C7OO 2FR1A 1EG7A 4DN6A 3PGJA 5KQSA 4J4BA 1FFGA 2DWQA 3W6NA 2BELA 5TRTA 1DC4A 1L5SA 2INGX 3HJWC 1RAGA 4DR7B 4NG5A 5B4VA 5GV7A 2GVIA 2QL7A 4MUMA 4YIKA 4ON9A 3NK7A 4FLUA 2P8SA 1EI9A 1N2EA 4JUBA 4Y9DA 5ESDA 1YC2A 1QE3A 3AYXB 3HGMA 4UW9A 5H5NA 4TQFA 3CC2F 1R4MB 2CHEA 3QBTA 4Q1EA 3S29A 4YRZA 3C87A 4L1KA 4YECA 5EZYB 4H35A 4ANFA 3S02A 1CJTC 2WDZA 3LNCA 1LFDB 3EJWA 5BOSA 5K01A 1PZXA 4AJ1A 3QE9Y 4NMXB 5KVCA 4HAWA 3CNOA 2J3DA 2IDKA 1I2CA 3FW1A 4F5DA 3REGA 1VHAA 2LVBA 4NARA 2ISQA 3OTIA 4ESEA 3AVTA 4UBKA 2UZAA 4BMDA 3PC3A 1CR6A 2DKFA 4TL8A 1Q3EA 3NOVA 2NUAB 4BATA 3EHBB 1AUVA 1NQTA 1A2OA 1NYTA 4B08A 4OUDA 2IOHA 1CUWA 1QZXA 1I3OA 3HXTA 2WICA 3U5ZB 1J70A 4RPKA 4N6NA 1EFDN 1QR8A 3ABLB 1KQNA 3EFHA 3S7ZA 5DFAA 3T54A 6ABPA 1XJ0A 3UAZA 4H7KA 2IDZA 2VWQA 3IAYA 3QUWA 1WDTA 4RTKA 3ASOC 2NO5A 4TX1A 1P0CA 3KZXA 1Z4JA 2ZDHA 1LBHA 1X39A 2IQ5A 5A3RA 4FMDB 2D1RA 3WK6A 1JW9B 5KJCA 4IUYA 1YDGA 4DV4O 4OGQB 3U7QB 3OTOO 4ZV9A 2WHPA 3TLXA 2JGAA 4GKBA 1FFHA 1A9RA 3HM2A 2XUDA 1VQNV 3EGXA 4Z2WA 2BFCA 3JQGB 4J2HA 2LDXA 3KKYA 2LGJA 3GG9A 3GX1A 3VFDA 2OXFA 3CGWA 3NDJA 3WG9A 2V7QG 3P10A 4R2XA 3VYRB 5FNVF 3BB1A 1ZVKA 4GUDA 1I1NA 1V7ZA 3D6JA 2E7ZA 3UJ8A 3VI3B 1G20A 1P7BA 3RU9A 5JT1A 2XHBA 3VVCA 3NIBA 1WY5A 2ZB3A 3MQFA 4GSKA 3H2SA 3RIEA 2UYGA 5D00A 3ZKWB 5EUMA 1T26A 1TLTA 3E0XA 3IB3A 4PHZA 4C2AA 2ZM5A 3H9VA 2H51A 3G5TA 2QE7A 3HM9A 2F93B 4C4XA 1G9SA 2QT1A 1SUCA 2YW9A 2AZ2A 3GLKA 2PNJA 4OQXA 3V8QA 4PNEA 1M0WA 3RW9A 4K26A 4YPOA 2H4HA 1I6LA 1XPUA 5K0ZA 1UPGA 3LG2A 2PT5A 2P91A 5G2OA 3FMPB 5I3ZA 2GN4A 3USCS 1NTKH 1D0VA 3FTQA 1ENVA 4EG0A 1VL0A 1WMBA 2WHXA 1YB6A 2QNRA 1VH8A 5C8VA 2QE7D 3BICA 1O94D 1ZHFA 2CXRA 5E9WA 2JLRA 2VP3A 4HQOA 1GCGA 3ELUA 4Q3LA 2O1XA 1T1RA 2A7QA 1VF7A 3L4BA 1PJ4A 4Y6GB 3R7AA 4AC9A 2GAJA 4E09A 5KOIA 1A7AA 4FJ0A 5E1DA 4YP9A 1KO7A 5LMUO 1O95A 3I2HA 4LF6B 4KJZA 4LWQA 2ANCA 4RV4A 5CVCA 4PV1B 4KU4A 2D0DA 3VZRA 3KB2A 4ND3A 3ZV5A 2FL4A 2ZR2A 2Q4TA 4LJ4A 4C04A 2NLOA 2QLFA 3OFND 4B7CA 1XTSA 5IH7A 4UBMA 3FTFA 4YQZA 1IY2A 2AZTA 4JFRA 2R8YA 2XNHA 2PKRA 1B8NA 3AJRA 4MHOA 2X4DA 2RH5A 4MYSA 2VJYA 3P94A 3P7MA 2PZSA 3ROKA 3JASA 3E61A 4XX0A 1H1DA 1YC5A 1KDZA 5LWQA 1M66A 1KVUA 2B7CA 4ZI3A 3S6JA 1A72A 4YQYA 3WLNA 4M1YA 4F0JA 3BBLA 4ICIA 4QUJA 3BY6A 1WNTA 2D8AA 3PQEA 1NC3A 2YASA 3AP3A 3PB3A 4GPTA 1PP9H 4KP7A 4L9AA 1U7PA 1GPWB 3B09A 2J4CA 4Y2VA 3STUA 5LZ2A 2QV0A 4R8VA 3TDKA 3ZQ4A 1E3TA 2TSYB 4RD1A 3VR1A 5JQWA 4GC5A 4K6MA 1S2OA 4H18A 3SZGA 1U1FA 3MJDA 5CDTA 2NACA 5EQTA 2YINC 3ADPA 1F38A 4DHWA 4DDHA 1NYQA 4X6YA 2WSBA 3R40A 2DJIA 3HCDA 3LX8A 2O48X 4L5JA 4MIKA 1DCMA 3Q6IA 2QM0A 5JPIA 4IJUA 3PQDA 3N0WA 1EVIA 2CC2A 4MAFA 3VPBA 4BW5A 2Y3IA 1NH2B 1RKQA 2BRUA 2XYRA 4WFIA 3IURA 4RZUA 3V9AA 3WV5A 1XHZA 2QG6A 3LS2A 4HLDA 3UJBA 4E30A 3M1IA 4BO7A 2P2NA 4IJ5A 3LUPA 2Z5FA 5CFNA 4DR5O 5CFOA 1KARA 3GEMA 4AZ0A 4PHCA 1NUSA 5J4LA 1MW9X 3SJ7A 3R24A 3RWRD 2LJ2A 1G2IA 2Q3EA 2QL6A 1F5NA 2P4HX 4B75A 4CM8A 3K5OA 4NWIA 1QP7A 1Q7RA 2JI7A 2R3SA 2R8OA 4O63O 3WSTA 1F0YA 1N2HA 2WLSA 2RGRA 4L8VA 4HNHA 3D36C 4KCGA 1KJWA 4YP1A 2YUAA 5G40A 1AKWA 2AD5A 4S1PA 2I2XB 4I7ZB 1NT4A 2Q5OA 2FLVA 2VPPA 3H2HA 1V5FA 2BFNA 1KE2A 2W70A 3UY4A 2NMUA 2VDVE 1JSRA 1EM6A 1OBHA 2VDLB 1XL0A 3Q7SA 1A95A 4HBZA 2BVNA 4LHYA 4KYTA 3K1YA 3WGVA 3CYFA 1TYBE 1AVTA 4DDWA 3T7AA 3PHHA 3BA1A 3L77A 4YJHA 3ZIAG 3DXXA 4F9EA 1ZMOA 1Z5UA 3JQDA 2VOEA 3K1TA 4DC0A 2VNSA 1UC5B 1Y1TA 3DT9A 5EVJA 1LVGA 5AW4A 5ICEA 2Q7OE 4AO8A 2R6HA 1USUA 1VDMA 3TBKA 3TXAA 1JYFA 1RYEA 1XDUA 3OFVA 1JDNA 3CH5A 5H9VA 2YS8A 2ARHA 4K0RA 4OB6A 2FF7A 3IR7A 4K9QA 5SY4A 1GRNA 3AVXA 2ZGVA 4AECA 2GZSA 5EG5A 1FAFA 3PXEA 3VMMA 2GKSA 4QNNA 1RC1A 5KOHB 1PM9A 1VB5A 4MV8A 2A7XA 4YRFA 5AW7A 2EVWX 3RTDA 1TUIA 1X7XA 1Z56C 3PNQA 3EA5A 5AVTA 1G5TA 5KVSA 1KQFA 1ZM4A 4GRIA 1YZ3A 4K03A 2WTMA 4LTNA 1IU9A 4CMCA 2QTAA 3MTIA 2WU4A 1IZYA 5BV7A 4H16A 3E83A 2QVLA 1SCUB 4JZ2A 3RIXA 4UBLA 1E4YA 3TLGA 1BOOA 1PGJA 1YI1A 3DOCA 3I6YA 5ESRA 1T3HA 1SUFA 3ZLBA 2DOSA 2NZJA 1WDLA 1SKAA 2I6QA 3NHZA 3T4UA 4BOYA 5KX5F 4M0LA 3SQDA 2PV0A 1Z68A 2ZS7A 1ISGA 2R97A 1PR2A 1E7WA 4TPKA 2EHJA 1LEHA 3CCSV 1IUPA 3AY7A 4KMRA 4OHMA 2Y1XA 4G1MB 3HKEB 3R7DA 4EAAA 4XSVA 3QOYA 4GOND 4X97A 4DR6O 2AK2A 3QG5A 3OCYA 4FHEA 1CLEA 3EDOA 4R2HA 1O97D 3KUUA 4FI3F 1HC7A 3D3IA 2J5BA 2HK6A 5CLGA 2UUBO 1RI2A 3AHFA 3SC2A 3HUFA 4PYQA 3RS9A 1G21B 2X2EA 3JR7A 2UYOA 5F3WB 2OTMA 2R86A 3I2GA 2F7SA 3UUEA 1MTOA 2P2GA 5CEFA 3LC2O 3KPUA 4EB6A 3WRXA 3VAAA 1SXHA 3GLGE 2OZKA 3O9OA 3GCDA 3ETNA 1TYZA 4PWZA 5M29A 1BA3A 1AILA 1BNCA 3AFIA 2HGZA 4X7MA 3ANSA 2HNKA 1KFCB 3P0FA 4MPRA 2EKPA 1GAXA 4ODIA 5HIIA 3RKSA 3D4LA 4CM5A 3TFOA 1UBFA 3W5SA 3QO5A 4CM3A 2NVOA 5HY1A 2F4VB 1TO6A 2I65A 2V03A 4YO7A 2WNHA 1NQVA 2OPBA 4L72A 1S5HC 3ZW8A 3N7AA 3L07A 4BVQA 1M1NB 3KYBA 4ILEA 2XXAA 1N6LA 1KKDA 3BDAA 5KJFA 2OBXA 4B7KA 4JTDB 2P4SA 3AWIA 1AZSC 1ZL8B 1ZCFA 1IE3A 3ND6A 3VR2A 3K3PA 2QTRA 2BBSA 1CZNA 2VH5R 3IDOA 4MS4A 3LY5A 1CHDA 1K3TA 3DOUA 2JH3A 5EZ6B 4CLHA 3SJAC 3K6SB 4KVFA 2P6UA 1SBIA 4ENRA 1BDMA 2WM9B 2D54A 1HNWO 3KT3A 4ZYZA 1WLEA 1WDWB 2NTYC 3T5CA 4BNTA 3S0JA 3UHFA 3OZWA 1UAYA 3SSOA 4DB4A 5LQDA 2Y9PB 2YQ5A 1ZD5A 1I08A 1W41A 2ARKA 1FSGA 2ZIVB 1IONA 1MC5A 3MLAA 4L6CA 4OD0A 4OK5A 4RQAA 4Z9BA 5EKSA 3ZWOA 3GK3A 4EB8A 1VL2A 2JFUA 3NJ4A 3P19A 1XZNA 1SC3A 2E1PA 2CSXA 2ZRLA 1W40A 5ERYA 3MYRA 3RWOA 4DBZA 3BT7A 1JSZA 5B4TA 3PYLA 3BGOS 2GEBA 4Q4CA 4ETWA 1J8YF 1X4TA 2OAGA 4MV0A 1VE1A 4JP1A 3G4SF 1GA4A 4V3BA 4ZDJA 2R65A 3ZVKA 1FW6A 2JRCA 1I7FA 4HPWA 4XX0B 2QRVA 1TUBB 2QI9F 3B9BA 3WQRA 5B1DA 3L6CA 3WOVA 2ZR0A 3DBRA 3B1YA 2LQTA 1KZHA 1Y8ZA 4DQVA 4B7AA 4GGPA 4XQ0A 1VMDA 1OFTA 5HP4A 3EQ6A 2HU2A 1QPGA 1VKRA 2ACKA 4YFVA 5ALUA 4MKZA 4AYWA 4E03A 3A6DA 1T4GA 3AEUB 3BD8A 1WOYA 2VATA 4O59O 2NAFA 1RTKA 4WASA 1JTEA 3CZPA 5AOCA 4LMBA 1F1JA 5FF9A 2XRZA 2H1IA 1G6KA 2O3TA 1Z39A 1ZJ4A 1GQRA 3E89A 4BVHA 1YJ9V 4I5EA 4C4AA 4NOLA 1E1NA 4C4PA 2BEWB 2KW5A 2V7TA 1MT0A 1XAJA 3K2EA 2WYVA 2OB1A 3K96A 1FNSA 1GL9B 1MJNA 1ZMBA 2Z8YA 3HXPA 3OX1A 4X93A 4Q7LA 4E0BA 2W0SA 1UBKS 3MFYA 3LPNA 2GAOA 1W8IA 4HYQA 1KXJA 4JYAB 3W7SA 1YJCA 2HEPA 3D3EA 3ABUA 2J59A 1XI1A 3O8OA 1JDJA 3MB5A 1IPAA 3O8QB 1JAXA 2FJPA 1HDZA 3I56V 1KVTA 3P5BA 4FJ1A 3A36A 3SPGA 5FUBA 4AJJA 4V24A 3Q5DA 3SU8A 4PGAA 2C9YA 1HG0A 3W7BA 2P67A 1PEYA 4RKFA 3AR4A 3RH0A 1QVFF 1Y89A 2JDID 4P9NA 5FWAA 5J40A 1OGJA 1FIUA 3ZU4A 2B8JA 4NYJQ 4F04A 3QXXA 1ZN8A 5A05A 4K9OA 1LB1B 3OLQA 1FMFA 2VP2A 4OQDA 5FBQB 3E3NA 5FB3A 3MCAB 4DG5A 4WTOA 3ZBPA 3MAQA 2YXEA 1DEAA 2XKBA 2QYHA 4PSCA 3V8PA 1C29B 5BUZA 2A78A 1U3FA 4EA7A 3OEED 1YB5A 3DDCA 2VCHA 4K9PA 3F3MA 4X6UA 4JF3A 4W4LA 1NPDA 5K4HA 3FNEA 1UC9A 2YR0A 3ZK8A 2HCTA 1XQXA 1W59A 4UE6A 4ZOAA 1UXIA 3YASA 4CCYB 1OCCC 1EZ4A 1XHOA 3L8EA 1I6KA 1JDPA 3OJXA 2R47A 3LIIA 4WKOA 4BNUA 4BNGA 1TEHA 1RQRA 5E3HA 3SQWA 2E76B 1HORA 1OXSC 2NPFA 1BMTA 3CRVA 4W1QA 4JI7O 4Z3DA 3JVIA 4MUXA 2AFHA 4DG9A 4IO1A 1CX9B 1OU4A 3AINA 3NVMB 1KEEA 4U3JA 1HPLA 1ZGCA 4JLSA 2H18A 1NJGA 1NKVA 1Q1ZA 1PEDA 3OPQA 1X9GA 2B69A 5KNDH 4UM5A 4YCAA 2XGJA 4KIFA 2WI8A 4LXGA 1CFZA 1XNGA 2R9RB 2YN2A 2ZJ5A 3GLTA 5DIFA 5TY0A 4TRMA 4EGFA 1CZLA 3DJFA 4BCDA 5ADHA 1E5QA 1Q20A 4JJ8A 3JQ8A 4CM1A 1YZYA 1ULZA 4KQWA 1Q3HA 1TQ4A 3SYKA 3KEOA 3F9IA 1JCHA 1UK7A 2Z8YM 4KXMA 2FZLA 3KXIA 1GU1A 2D5AA 4DC1A 1LCIA 4KBGA 2FCRA 1CZOA 3ZP7A 2GETA 3ELYA 3G13A 1Y1QA 3TXYA 2BKAA 4PE5B 3WNDA 5H2FZ 3OT7A 3KAKA 3NRCA 1ZIYA 3NONA 5JARA 3OZAA 5CTJA 1IVSA 1DC8A 3B9QA 3ETQA 1KQ3A 3DR3A 4Z0TA 4YCSA 2D0OB 1NQ3A 2IXGA 3V8MA 2DFVA 3W05A 4J7JA 1K5SA 1ABEA 1X77A 4LF5B 2EXXA 3L4SO 2WVJA 3TPCA 5LPNA 3GXBA 5DT2A 4UBNA 1J99A 1BS9A 1RE0A 1RJEA 1FFTB 2GI4A 3UWDA 2WHQA 3DOFA 4GICA 1J5EO 3ABOB 4ABMA 3CUEF 4YJ2F 2OECA 1M72A 2CJWB 4FEEA 1JD1A 4JB8A 2J3IA 1AQ6A 3L7QA 3FZYA 4AZWA 1U65A 4ZYXA 2CXSA 3WBKA 2HRCA 3G5LA 3C15C 3GMTA 2WIDA 3JTMA 2RH8A 1O94C 3MUOA 4ZVKA 3TRJA 1JP7A 3DYVA 3RD5A 2Q3DA 2FXIA 4FU0A 4BLTA 4DLNA 4DPMA 3K0HA 5K0EA 4OYRA 3ZRSA 5F3RA 4EMSA 1N78A 3WGJA 1ORDA 2GLXA 4ROTA 5IW8A 2HP3A 3UAWA 2HXGA 3BGSA 3U0OA 3PGA1 3PS9A 3QEOA 3VKUA 4Q3KA 3S2IA 1R2QA 3FOWA 1EB8A 3P9RA 3NETA 3NR2A 5H02A 1H0HA 4LJRA 1IQPA 1RRGA 2P22C 2ODEA 2ZJOA 4G36A 4GYKA 4V2UA 4XZ3A 5IAEA 1ZFNA 4AMUA 5A02A 5IH3A 3QP9A 4YMVA 3C98A 2PKCA 5JCXA 3FZGA 3T35A 3BQMB 3E5NA 4K6OA 4TRJA 1R0LA 2RHJA 3K0BA 1XZPA 5EMLA 1QO9A 2Z4TA 2HSWA 3ER6A 3O82A 2W6MA 2QW0X 3AW8A 2G9VA 1NRWA 2CXOA 3HYTA 2O8BA 1U3LA 2HWUA 1AKVA 2CH7B 4K6GA 1Q1EA 3A9SA 3PDIB 2V59A 4LA4A 1JRLA 3JPWA 3IQFA 4X0EA 1T1EA 4GC9A 2JNBA 1LW7A 4KYIB 4YV2A 4JXJA 1SELA 4ND4A 1XDWA 1CRWG 4MGHA 4OI0A 2ETXA 4LJAA 1DDOA 2Q9AA 4M83A 2QDOA 1DKOA 1J6UA 1Z45A 4WBXC 1JU9A 1F51A 1YVEI 4ITVA 2G36A 1YVRA 3CJRA 3UFBA 1JHRA 3TCUA 3S06A 1BKSB 2VRBA 3TQTA 2NWQA 1BQ0A 1ZLZA 1WJZA 2IYAA 4TUYA 2ZU0C 1K8AW 4B3MO 1JHAA 1Z83A 1DRWA 3WO0A 8LDHA 4TV8F 1K2WA 5IUKC 4R50A 5KQGA 4BXOA 1UP4A 3K20A 3E1YA 1OAOA 1CEZA 2O0KA 2CVQA 4Q03A 3OM3B 2DYKA 2QSJA 3DNPA 5DI9A 3NQ41 1CR2A 4EB6B 4QLBA 2FHSA 4Z3OA 3QLUC 3ZZTA 1SZJG 1E4EB 2QMQA 2X7HA 4OHWA 3WTCA 3ZBTA 4F8JA 4TLMB 4R05A 3W77A 1VMAA 4J1SA 3EXAA 4JJIA 3F0TA 2WTAA 3Q0EA 4OXKA 3OGIB 4MYUA 4GI3A 3UCSC 4OCZA 5HQJA 5BRNA 2PY5A 1GITA 4N3CA 3ZHSA 4G5RA 3X2SA 5EE5B 1JXOA 1L7MA 3CN9A 3VOBA 1YU6A 1AJNA 1GY8A 1Q82W 1B8PA 3K0CA 4JAVA 2EX1A 2AN3A 3MRXA 4S12A 2VQFB 3A8TA 3HPQA 2QSZA 5CG2A 2OK8A 5JBIA 3WE7A 1NFQA 3DEHA 3WK5A 2O0HA 4AIRA 1CUSA 1WQ3A 1KYXA 3ZMZA 4LS3A 1VPDA 5HIAA 3R9IA 4LGVA 1VYHA 1VBFA 2DJ5A 2PANA 2X1LA 1AF4A 2CUNA 1JQBA 4LJ9A 1URPA 2AFIB 5LR6A 4KACA 1ZXLA 1ADYA 2VDWA 3BEOA 3H04A 5JO9A 3HJUA 4C01A 4CN9A 3SICE 4N0PA 5L3EA 1GTG1 2RI1A 3FF4A 4RKYA 1VA4A 2BFBB 2WK1A 5HQ3A 3LHSA 4ND5A 3ETCA 3VC3A 5F2VO 1VRWA 3USES 2R5WA 5ES4B 3ODGA 1JHXA 1CQPA 2Y0PA 1RLUA 2V7QD 3EAQA 4XJTA 4DV2O 1DZ3A 1GM7A 5MN4A 3KOWA 1A9YA 1AJQA 3ZGXA 4A26A 1T6BY 4EHFA 3FX2A 5HJ5A 4JT8A 1D5CA 3U7FB 4PBSA 1XMQB 1IZ8A 1Y5LA 4I9UA 4OHBA 2GCIA 3EVFA 2O50A 1RAHA 1W0CA 3C8MA 1T2AA 3O1LA 3HR8A 3L7AA 2A92A 4UFPA 4MA5A 4D7SA 3VPGA 4G23A 1BAPA 5KDDA 4WINA 1AKNA 2O3UA 1ZRHA 1EUDA 3KWMA 2Q3MA 5EB0A 1E1MA 2YVKA 3NCHA 3L9XA 1MRNA 3PNPA 4HEHA 3M6UA 4ALLA 4CCYA 2AB0A 1Z4NA 4FM1A 1RJFA 4XYEA 3VO2A 4ZCPA 3KE8A 1W2GA 1O6CA 4B33A 5K8TA 2BPOA 3H2YA 1R4NA 2X86A 1PNMA 3D0KA 3L0SA 3WDMA 3IAAA 3MJRA 1HYHA 1Z5ZA 5BVGA 4B4WA 5CAEA 3C48A 1Y3DE 2Q8PA 4HDRB 1XMJA 3OE4A 4WACA 1T3GA 2WALA 1J0AA 3W90A 5K6AA 1AKMA 3W9BA 2DUMA 3LVFO 3QZUA 3LOPA 2IRWA 4IHKA 3CPEA 3QKTA 2VKTA 2GDSA 4M1EA 2YEVA 3BMCA 2BJHA 3E58A 3IJPA 5LYYA 3MDSA 2YV3A 3BWXA 1F2DA 3FE2A 5K3CA 1DWPA 1P60A 3QVWA 5KHGA 1B0UA 4Q9HA 1U3GA 4QBKA 4OSOA 4JA2A 1NUTA 3QGMA 3TKAA 3K5NA 5KHLB 2FWNA 4B8WA 1A4UA 3X44A 4FP9A 1NBMD 1J24A 3C5CA 1UWKA 2BUAA 4K40A 1H7MA 4RSMA 2ZR9A 4N8EA 2QRPA 3UUFA 1OKKA 2EL7A 2HJVA 1GUZA 3INYA 3KFXA 3P27A 4LCEA 3ZW7A 3OLCX 3HKCB 3ZG6A 1DRVA 4QAQA 4RIHA 1GSOA 3I6BA 3UJ7A 5B66Z 4B3SB 3GYBA 7YASA 3FWZA 3D8BA 1PVVA 1W52X 2XYPA 3SVTA 5LYJA 1H9BA 1VGVA 5IC6A 1V9CA 3M5WA 4XGRA 1CUXA 1SC1A 4L8FA 5GWXA 2E82A 3DDWA 3IAHA 4GKKO 4BWVA 3GT0A 1KI1A 1O1YA 4WY2A 2FVXA 3N74A 4PG6A 1T1SA 2WM3A 4W9RA 3VM6A 5FBVB 1T9BA 1BWSA 5IJZA 1V55C 1ZW6A 1F4PA 2Q5ZA 1XLWA 1D4OA 2EWWA 4TXMA 3HFJA 4O1MA 4W5WA 5CT8A 1LLDA 1KDOA 1E2JA 2WLIB 2V8OA 1Z0AA 2WW8A 3TK1A 1A8PA 2AE2A 3E9CA 1ACMA 4MUJA 5CLFA 5K8LA 1WUKS 4JUAA 3T9DA 3OPXA 4HH4A 5HXUA 2PSHA 3KCQA 5FPPA 4P7FA 4IHJB 2C54A 2F59A 5AVVA 5I47A 1WZEA 1TK9A 4LNUA 4M9RA 5JJJB 2P4UA 3VH4A 4EB3A 4L73A 1GRVA 1UFIA 3VUFA 1YJ5A 3GMDA 3CVYA 1R8QA 5IFKA 5E7JA 3TTXA 4MTLA 1OI3A 4C7JA 4F4JA 2WB2A 2CDAA 1T5LA 4KLNA 5SYAA 1RRKA 5JWPA 4MVJF 5F4BA 4QXPA 2QWPB 2XDYA 3WRVA 3AW9A 1NR5A 3H8VA 1ZU5A 3OWXA 4JP5A 4URHA 1KSGA 3RE1A 5L6MB 4DZRA 5KKNB 3SVLA 1NI3A 4W5NA 2JGLA 3A9WA 3FYCA 3W06A 4YRCA 5J2TA 1QKKA 1XALA 2A0UA 3D4NA 1T4CB 1W96A 1Z62A 2NUPA 3PXBA 3QPAA 4P36A 4QDZA 4BV3A 1NI5A 4RIFA 4CQJA 5KYYB 4G5HA 2CXQA 1QS0B 2LTAA 4RNDB 3MTDA 4W9NC 3K70B 4AYXA 1I3KA 2W93A 3OOJA 4FD2A 3M89A 5FFMA 3PYMA 4OI4A 3WXBA 3QOWA 4R8LA 3PICA 1V5GA 1F6DA 2JIZG 1SVUA 3HWSA 1GKLA 3K4PA 5LHGA 2DTEA 2R1ZA 4A10A 1Y6ZA 3MRTA 1MFPA 4NFLA 2NU6A 2BR5A 2FR8A 1FPOA 5EIBC 1CG6A 2YWJA 4NZ9A 3WNZA 2F9FA 5DN6G 1GT6A 3IMKA 1ZH2A 3BQ9A 3FKSD 1JKMA 1AI5A 4H0CA 1GZ7A 3RI3A 3OCXA 4I5IA 3ONFA 1Y9EA 4WESA 3FB7C 2YDXA 2GKGA 4J1TA 4LOHA 3RR2A 5HNKA 4MR8A 3RSSA 4U2EA 2G06A 1S7GA 4NXNO 4JASA 1MQAA 1GNSA 3L92A 4AROA 3V42A 4QIWF 4RHFA 5KYTA 3N9IA 4FFBB 2C59A 2O07A 3K0SA 3SOZA 1YKSA 4WY8A 1MO2A 2XUIA 1T34A 3TAUA 1RXSA 2NUPB 2PLRA 4C2BA 3H17A 5B12A 3HCRA 5LA6B 1RSZA 2FSPA 2GZ1A 1WUYA 1FD9A 3SS7X 4LCUC 2CXXA 3HYSA 1WTCA 1OX5A 1W2WB 3PFCA 1WZIA 3TGUH 4FHZA 3ZU3A 1MAWA 4IOMA 4CKEB 1KVRA 3R7NA 1JPVA 2ADOA 4XDZA 5BZBA 5K3FA 2OSVA 3OA0A 2YC0A 3KXLA 4WXMA 3TEFA 1SHZA 4D6XA 2XOXA 4Q7MB 3L4JA 4U39A 5IT9M 3CUWA 4MINA 1Z4PX 1V8ZA 3AHHA 3D8TA 3JRNA 3PJDA 4IVNA 4Y6SA 5E8JA 5BNFA 1SBQA 2XLCA 1N3IA 4CMHA 2AIZP 3C8UA 4FMDF 4B80A 2R6CA 3P0HA 3WGOA 4D0SA 3JRWA 1PJ8A 2HRRA 3DHYA 1JEEA 1FXWA 1KA9H 2D74A 1SQGA 2OMEA 3CTPA 3NFYA 5BN3A 2ZINA 4QE9A 2P06A 1GNRA 1KI4A 1TGVA 2DPHA 3ZMTA 2Q45A 1R64A 1MOFA 3H9QA 3QUTA 4WQMA 4P2ZA 1GPNA 3M5CA 2UYKA 3MW8A 3BXPA 1RLJA 4D3SA 1PAUA 3MD9A 1SFRA 4DM3A 1LV7A 4LOJA 5AOBA 1W2HA 4PX9A 4Q7JB 1PXWA 1QK5A 1CUJA 1ZP6A 3IELA 3OZBA 3PIDA 4IDDA 1BD3A 4CG3A 2ODTX 5C1IA 2PQMA 3CB2A 4RQEA 2HDOA 2ZANA 4JKIA 5CB6A 5HFMA 2ZAGA 3RAFC 1Q0HA 4LY6A 4XWAA 2AX3A 1X80B 4KAAA 1Z2EA 2VHVA 1D0IA 3BIFA 3JQEA 3U3RA 3RRBA 4OJTA 2OXCA 5I9LA 3JYNA 3V34A 2XAUA 4ZZ3A 3HP7A 4HB0A 5AKXA 1R1MA 2XMGA 4F3TA 2AZXA 3PPVA 1BDIA 3EFOB 3MGAA 1VG9B 3E7DA 2LE0A 5BR7A 1NHWA 1NWHA 1L7AA 4RGVA 5E1AC 3A3KA 4G85A 2L82A 2W0FC 3MHHC 1E3WA 4RVSA 4UXIA 5DOZA 1UP6A 1XQ1A 5BYKA 2GAAA 4FWTA 3CMAF 2DBVO 2GEFA 2GHQA 2JJ2A 3EIHA 3AJ8A 3Q10A 4Y2PA 1RLIA 1SCKA 3Q1KA 2ZDGA 4ARVA 5DBFA 4FXOA 4CU2A 2VYNA 5LU9A 3ZE8A 4Q9IA 3E7XA 3KT6A 1Z0UA 4JUDX 3LBYA 3D6MA 4QM6A 3CCVV 3EDQA 4BS9A 3PXXA 3R6DA 3DVRX 4FFNA 2HMVA 2KG4A 1ULHA 3QV1A 2Y05A 1HE2A 1SHTX 2JFFA 2H0AA 1DIRA 1NLFA 3A6HA 1VEWA 3IX7A 3Q98A 5EP4A 3A4IA 1BSVA 2LBWA 4IWXA 2QN9A 5F1OA 4KRFA 3NW9A 2B9VA 721PA 2X5XA 4F5EA 1R0SA 2IYOA 3OIWA 5GV8A 3TL6A 2GARA 3NTVA 4P2GA 4C6HA 1GZ5A 1J8QA 4DILA 3W5AA 3DCNA 3PLRA 1OGYA 3O3OB 1G7CA 4R3NA 4WLOA 3OCWA 3UK2A 1R5BA 3GFGA 1RFLA 3LWOC 3SE7A 2X2OA 4CV0A 5K0GA 2OTJV 1S9DA 2ZAOA 3FRJA 1NPTO 1KMNA 3IC7A 4Z1MG 2CLIB 1BHO1 2C2MA 4N7JA 3TRFA 3LCRA 2J5KA 4AU1A 4UC0A 1AUPA 5ARBA 3VV3A 4DV5O 3E8HA 1KY3A 3EAGA 4LR3A 5FTMA 3E18A 4MW6A 1FNNA 2V1UA 3G88A 3S03A 5DBIA 1WB7A 2ZG6A 4L3OA 1OXBB 1Y1RA 2D5LA 1CB7A 1YDEA 3PDIA 4KQ1A 4XE5A 2GV9A 2ZUCA 3HCOA 4UOZA 4ZTZB 1QZZA 3DVAB 4P3YA 2ZRBA 1YF2A 2R79A 2EKDA 1U0NA 5CDUA 3ZDFA 2XMZA 3OECA 3PPIA 4YCMA 3C6BA 3IQIX 2KM1A 2QY9A 4V0KA 3RTAA 3HU5A 1DCKA 1D2AA 3NWEA 3CF4G 1S89A 1HDYA 4MRMB 5DSTA 4HH0A 2G1KA 4W5RA 3U9LA 3I92A 5EBLC 1SVSA 4JI6O 3H6HA 3U16A 1FFWA 1YR2A 4L4ZA 2P9GA 2YWBA 5C2JB 2OBYA 3U44A 3MDOA 3RBXA 3CP1A 3FR8A 2ES4A 4JXKA 5FOQA 1XN4A 4JAAA 1ENPA 6REQA 2LXNA 1NJ6A 1TJ5A 4RD2A 1Z0SA 4QG7A 5AJXA 5KC9A 4ACAA 4O25A 1FP7A 4UM9D 5JS2A 4CT0A 5KA6A 4QRHA 3INTA 3FYUA 1H3NA 4MVJE 1OW3B 1OWMA 3D54D 3DW3X 1AN0A 1SBNE 2ADQB 4RMJA 2WKRA 1DS6A 1U4NA 4OGKA 4RAOA 1BO6A 1HEIA 2G76A 2ORWA 1QDEA 4RA6A 5KJEA 1PJTA 1U5BA 2SHKA 1JBKA 1VHLA 1RM5A 2PGOA 2QRKA 3I42A 3RABA 2FXVA 3U17A 1WBBA 3H7AA 1GSIA 2EFEB 2IBZH 3FAZA 1HGXA 2VQ3A 3FNFA 2CTWA 4JITA 4R71A 1PIWA 3G0GA 3P2MA 1LPMA 2VCEA 3UANA 4FFSA 1HT1E 4LWZA 5GIPE 4MKFA 3DMDA 3PN1A 4UHDA 4UEOA 3TD9A 4RULA 1AF7A 2DPLA 4LDRA 3PD7A 5KPJA 2XDAA 1K5QA 3T9FA 4F7DA 3KX2A 4M9SA 2DRIA 4EOGA 1GTVA 1VGQA 5JRJA 4TKUB 3ABLC 5AVZA 3OG9A 3SLGA 4S04A 5F7ZA 1XJ5A 3ZWNA 5IX8A 1E79G 1JIQA 3ASZA 3R3YA 3WZMA 1CV2A 5HP8A 1YR1A 2A59A 2I03A 1XD2B 3OUSA 4X64O 2V6BA 3BRWD 3L18A 3WRWA 4FFLA 5JU6A 3W2TA 1RP1A 3AR8A 1L7EA 5CYGA 2BEUB 4B8YA 5B1OA 1RS0A 4R6XA 4HI0E 4UFOA 4F1JA 5AW3A 3HWWA 1DJLA 5BW4A 4CE6A 1TKCA 1T2NA 4HXGA 4LYHA 1NUAA 4YCBA 1I0ZA 2EQAA 2EJCA 3SDZA 2QEXV 3ZVLA 3E35A 3ZNPA 3OAAG 1BIFA 2Q1YA 3NHAA 2NYVA 3M1YA 1NVGA 1F2UA 2B4KA 2R48A 3B3QA 3C3MA 4UAJA 4B84A 2BWJA 2YJGA 2QN2A 4MVYA 4NBTA 1EWKA 4NPHA 4P33A 1G8YA 2Q2WA 3WG7C 2XZDA 4X88A 3LPCA 3MN1A 4DLZA 5K8IA 2AN5A 3H2GA 5AKEA 4QEZA 5AKHA 2LIPA 3OPNA 3RFCA 5A71A 2IU3A 1OZGA 2J7PA 2PKWA 1JX6A 3CF2A 3LE8A 3WFIA 2NQ2C 4GQIA 1DADA 4QM7A 1TE2A 5EC1C 5KYGA 1IY0A 5CXUA 1CT9A 1MB4A 3IT3A 1DJOA 4Z9YA 1N2CA 5LP1A 4MICA 4OQQA 3TZKA 2ZIEA 3C90A 1XOIA 1AQIA 5JDIA 1U7WA 3VBBA 1MVNA 3M3DA 1UR5A 2IE0A 3OHSX 3M2PA 3CF4A 4D6YA 4IVQA 1U2QA 1CF2O 2AOTA 4MTGA 5BXZA 1A4IA 1MX1A 1V41E 2B20A 1XZQA 3DEJA 3Q2OA 4HQFA 4RGBA 4ZEOA 2II6A 1SVIA 3QJGA 5AJUA 3VHXA 2PMDA 3TB4A 5E6RA 2Q49A 3LSQA 2ODQA 2X0DA 1XXLA 4M8KA 3KCXA 3A06A 3Q8HA 2R00A 3AQ4A 4I1OA 4LVUA 1I7SB 2PGAA 3A11A 3ZXXA 2CE4A 1NVEA 1PS0A 1YDWA 4PDMA 2ZUVA 1ZR2A 5DRYA 2HWXA 3H9CA 2VJBA 3JRXA 4JR0A 1O6BA 1Z2NX 2DY1A 1J7KA 3GNQA 4I4NA 4A4DA 2FSFA 3CW8X 2BGWA 4MNTA 2LPMA 1CZHA 1TZJA 4IY1A 3ZMVA 4C6TB 1GEEA 4KTTE 3V8EA 2WYUA 5LJIA 1ZZGA 1E6UA 5GVRA 3FYUC 5BSUA 1UC8A 1NVTA 3NIFB 1B3QA 3K05A 1JXQA 1IWBB 3II6X 1CJBA 4I46A 4RZHA 1GTOA 4Z0NA 2XNDG 4URUR 4ARBA 2DXIA 4PA7A 4ZA2A 2A5JA 3OO0A 4GP7A 2E89A 4F3RA 3KR1A 4OQFA 4ARUA 1H8HA 3PWZA 3W9YA 1NT2A 3O21A 3HYLA 4BTLA 2W11A 4BVJA 1DQYA 3MT7A 4PXAA 3DWGA 4RETA 2Y6UA 3NEAA 1U2SA 2NU9B 2WPDG 3B6NA 4MRPA 5A5GA 1IJKA 2YJ5A 4AKTA 3S0WA 1V39A 3U60B 4JL6A 4RL6A 3W8EA 1Q0RA 4ER6A 1QAMA 1EQUA 2E1RA 4RHXA 3S8MA 1W581 3NVAA 2C58A 4R68A 4YCJA 4BTVA 2Q9UA 3V4OA 3PJRA 1YUBA 1PTJA 2R6FA 1REQB 2RDCA 1RA4A 4HAXA 2SNIE 2ZSAA 4GGMX 4KOEC 4BB0A 3PEWA 3ZLVA 2LW7A 2R8PA 1DXQA 1YKFA 2NSLA 2H2HA 2GA9A 1JJOA 2JJ1G 5CXSA 4D6TH 2Y93A 4WL0A 1KMIZ 1NX9A 2GBLC 1IBLO 2UYYA 4YRPA 3SR0A 2MCFA 3T3GA 3HCAA 4GKJB 4M60A 4FM9A 1SC9A 1MB2A 1KEWA 4MLDA 3W5DA 1OTXA 3CS3A 1OD6A 4ND8A 1K5HA 2R7NA 1AZTA 3FSJX 3CRZA 4Q16A 3SYNA 2BFDB 3NUGA 1FW8A 1MO6A 1W87A 4MLPA 3EGXB 1ONOA 4JBYA 1EFRG 5AJZA 5EQDA 2PA3A 3DO5A 1CJCA 3RS8A 2FW9A 1L5MA 3AETB 2HO5A 3DQZA 4NBUA 2NMVA 1T9CA 3I04M 4UDYX 5JW6A 5IRCD 4HTFB 3WLFA 4PPNA 1GUYA 1P5RA 3UOAB 2Y6VA 3VZCA 2FWMX 3G1WA 3FMFA 1A7UA 1P1HA 2C8KA 2HT1A 1QS0A 4WLNA 3TTSA 5A06A 1J2TA 2IP2A 3B1JA 3ENQA 1K7EB 1XRQA 1H2MA 1GG9A 2VJLA 1QYXA 2HS3A 4QYSA 3CLTD 4RVDA 3MOGA 2HJSA 1P5JA 3LCMA 1RADA 2CUTA 3GZ4A 3IQGX 4CMKA 4J03A 4IEIA 1SOWA 4LDQA 4ABTA 3SR2C 3JVHA 1QHSA 4HD8A 1UDCA 2YV1A 2H5JA 2YZKA 2PS1A 4JI2B 3RVJA 3PEYA 1NRXA 1QRSA 2FPIB 3UMMA 4UXHA 3OURA 4DR4O 1CP9A 1CC1S 2YWHA 4CU5A 3ZZNA 4JC0A 1C0LA 5KTTA 3F0GA 2KSQA 2P6PA 1JEYA 1PV0A 3WADA 4DJFC 4QOGA 2ST1A 3VC7A 4EQ6B 3OMIB 1PQ4A 2ATKC 1KKMA 1KC8W 4YALA 2JAOA 3IPRA 4UU1A 5A4KA 4KI0A 2JGDB 5E7QA 2B1GA 2GTIA 3M5PA 3ZI7A 4JLMA 2XYQA 3OONA 1P4SA 1WAMA 1NNLA 3R3SA 1T0PA 4DBLE 1CQJB 5D01A 3ZHXA 3BRWA 5H5JA 1E69A 3EA4A 2BF7A 2VXBA 3DMRA 3GNLA 4PDVA 2VXCA 1L7OA 1ZJZA 1ZOSA 2IEIA 2Q3FA 4LBYA 3DBIA 4EW3A 4AMBA 5JEDA 3REQA 3A1DA 1K75A 1N6PA 1PNRA 4ZYWA 1T5OA 4DCTA 5CDYA 1G5QA 1E2PA 5MDHA 4G27B 1XNQO 3CEIA 4TKVA 2F9MA 2NVWA 4MW9A 1N2IA 4GI1A 4ZARA 2EWVA 5TMEA 4G07A 3R7SA 3BJIC 5DK6A 2PXXA 4O0MA 2OT3B 2HQRA 5EMMA 4CODB 5LN1A 4REQB 4BO8A 2PBLA 2WG1A 4RVCA 2JEXA 3AERA 4TUYB 1FUUA 2X6BA 3AIOA 3SZLA 1A2KC 1B3BA 1O08A 2I8LA 4EGSA 4ZV4A 4L5YA 4MYRA 1CETA 4J3NA 1CF4A 3HDYA 2XIQA 2N75A 3VBCA 1N2SA 2O1EA 4C5BA 1OZFA 4FYYA 5TQ0A 2QTOA 1R3UA 2PKQP 4C7BA 4F2WA 3AU8A 1UBEA 1CY7A 1XD8A 4NG4A 4GX2A 1PQUA 3OJCA 4RPJA 3RGWS 1UBMS 2X19A 4GMFA 4PZ0A 3LUDA 4E07A 3IRUA 1YQXA 1Y66A 2JS3A 3PGXA 3ZGVA 3DDNA 2G70A 3ENNA 2GBLA 3MILA 1G16A 1LQ2A 1Y4MA 1EP2B 4E2WA 2G17A 3D02A 4WKPA 1NM5A 3B78A 4YRTA 4FMPA 1FJHA 2YXPX 2ZZKA 1RHUA 4W1RA 2PZAA 3ZDCA 5TS3A 3R0XA 5EJ4A 4RSRA 2RGUA 2VWHA 1KO5A 1SWWA 2VTBA 2RBGA 1T25A 3NUZA 5K20A 1VQPF 1IXRC 2GYWA 2WFLB 3H5AA 5ILQA 1FOEB 1LFAA 1QVAA 3LYHA 2EHDA 2UZ3A 4DR6B 1OA1A 2HQBA 3SYQA 1DX6A 1X1AA 1NWCA 2G4CA 4BN4A 2IEBA 4CUZA 5HS4A 3ERCA 4A6DA 3M1XA 3DE7X 5LDHA 2AFIE 1ZLXA 2HMSA 4GSYA 4IXWA 4TM8A 4NVPA 3HXLA 3AGQA 2PUTA 3ACBA 3CLUD 5G0VA 4E5KA 3Q4HA 1AXEA 1S1CA 4IIBA 3DTNA 4WZAA 5LC1A 2R6R1 1HR0O 1Y5RA 1XT6A 3TQQA 2A30A 3CF6R 3T7IA 1IUOA 3MUNA 3DFZA 4DK1A 2XWPA 4EITA 5LLTA 3VDMA 5JS8A 2IHNA 1W93A 3AV0B 3ILXA 3BKXA 3DNFA 1VI2A 2HD4A 3WB1A 3RW0A 1SQBH 1JDUA 3LWRC 3FIJA 4LY9A 5DYYA 1NQUA 1CW2B 5B7QA 3CFYA 2Y1LA 3R5JA 3HU1A 3FPAA 3LC0A 2E49A 2CFOA 4OHXA 3T1CA 5KNDA 3AILA 3GUUA 3OPYB 1YB1A 2KLHA 2GESA 2O14A 4N0MA 3WJ7A 5LMNB 3ZNNA 2Y1GA 4Q12A 3ETJA 1GAQA 6YASA 1CQJA 3GVHA 3I55F 4ZKIA 4RUFA 4EJ6A 1YOBA 2A2ZA 3FHOA 1UFOA 2O7NA 4H6VA 4AJPA 3WIVA 1YXMA 4TZ0A 1C1XA 4FLFA 3IMPA 5LNK6 4MR7A 3UUWA 3NP7A 4LK3A 3V6MA 1VPEA 3NYRA 1T5BA 3AR3A 4GI2A 3RVQA 4AJ9A 2ZIXB 5HP7A 2IZ6A 2FMXA 2F3RA 2QN8A 2JHPA 1FBNA 1OJHA 3FFXA 5KTSA 2V54A 1HMPA 3JW8A 4L4RA 4B4UA 4HDKB 2PM8A 3DEZA 2EGHA 1LWOA 4E13A 5IEBA 4DV7O 4EI7A 2JBWA 4N23A 4DXWA 3MCQA 2JK0A 3HVIA 1JJ2F 1DAHA 2O2EA 5C9ZA 2OG2A 4R8CA 1JV2B 3EWIA 2OA0A 4OQ4A 3ZD9A 4EPYA 5DN9A 5G1OA 5H4GA 3WBJA 5K9ZA 2QR2A 4LJKA 2DYRB 3K1ZA 1T0IA 2WYOA 2KI5A 1N5LA 3KQMA 5G1NA 4PLCA 5AUQA 4X7BA 1H9CA 4KAFA 4H1UA 4OHKA 1JU4A 5ELXA 5KYWB 1U1IA 3QLJA 2DVMA 4RWEA 4OXXA 5IF9A 3G8BA 4QO8A 1H0SA 4OL0A 2X5KO 3EXG1 4U7PB 1C3XA 1F7VA 2IM9A 1AKTA 2WILA 5K2OA 3T9AA 3JQAA 1SCJA 4RS4A 1SQXH 1B6TA 1CHNA 2V3CC 1E18A 5T8KA 3ZLTA 4FTWA 2HNAA 1X38A 2B8NA 1MLDA 4MW5A 1NONA 4HAMA 2I4IA 2W2MA 1JPNA 2YHIB 4OXIA 2PX2A 2FZCA 4FONA 1DLIA 2QQGA 1SIUA 4PAMA 3T34A 1TYCA 2C4KA 4J0FA 2BDEA 2WWXA 4Z99A 2JD2A 3FNIA 1EDEA 1NMXA 1ZVQA 1GLVA 2ODNA 2P6JA 3O38A 2DFDA 3PC7A 2JDIG 1B3RA 1EBFA 1HK7A 2VPTA 5FBLB 2M7WA 3HZOA 1WB5A 4OTZA 2FB9A 3U62A 4DCPA 2C7OA 2G4VA 4UTXA 4AG6A 2A0WA 4EO7A 1EDBA 4KO3S 1AQNA 3U4AA 1Z5VA 4BN5A 2PS9A 5EK0A 2XMCA 2W6PA 2HYIC 3E27A 1T15A 3K0DA 1NF3A 2FZEA 3KG2A 2WBLC 2ZT5A 5IVPA 4L8JA 2EYUA 1Q7YH 2HT6A 2WMOB 3RSZA 1X7PA 16PKA 3LDHA 2PA0A 1G18A 4F5ZA 5BR1A 1OT3A 3EZLA 4YUZA 1RWMA 1CUDA 2WNSA 3IVCA 3H11B 3A10A 3ASVA 4BVFA 1TJ3A 2VG8A 3HL4A 4FCWA 3M34A 4H3KB 3RHZA 1XFAA 4L5AA 1JIXA 3N07A 3A27A 3KSAC 2OWDA 2ICAA 3D4BA 3SF8B 2QORA 1B8OA 1AQUA 1E9DA 1QCCA 3WBBA 2OHJA 2VRNA 2P2CA 1QP8A 3C70A 3G8YA 1Y4DE 4UASA 3KU1A 3LFTA 4LF8O 2ZDIC 3AG1C 1HE1C 1JTVA 2E4UA 1KKLA 3N2IA 4U9IS 3R7FA 5C7YA 1EAMA 2Z08A 2W4QA 1HT2E 1V11B 2FQXA 4AJKA 1G4AE 1ODCA 5AHXA 1GXSB 4I36A 5FL7D 1SRYA 2YV2A 8OHMA 4O2BB 3E3OA 2C8JA 2V7WA 1YEWA 3SDSA 2VEDA 3NHYA 3UMSA 1UMBB 3EG5A 1HG1A 4A3SA 4R0MA 5HKLA 2LKCA 1Y7TA 4KEAA 5EJIA 4YRRA 3VDXA 2QT0A 1S8OA 1XZEA 3ZJVA 4NV1A 1E0JA 1QVGF 3UW3A 2C96A 5EKDA 2OAEA 5DBEX 4D3FA 4I1PA 4W6ZA 1K89A 4F2PA 3FHJA 4LYDA 1G8SA 3G9QA 2QU7A 4MMXB 2FG5A 4URYR 3B5JA 3EUAA 1M56B 1PSWA 2OLEA 2ZJAA 4N3NA 2FSGA 4M1OA 1UPUA 3GQBB 3GCGA 4Z8YA 1QQ7A 1LGYA 1KI7A 3SM9A 2WLLA 1RE1A 2OV6A 4IH4A 5CVVA 3GJSA 2IH2A 4NCAA 1R3IC 5TR9A 3UK0A 4BVBA 4BFLA 2CFIA 4U2DA 2OTCA 3H1TA 3R5SA 4DR7O 1Z36A 1JPXA 3Q9LA 3RYIA 1V16A 2TMKA 5HE9A 4BRZA 2QR4A 2E4ZA 2OQ2A 4Z4GA 4JQOA 3EYWA 3D00A 1KH3A 4D9EA 4EHKA 2IH4A 4QTXA 5H3HA 5CFPA 2DMRA 3V8VA 2Y92A 1SPBS 3LF2A 4IHAA 3QX3A 1T9HA 3W79A 2WIJA 1FDTA 1N1MA 3PR1A 2H7CA 5BXQC 4G4YA 3VQYA 1MNQA 2R1TA 3ELWA 3TLMA 4YIOA 4BV2A 4FLZA 2FPGB 2VHEA 3F5TA 2XB4A 3FPIA 1P4GA 3CCBA 2OT5A 3C3AA 3K6RA 4IS2A 4P30A 2ODMA 4G0YA 4YVFA 2UVPB 3L6RA 3SSMA 4MARA 3K9GA 1LJUA 4QD3A 4Q66C 3AG7A 4PX5A 3LH5A 1QV6A 5DX1A 3K94A 1WR8A 3L7YA 4CNBA 1TZMA 3MIIA 3QQ5A 5IBQA 4PYJA 4ZJUA 4C87A 1K3EA 2OIGA 1W25A 3H2ZA 4D56A 2IEYA 1OI2A 3JSNA 4FILA 2DR2A 3QW2A 4D9IA 4TOIA 1LDGA 5LMUB 3BMNA 3HGQA 3QU7A 2R8BA 2OYRA 4Q4DA 4MUKA 5JJ5A 4JHXA 3Q5EA 5AVWA 2AHRA 4Q01A 1R8SA 2AWOA 1UBNA 2M6YA 2FPUA 1U2DC 2Q0SA 3C5WP 1UPAA 2B4AA 1MGOA 3E3LA 4FNAA 2MINA 5DYTA 3C7DB 4DPKA 4EFKA 4FVTA 4HNSA 1GCUA 5F1PA 1JFTA 1YCGA 2Z9DA 4RCYA 1FK8A 4TMZA 3PUXA 1M93A 2ZXWC 3KQNA 3HNOA 4A73A 4JXZA 4CKWB 1P39A 1H2YA 2A3NA 4W8OA 4EHLA 4KH0A 5LD2C 3RSCA 1ZM3A 3VSEA 4GHWA 3Q11A 2H0RA 4BPRA 4DQ0A 2OTLF 2ECKA 3UMVA 3CYPB 3OEHG 1B14A 4MIYA 4TSFG 2R2AA 3IS3A 1RP3B 1P3DA 5L51A 1SN7A 4MKRA 5GZ6A 2D6FA 2CDRA 4KVAA 1H2NA 2X8JA 3NYWA 3JX9A 3GJRA 1XTVA 5CA1A 1RWNA 3GEBA 4AP9A 3Q7TA 2VAXA 1DX9A 4JJ7A 1KQSF 2F9ZC 1EX1A 1LKZA 1QDUA 2YWRA 5J4KA 3P26A 3RHTA 1NSYA 3ZDDA 1ORIA 4K9RA 5JSQA 4UCSA 3I9JA 2HJHA 3STYA 4QUHA 2R9VA 2Q9LA 1QGAA 3S2UA 2XZLA 2A9OA 2DR3A 4ZOLF 1U8TA 2JZNA 1EZ1A 2IAFA 5I9BA 1A98A 4GZ3A 3O4FA 4HKTA 3G23A 3QVKA 4X00A 3TMAA 5CT6A 5FWYB 3TR5A 4U4AA 2JFXA 4DOMA 4BASA 3FR7A 4FJCC 1ESZA 1IY1A 5E38A 1X1CA 2QXUA 2IWHA 2EKQA 3G5MA 1ZZEA 2OWEA 1HLGA 2KLBA 2JGDA 2R70A 2XAQA 3K0EA 3QJYA 1WKCA 4E31A 3ZE7A 4Z9FA 1VECA 1Z3IX 2VP9A 4BAYA 5LP6F 3ROZA 2VLIA 3AUAA 3D3QA 2W2OA 3LVRE 3JALA 1XEFA 4NEQA 1VCMA 1JAIA 3PRYA 4H7IA 4N6GA 5D3KA 4F60A 4F96A 5FCDA 3GLGB 1NY5A 4P98A 4F6RB 1H2BA 4CLRA 4UHBA 1GGKA 2ATVA 2QU8A 4Y7DA 3DV2A 4OQNA 2PQ2A 5DW0A 5TS2A 3GZNA 3V4SA 1SR8A 2CE7A 1XTUA 3A6PC 1XVTA 4IMIB 2IV3A 1SZXA 1O4VA 3E23A 1YI2F 3Q9NA 4FGSA 4KN9S 3R0QA 3TR0A 3P9CA 4JYCA 3V80A 5BNTA 3LA8A 1MEOA 1M1NA 3AG4C 1DAKA 1V9SA 3DFIA 2CNKA 3DYBA 3HVJA 3T7RA 4D98A 1ACJA 3DEYX 4AICA 4FN5A 4IGIA 3CMEF 1I5XA 5IT9N 3HBLA 4IIUA 1ZIDA 2VPIA 2YHUA 3H9UA 4JGIA 4MW1A 4AN0A 3LZCA 3QPDA 4WLFA 2AT1A 1DKRA 1DKNA 2H52A 2BDUA 2IS4A 2QD2A 1K9MH 1GAJA 4ITRC 1M1ZA 1VLLA 4DYDA 4HLUA 4HBGA 2G1JA 1FTYA 2FW1A 3HB5X 2BM8A 3NP9A 4DCSA 5DK4A 2XA1A 1H2ZA 3MJHA 5K1PA 1K5GA 3IULA 2A5YB 2WA4A 3JPYA 3HG7A 4CS4A 4BFUA 3WLQA 4BRSA 4HAYA 1KH1A 4XLTA 4OU4A 3SYAA 1E77A 2BZ0A 3MAGA 5AP9A 1AK9A 1OCEA 1Z0DA 3CR8A 3FFQA 3FPLA 4KI7A 4C7KA 4M0CA 1BE6A 4LXXA 3HCPA 1D8AA 3AX6A 3DE2X 1EK2A 1N1DA 2AI2A 3ME5A 4R5MA 3S68A 4EGJA 4EG6A 1WE2A 3EPHA 5IC5A 1J1ZA 1VMGA 2HSDA 4TV9B 2FZKA 3KM0A 2FYUH 5IKMA 1Y7PA 3SX2A 1YB4A 1D09A 3K04A 2HMUA 3LSYA 5FUXA 2J9FB 3MT9A 3OIDA 3RADC 1P3JA 3QWIA 1PZMA 1NQAO 1QYWA 1SERA 3G3EA 2ZIAA 2I99A 1C9EA 2WJ3A 3GIWA 1RPNA 5LQSA 1Z5WA 4WXYB 4BJHB 1SZPA 3HCNA 4QE3A 1QGED 4RENA 4KPUA 2PZBA 1S72F 4JB0A 1X8XA 2A0YA 3LPLA 4OBEA 1OC4A 4FR2A 1ECLA 2W6JA 3SE0A 2CMDA 2ZRDA 1EU1A 5FUMA 5INTA 4H1WA 3QKRA 1J07A 1K86A 4RHCA 1EUZA 1UQUA 2FR0A 2VH1A 5I4IA 5IYZB 1I7DA 2G8LA 2DCUA 4CC5A 2NU6B 4I2NA 3GLVA 2EBWA 1EAYA 4J2TA 3GGPA 5JSYA 4F91B 1EP9A 2TMDA 1FKAO 1ISIA 3F74A 5FTWA 4ENUA 1QV7A 3A2KA 3SKYA 1OZAA 2IOFK 5C8YB 4ZZ0A 2E74B 2JBAB 4FGLA 2HWKA 2QRVB 4FZRA 5GVSA 1JXMA 5G3ZA 4FB4A 1ZQ9A 2QQ5A 1B16A 3MWDB 5GTDA 2H1OA 4M76B 3KLOA 4R9NA 1ODJA 5D6OA 2O3RA 4I55F 4QPKA 5EGSA 3S2ZA 2I1VB 4AP5A 3FWNA 4D8UA 5DCWA 4ZDKA 2JHCA 3IQEA 4NBLA 1SHJA 4KXRA 3VOSA 3UOWA 2G38A 2ZE6A 1L5YA 1SO8A 2QQFA 2WLTA 2YN0A 3KKQA 3ZRWA 2PEYA 3FB1A 4NFYA 4DJDC 4OYHA 5C81A 1T8PA 2WF8A 2RB5A 3LTEA 3TZEA 2C0CA 1ATIA 2O6LA 2JRIA 2N3ZA 2QD4A 4EA9A 1PL0A 3WLTA 1KAGA 4MRRA 4DCNA 1VL1A 3LKZA 2HPAA 1KZ1A 3JYLA 4OKSA 3D9QX 3LHDA 1XPJA 5J1SB 1XMXA 3STZC 2VBCA 2JIZD 2BP7B 3PDJA 3QY9A 4CLEA 4BO4A 2VQDA 3HWX1 1ZI9A 1AP5A 2DQ0A 3DFFA 1KNKA 1Z5GA 3JV7A 3OM1A 1EBUA 5EP3A 5AVKA 4AW9A 1SCNE 4K86A 4CN8A 5DN6D 2D2CB 1XCLA 2HRZA 4YRSA 1CRZA 2F3QA 5CA1F 4N21A 3PBKA 1OWLA 1I7PA 1DKMA 3DC6A 2HJWA 3R5FA 4AY4A 8AT1A 4NU6A 3KDPA 1F0NA 1N6HA 5CHEA 5FYQA 4DZTA 2GPNA 3AV3A 1ICEA 1K4MA 3MMZA 4LNAA 4HLUC 2SKEA 1ISSA 5COQA 2CXUA 2HHAA 2ZT6A 2FPPA 4OYYA 4PN7A 1TKRA 1TL7C 2G5TA 1GPYA 1PG0A 2HQSA 5DM2A 3SS9X 1P5FA 4PWTA 3VMFB 5AI6A 4ESVA 3SYCA 1FJXA 1P9OA 1TGOA 2WWFA 1ECBA 3GAMA 4YP0A 1U2GC 4XIIA 1AMOA 3ZHUA 2P9CA 3OQ1A 4CMIA 5BSMA 3MAAC 4JI2O 1KFJB 4QGHA 3LI2A 1Z4OA 2WG2A 2GZDA 1PR0A 3KJHA 4Q4HA 4KITB 4DSNA 2BDTA 2H7XA 1QAQA 3VZPA 3GPBA 3WLKX 1BROA 1IAQA 2O2IA 3FA2A 1JLMA 1T10A 4JR1A 4IIGA 3L43A 1TXGA 1MXFA 3GDOA 3JQGA 3A3OA 4C78A 4H37A 3L0BA 3KLBA 4BNVA 4MV1A 1ZWZA 1DIHA 1GV0A 1Y9AA 2EF0A 3ADOA 4DARA 1T9GS 2V7BA 2XMRA 4PC3A 2KBFA 121PA 1ZONA 3QVNA 3V32A 3BE6A 4UVCA 4TWJA 3MB8A 4BMPB 3FX7A 5FADA 3GEIA 2V9ZA 3S99A 3WBFA 3RUDA 3CX4A 4KK3A 3JD1A 4OK3A 3O4VA 1OAPA 4PDRA 4JR2A 1FUKA 4U7GA 2CLDX 1AKEA 2ZULA 1H2GA 4NH4A 1VF6C 3T1VA 1XN1A 4JT2A 1LW6E 4IHJA 1PFKA 2ZTSA 3MJCA 5CDHA 5ALTA 3A37A 1Z4IA 2ZSIA 1NXSA 1YDFA 3ABKC 1I4EB 2ADFA 4HNRA 3WQQA 3WU2Z 1KEUA 2XVYA 3TTVA 4KBYA 2WZQA 3WX0A 2A9JA 3KXDA 2Y1OA 1HOTA 2V1XA 1PHPA 4NMWA 3RS4A 2H31A 3ZHOA 4BFXA 1WXWA 5KYXA 3CHYA 2WKQA 2ZYIA 3G89A 4YCNA 1NR1A 5EIBD 3E86A 4OBBA 5B4UA 2MSCB 1XVUA 3O3MB 5AICA 3RRXA 4N7RA 2JFPA 1DBWA 3DBLA 3IO3A 3AUJB 3K9LA 3NEJA 3O2SB 5M04A 2IU4A 2IIVA 1JQDA 3P2YA 2CJWA 1L6RA 2TECE 3C3DA 3D8UA 3JARB 3NORA 1G0OA 1FDVA 3QX8A 2R85A 3R3ZA 3GJ7A 1WS6A 4KX5A 3LVQE 1U6JA 1IBSA 3F6EX 5IWAO 3H18A 1BRTA 1C4WA 2VUUA 2XQJA 3UHOA 1HDXA 3PT5A 2Q1WA 1FSZA 2E6KA 3QHPA 2Y67A 4OQYA 3ZY6A 2HSEA 5DYWA 2IP4A 1IHUA 3N2NA 2O4UX 1FJGB 3SXJA 4ZK2A 2GXUA 1TZ2A 1E2UA 1EM8B 5DM1A 1TYAE 3GAZA 2OILA 3GO4A 1JAHA 5DYNA 3T4PA 2HO4A 5BMOA 4S05A 4S1VA 3PRJA 4HAIA 4J7AA 3ZCXA 1EFRD 1OV4A 4YN3A 4A8TA 3L9DA 2OCAA 1X0VA 3HA3A 3ZE9A 2NSYA 3W8FA 3KVRA 4F3CA 3JQQA 3TPZA 3KTAA 4LX8A 5HKOA 3G0HA 5CBPA 5JHGB 3AHGA 1QMGA 4FYPA 4R0VA 2C3OA 3DE4X 1M8JA 5DECA 4DYLA 4FR5A 2UZ4A 3B1ZA 4JYBA 1CERA 2NUTB 3CONA 4K9KA 3C6XA 1PK7A 2WWGA 4KFTA 4YJKA 1U6IA 2XGSA 5A5EA 1USWA 3KIPA 2XDQB 4Y9SA 1NVXQ 3SIWA 2GCEA 3B70A 4ESOA 1K9SA 1EUYA 2ONYA 4CEJA 5FOXA 1NBOA 1JE1A 3PKJA 3JSXA 5A3SA 1IJFA 1GU7A 3DG9A 2JKYA 2W7TA 4LPSA 4RIIA 1AHNA 1G5RA 2O7RA 1C0EA 3R8XA 2XNCA 1AUQA 3WR5A 3CVUA 1DPFA 1G1MA 3F4LA 4TQAA 2F55A 4K28A 2GUZB 1P33A 2O2ZA 2I71A 2QYTA 3C6ZA 4LN1A 5HGJA 1N6RA 4EARA 5BUQA 1DEOA 1XAGA 2CZWA 4OLAA 2WLIA 3NV9A 1VQ6V 4E22A 1BJRE 3CZAA 4NZNA 1W0KD 1AI6A 2Z0AA 1N3BA 3ILYA 3JATB 1T5TA 2OGWA 1W3EX 3OMWA 5C8XA 4NE7A 2GSMB 2PWAA 3HGTA 3OZTA 4AZ3A 4DWOA 3Q1LA 4P3XA 3AY0A 3P5SA 1WSAA 1WW8A 1L0NH 3FF1A 2EZ4A 3G1UA 5JI2E 1I10A 1M6HA 3GUZA 2F8TA 2PO7A 3U0VA 1PFYA 4DA7A 2BAGA 5C34B 1M76A 1WXEA 4WCFA 4DQLA 2OUKA 3QF4B 1FJ2A 3ESQA 2P2LA 5CBPB 2OD7A 4NU5A 1QYDA 1RM3A 2Z5LA 3W04A 5FDFA 1GX1A 2I33A 3ANXA 3CSUA 3NG1A 4UUPA 3BWYA 4AT1A 3OEYA 1IC6A 5AIBA 1KRWA 1HLDA 4QASA 4IILA 1F4LA 2OAQ1 5E95A 2LFRA 4A2CA 4ER5A 1FJGO 3CCQF 1FUIA 3CCJV 1ZNXA 2WLNA 3D1JA 3LWZA 5AHOA 1AKUA 3JWIA 5DULA 1EM1A 2Q3LA 4TQDA 4DBLC 1LDNA 2FCAA 2PK3A 3CX8A 3R5HA 3JQCA 2K5UA 3QUBA 2V0GA 2N04A 4MA0A 1PD3A 1CVIA 1FQWA 4GLFA 2UUBB 4JMLA 1W44A 5EXSA 4LQCA 1QBZA 3ZHRA 5FTJA 4BO0A 3M4NA 3B51X 5DGXA 5MN5A 3GP3A 3P9XA 4LRTB 2CZQA 4MVJM 1QO0D 5FPRA 2AJCA 2A1UB 1CZRA 2IP1A 3HJHA 4YB8A 3VNRA 4CUJA 4QDOA 1M5TA 3NBYC 4B6OA 1UK6A 1JJIA 3EEFA 3W4JA 2RGEA 2FQQA 1LNZA 1CYDA 4GX5A 2PH5A 1YBHA 3IBGA 3HADA 3AG2B 1VPVA 4QBTA 3BTSA 4MRMA 1N6KA 5GINE 4WEOA 4KLRA 3FCEA 2BGKA 1ZLYA 3RU7A 4PC1A 3KYCA 2OCPA 2NZ2A 3IDSA 5G53C 1UKZA 4IMJB 4TSFD 4ZMBA 1L4LA 3UJAA 1Q7CA 3IUPA 4NR0A 1VZ3A 4IDFA 4A7PA 5HF8A 1ABBA 1NAHA 1H5NA 4Q48A 1M10A 2QTCA 1TM3E 4KGVA 5CMLA 4YRLA 1ZJYA 1RZUA 3RC7A 2ZRHA 3VYTB 2GNAA 4D3XA 4A82A 2EC5A 2OZLB 5I4BA 4ALKA 1X1BA 2OV3A 1PR9A 3K16A 2C4NA 3WLEA 4EHNA 5IDQA 5E1BA 2JEUA 2PPLA 1PG5A 2JRLA 2EWCA 1EJBA 3NM6B 1A7KA 4N01A 4XR4A 5BNIA 4M89A 3ZGYA 2ERXA 3QA3E 1ESDA 2YWDA 1Y5NA 4GPIB 1XROA 2EP5A 3F67A 5JATA 3ASOB 2HQOA 2ZYTX 2CLFB 1E9VA 2K9PA 1JF8A 3CO5A 1UM9A 1UPCA 2P7HA 3CRW1 3SYOA 4G2TA 1Z12A 3BDIA 3WRYC 1KC3A 2HA3A 3H1JH 3B1VA 4XVCA 3JVDA 4D57A 4EENA 2VPYA 3IMGA 3UK6A 3WMXA 2OKGA 3EC2A 2RK3A 1HEUA 2PY6A 1ZGHA 3HHEA 3KDSE 4ZZ2A 4YRAA 4TRRA 5DH9A 1HRDA 3KP1A 3BWMA 2ZAMA 3E82A 1JQ5A 3G0CA 1PNLA 3CWBH 1N0IA 4PIMA 4QVKA 4ZPJA 5GOZA 3TOXA 1KZGB 2QLJA 1AHPA 1M1KH 3SPCA 2OXTA 3JTEA 4ER3A 3DZGA 2YXYA 4ZC1A 2RGXA 4GEGA 1FLDA 3EEQA 4LYJA 4BQIA 4XUCA 5L95A 2D3WA 1U96A 1FF9A 2ZZNA 1TAUA 1RW4A 3A14A 2CNNA 3WGYA 4KRYA 2ZITA 2O8BB 5AK5A 5A5VA 4U7TB 4RD0A 1MQ9A 3OF3A 1GYRA 3OKFA 4QFCA 5KSWB 2G9NA 2IQQA 2LIVA 4LH6A 1Y3BE 2PJDA 3DKIA 3VTFA 1S3SA 1DHRA 2F95B 1FE8A 1R37A 3M70A 3RN4A 3OX3A 3V2HA 1ZESA 4B6QA 3QHQA 3AVWA 4BFCA 4DJTA 4GVLA 3E9MA 1QD9A 1AKRA 4OQLA 2A1TR 5B1BB 1X70A 3GW8A 1ZGZA 2ZB7A 2IYYA 5FTLA 1OB5A 4CIDA 2GSDA 2J0EA 1L8DA 3IP7A 3EORA 3T94A 3PSAA 5CMUA 3TLKA 3F3YA 1ISJA 2JFOA 5BVHA 2VYVD 4A0GA 3KJJA 2JGNA 1V3VA 3KZIZ 3CXCF 3OP1A 1J39A 4BRWA 4DNQA 2UZ0A 4QAJA 3UGTA 3NXKA 2XCUA 1QRAA 3OICA 5BOVA 4BVTA 4DSZA 3UKMA 4XCVA 2FW0A 3Q15C 4QQKA 4NCXA 2JAPA 4DUYO 1BTOA 1WCXA 3AFNA 4Q9NA 5IDJA 1JGTA 3KR2A 4HAVA 1S2LA 1M5IA 2Z1DA 4FLEA 4WN9A 5EWRA 4ZI7B 2QWRB 1C3LA 1JKJB 1Q43A 1KMHB 2OE2A 2Q2QA 3A9CA 1L4UA 4WKGA 4BO3A 3G2HA 1N75A 2I5PO 4E4EA 4FCCA 2J48A 4NP6A 5D7BA 4I5GA 4YRJA 1M1YA 5IN4A 4MS1A 4B71A 1L5GB 2H16A 3M5DA 4LJLA 2EJTA 4PLYA 3KC2A 1ZSVA 3A9UA 4MYTA 2XKKA 1QVWA 1Y74B 5A62A 1L5ZA 2CXHA 2C7GA 2XCLA 3G9XA 5DHFA 4ZV7A 4OJMX 4YRGA 5IMSA 3O1HB 2Y1CA 4NZZA 2G0TA 4RU1A 3WYBA 3KTAB 4EG8A 3JQ6A 3EHEA 1S7CA 1TW3A 1ZSNA 3GT4A 4W7IA 2M6LA 3MINB 4EYGA 8ATCA 3BJZA 4ZCSA 3K0FA 3SBDA 4LF7B 3A1UA 4WNCA 4EYSA 1XU4A 2KQUA 3KYJB 4HXFB 5AUNB 5LA6A 1PT8A 4HV4A 5HYVA 2WJWA 3CNHA 1RYZA 4PY2A 3DHNA 1Y1SA 1SU6A 2ZT7A 2I3DA 2I6DA 4ZVSA 3Q3VA 4D44A 2YIDA 1NN5A 1Y80A 2SCUB 2WJHA 3NB0A 1EZJA 1RZ3A 3R6LA 1WB9A 4RTPA 4O33A 4LZZA 4ZHQB 2HBQA 2GPTA 3H05A 3AHDA 4EUKA 3ETEA 2VF8A 5FOSA 4CWAA 3HH8A 3H2JA 5BORA 2PSJA 1ES9A 3QOXA 3U48A 2FN4A 1ULAA 1MZEA 1TQ2A 1XDGA 2KJQA 4WZZA 1QZUA 1YJBA 5AT1A 2QQEA 2XQGA 4RORA 1Y98A 5BQPA 4M87A 2VK4A 1R6BX 1ZMTA 2RAUA 1MD9A 4BKOA 4ZKEA 2JEZA 2VKQA 4DT1B 1KP3A 1FP2A 1OAKA 2ZS8A 3K09A 3KEFA 2BTQA 1OBOA 1Y3HA 1G5FA 1YBAA 2O52A 4Y9UA 5F9MA 2ZCUA 3H4IA 2J5QA 1NG9A 1EH5A 1O6FA 3I1IA 3R6WA 1JSLA 3E9NA 3LY8A 4MB6A 4ZC8A 3RWBA 2O19A 1I5EA 2AYZA 2EIJC 1DFIA 3W3AH 3ISTA 4MO2A 5B3AA 4O08A 2CL6X 2JJYA 3KV1A 2QUBA 4C6SA 1B41A 1IFXA 3CG4A 4NU8X 3OCZA 3V6LA 4IOLA 5JAUA 5J47A 1SQFA 1E1RG 1GYQA 4P4TA 4HY3A 4BLWA 3ABKB 3KD2A 2NV6A 3K14A 1WXQA 3ONEA 4LRQA 4RK6A 3ZHQA 4MR8B 3A4VA 4OP3A 3LKVA 3UZUA 3ZE1B 4D8WA 4EABA 2QE7G 2W4MA 4NXNB 3AEXA 4OFXA 4CIVA 4GX0A 2I1WA 2ZYAA 1DC3A 2NUTA 4TYNA 2EZOA 5D5QA 4FHDA 1J00A 3Q5GA 2IEDA 1GN4A 1HURA 3ZMSA 1PZFA 5GAJA 3NOQA 3IKMB 4D0RA 3RANA 2FPGA 1N0NA 3EWNA 3PTAA 2AFIA 2FDXA 1WVIA 2V7QA 2WZCA 3D3WA 4IQ4A 4IV5A 1W48A 2XGOA 1OH7A 1XU7A 2ZKOA 1UMDB 3LQKA 1GUAA 4WF9V 2VLBA 3BGDA 4HYTA 4DJJA 1XJWA 4AO6A 1FPQA 3F7NA 4N54A 2X1MA 1BHJA 5H4HA 5FWXB 3CISA 3RUEA 1QWSA 2QTHA 1RMYA 1XU9A 1PGPA 4CS2A 4PZAA 4LDZA 3TL3A 2WVAA 5IU6A 4E5MA 5E4FA 1LUAA 3CCLF 1FB5A 4QOHA 3T52A 4CFYA 1Z22A 1GYPA 3FMIA 3B7GA 4I99A 4KN6A 2GILA 4K3UA 3EPKA 5ECGC 1NOIA 2FTKA 4DRXB 2DSTA 2MMCA 4HWRA 4QPDA 5ENZA 4BFSA 4LECA 4EO9A 2SICE 4JGGA 4RKRA 4PYLA 2V7EA 3CNLA 5EWMA 1YA4A 3CD6V 5ALJA 3SR3A 5BSKA 5GMOA 4L2IA 2L69A 5AXBA 2VJQA 4B2IA 3DDZX 3WGKA 1Y8RA 4ERXA 4L7VA 2QM3A 3I9OA 1D07A 2VQ6A 1PL7A 3QPBA 1Y3CE 3FB4A 5J58A 4C0HA 2YXDA 4JLPA 2BE3A 2XAGA 4NCIA 1YMVA 5FOUA 4XVQA 4L5CA 5EO3A 4OKIA 4NB5A 3T41A 4QG3A 5JY1A 2BGRA 2YYAA 4N3AA 4IL6Z 1IZZA 1BWPA 4J9UE 5T4HA 4QUAA 4HNAB 1W42A 2OFFA 4F8YA 4OB8A 1JIVA 2C8VA 1TZKA 1U7ZA 1O8CA 1XWWA 3PAFA 2XUFA 3V5NA 1XAIA 4EI8A 4PLPA 4K35A 1SY7A 1TUBA 1NLZA 3C3YA 3CCQV 1MHPA 1VLHA 5ALIA 4ZICA 3BS4A 4MA4A 1RP7A 3LPAA 2AMFA 1VQ8F 4RY9A 1T6NA 4L76A 5CP8A 5IJAA 2BKXA 2OZBA 2P4EA 1T36A 3FOCA 2QLTA 3NDPA 3U4CA 5ISMA 1L1QA 1P9RA 2W42A 2BH2A 5ER9A 5EWMB 1C1YA 1E89A 3I12A 1DGQA 3BEHA 4LF7O 1UBGA 1WY7A 3BE5A 3L49A 2YNMC 4IG9A 4OU5A 4CRWB 2Q73A 2IZ1A 4IJVA 4HG2A 4HEA1 2PMEA 5KNLA 2XR1A 3WLMA 4EPXA 4HN2A 4RHAA 1EK5A 3ZWWA 4DRYA 4UOQA 2H06A 1WEKA 2B30A 3CH4B 3FB6C 3QWAA 3GFVA 1R8JA 3FUVA 4XYBA 5FT9A 5ENDA 1NASA 1M56C 4X1KB 1UOQA 1Z18A 4HFRA 3WS7A 4EJFA 2NU8A 4P08A 3VCZA 2K6GA 3TNLA 2JAUA 4YUYA 5HZGA 4XCQA 1CQWA 2H5LA 2ZRNA 3EULA 2JS5A 4GLBA 4X24A 4A0FA 2VP4A 4E6PA 2XCIA 2XNDA 3HVUA 3WSVA 2QENA 3NALA 4F84A 3PFWO 1A9OA 4I81A 3VYWA 1TUEA 1CUCA 1QRDA 1TYEB 1LRKA 4MTFA 5KNDD 1XO1A 3D8NA 3F8TA 3ORSA 3CBGA 3GGGA 1MT3A 2P65A 3R5KA 3RSOA 5CCXA 1E9CA 3EZFA 5D2CA 4RTNA 3FWPA 1P91A 4R7TA 1IV1A 3LX5A 3NBUA 4TWZA 3SX4A 4B74A 4I1UA 2HR3A 3EPRA 2Z0MA 3KVYA 4KQKA 5EXEA 2AJDA 2E75B 4BKPA 2HWYA 4XYMA 3ICEA 3QXHA 4HL6A 1E2DA 1XFDA 1KC8H 4TLEA 1RZRD 2OHGA 1W0JG 4DXDA 4JI5O 3EARA 2C84A 2HFJA 1JHDA 2NTJA 3E9YA 4EECA 4GXTA 1PJAA 2DWPA 3BWVA 2IYQA 3CNQS 2FR8C 3GLFA 2QBYB 1VQ5F 3NX4A 4IIHA 1NTMH 2YJ4A 3OEEA 4I9QA 1E1QA 1CZUA 1U9ZA 2IYLD 3CPHA 3PC4A 5F64A 3TG2A 3QYAA 4DXHA 2X40A 4E51A 1BL8A 2H29A 2JVJA 5ALNA 1ENYA 3A4LA 5FH9A 1JKFA 2QX9A 3T3MB 3WJ1A 3KQUA 3G2KA 4KNWA 4JLJA 2FLKA 3F96A 3G2PA 3RGBA 5B6PA 2REQB 1KD1W 2JAHA 3GD5A 5IT9A 1PQWA 3NOOA 1JAYA 3JCMM 1L7PA 3MELA 1U7OA 2AFHE 5I3CA 5FR2A 4RDCA 1C7QA 4G4JA 2WTEA 1J1UA 4YASA 2ZRJA 1P29A 1K33A 1T9KA 3FLMA 3VTZA 4QEDA 1FEZA 2I2FA 3KJEA 1X42A 4UQPA 3K8OE 2FMKA 3AUTA 5ULLA 1YXBA 1CEQA 4YQFA 2JVIA 4HQ6A 3AGPA 2BGGA 3CLHA 2PAAA 2VSNA 3PSHA 5EE3A 2RQ6A 3HB9A 3LY7A 4ZAVA 2OXIA 3JSAA 4Q1VA 5AJWA 4O6VA 3RRZA 2H65A 5LFAA 2C4MA 2CW4A 3J7TA 4UAVA 2YHSA 2GM4A 3P9ZA 4N5HX 3CZCA 4PO8A 2ZJBA 3TI7A 4ZVRA 1HTBA 3D2BA 3OQHA 3SLRA 4DREA 2FQWA 1CZKA 4MQ5A 3RKUA 3DL4A 2GJ8A 2QIPA 1VSUA 4FCTA 4DM4A 5HZMA 4ZO7A 3RRMA 5L8VA 4M99A 2RARA 3L0ZA 1DT9A 1W5BA 1P7ZA 3QKRB 3ON5A 5JANA 1MA0A 4BPBA 4J9VA 4CM9D 2JFZA 4X65B 1BKYA 2DLDA 1LH0A 3L7JA 3WA6A 3M6VA