4ZOLB

Crystal structure of tubulin-stathmin-ttl-tubulysin m complex
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
430
structure length
430
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 177
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zolB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zolB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zolB01
3RYHB 1TUBA 1W5FA 4I55A 4IHJB 4O4IB 5IJ9B 5LXTA 4I4TB 2BTQA 4ZHQB 5LYJB 3C8LA 5M7EA 5C8YA 3VPAA 4E6EA 5EIBD 3HKCA 4O4LA 4X20B 2VAWA 3RYIB 5EYPB 4WBNB 5LP6B 3RYHA 5EZYB 5CA1A 3UT5B 1W581 4HNAB 3CB2A 4FFBA 1RQ7A 5IJ9A 5KMGB 1W5EA 4B45A 5MN5A 3JASB 3HKBA 4U39A 3VOBA 4EI7A 4ZOLB 5C8YB 3RYIA 4YJ3A 4EB6B 3ZBQA 5EZYA 3HKCB 4O4LB 3WGJA 2R6R1 5IJ0A 4DRXA 4HNAA 1W5AA 5J2UB 3JALB 1W5BA 5IYZA 3VO8A 5CA1B 5KMGA 3HKEA 2XKBA 3RYCB 4FFBB 3JAWB 3E22B 3JASA 5LA6A 2RHOA 4ZOLA 5JVDA 4F6RB 3HKBB 4EB6A 5KX5B 4ZI7B 5JH7A 3M89A 4YJ3B 5CA0A 5J2UA 1RQ2A 3JALA 2Q1XA 5LP6C 5IJ0B 4DRXB 3RYCA 3WGMA 3JAWA 3E22A 4X1KA 5IYZB 4B46A 3M8KA 1JFFA 3HKEB 5J2TA 5LA6B 4F6RA 1SA0A 5KX5A 4ZI7A 3WGKA 4O2AB 3VOAA 5JCOA 5JVDB 5ITZA 5JQGA 2XKAA 5JH7B 4O4HA 5CA0B 4XCQA 5CB4A 2VAPA 2GVIA 2RHLA 4I50A 3VO9A 5GONA 4TV9B 4U3JB 4X1KB 5MN4A 1JFFB 3WGNA 3ZBPA 4LNUA 4X1YA 4O2AA 2RHHA 1W59A 5J2TB 3JARB 3WGLA 1SA0B 4YJ2A 5FNVA 2VAMA 1FFXB 4O4JA 5LOVA 5ITZB 5JQGB 1RLUA 4O4HB 3JATA 2R751 3ZIDA 4M8IA 4TV9A 4U3JA 5CB4B 4IIJA 2BTOA 4I50B 5GONB 4TV8B 3JARA 4TUYB 4O2BA 4LNUB 4X1YB 3HKDA 4X1IA 3RB8A 1FFXA 3N2KA 4YJ2B 5BMVA 3R4VA 5FNVB 2Q1YA 4EI9A 4O4JB 5LOVB 1TVKA 5EIBC 4KWEA 3JAKB 3RYFA 3JATB 2RHJA 4DXDA 4TV8A 1OFUA 2VXYA 4TUYA 3N2GA 4IIJB 1FSZA 3V3TA 4O2BB 5MN6A 3HKDB 4IHJA 4O4IA 4X1IB 1TUBB 3N2KB 4I4TA 5LYJA 4ZHQA 5JCOC 5BMVB 3JAKA 4I55B 5LXTB 2BTQB 1Z5VA 1TVKB 4X20A 3RYFB 4WBNA 5EYPA 4EI8A 5LP6A 1Z5WA 3N2GB 3UT5A
chains in the Genus database with same CATH superfamily
4MAAA 4CWAA 3DEKA 1S3FA 2A35A 4DLWA 3VPAA 4OXKA 4D9GA 4UJ5A 2QZSA 3Q8XB 4LRQA 4FXOA 2NU9B 4AO6A 1MC4A 3D3JA 3RK4A 1M83A 2G5CA 3KUUA 2ZRKA 1H65A 1OH8A 3C41J 4FLTA 2PZJA 3FPCA 3ICEA 3V7EA 5BN5A 5JYBA 1U3WA 1JPJA 4OK6A 2XI4A 4HXFB 3AK4A 4J7KA 5DNDA 2DT5A 1A97A 3X1KA 4UEWA 4MA4A 4G41A 3GRKA 1QJCA 4TWAA 5L4LA 3CXCU 1DOHA 2OM2A 3LGXA 5ITZB 3DE5X 5G1PA 3ROEA 4TV9A 2F4VB 3OQPA 5LYJF 2XYPA 5A1JA 2WAAA 3JQ7A 1QMGA 3EXFA 1V25A 5BRAA 3IXLA 3A2KA 1S9DA 4LDRA 3PPVA 1T5LA 3ABIA 1YE3A 1XSEA 3E0XA 2BFMA 1KRWA 1UMBA 5JS2A 4CM4A 1LK5A 3HB9A 2PKEA 1A9PA 2BOCC 1Q0HA 4M1OA 2ZU6A 1Y8AA 1NM5A 2AHOA 4F3NA 1JE1A 4TS9A 4J49A 3OT1A 2AZ4A 1CLEA 1LWOA 4RHTA 5DTRA 4ZVLA 3LC7O 3ZWNA 1IOLA 3AU8A 4YMGA 3IESA 4DUZO 3AV3A 5ENZA 1D1TA 1RHQA 2O06A 4FLWA 3QWIA 2OD9A 3OKPA 4L6CA 3GLFB 1LNZA 1A2KC 3HZHA 1JY8A 1IBRA 3P0EA 4M1SA 3INYA 3SXUA 1SQPH 1YZQA 4DV5B 1D03A 3UF0A 1E2PA 1F1JA 3ODPA 4FR2A 3TX2A 2EBFX 3AEUB 4U02A 1TUIA 2P2DA 2BMEA 2Q3HA 4I7ZB 1LRKA 4ABMA 4GYYA 2Q6TA 3CLUD 3QOXA 1XG5A 4X1IB 5JDIC 1BWSA 2H4XA 1W0JD 2CNBA 3QMVA 1VMGA 4M8LA 1OGIA 3SY8A 2I4NA 1NVWQ 5JOQA 3GGSA 4GEKA 2FR1A 4C03A 2XE4A 3ZE7A 4NOJA 3WDMA 5TQVA 3BD9A 1KMHA 4RLQA 1GQFA 5FOVA 4LTDA 3BJIC 5JFOA 2CVQA 3DL7A 4FLFA 1C9JA 2I4MA 2QM4A 2PS1A 5KYXB 5J2UA 4ZK6A 4FILA 5EPOA 2VYND 3ROKA 3GLUA 1K63A 1DG1G 3NHKA 4DQKA 1SB9A 2H2AA 1QU7A 3WZ2A 2C9BA 4LZLA 4WNAB 5L45A 3A3NA 4Q1DA 4I50B 5TPWA 4ILEA 5BMVA 1QD9A 4HS9A 2E74B 3B77A 1WR8A 4PC7A 5CVTA 1ZI9A 3B4SA 2DBYA 3EDOA 3LC1O 4M38A 3FZQA 5LMZA 1KYIA 4BIIA 5FLXM 1WAZA 2VXOA 4I9FA 2NN3C 1ZGZA 1XWWA 2C5AA 3AHDA 4JEMA 2OG1A 3RUDA 1DUVG 1M74A 2E21A 2J0UA 4GPAA 4K6GA 4ECEA 1I36A 3EVTA 2XHBA 4JUDX 1E1LA 4OHUA 3AVYA 3MOIA 1KVTA 4ZMRA 1Z2AA 1JU3A 5LFAA 1DKLA 1F2UB 1RWNA 4JU8A 1CK2A 4B3BA 4QJ4A 2QG9A 4PI0A 2P1RA 1G6Q1 4K26A 1T5EA 1RKVA 4LW8A 1XA3A 3W78A 1X87A 1NLYA 2RFLA 3HSSA 4P33A 4NZYA 4ZCIA 4MI9A 2F4VO 2X5NA 5TVKA 5BNWA 1KO7A 1DWPA 3MYYA 3UO2A 3BE5A 2KB1A 1Y5LA 2FX3A 1M6EX 1VB3A 5CDHA 1EX6A 2X8WA 5CFQA 4IMRA 4HYEA 1VKHA 3FUTA 1JIVA 1RQLA 1D2EA 2LP7A 2YJGA 1U5CA 2F64A 1RYNA 4QXAA 4XUEA 4N7BA 3W3AA 5CB4F 1RFLA 2KG4A 5CYGA 4Z2WA 5L3QB 2GQ0A 5SYAA 2ZYUX 3ANSA 1VHDA 1NPDA 2VIIA 1N6PA 5BSVA 4YXWD 4MX8A 4J9ZB 1N3YA 5KVQA 3UMCA 2WLSA 1E1YA 1YJCA 1GR1A 4R7GA 2VAPA 2FW7A 4LJSA 4X90A 2JJ8A 4NV3A 4PQRA 3LUCA 3RWBA 2DLCX 4YAEA 3H01A 2ZJ0A 1OXBB 4GGOA 3PF9A 1UBEA 4MKHA 2ZCUA 3T2MA 3SZRA 1Y66A 2XTMA 4KZPA 4G2KA 2NSJA 1IVSA 3VSAA 4DV5O 5BRJA 4AY3A 2VNAA 5BOVA 2BV3A 4PLPA 4L87A 1KA9H 4J8PA 3OY2A 5FPHA 2JD1A 3D36C 3EMVA 4PTZA 3RTCA 5HDQA 2I8AA 2BC9A 3QIAA 3WIOA 3HNPA 1D8AA 1VQPF 4B4VA 4G23A 4RTLA 4BGDA 3CC2F 3WNDA 5KWEA 1UK9A 3VOUA 2YMMA 5KWJA 3LUDA 1Z36A 3HR8A 4IXDA 3S2YA 3ENNA 1FYWA 3MSCA 1ZMRA 3HJFA 1ZXBA 2XNDD 3R7LA 4C78A 1OJLA 2Q6LA 3AU9A 3P3NA 4HYOA 4GI7A 3OQIB 2DBRA 3LW7A 1E8DA 3F49S 3P97A 2ZRQA 5JQGA 5L3GA 1PVDA 4XYMA 1YJNF 3PXEA 2CH7B 3SZLA 4QFMA 1YCFA 2B8NA 4HB4A 4K3AA 5IBCA 1F6BA 2GN2A 2ZVDA 1E8MA 3MUEA 3G2PA 5IULC 3EIWA 1UDBA 1IJEA 3NJ8A 3RHZA 4K88A 1T3GA 4EAQA 2Q4PA 3KZ1E 3MJFA 1ISIA 4OOFA 4YJHB 4LG1A 3MS2A 4CM1A 4RXMA 4EQ6A 3A6GA 2XF2A 1WMAA 1LDEA 2BZ1A 1X8KA 1CQXA 2IA5A 1LB1B 2BGLA 2AG8A 3CCMV 5G4UC 1SOMA 1R50A 3ZE1B 4KO3S 1FMFA 1AGYA 1JLLB 3LHIA 4S3MA 5E0OA 5B1BB 1BA3A 2DTXA 4UTPA 2ZZMA 1TEXA 2QL6A 1LLCA 1KARA 2IIVA 2FXIA 2XCTB 4L2IA 3HA2A 3LMKA 1P7PA 2JDIG 1W96A 3H8WA 5JS1A 1GO0A 3UWOA 4JVLA 4XLLA 3VKGA 1YXBA 3OOSA 1EA7A 1KFEB 3UKJA 3FYHA 3QNWA 4BP3A 1W40A 2B9ZA 3ORFA 2X40A 2WALA 3GHYA 1FMJA 2YYEA 2OO3A 4KQIA 5AVSA 2FVYA 1T0KB 2KPOA 2FPKA 2CFIA 1INLA 1JA1A 3EHDA 3BXHA 1ZEJA 2X4LA 2XZOA 3SHVA 4P7FA 2QMEA 4S12A 2EKPA 4Z3KA 4ZVSA 2JATA 1T2FA 3MCWA 1SHKA 3H2BA 3GRUA 4R3NA 3QQ5A 3VXKA 5TMEA 3R7SA 3OWHA 3OY7A 4IMIB 1AKQA 2WJYA 4W6QA 3HUEA 4GD3Q 4RU1A 1PM9A 2OZVA 4P3PA 1JHXA 2JIPA 1MA3A 3NYQA 1WETA 2ZI3A 2P4QA 2DOKA 3C3AA 1XVVA 2PGLA 3R74A 4AROA 1XZPA 5KTYA 1G21E 1XIVA 5BVGA 5AQEA 1N5MA 3QTBA 1NQ5A 3G7NA 1IHUA 4QVIA 4EGQA 5BWCA 1NP6A 4BP8A 2C4WA 4RV4A 4MKGA 1X1DA 3KEGA 3X2SA 2AZTA 4RHFA 2FTKA 4YAKA 3K9AA 3ET5A 1IXMA 2CVFA 3H04A 5BV8A 1PR3A 3R2JA 1SXJE 3Q6MA 4ZICA 1XTUA 4G9BA 4C7JA 4DMUB 4WBNF 3N8GA 5BQPA 4FKMA 3AG3C 3HDJA 1KYQA 4OLJA 3IO5A 4E7OA 1NLUA 1QAQA 4YMIA 1Y1LA 1XHZA 4C0SA 4HDKB 4PSAA 1RWPA 3INGA 5H02A 1XBIA 1KK3A 1OXUA 1JG6A 2R7NA 1BAPA 5DLYA 5DM6V 3ZU3A 4N76A 1VK3A 4AQYB 3JQFA 4RM2A 5FXMA 3E6AA 2O5CA 3C7AA 3D7NA 3WKCA 3IIEA 4PCUA 4KQ2A 3RYIB 3RT1A 5SYNA 1E7SA 1NYLA 3PWZA 1WMSA 1JHQA 1JPNA 3IOMA 3OMNB 1BKSB 1YNOA 1FDWA 1FFAA 1S5PA 4TKVB 2JAHA 3CPQA 2ZYDA 1QDUA 4UZSA 3X2FA 1ZSVA 1ZM3A 3UPUA 2WD7B 4OHKA 1Z34A 4P54A 4B5CA 3ZRWA 2ZRIA 3L4EA 3CXRA 1T9KA 2XV1A 2M6LA 4OK3A 4EEKA 4Y2HA 5JS7A 3HH8A 3GFPA 1UMDB 1KPGA 1Z8DA 3LP6A 3FOWA 3WB9A 2G0AA 2P0YA 5KOHB 1GT6A 3KX2A 4DJ5X 3G49A 2CWJA 1N6IA 1QTQA 5EQJB 4GCZA 3RVLA 2NTEA 1UOPA 3LT2A 1HLDA 3B9PA 2YWRA 4WDRA 4RLFA 4HQRA 3S27A 1PLLA 3NBMA 3SKXA 2EX3A 2ORED 1AUQA 1EX9A 1S2MA 4ITVA 1SKYE 5FPQA 2WUGA 3P0RA 1VQKV 1C1DB 2ES4A 3BX1A 3P10A 4JAAA 3RTBA 1K9SA 1T1SA 1EWYA 5EMHA 1JEQA 3T3NA 3S0YA 5JDCC 5CA0F 1KWGA 3OUTA 4YCJA 2PY6A 1SKBA 3N76A 4PYOA 2CBZA 4EYQA 4C7VA 2A0WA 4V2UA 4YRSA 3EUFA 3GUHA 3OD1A 3HR0A 3S2FA 1E79D 1PEDA 3NB0A 3ACDA 2CLIB 1FD9A 5C3UA 2VQ3A 4HDSA 3RE3A 2BO1A 1VQMV 1YZBA 1ACMA 4MIYA 1U96A 1IV2A 3NG1A 3NZEA 5KDLA 5IT5A 1T6YA 1TRHA 4DQUA 3T4UA 2Z3WA 4NDNE 4RD2A 2L17A 3FTNA 4EK9A 3LUAA 4FCWA 1BMFD 2TSYB 1A27A 3T9AA 4IQ0A 4C4XA 2C2ZA 1WDWB 3ISJA 4ZPXA 2BKLA 2DM6A 4YJFB 1UOEA 2DFTA 1CDZA 2JLAA 4A5SA 1M54A 3QJ5A 2C94A 4YQYA 5F52A 3ZH9B 2JIQA 5JNLA 1G9SA 4XIYA 4FOPA 2IHYA 4U8HA 4CL0A 2CJXA 2FL4A 4JB8A 4R0MA 4YR9A 3GEPA 2WSLA 4Y1FA 1JAHA 3TD6A 4E03A 3EXG2 3SE7A 2HRQA 1ZWKA 1NATA 3C7KA 4I66A 4PLFA 4D5EA 2R25B 4KODA 4RC9A 1OCRB 1OYWA 4OSEA 1N78A 5C7OO 5DO9A 5T6BA 1M2HA 1KOLA 4UARA 3W4KA 1PWHA 1G5QA 2JBAB 2YJNA 2HF2A 1AF4A 3F6CA 2YNMC 3AVTA 4QREA 2P78A 1TZJA 1E8NA 5KNDH 1YL6A 2FWMX 1HNXB 3VH2A 4O6VA 3EG9B 3LW8A 4RHYA 2IEDA 5E95A 2Y71A 1YVUA 3IDOA 4NR1A 5E2AA 3WGQA 5CBHA 2JANA 1P2SA 4DUPA 3LNMB 3GVMA 4L4XA 1XQ8A 1ODCA 2IH5A 3A37A 1AGXA 2SKDA 4LBZA 4JD5A 1TW3A 3LT0A 5BYAA 1L7AA 2I3BA 4G0QA 3P4EA 4ZI7F 5CIWA 3E2EA 1CRQA 4HJRA 4H1HA 5IP5A 4AQYO 2M9MA 5CNKA 3L8EA 5C5EA 3ONDA 4UUBA 2WU4A 4QWMA 1CP2A 4ENTA 2BFNA 4UCXA 3I5MA 3KJXA 1W46A 2FPGB 2HGSA 4MR7B 3BKXA 3UCFA 5JS6A 2BM1A 5KNCH 1F9AA 2G9VA 3A6DA 5C7LO 1OW3B 1H2ZA 2WVJA 1OB5A 4KU4A 1OSNA 3NHMA 3F7VC 2HS0A 2ZT6A 2COEA 5DN6A 4N5LA 3D4LA 3BK7A 5FHQA 2IUEA 3RSOA 4AI8A 1TOAA 3VSEA 5EB1B 2F1OA 3M6XA 1QP7A 1PFYA 1T4CB 1NSTA 4X7PA 1JR3A 5DM60 2EIHA 5BWLA 4WY5A 3RJ9A 3HUUA 2DTEA 2E4ZA 3K94A 2CWDA 2RH8A 3FPLA 4GLLA 3H19A 3ROZA 3DBLA 5ABPA 3MQ4A 5K8TA 2V7VA 3I28A 1FL9A 5FO0A 1V11B 3OECA 4IGFA 4IEEA 4Y67A 4LJ4A 2ARKA 1FS6A 1Z39A 2ZUSA 3J7AR 1YDGA 3EZXA 1RD4A 5EJEA 1JEJA 3U7QB 2REXB 1YRAA 1U40A 3ZIDA 1XKXA 3UM9A 4ND1A 2L26A 1VGQA 2WT8A 2IOFK 3QO5A 1NC1A 1UT6A 4JSYA 1HRDA 4KG7A 3G5LA 1KC3A 2O8FB 3B1JA 1C9NA 2PEZA 3N5CA 1G0NA 1Q82H 4G5GA 3PHHA 4MHOA 2DG2A 4NCAA 4C14A 4LJ6A 3RLIA 2WHEA 1ZVMA 5TPZD 3C3SA 1YQEA 1H48A 4UMEA 2QW0X 1DO0A 5EQDA 2NUPB 1L5WA 4H4EA 2M2IA 3K08A 1RLJA 3TQIA 5EN4A 1C14A 1ONNA 3PXBA 4ZARA 2JS3A 3G5AA 1GUZA 1EVYA 1H05A 1AI6A 5A6VA 4M7WA 3ADDA 5IAEA 4OY3A 5F35A 1MH1A 2A30A 3WQBA 3DZIA 3T61A 1QHIA 3D59A 2O1SA 2YIJA 2C83A 3RB8A 1CZUA 3JCUZ 4BT4A 2O4CA 4NMWA 4Y9TA 1Y9AA 4B6RA 4FYXA 2Z1NA 1B23P 2X4IA 1WZ2A 3EIFA 5LXTB 3R5XA 3JD0A 2XX3A 4LWSB 4FMCB 3F0TA 3AHHA 3Q3IA 1V48A 1UJ4A 5F7OA 3EGDB 3CS5A 4RVFA 3TVYA 2ZBVA 2WYHA 1XN4A 1UUFA 3EEFA 5DULA 1QHEA 4Q01A 1HNXO 2AYYA 2BFCB 4E15A 3VR4A 2ZGVA 4FGSA 4KPUB 5E1AC 2B25A 5T64A 3RYCB 5FBZA 3ZLJA 4GRDA 2C0PA 2JHAA 1HE1C 4MO2A 4LF5B 1MJFA 3UG6A 4URWR 3T3GA 2QYHA 1PS0A 4UATA 2V98A 3V4LA 3WTCA 5ERYA 3KPYA 5JROA 2OYSA 1JUDA 2FPRA 3W7XA 4FFNA 2PKYX 2ACEA 4EI2A 3KQYA 4HGOA 3OUZA 4WFKA 2EZ9A 3T1YB 1Y3BE 4XJSA 4G4VA 4FTWA 3WBBA 1FTWA 2CL6X 4CG1A 4G9EA 1JIXA 3W9UA 4PVCA 4DGQA 3RC2A 4MIKA 4ND2A 2DVMA 3CPHA 2FZCA 3WL5A 2GNOA 2ECPA 3KJEA 4RKFA 4WLOA 2YZ2A 3OF2A 2F66C 2MK3A 3B1FA 5CURA 4BEVA 2RHOA 2IDZA 3RKRA 5KZMB 4QEKA 1K8QA 1IM5A 1QHYA 1AI7A 4R9RA 3HB7A 2DYSC 4XAQA 4JROA 5EXTA 4DDKA 2GBFA 4LOHA 3RI3A 4IIJF 3AW9A 3CE6A 1P9NA 2BYTA 1EM8A 3LWOC 1GNRA 5ALEA 1A9SA 3MWLA 1PT7A 3CUYA 2B7LA 3GI1A 3AL3A 4WACA 3FVRA 4WA7A 421PA 5CVCA 2PS0A 4BECA 3ZE9A 4Q24A 5IPFA 1JXQA 3FRHA 3CWZA 4M9SA 2GAJA 4G4SO 4J2OA 4KLRA 4GW3A 1L4YA 4BNNA 2GZ3A 1PJ8A 1NXVA 4R6WA 4MS2A 3ROXA 1F12A 1KIMA 3IKMB 3GB7C 3GEMA 5MGBA 4MR9A 1U7WA 3HJUA 5TQ0B 4K8RB 2G8LA 1KI6A 3ICWA 1YVPA 2XZDA 3K4QA 5EZYB 2Q8NA 3IBTA 3TFOA 2CLFB 3ZKAA 5AVYA 2HJ9A 3AM1A 2I1QA 1ZNZA 3UUFA 1E96A 2WNIA 2A9JA 4UU1A 5LJIA 2TYSB 4BMDA 4UCOA 4DLZA 4WOKA 3K6SA 1G41A 4ZVPA 1U8EA 4CUKA 3IHTA 2F17A 4QFCA 2WSYB 1Z12A 3DYVA 1DV1A 2I55A 5A2QM 2JAUA 2OIEA 1ZD9A 1MG0A 4KVZA 5J5VA 2AMFA 4WCEV 2PH5A 4Q66C 4DBZA 2HW8A 4KSCA 4HZGA 2EWVA 2QGZA 2OC9A 6ABPA 5A3SA 2DT4A 3H9QA 5FEUA 4IFEA 5CXUA 3PGXA 1PEAA 4GOKA 4YN3A 4AJ1A 5K0EA 4Q7LA 5MFPA 1RAGA 4ZJZA 4BNGA 1QNFA 5JAMA 2DBVO 1I33A 1NLMA 4G09A 3TBHA 3LVBA 5GINE 1U2DA 5A5DA 3HGTA 1NVMB 2W7TA 1S7CA 2BFDA 3CZ9A 4MVYA 2QX8A 3DFMA 5TLSA 3OUSA 4QOIA 1VM6A 2Y66A 4MUEA 4X92A 2W6ID 2ZANA 4FDMA 3C9TA 1MR3F 1JR6A 2P68A 4D98A 2QX7A 1JHYA 4P3KA 4Q9JA 1OD6A 2H9YA 4UHBA 3A4NA 4QGFA 2EBUA 1SA0A 2GEDA 2O23A 3PA6A 3LNCA 2GR9A 1MAWA 1B26A 3ZBPA 1OYVA 2X1HA 3THSA 1VQ7F 3NHBA 4QPZA 4LF5O 2GHRA 3MCAA 4IUCS 4LXQA 3I37X 3WQRA 5ALHA 2IIBA 4D6PA 3A9SA 3PENA 2H00A 1ZVQA 1LLDA 4KKVA 3HZZA 1TD9A 3MMPA 5BSTA 4FR0A 1I7NA 3HO6A 1C7FA 1SC9A 3GRPA 4ALLA 1UBJS 3L5OA 5E1BA 1BXZA 1L5NA 4NY1A 3EEBA 2BWJA 1E3DA 4O1IA 4WDQA 5ALPA 1ZONA 4FKBA 3WMWA 4QTXA 1REQB 2PQ0A 2B30A 3ZHCA 3UJCA 2CHVA 4RJ2A 4PAGA 2P5UA 2P9EA 3L6BA 3CLSC 4L9WA 4CF7A 2JIBA 4PNZA 1VRCA 4K9OA 4D4JA 3UJBA 4N40A 2WTAA 3EC1A 2B83A 3U44A 1AB5A 1LSSA 3IEXA 4MMZB 3T0FA 5HCUA 4ZI3A 3RAFC 4OH1A 1PL7A 1PYGA 2AGAA 4BX3A 4UDYX 2AW3A 3L7DA 1ZGGA 4HLDA 3ICVA 2PSSA 1UKEA 3I42A 4KN8A 2V7QG 1H1TA 1U4SA 3E8XA 5GIOC 2JCXA 5C1PA 1NV9A 3GJ4A 2I66A 1N0NA 2OCYC 3D7LA 4BN0A 5FUVA 1HWYA 4EI8A 3CW8X 2WF5A 3S7TA 5DYNA 3P71T 1NXWA 3ZGXA 5E4YA 4DREA 1YT5A 3OMXA 3GPLA 3GRRA 2PE5A 1K7YA 3WRYA 4OQDA 5B1OA 3V8PA 1VE3A 4N47A 4LRSB 4S1OA 1KBHA 3DFFA 4CC5A 4B74A 1A9XA 3V34A 4RBNA 1I6MA 2H7XA 1GFSA 2JKZA 3K72B 4LSMA 1AKNA 1WMDA 4HNGA 1NM5C 1QGZA 5K0BA 1YE8A 3N4YA 5K2MA 3IMKA 4OJMX 5LKAA 1VHQA 2NU8A 2HMVA 5FBRB 2ZWVA 2GEBA 3VC1A 2IPNA 3JX9A 4GG1A 4P4SB 4LHZA 4Q7KA 3DL4A 2VQ6A 2ZUCA 4PFQA 4YB8A 4M89A 3QXGA 1CBUA 3JR7A 4OAPA 4H17A 5FA5A 3U0ZA 1ISMA 3O4IA 3BL5A 3QPWA 1KP9A 2IT1A 1QS0B 2CVPA 3A4YA 1BS3A 4BAZA 4JASA 3JQGA 5CP8A 2VUIB 3KOWA 4EITA 4A0FA 1RBMA 3AY6A 2VSYA 3DQZA 2C0CA 3OF3A 2CMDA 16PKA 1PV2A 3F3SA 1BVUA 2K7ZA 3LDFA 3GFOA 3ZBHA 4KO2S 3NCHA 2M6YA 3BTVA 2FMHA 4N49A 2KSDA 1ESEA 2NW6A 1GIAA 1Q1GA 4JBNA 3X1ZA 2LCAA 1WA5A 4CEIB 2OZLB 1RYYA 3TLBA 3OH8A 2CGNA 1OIWA 5K4HA 1M1KH 4CCAA 3GUVA 4MOWA 4RELA 1YF3A 4PEVA 4KFRA 2GYUA 1V6SA 2I33A 1I4DD 3K06A 1N5JA 1XEQA 4RHXA 4RW0A 3ADPA 4Q12A 2JH3A 5ES4B 4HJXA 2JEYA 1BX1A 3VAZA 4DIOA 1JLHA 2QPAA 2EKQA 3SOZA 3SJAA 3VDMA 3HPRA 1NBWB 3R5SA 1AZWA 4N9QA 5EPUA 3EX7C 3ORYA 1AHNA 1DC7A 2C59A 2UVPA 3ABOB 4D3YA 3OWXA 3PF8A 2YQ4A 3MELA 3DVQX 2ERCA 2ZYIA 1CY7A 3NXKA 3TCNA 3FX2A 1N8SA 4ZAFA 4MB6A 2YMQA 1FRFS 3K9CA 4FI3C 2H2DA 1W5FA 3HM2A 3D1VA 3JQ8B 1O08A 2JHGA 2FMUA 3TLAA 2H85A 3FCAA 1T8WA 8ADHA 2FA9A 3D6MA 1CS0A 1XQYA 3R7BA 3K2XA 1EGQA 1X19A 5KYUB 1TAEA 1E9BA 5JHGB 4CS2A 1AV6A 3WK5A 1R0ZA 1E59A 4RIEA 1H8EG 3TSZA 4W5JA 3S2GA 4OJTA 2H18A 4AMVA 2ZS7A 4E2WA 3VDNB 3MJHA 2PUCA 3N4ZA 4LVNA 2LXNA 3ETHA 1I7FA 3BSYA 2ID4A 3C1TA 1T9HA 4ZJPA 2VAVA 1AURA 1B73A 2QG4A 3RADC 3CCLF 4K81B 1LKZA 4ZALA 1QK3A 2EJUA 3CH6A 4FJCC 1NBOA 4UEQA 4JC5A 5G0SA 4MYSA 4H3HB 3HHPA 1RDFA 3LI2A 3Q3GE 4ZYUA 1Z3CA 3HJGA 4LSGA 4ZOLF 3T54A 3TN7A 1C4KA 4KXNA 4A2QA 3K9WA 4FMPA 2WAMA 1Y4AE 4BX8A 1TU4A 3QP9A 2O05A 3TTSA 3KJQA 1FFGA 4J11A 3SKYA 1UXHA 1U5AA 4H0LB 3TJRA 3LY9A 1R16A 1YFZA 4AVYA 2OV3A 2I9PA 3WXMA 3SYNA 3RSQA 1QYRA 1P6XA 3IP3A 4ZGGA 1OZ0A 2V9PA 2Q5ZA 5TS3A 4WOJA 4QL3A 2EIKB 3VBBA 2XVXA 3BQNB 5TSDA 4KNVA 1O03A 2NYRA 4OQFA 4I5GA 3G2QA 3OHPA 2IYXA 4MVSA 4ITUA 3AZQA 3MJ4A 1RP7A 3TIFA 4GEGA 1P2DA 3W8RA 1WA8A 1YDHA 3LECA 1B6TA 1L5GB 2HK6A 4DT1A 2HRDA 3SBOA 3HLYA 1G8GA 4CEHA 4IKOA 3DLIA 1F7UA 4EZBA 1Z0KA 2PUEA 4X00A 1ZTEA 3VYUB 1ZXLA 4HXYA 7REQA 3NANA 5KYVA 1K5QA 3J80N 3JVVA 2RIRA 3RASA 5GVRA 1BW9B 1N4DA 4NJMB 2O3UA 3DV9A 3UK0A 5EHNA 1DAEA 1R4MB 2PX3A 4MUXA 2XB8A 3H3XA 3ZGZA 3VNQA 2NV6A 4GOOD 2Z0AA 3S02A 2P4HX 5ECWA 4A91A 1XMOB 2PBFA 4IDDA 2O8BB 3G9ZA 1JJVA 2E7ZA 3BMNA 2WQ6A 1AN0A 5H8WA 4R50A 1I7PA 1C8LA 2W6ZA 1TMGE 2WP8J 3NALA 3TMKA 1AK1A 3TOCA 3WLJA 3TX6A 4BVEA 4WFBV 3PRHA 1DO2A 1ZW1A 3RVKA 4IG9A 3UYLA 2BH2A 1H2HA 2GBCA 2Q6VA 2GPNA 3OCCA 5C2JB 1M1YE 4GP6A 1MKYA 4DR4O 3QVMA 2GCPA 3CJHB 2IAFA 1RJ9A 2WYWA 1KNQA 2WJIA 3ABQB 3PHGA 3DZBA 1GNPA 1PZXA 4LYDA 1FIUA 3SPXA 2AOTA 1GTOA 3HCBA 2ZSKA 4OGWA 4LTMA 4XVCA 3OSZA 1KZ1A 2DQKA 1DCFA 4CQNA 1YSCA 2AJTA 1T2UA 1Q7EA 4UE6A 2PZAA 4EMSA 4FOLA 4Y1GA 2A4MA 2GLZA 2DKFA 2QTGA 1GO3F 3KKEA 3ADBA 4GAEA 2Q45A 4N7RA 1K08A 1J2RA 3TW8A 4YRZA 4Z4GA 2C3YA 4UHKA 2W8BB 2ZI4A 1IQRA 4YJGB 1HRKA 2UYNA 2D0DA 3UA4A 1T9ZA 4MYCA 3UB3A 4WY2A 3T4XA 3NBYC 4C05A 1DINA 3DC6A 3RVYA 3WX0A 1CS4C 1O2DA 3UWMA 4LE0A 1CV2A 1W34A 5AMXA 3ESBA 4ZT5A 4KV9A 5EWLB 1YVEI 3WGUA 1BSMA 5EWJB 4F1JA 2XCIA 4J0DA 1G18A 3SQOA 4J3FA 1U28A 5G0VA 4JDPA 4DIBA 1MSDA 4F9TA 1MOSA 3GUCA 4MTCA 1JT2A 1DT9A 3L8MA 1WE2A 2C8VA 4QBTA 1VG0B 2RGCA 4P4GA 5IVDA 3AHCA 5J43A 2QBYA 3HDTA 4J7JA 3BA8A 1V7QA 3C3XA 1QNMA 1GZ7A 5FOUA 3X1MA 3H5AA 5FLEX 1DHRA 4YV2A 2P3LA 4HC4A 1L4FA 5G0UA 3GJ3A 2OPBA 4KDRA 3K1TA 4UAGA 1YITF 4DWWA 1C7IA 1Z4PX 3BFRA 2ADOA 3UWPA 4F9GA 3FGOA 3VTZA 5HQTA 2JL1A 2AQ8A 2Y0DA 1X7WA 5K1XA 3B7WA 2ETNA 2FJPA 1UWLA 1Y1KE 1SRYA 1I9CA 3NDJA 2VQDA 3KKNA 5BW4A 3I64A 3JQFC 3GMIA 5LA6B 3M33A 1WVMA 3MMXA 3K0DA 3TW6A 4U3JB 1D5AA 4E88A 2HKIA 4HMPA 3IXQA 3MJCA 5DLDA 1YS2X 3K4HA 4RVHA 3CNLA 4B82A 2PWBA 2VJLA 3CFYA 1MCZA 3BIFA 1NQVA 1P4HA 2HB6A 3S8MA 1PP4A 1DF4A 4Z54A 4MS4A 1DAFA 3K71B 2QN7A 3H8VA 3F7OA 1XMOO 3G1TA 3VNSA 4A8JB 4DW1A 2VH1A 3H13A 5EHZA 1B3RA 2B61A 3OX4A 3HJRA 2KG7A 1E77A 3DDSA 1Z5NA 1M73E 3M1LA 1T6NA 3WXBA 4Q3CA 1FMTA 2H11A 2NOAA 2GXSA 4Z1VA 4RXUA 3DKVA 4N54A 4LRUA 4W82A 1EQUA 1GA1A 1UBSB 3BIXA 4HWSA 4D6XA 5FTJA 5K09A 3A4VA 1V47A 1ZI6A 4LJ5A 4IUBS 1RRMA 5LLDA 2C4UA 2CMHA 2VHVA 1YS6A 1JD1A 1VQLV 1U3DA 2NVWA 1XV2A 5IAJA 5KOJB 5JBIA 2YW9A 3VPBA 1CUDA 4GI1A 4UUQA 3AVVA 3DZJA 4CM9A 3THXA 3MWFA 5DASA 2QN6A 2EJTA 3MJSA 3H16A 3VDXA 2QT0A 2A9VA 3IA7A 3K5OA 4BTEA 4FLYA 3UJ8A 3ZTTA 3ETCA 1JDPA 3STXA 2QIOA 4BAYA 2JCYA 3TJMA 2A5LA 3I5XA 2ATKC 2MWMA 1ADBA 2VYCA 3ZO8A 4F3YA 2UUAB 1QUEA 4B1FA 3GLTA 3GROA 4XGKA 4YAOA 2WVHA 3RS3A 5I8ZA 2EJRA 4Q48A 2HV8A 3TJTA 4LX0A 4B3RB 3C6QA 4JLMA 4JQSA 4Q9KA 3NNNA 2O3JA 1RXCA 5FUBA 3UIEA 4YCCA 4JBHA 2R72A 1JHDA 2XUQA 4UDXX 2JFUA 2Q6IA 1N2CA 1C4OA 1NBMG 1VIYA 1Y8RB 4C4RA 3SYPA 2HFJA 2UXBB 1Y81A 4BNIA 1DJOA 4MRMA 3TUJC 3NYIA 5CMLA 4N03A 3VKVA 4CEJB 3I83A 1X2EA 3FNFA 2I7DA 4F8YA 2OZPA 3NHRA 4F96A 1K5HA 1H23A 1JKJB 1JR9A 1RQ7A 1NP3A 4KX3A 2WZCA 4NB5A 3D7RA 4U2CA 1H1LA 2ZE7A 4ARZB 1J24A 2O7SA 2WYOA 5KNBD 5D1NA 3I61A 4W8OA 1YV9A 1YDXA 1H66A 3QKSA 2ONZA 2ZRNA 1XU9A 1IFXA 3AETA 1PVOA 3ROQA 1AOXA 1VCOA 4R40A 5AKYA 4EO7A 1J0CA 2NO1A 4LYFA 2AUTA 4DMFA 4ETNA 5EIOA 1RI1A 3AGPA 3LPDA 3ZCRA 5DTMA 4NTYA 3EEQA 3K0TA 1FXKB 4RLSA 3ONEA 3TW0A 3HCFA 2BSQA 3RF7A 2QSUA 4EHKA 1PFVA 2JLUA 1T6ZA 3TIGA 2IP4A 3JR3A 1P9OA 4LMRA 1XROA 2IYYA 5M29A 3JS5A 2EIMB 3QW4B 1VGVA 1U3VA 2HQSA 4WXMA 2C84A 4WH0A 2X6CA 1K1EA 1WCIB 1DC4A 2QHXA 2A1UB 2VVTA 3OU6A 2QR4A 1RWVA 1Z4QA 5EY5B 4C7OB 1VLJA 2E6KA 2Q5OA 4ITRC 1YR7A 3CMCO 5DU2A 2MYPA 1KECA 5LHGA 1FBNA 2XAHA 3GQBA 4PZDA 1CQJA 3Q7SA 1IK4A 4L74A 1IY0A 2DWCA 4MV0A 2X86A 2OAGA 5HIIA 3D81A 3JXEA 1D6JA 3N8DA 4BCBA 4D9BA 4R1UA 3G6EV 2HK7A 4G5RA 2AV6A 4JB3A 2CFRA 3OZFA 4NV1A 4O4IF 5KNCD 2C5LA 4CFYA 4EY5A 1CLUA 2PUBA 1PUJA 4EX6A 5KAIZ 5A2QA 2XQGA 5DX0A 1VP9A 4RNCA 2X7JA 3O91A 1Y8ZA 5KTKA 4IDOA 2Z56A 2BKEA 4ALKA 3QX7A 1ZH8A 1EYZA 1EUYA 5KOYA 4RF4A 3UYKA 2HA5A 1ZBDA 3IQDB 1GXSA 2CK3G 1H2LA 5E4TA 1XA0A 3O4GA 1TLTA 5A5GA 3AFOA 3VZPA 4UHHA 2B4QA 1XJ0A 4G84A 2I3ZA 3G2NA 1E5QA 1OHHG 1A0OA 5M04A 3T5DA 3HJCA 4BFYA 4F0JA 4J0CA 3RWMB 4M9XA 1S72F 1M34E 5L51A 1Q0LA 5KOIA 2UUAO 3OPXA 5BPHA 3QVNA 4R8CA 3FNHA 2C54A 5LOVA 2J41A 2C5HA 1RKQA 4MS1A 4B83A 3T15A 1ZMBA 4JLJA 2AFIE 3U80A 4IVQA 3LT1A 2DYRB 4MVJM 3A9CA 5J3JA 2CFCA 1JFVA 4LZPA 3BYQA 1J56A 4B3RO 2GXQA 2OHJA 3CCCA 2GNAA 3QUBA 2C3PA 1E0KA 3LDDA 1NW6A 2ITDC 2Z43A 2W4QA 3WJ1A 5FAXA 4WKPA 2UXBO 4W5WA 4NEQA 1MO4A 1HDOA 3MBIA 2YX1A 3ZC3A 1EFPB 3PUYA 4U7WA 1XD8A 2WYIA 5EJ7A 1ZD1A 3JASA 2GN1A 3KZNA 4XIJA 4ZMSA 4EF5A 2GKSA 4LGCA 1CLIA 4ZOCA 3M83A 2JIZG 3GCDA 3OIDA 1EJ6A 3HB1A 3NV9A 3JWPA 5EOVA 4YAJA 3DTYA 4D8XA 2G4CA 4X9QA 1TAUA 3ABKC 1JQJC 4GI3A 1QFJA 1PNTA 3DHVA 4BKQA 5KJEA 3AUAA 1FVFA 2NVOA 3EBOA 4JI6B 3Q3EA 1PD3A 4Q4JB 3OJXA 3NUZA 4PO8A 2W2LA 5JT1A 1V5EA 4FE7A 4RH0A 3LWPC 5HWEA 5DGCA 3C8LA 2W6CX 1ADYA 2H1WA 3Q9SA 4RWUA 1J0EA 4BQOA 4RTQA 2Z30A 1C7RA 2BKVA 1M6VA 3AOGA 5AVOA 4CETA 3UKDA 1T5BA 3D8TA 2PZEA 3PWSA 2XTNA 2UXNA 1UADA 4P9OA 3KUXA 4DL9A 1ISFA 2XYRA 4ALMA 5L40A 1V5IA 2YZGA 3E3AA 2TMDA 4X65B 5JWRA 4PYQA 3RVQA 1WNFA 2EGGA 1KJ9A 3DHEA 2ZS9A 2P41A 4MPPA 1VIVA 2VWKA 1K89A 1XRJA 3K73O 3IA2A 3N2KB 2NWQA 5EKSA 3B1KA 2DJIA 4DQDA 4CKEA 4RWEA 3NO4A 4IWXA 3WLEA 3W5DA 3LPLA 1KD1W 4BV8A 2EX1A 3TGPA 4K6OA 3ICOA 3VYTC 1CRZA 3HRKA 2P6PA 1YK1A 3MJEA 3KE9A 2JCBA 3MVEA 3CJQA 1GX1A 3OZRA 9LDTA 2IJJA 2R9RB 1GN3A 3GLHB 1NW3A 2ALJA 4FMBB 3NHUA 2C03A 1CR4A 5ED4A 4C43A 3WZMA 2D8AA 1Q5OA 1L7XA 4WK2B 1YACA 3A25A 4UUPA 4PR0A 2GH1A 4DMMA 2HVYD 5ADHA 2OM6A 3A05A 1TFRA 3E81A 1ZS9A 4CE6A 4RA9A 4RA6B 2BTOA 1AK9A 3R7WB 4JYYA 4QGAA 4KH0A 3A9UA 5EO3A 1ZAKA 2IHJA 1ZFNA 4G88A 2UZHA 3RIGA 5H4HA 2B1GA 3PAFA 2UZ1B 2Y67A 4QE9A 5DTJA 4AZ0A 2IHUA 5ALYA 4YRAA 1X80A 1AF7A 4RY2A 4W7HA 5TEWA 3KWLA 1HDRA 4HRYA 3KU1A 4J1QA 3EEYA 2CV2A 2Q8PA 3AFNA 3R8FA 1A8PA 3ZXYA 4DDWA 1JECA 2FKXA 1SU8A 2CK3A 2QYOA 1L9KA 4BASA 4DYDA 4EW2A 1V3VA 4MR8A 5FJJA 1US8B 1U2DC 4TMZA 4MAMA 3CY6A 3BT7A 3MHPA 4RQEA 1NXOA 3PLRA 1CQIA 1Z2DA 4D6TH 5KHIA 4NZ9A 2HU8A 5HKAA 3PG5A 1GG5A 1PW7A 1QHXA 2FN8A 1I3CA 2ZJOA 2OHXA 4V0MA 3L9DA 2E85A 2PVCA 3LFHA 2P6RA 4PIPA 4P81A 2R8EA 4NCJA 4BNDB 1TKBA 3K0EA 3DAOA 4WZAE 3SQDA 1VSTA 2DFDA 3SLGA 4D9EA 1YCGA 1MTZA 3TSCA 5KHAA 3E82A 3EUWA 5U4XA 1LSOA 3AJ9A 1U0TA 2P6UA 1F8FA 4JI6O 3CB2A 1JJ2U 1KYOF 2B5VA 1N3BA 3K0FA 1KKUA 4F3CA 1E2NA 4NG4A 1QGOA 2QAIA 3Q7EA 5REQA 4QECA 1WQ4A 4EW3A 4KWHA 4OYLA 2D54A 3EVBA 1OI2A 4BIZA 4OG2A 3UGJA 3DXXA 1X52A 1Q0TA 1XRGA 4QDUA 4BIOA 1JQ0A 3SZUA 4QTTB 2R4QA 3S3XA 1Q92A 2GOYA 4MVJF 4ZVRA 1PD1A 2BSXA 1S7GA 1O57A 1PYOA 5JRJA 1TXGA 3M3PA 3AR8A 3E86A 4UTOA 1DBRA 1AGPA 2EW2A 1QFMA 1H5UA 3SVTA 4NCIA 4FDTA 4E5UA 3SZ3A 3HVJA 2Z2IA 5CEFA 3L77A 1C1XB 3A0BZ 2A5YB 2G9RA 3HKDB 4WBSA 5LYJA 4X65O 5BUZA 3EXHA 5DHFA 2E89A 1OV4A 2FN9A 1NMUB 3QA9A 3VGJA 4QLBA 1COZA 4KMOA 1KZ9A 1Q91A 2W0SA 4W1RA 1IDSA 2WRZA 1N75A 2Q5IA 2JDIA 3UCXA 1NU6A 4WZBA 2B4KA 4O4LB 5HBGA 2NO4A 3DBOB 4N0MA 4JU9A 5AW5A 1GTVA 1TPYA 2A0LA 4RV5A 4NBKA 3Q9UA 3PC8A 4LRWA 2QN9A 3KWFA 1OE0A 4QTZA 4YV1A 2ZDQA 3QBEA 2XCLA 3VR6A 1RACA 3IAS6 1P72A 3WRYC 1KBZA 1Q44A 1DBFA 2WSBA 5T7BA 1PHPA 2E87A 3AEKA 1PL6A 4F5ZA 3CPJB 1S1MA 1MJGA 2IU3A 2O7NA 4TLCA 2P69A 4XPZA 4ND4A 3V1NA 1XUQA 4M7RA 3BSWA 4OAOA 3OCJA 3L7OA 3TAUA 3D2BA 3N0RA 1UZUA 1SZCA 4JKOA 3GV0A 5DNEA 4CHGA 2H4ZA 4FDLA 2LBTA 4FQ8A 5AI0A 1E7MA 2QUZA 4HDAA 4KXMA 1EVZA 1Z06A 5IZCA 3W1VA 3LOUA 4EJMA 1IL0A 1J2EA 2A78A 1U7OA 3LCMA 4X6XA 3SMVA 4TSFG 3I9KA 4HZIA 4II3A 5IDVA 3VIUA 1W36B 5H2FZ 2WICA 3URKA 2RGNA 3ERCA 2ZJYA 4AXBA 4IHJF 1USGA 1ZX3A 3FNBA 2F2TA 1X1CA 2Q62A 2IH4A 1VL8A 2G0TA 3SYRA 3A1TA 1JYEA 3HB5X 5ADWA 4B81A 1WCYA 3ZR4B 2BHNA 5G41A 4GPTA 1Z4OA 2NSLA 1KI1A 1MGOA 4V03A 3PNPA 4QEDA 4X3OA 4BL5A 4ZYXA 3UB4A 2ZRCA 1B1AA 1E6WA 1OTYA 2CXSA 2XNDG 4BZQA 2X9NA 4RCYA 4FYKA 2QSJA 4Y2XA 3PYMA 3U48A 4NBUA 4H37A 3ZDBA 4LCJA 1RWWA 4ME6A 3SJAC 3OTQA 5A3JA 1ZRSA 1ZMOA 5BY1A 3AG4B 1KZ7B 2J9FA 1CR2A 4LKOA 1DDOA 1PK7A 3RTDA 1RMYA 2WA2A 4DJFC 4S0XA 4DR7B 1FPMA 3HE3A 1IBCA 2L35A 4DVGA 1GPUA 1DUIA 2VH5R 2VP4A 1I0IA 1Y63A 3EASA 1E6KA 3PFHA 4C07A 1ML4A 4ALJA 3DF9A 2CDRA 1VQOF 4BNFA 3DONA 2J5XA 3SQLA 3GLRA 1PWXA 3Q9LA 2Q27A 1FUIA 3LBFA 3AK3A 2XMDA 1RHKA 3QEOA 4KXRA 4BO1A 1OCZC 4DJDC 5HCIA 3A4TA 1LC0A 4Q47A 2E5LB 4G5FA 1V55C 1L6RA 3DMTA 1KAMA 4ZC8A 3DHNA 3IPCA 2HWXA 4JYCA 4ARCA 5B5SA 2XCQA 3FJ1A 5CB0A 4CIXA 2CJWB 3IUBA 4BO7A 2FK8A 5FOXA 2EWMA 2XH8A 3FCCA 3RUFA 1L1QA 1NI4B 2GZSA 3AGQA 2KQUA 1QRSA 4G56A 1TEHA 3D8HA 1NY5A 4FMDF 5CB4A 2ZJ2A 2AX4A 1T1GA 5EE1A 3I5YA 3T52A 2HCJB 1M56B 5J9FA 3HCWA 4OBXA 4TPKA 1DC3A 1GA4A 1KF0A 4M37A 3FNQA 4HRVA 4XKJA 4MTGA 2Q6AA 2DQZA 3ESRA 5H70A 1S8OA 1NVDA 3KZKA 5FI1B 1TUBB 4QAJA 1JMYA 3PNQA 4JJEA 1ES9A 2OC4A 4CR7A 1LY1A 3USES 2ONCA 1IAQA 1XMSA 3E2PA 4F45A 5FIUA 4NWIA 2BRUC 4I8IA 1TTHA 1EK1A 4D8TA 2HU5A 3PQFA 3OZDA 4HUQB 4U7NA 2YFYA 2C2GA 4CM5A 3H11B 4ZANA 2CUZA 4HN9A 2HCFA 1Q20A 4IJ6A 4M55A 1NMQA 3U7RA 4M9ZA 1HBJA 3PUHA 5A71A 1TJ4A 4AUEA 2Q29A 2O48X 1C5KA 2CD7A 1G5HA 3W5CA 4AMBA 3LWVC 1J70A 1A7UA 2YHSA 5DYGA 1UJWB 2HMYB 4I0XA 1UK8A 3R9KA 2WFLB 4H7PA 5JALA 1UM8A 4JP2A 1TQ4A 2W6OA 3TR5A 1Y9ZA 3WJAA 2FW6A 5TMPA 3PE6A 4KDCA 4Z0NA 4MVJG 4FD3A 4BWYA 4TMKA 1AKMA 4MKIA 5B58C 3L7KA 3CYPB 1AS3A 5TJ9A 2P06A 5M34A 4Z9FA 3X3HA 3RUPA 2BBWA 1M90W 4EHAA 3GA5A 3WLQA 5J2TF 2CTPA 1R1DA 2G09A 5FA8A 5EIXA 4UFPA 1JX6A 4BT7A 3MGGA 1JZTA 3DAPA 2BT4A 2UYJA 2ZRJA 4KQKA 4N3NA 3B6MA 3JVIA 5UKDA 1U02A 2CEKA 1RVDA 5BVHA 2VF7A 5HEKA 3ZW9A 3B13B 2DCUA 4PCVA 1IV4A 1CVIA 4IDBA 4LC0A 4DR7O 4EIWA 1OBHA 3CUTA 3GJ7A 3KU4A 2B4TO 3L7BA 4M1MA 4MRAA 2PQMA 1QZXA 5J1SB 3P4YA 4LOKA 3I12A 4OXRA 2VZLA 3L7YA 1K7DA 3B38A 1MB2A 3L8YA 5AW9A 4JEUA 5D3KA 5JZVA 1G55A 1D7OA 4IQFA 1W36D 1AUVA 4BMCA 2VPTA 4RH1A 2IBZH 2E5LO 4B31A 3T5TA 1K3TA 2Y1OA 1ST3A 3AYXB 5LSAA 2DXIA 4HAWA 5IVHA 5T6MA 4JK3A 3GJ8A 4L16A 2E6UX 1VQ5V 2GFIA 5TIIA 2HSJA 3ZCPA 4ATNA 2PX0A 4QBGB 1NQAO 4DLVA 2F1RA 1EFVB 4RESA 3GCGA 2YWJA 4XX1A 4PSUA 5LQDA 1FP4B 1PJ3A 4H3KB 4MUBA 3UHAA 1FNJA 2VPPA 2JJMA 2JLXA 3H8JA 2BZ0A 3SZMA 5I4BA 2NG1A 1QV9A 3AIMA 3LPMA 3MCTA 3NHPA 3CWQA 3G0CA 4ND8B 3N2GA 3KEFA 3EQ9A 2ZJ5A 2AD5A 1U28C 4OQNA 4F5WA 3UT0A 3AJDA 1XK7A 4WBNA 4N39A 2FE1A 5EMNA 4D0LB 4XCXA 2PIAA 2W2XA 5FLXA 1W9MA 5DJ5A 2PNJA 1RTKA 2VEOA 2B0CA 1W94A 1WX1A 1P2UA 4BB9A 4X9XA 2ONJA 1RMQA 1L4HA 4DEXA 3V1UA 1GPKA 4RPKA 3AP1A 2JI8A 2YWEA 2EX0A 4RK1A 2B1QA 4R8KA 3D6HA 1I7QB 3E8FA 2Y92A 4DG8A 4RK0A 3A58B 3PHBE 4P82A 3KCYA 3BMQA 3IVAA 3LBAA 3FGPA 2BCJQ 4PZAA 4PRYA 2H29A 2G83A 3RNOA 1KZ4A 2Y2UA 1M75A 3A11A 3TFWA 3BK2A 5AI4A 3T1YO 2YJ3A 2QTPA 4YRRA 2V9YA 2P2ZA 1DAGA 1H5QA 3DWFA 5DE3A 3KS9A 3ICQB 3GUZA 3HJBA 2P2SA 2QN8A 1TD1A 3BH0A 2LNDA 3R0XA 1JW9B 5B6PA 1QTRA 1Z0ZA 3T35A 1O95A 3HM9A 4U4AA 3DTUB 5D7NA 3OFVA 1DQZA 3IV6A 2IBTA 3VR2D 3B5JA 4XWAA 4M9RA 5BXYA 4MVXA 3WGJA 2Z58A 3SMQA 3CC7V 4Q5IA 1JXOA 4ZODA 3GOHA 2QMYA 5CA0A 5J4LA 4X1KA 5K3CA 3GBSA 4ZKIA 3IPRA 4EECA 1A9QA 2EINB 4X7BA 4ZOAA 4HVLA 5FTLA 3HLTA 1O97C 1W4AA 4WK4B 2O3TA 4DWVA 2Z2ZA 1MUUA 3ZRSA 1RYZA 3U10A 2I34A 3Q7PA 4Y6RA 1B42A 5B1IA 4GS5A 4OQEA 2QL7A 3PX7A 1F0PA 2DWEC 4ZT7A 3T4PA 1PS8A 1Q5PA 4PAQA 3OTWA 4Q4HA 4W4KA 2J4CA 4X20A 4CPDA 4KIWA 4UHFA 4JI5B 4RFSA 1IOZA 1SBQA 2AK2A 5LL6P 1T0BA 5AJTA 1O0BA 3CBGA 1MH9A 3OX3A 1ZKMA 2ZRPA 1AJEA 1A1VA 4HWKA 1VFPA 3M4SA 2XAJA 2GM3A 2PTGA 3B7PA 3HKEB 1K2VN 1W6RA 1YZGA 2QMZA 2ZJZA 3ZU4A 1GYPA 3V7FA 3KQNA 1VLHA 1MD9A 2HLHA 4AT1A 3QFRA 4OCZA 2QY6A 2R7AA 1OBOA 2XE6A 3UWSA 1L8XA 2EQ5A 1SD2A 1VQNF 3E4CA 5ARCA 3A6PC 3ET4A 2A14A 3ZWXA 1TNDA 3BXEA 3GPIA 5KI6A 2P6NA 5J9PC 3HU5A 4MVQA 2WJGA 3ROTA 5LXTF 1WHSA 2BEVA 4TKUB 3M6AA 1VJRA 1BXRA 2B33A 2YVLA 2BTQB 1IYZA 3VZSA 4Q16A 2O6LA 1JDSA 5KAMA 5THQA 3TNJA 1BCRB 3SR2C 1OZAA 4U6SA 3VBEA 4X3PA 4N5MA 1KAEA 2J3LA 4R2HA 4BZPA 3U60B 2O2XA 4WX2B 4FEEA 1N1EA 4IBOA 3UFXA 1KZHA 3QEMA 3BS4A 2GAIA 1BA2A 4HD8A 4KJZA 4QDJA 3E22B 1DV2A 1CULC 3DC7A 1KDOA 3TMAA 5EKXA 1DVRA 4BJ5A 1X9HA 1GN2A 4KUEA 4MCIA 1DAMA 5A5EA 1NDQA 4ZI7A 2A06H 2YYAA 3NYRA 2EBHX 5DM1A 1M2NA 4BWAA 4UFZA 3A9WA 4MPRA 1QH1A 2BFEA 3DEHA 3C9UA 4K9QA 5GPBA 1QU9A 1SIWA 5B53A 3B85A 4Y2GA 3KTFA 1V1RB 3LO5A 4BN4A 2HC9A 4QPCA 2OBBA 3K05A 3WDKA 4YBRA 4Z4CA 5KU1A 1FLDA 3QKTA 4I4IA 3KQSA 3NUQA 4I2NA 1XB2A 4PTYA 3VPSA 1M66A 2D1YA 1HQKA 2P5OA 5PGMA 2PRZA 1U3CA 5KA5A 5ESDA 2H0RA 3II6X 2CNWD 4EARA 1H2BA 1RWOA 1DEHA 1P5FA 4IICA 2Z98A 4V0OA 4A82A 1EBBA 1M2OB 5HQJA 2YJ5A 4KCGA 1LQUA 1YWGO 3QX8A 1SU7A 4BPRA 1XMIA 2JFBA 5CNJA 4FKZA 1RQ2A 1UJCA 1MG5A 3FAVA 1MSWD 4AJ4A 5CN0A 4S2UA 1M8KA 4ARSA 2HQSC 4DNOA 1UKAA 4HTFB 2CZWA 3F2IA 4LBWA 3GFBA 1GL3A 1FNKA 3QKRB 4MW1A 4FIDA 3BA1A 3WYNA 4DWJA 3ABSB 4G4JA 4NFSA 5BSMA 2LTAA 3AG6A 1IMJA 4GRAA 1J5PA 4QOHA 4BEWA 4LRTB 4NRDA 1GZDA 4AX4A 3U4QA 4IMJB 1MBZA 3H9UA 3BMOA 4OUDB 5EZYF 2D0IA 4JJ7A 1VSUA 3GLGE 3L75H 2KWIA 1DTWA 3QMPA 3HA3A 3RU9A 1VLMA 3OTOB 4JI5O 3UJHA 1UBCA 4BCDA 4GR4A 1TT5A 1AH2A 1Z3IX 1P0PA 4UTXA 3D3QA 1ACLA 2HRRA 4TT3G 1XHFA 1AQLA 1NQWA 1HG0A 4A5UB 3WJPA 5K7SA 4JJ4A 1NUTA 2GK4A 4JL5A 2QTHA 1OLXA 1SUEA 2B7CA 1SGWA 3WB1A 2Z57A 3O21A 2PSFA 2V7QA 3QUSA 4V38A 1L4GA 2IP1A 4TYQA 3E1KA 3RM3A 1NU1H 1GM5A 3DNFA 5ERXA 3D6AA 3G2LA 4ZA2A 4JHXA 3SN6A 2O0LA 3O85A 4A9AA 3OOHA 4HRXA 1QG6A 5EHXA 4P7BA 3ZXSA 1VPVA 1SQ6A 1SBHA 5FUQA 1FFHA 4ZHQB 4M1WA 3SLRA 4KLAA 1JCHA 1GUYA 2E55A 2FG7C 2KW5A 3UT5B 3KQTA 4P34A 1K0FA 3WR5A 3T7EA 1DKOA 2ZB8A 4FX5A 4OIFA 3DVAB 3CT4A 4J41A 2IF2A 2W11A 5BN3A 4LY0A 4YAGA 2IUUA 3S0HA 4R16A 4Z4EA 2C4MA 3AQIA 1RC8A 3ELYA 4EB3A 4XB1A 3DXYA 4BBJA 1US6A 3M6WA 2X9GA 4L27A 1GKIA 1ZICA 5KYYA 4PELA 1TKAA 3I73A 5ANRB 3HEAA 5I45A 2YVUA 1KI7A 2Z09A 1T25A 2CT8A 1TC2A 4QNNA 3TETA 4AZWA 4BO3A 5IKEA 1RRKA 3W0LB 4Q4LA 2P6YA 5CNIA 1TQ6A 1E1CB 1XJWA 2J59A 3OETA 2YIDA 4RACA 1GAEO 3AG2C 4XEUA 1JLRA 2W6IG 1EBUA 3CCSV 5EP1A 4KWTA 3JYLA 1FS5A 5KMGB 2PS3A 4DABA 2UYYA 2WIKA 4I3HA 2JZNA 1IJFA 1O9GA 3EXIA 1C29B 4RIFA 2OCBA 4J0KA 3TTTA 1RABA 3KPJA 1XILA 4U63A 3SD7A 1P3JA 5K0ZA 3Q9NA 1LI5A 1OFIA 3ZV4A 2R6FA 4XD7D 4CTKA 4FS8A 5CFLA 1SERA 2HD4A 1IAVA 3RVOA 3AKYA 3TZKA 4BZWA 4DB4A 3KYCB 3N2IA 1P1FA 4IIJA 3F0DA 2HTEA 1NLFA 5KAFZ 2XPCA 2XAAA 5AFSA 2PT7A 4NYIR 4US0R 1PWEA 2VTKA 3CVYA 1Q6HA 4DDTA 2WZQA 4JJIA 1Y1QA 2K7FA 5EWMB 3FB8C 1JZQA 3WFVA 4JJGA 1Y1SA 4BHTA 1IUNA 2LVBA 4TS4A 2Q4BA 4EFKA 4DSUA 1UBUS 4K6KA 1JA8A 3NBFA 2RAPA 1ZEMA 2UYCA 1L7VC 1UQRA 2Z3VA 2HJSA 4H1UA 1H8EA 4GYJA 2B36A 4E4YA 4XWKA 1YFLA 3W6NA 2EZ4A 2HJWA 3KKMA 3NP9A 1TF2A 4UREA 1GCGA 4DV2B 4R3WA 3T1QA 2QEXF 5I8WA 3OTOO 3BEOA 2HYDA 3EMBA 4EL0A 1PDVA 3PFBA 4UW9A 4BBAA 1FAFA 5ALNA 4EG1A 5C9ZA 1JPUA 2QJFA 3I76A 4CV3A 3FLMA 1NVKA 3N8NA 4ENPA 1FFXA 4JXXA 1RHUA 2ZAYA 2YIAA 1SQSA 4UNQA 2VAXA 1NUSA 1UBHS 4WFJA 3KTAB 4R2XA 3E3MA 3QYAA 4R6ZA 3PHIA 4DCOA 1KSGA 5D6NA 8LDHA 2QU7A 4G0UA 1A3CA 2G36A 1OMOA 3QUCA 1GM7A 1G4HA 2QAJA 4IKEA 2JA1A 2I1WA 3CO0S 3X1XA 1ECBA 3K0CA 4F4DA 5FR1A 2FMLA 1DXOA 2QG6A 4QUKA 1RBQA 5ALRA 4ZTZB 3SEQA 1CX9B 1P31A 5CTAA 3H2HA 2PMDA 1HEUA 1ZCAA 3IOCA 2JGAA 2EP8A 5GZ1A 4PV7A 3I3SR 2WTUA 3IEVA 2FX5A 3PKZA 5DGHA 4PC2A 1GL9B 3P0FA 3SZGA 2UYQA 3T38A 1Y6JA 3O4VA 4B4KA 3JZMA 1KMCA 1VRWA 1UJMA 1RBYA 3BABA 1QR6A 2Q9UA 3PI7A 4DK0A 3JVHA 2F1HA 3TKLA 3QOWA 3C8MA 1OJ7A 1Z2EA 3LUJA 4G0XA 1OZFA 3OIGA 2RCVA 2WIBA 3ER6A 4L08A 3RYHB 4RJLA 4IFBA 4K86A 4IAOA 1ODLA 5FHRA 5CLIA 1U9ZA 5EIHA 2QTVA 1SQQH 4YT2A 2HTFA 4I7EA 4YTEA 2EV9A 3LX8A 1SZDA 3GW8A 2CLHB 3T9CA 5K6AA 2IHTA 4PZYA 3NHWA 3DOIA 4WECA 1JLSA 3LPCA 1H8HD 2WLKA 3ZWMA 1PSDA 1DBVO 3PHLA 4F4IA 4Z4FA 1L5MA 2JK1A 2QP9X 1D2HA 3TRDA 4LJKA 4ZOEA 1EWRA 5C4MA 3PFGA 3DMPA 4D9JA 5TC4A 1KEUA 2H2GA 4RJJA 1DRUA 3WMXA 4BMSA 3DXRA 1QHHA 2HXYA 2J5KA 4ZREA 5CX1A 3EZ7A 4KO8A 3U3KA 4WEQA 4EJ6A 2XHEA 5K0CA 4OQXA 4BB0A 1K68A 1RWKA 5H3CA 1VJ1A 2Q8QA 2OIGA 2GK7A 4ND5A 2XLCA 5FV7A 1Y7HA 3R6GA 1BRMA 1TTTA 3OSUA 1J0BA 3MS4A 1N6KA 3MTAA 1NJ5A 4A6EA 1H5NA 5KNLA 3QA3E 2Q2NA 1JJBA 5CK5A 1E3WB 2ZBDA 2J9GA 4OI1A 3AG1C 3R0PA 2OXCA 2J6BA 4MJ3A 1YKSA 1WVGA 4D5GA 4YR7A 4DHWA 5AHWA 4IFIA 3I9V6 4MWBA 4BDTA 1B6RA 1OT3A 4DV2O 2VOJA 2O6HA 3ONVA 4AW9A 1QB7A 2VZEA 1WSWA 2AIZP 3B52X 4QQKA 1DTEA 3PSAA 3FUXA 3ELBA 3KQHA 4Y6SA 1L4NA 2ZR8A 4OU5A 2Q0HA 5E6UB 4L9SA 2NP6A 5DECA 3VC3A 1QCCA 1I5XA 3TKYA 1MNQA 3FVTA 4DA6A 5M7EA 4QLOA 3HKCA 2BH9A 3LPAA 3PGMA 2EIJB 2R4TA 3GZNA 1FU4A 1H2NA 3WGOA 4BO2A 5K8JB 3L5KA 4CM6A 1IV1A 3RS0A 4YJ3B 2O8CA 4CDGA 3GN1A 1PX2A 3UJ6A 4GO1A 1RE1A 4XIFA 3E58A 5FR2A 4Q3OA 3CEJA 4GKKB 5BR4A 4BGEA 4PDVA 4QKQA 5KNDD 3W6PA 5IZCC 5HMMA 3N70A 4AWAA 1X3LA 4EVRA 2QRNA 3NDIA 4ZYLA 3PNKA 4EELA 3C3EA 4EKIA 3QG1A 2FR8A 2RHWA 3KKQA 1NZJA 1TIBA 5IT9N 3E9CA 4NK5A 1UM9A 4KWIA 3OBIA 1OX4A 2RGNC 3NTOA 3GG2A 4R54A 2XUAA 1OKKD 2H92A 1WVIA 5BMOA 4EW1A 5IJ0A 3BEHA 1I2CA 2BFAA 5IZ4A 5KPJA 1G5FA 4U7DA 3EZFA 1M33A 5K3OA 1R18A 1GQRA 4R5MA 4AUNA 5KHOC 2UYGA 4AJHA 4PX9A 3V7WA 3QHDA 5F3WB 1L5FA 5EB0A 1HT2E 1L3IA 2BLNA 1SB8A 5JIBA 3MT9A 5AKJA 4QRIA 4JA0A 4A92A 3PEEA 3JYNA 2WC1A 1P0CA 5DLEA 4G5OA 1MIOB 4NH4A 2XNHA 4GICA 5GV7A 4X41A 2XE7A 4GOMD 2ZYTX 3FD9A 4OL9A 3T99A 2BEWB 5JPCA 3H2IA 1QX4A 4MGHA 4B2IA 3FLBA 2B94A 2ZJ8A 1L5ZA 4BVBA 4LY3A 4Q34A 5IYZF 1DKPA 2FG6C 4MWTA 3DAGA 1P4SA 3ENVA 2XYQA 1YR1A 1PFUA 3HDHA 3T9BA 1XKQA 5K3AA 3NH6A 4JBGA 1L8AA 5TX7A 4ZOLA 3G9UA 3DC5A 4JA2A 2W4IA 3BXXA 2I6GA 1K6MA 1Z29A 2NO9A 1MORA 1N5OX 4O2RA 3IVXA 3ESZA 1NW7A 2P22C 2F1IA 3HVRA 1ULZA 1JFSA 4QDOA 2GHTA 4IOMA 4ONEA 3VJKA 2CKMA 1Y4DE 1VJDA 3LL4A 1XXHE 3QOFA 2VBGA 2DY1A 3O90A 4FYMA 4YALA 2PO5A 3O4JA 4LGVA 2WWTA 5CDUA 2CVZA 1ENVA 2EQAA 3UV7A 2DAPA 1XN1A 3NASA 1AQUA 4QU9A 3CISA 1BDHA 5KYTA 4LFCB 3EAGA 2HA4A 5CYOA 5TV2A 4LZJA 3PL1A 3GJQA 2AOUA 3NONA 2K9PA 4TTQA 4D9FA 4K9RA 3ZY3A 2GASA 4HNRA 4IUYA 4N6NA 3ABLB 1JHUA 2GYWA 1M57C 1EVLA 1WABA 2I6XA 1MEEA 3INTA 2PCJA 4DIUA 2WUDA 1T5HX 4IYHA 3ZUPA 2EF0A 3PQ4A 1P5HA 1ZZGA 4LNAA 3V8EA 1PIWA 4DO2A 2JGDA 2V1DA 1QIFA 4NPAA 3CVWA 1NBMA 4ZO4A 3JD3A 5TGTA 3OONA 4MNTA 1OBFO 2FNAA 5DKFA 4G89A 3P96A 1WCV1 4QJ5A 1TI7A 2BBOA 5LYYA 3HYLA 4UUNA 4IL6Z 3FA2A 1LVHA 2LKCA 4RTRA 1V71A 2P90A 3G71V 4RUKA 3B3QA 2FEAA 4ZHSA 2D3TA 4GKKO 2D06A 4WIAA 3FOCA 4FWBA 3SLKA 1WUHS 1T3ZA 2YTZA 5AOCA 3V8BA 5IRCD 1DX6A 4R1LA 1FDSA 5C53B 5HXAA 3CCVV 5JAUA 2VWJA 2A1TR 5CYPA 2I3GA 5KPDA 4NUTA 1XDDA 1USVA 2QUIA 1CY8A 1F20A 4X71A 2VDKB 2A4KA 5B3LA 1XMQB 2HM7A 3HN2A 3TM4A 1FFEA 2FF7A 3RANA 3V42A 1K4KA 1R3UA 4ZQIA 1E2DA 4UEKA 2O8EB 1NJ2A 2Z2YA 4S1NA 5CCDA 5HIJA 4KN9S 1D5WA 3I0ZA 1OX6A 4MP6A 3MTDA 4B32A 2Q5LA 1OFGA 2IV3A 4KQ9A 5EGNA 4Q4CA 2ZWMA 2OPHA 1ZMTA 3MJVA 4KQMA 1PZGA 3P9YA 1XKTA 3RABA 3IP8A 4FB4A 3IEWA 3ZYCA 3E9DA 3GARA 5KCMA 4V1CI 3O8CA 1JAZA 3RC7A 3UICA 4NTXA 3RSHA 3A1SA 4I4TB 4TSKA 3RSLA 2ADPA 2NU6A 1DQSA 1BNCA 1DDGA 1E7QA 5A4MS 5EESA 4JS0A 4E5PA 5IY5C 1V1JA 2J6CA 1V16A 5JCJD 2R6R1 1CE8B 1DJPA 3DPSA 3DDOA 1JXAA 1L4BA 5A0VA 1Z4MA 1J22A 3T80A 3WYBA 4RANA 2J85A 4NCXA 3B3GA 4FDUA 4NH0A 1M5TA 5G4KB 2X8JA 3EGXB 1PPJH 4EA9A 2FP4B 3FW1A 1WD7A 3AESB 3O9ZA 3BQMB 1PJCA 3P27A 1P8JA 1UKVY 3BXZA 3ZQJA 3KB6A 4EUSA 1X7GA 4NTZA 3CSDA 4P4UA 1H9CA 5ALGA 2BP7A 4LHVA 1DKRA 2ZIXA 4X8MA 3I9NA 3KNZA 1UAGA 1PK9A 3D8NA 1IN6A 1FU7A 1VE6A 3QXCA 4GI5A 3K96A 2WOOA 4GT1A 3ZTWA 2V5VA 5CCXA 5DSXA 4RD1A 3F6RA 3HCOA 3K9SA 1UXKA 1NOIA 1Q8IA 3W2EA 4J4BA 4LXYA 5ARBA 2Q7XA 3T3HA 4W8HA 1BX3A 3Q85A 2P4UA 3GFQA 1J0AA 1A2QA 1GSIA 5AYVA 5BQOA 4PCLA 3AOEA 3RK0A 1OHHA 4OGGA 2Z4RA 4NBLA 3PNOA 4LFCO 2HG5C 3TLGA 2IELA 5D3MA 3PXGA 1L4LA 4L15A 2X2FA 4I50F 3F6YA 2CXTA 3GAFA 1GZHB 3LXUX 3RBAA 1W0JG 3B51X 4NCKA 1OI3A 3SWWA 2A5FA 1CIJA 3PTZA 1BROA 4JTAB 2DWPA 2AC4A 1ISGA 3LP8A 1L4UA 4UFOA 4RHCA 1JFRA 1GP2A 5D86A 4N5HX 4TXMA 4TQUS 4C2BA 2OECA 1FXUA 3AHFA 3OMLA 4RUFA 3CMAV 1VQ6V 1ZN9A 3NOXA 5D3QA 5KSOA 1NMZA 3VMMA 4J7CA 3SFZA 3O3MB 3P4UA 4KO4S 4AX8A 3ITDA 5B2EA 4X45A 3ND6A 2NMVA 2HIGA 2WUEA 2HP8A 3E7FA 2JIZA 1SS3A 2P40A 4WE3A 3F0EA 5HK8A 3J7TA 1P7BA 1RM1C 2OESA 1QMPA 1K34A 2V3CC 5KTNA 1GAJA 3AI3A 1O95C 3R41A 3PR2B 4Z4IA 1GRJA 5E9AA 1YOVA 1Z82A 4MV7A 4BP9A 1RXUA 2FI1A 3CNEA 3OI7A 4BJ6A 5B12A 3BGVA 4MDEA 1AZSC 5CHEA 4TQGA 2NYVA 4MW9A 2XODA 5AVJA 4HBNA 4RJIA 2XQFA 4M8NE 1KYTA 4TLBA 4I55B 1X74A 1A8QA 4Z4QA 4DWOA 3PC3A 1W85A 2WLJA 1BXGB 4PSVA 4R2MA 2OXRA 3FFMA 4LJ9A 4YPVA 4BUJA 3G4SV 1H2FA 5DI3B 4I1RA 3BTOA 4KBGA 5TISZ 1RPTA 4BRSA 4JIGA 2XLBA 1KYZA 1Z75A 2HRZA 1KPIA 4OHVA 1M93A 3I04M 3W34A 3UT6A 2H7CA 3T7IA 1DBQA 3KV3O 3TZCA 3VZBA 4ARIA 4QSHA 1SUWA 1J97A 1N3IA 5L8VA 2AHZA 4JFRA 1G8AA 2DRIA 2HDNB 1HORA 2RHTA 1P7ZA 3EC7A 1Z68A 4B4DA 3Q5EA 6REQA 3BXGA 1U4NA 3DAHA 5CRIA 2QQFA 2IKSA 3P32A 4KMSA 1G7SA 4YCSA 4WOCA 1EJ0A 3ETGA 4KFTA 2O50A 5G1NA 1ZI8A 1E5TA 2QDXA 2A84A 1AD2A 4HBGA 3I4LA 2JLYA 3PFNA 3DDZX 2V74B 2JIRA 4FC6A 4C7BA 4YXWG 4MVRA 1IV3A 4V24A 5CT4A 3U09A 1VJ0A 5HZGA 1HFJA 4IXWA 4QOGA 1BN6A 1B6SA 3Q11A 1EFTA 1EG2A 3AEXA 3HHEA 4WNIA 2GM9A 1G20E 3CMEF 4FW8A 3QV1A 3RIYA 4IIFA 2VATA 1Z83A 2QSAA 1RAEA 1G6HA 3DL0A 3UH1A 1YZTA 2FWJA 3EPKA 4MULA 1H85A 2I54A 1JFFA 1NUHA 2C8LA 2UU9B 1V39A 1JNYA 4B7ZA 1VKZA 2Q1WA 4ZT4A 4CV1A 3CVOA 4GM1A 4R9SA 3HFGA 4CFSA 4M36A 2QZJA 2Q1TA 2OA0A 1UK6A 4LOLA 3DSRA 4C9BA 1U8CB 1SOUA 1ECPA 2QVBA 1G38A 2C2OA 3KHNA 2XMRA 3LZ6A 3ZWVA 2BY4A 4BC1A 4FM1A 1SM4A 1T2NA 3WSVA 3ESJA 2FMKA 4QG7A 2GJSA 4XWWA 4NZPA 2J5BA 3NU1A 3K8OE 2J0VA 2RHBA 5DCYA 1XNQB 3FBAA 2GN6A 2YHUA 3VPGA 1E4VA 1EK0A 3EFEA 3P0JA 1SH7A 4F1KA 4YMUA 4HUTA 3IT1A 1DCTA 3PRYA 3N2LA 4W9MC 4G24A 1H2XA 3GUUA 4NF2A 3CXHF 3BAAA 2WKRA 5JG7A 3ZV5A 5L3SB 5DM70 4IZ6A 1QKKA 2I4RA 4K3UA 5E6RA 2UDPA 3GDFA 3S40A 2PR7A 2Y0EA 4YO8A 5HP4A 2PKCA 2WI8A 2KX7A 4F2WA 1GNVA 1QK5A 1W0JA 3BFJA 1Q0ZA 5EP2A 5F51A 1KKMA 3N86A 5CUQA 1NQXA 2GZ1A 4EI9A 4INAA 3PUVA 1Q0UA 3ZQ6A 1QGAA 2H0AA 1D09A 5F9FA 3PE3A 4E31A 3RD5A 4O4IA 4MUNA 4GI2A 3FVQA 2VYNA 4KH1A 4ECAA 2HHJA 3W8FA 5T4FA 2NR5A 3D8UA 2FZLA 5I3CA 2M6KA 3UUGA 4HNAB 2O8DB 4Z3DA 3LU1A 1SVWA 1CT9A 2HX0A 2PVSA 4HH1A 2JGMA 3UOWA 1GRCA 1BHO1 4XYEA 3SC2A 4MVWA 4Z9AA 1QF7A 2NAFA 2VGNA 2EEPA 2PBRA 3NUGA 3BWYA 4JJZA 1YB4A 2LIVA 4UE3S 2ORYA 1B8VA 5E7IA 3E9NA 9ABPA 5JVDB 3HP7A 1HFKA 1Z5UA 4C82A 1DAHA 4TMVA 5AUQA 2PGXA 4ARAA 4GOND 3EG5A 4JKIA 4NJEB 2VLIA 3RAEC 4BVSA 3AHGA 5GONB 2YV2A 4V1CB 2A1TS 5G4VC 2V3VA 1JEYB 5SZJA 1G3QA 1KP2A 2GBLA 2PPVA 2MINB 5AG2A 3KM0A 3OM1A 4L3OA 2AUMA 3D3WA 3ENZA 3JRNA 2X9LA 5H0IA 3TXQA 4BKMA 4BCCA 3LVQE 4DZRA 1SUCA 3QJGA 3JAMM 4UASA 3WICA 2HY7A 4MGZR 4MQFB 4Y6QA 1G1AA 1IOWA 1I4TD 5DHSA 2C3UA 1FNBA 2IYAA 2OAP1 2OILA 5A62A 2P9GA 3R9WA 4HCJA 4P22A 4CZZA 2GHIA 1AKTA 1N2EA 3I9JA 1ZBQA 2XGOA 2VTDA 2X41A 4XUCA 3BEDA 1KKLA 1DFIA 1EGHA 1U8TA 2L69A 2X5KO 4AY5A 4HAMA 2JFFA 1HEYA 1CY6A 3LQ2A 1Q7RA 3TL3A 1RYBA 1DTSA 4KAAA 2W2MA 5JZBA 4RDXA 3U4IA 1D0VA 3NTLA 3PEFA 1HR0B 4HFMA 4HB2A 1G17A 3CURA 3QPVA 1I6LA 4TUYB 2UU9O 2D2FA 3KXLA 3PVZA 4RMNA 4R7TA 3TLMA 1T5OA 2IJGX 4DCMA 2DEUA 2KQXA 4XDLA 2ECKA 3BWXA 1E2IA 3KT8A 1PT8A 3OQMA 3CX8A 3DUWA 3C6KA 1AJNA 2JLZA 4B3CA 3ZCQA 2QTMA 4QRDA 1UPAA 1CF9A 2ZE5A 2TMKA 4ZCMA 5EWRA 2BHLA 1XNQO 5FTNA 2H6LA 1S5HC 4INPA 4TSFA 3JSNA 4GL4A 1VHTA 4L5YA 1JIUA 2O2ZA 3IP5A 4BT5A 1ATIA 3ED1A 5HG0A 3NYWA 4AURA 3SS8A 5BNIA 2YVKA 2CLKB 3TRKA 1FTGA 3TNYA 2W6JD 2VBIA 2NZJA 3J81M 1RRPA 1CUXA 2HMUA 4CKWB 3BBLA 2H1IA 3SDSA 3T5BA 3GZJA 3W7UA 3EVNA 1G63A 2H06A 1E79G 2GZLA 2VSXA 4O4JB 3S0WA 5IJWA 4L51A 3T9EA 4KUMA 2GETA 4YRDA 1O6FA 1SKQA 2OFFA 5LBUA 5WRFA 2XNDA 3ZPXA 4PFKA 5ALKA 3L8HA 1Y3CE 2QZPA 3O95A 5KCZA 1RFGE 1N2IA 1BCSA 5EJ9A 3FZEA 1UFIA 3ZX4A 4MUMA 3W7VA 3CN7A 4HDMA 2W43A 1YBFA 4QGBA 4J4TA 1R9GA 3UKMA 1XWIA 3LVFO 1I5EA 4LI0A 2Z8ZA 5K6TA 4OHRA 4CR6A 4EB6B 3BZUA 2XMZA 1SEVA 2XTJA 1RJWA 5E1DA 2HA2A 4ZYWA 4IKPA 3H9VA 2OCIA 1BMFG 4MGYR 4YP6A 3V2IA 1KH1A 4UBNA 3CCRF 4PLCA 5AH0A 3FX7A 2NXNA 3HY6A 3A1FA 1PHRA 2PX5A 4QOSA 3LGAA 1P1RA 1K8XB 3AFGA 4GDFA 1YXMA 1U0BB 1QQ7A 2DBZA 2E4XA 4WINA 3ZYZA 3ZHSA 2PN1A 3ORSA 3RVDA 1E94E 1MENA 4YRCA 4ENWA 2Z1UA 3U1BA 4YCNA 1TZ2A 2KSQA 1QC5A 1WNTA 3KVVA 1E1MA 4O2BB 2F4NA 3C3PA 3R3HA 4YCLA 4OX9Y 2X5JO 4P2BA 4Q21A 2R1ZA 3N0WA 1DEOA 3KAPA 4OLBA 3VV2A 1C1YA 1EEHA 3EZLA 3ZGNA 1PJBA 4C1BA 5FBHA 4GPEA 1H0HA 2VK8A 4OOEA 1JJOA 4QICA 3W7TA 1PS9A 3PUZA 3R3XA 3GBVA 1N6NA 2WJ6A 2F1MA 4F92B 5F5NA 4QT0A 2HDHA 2HOQA 4BVLA 3W2HA 1HF3A 2FZEA 3DDNA 4OGLA 1VBNA 4R81A 2R84A 1JJAA 5I8PA 3THYA 1F9EA 4FSDA 1KQOA 1KDYA 2GFQA 3TLJA 5CPBA 4GBED 4EEZA 1YJWV 5A5VA 1BGYH 1PNLA 1KO8A 2A3RA 3SNKA 1K7FB 1H2RS 4JODA 3EAQA 2WWRA 1NJ8A 3U7FB 4BLSA 5KWVA 4EJSB 4X1YB 4DEVA 3COVA 2ZIOA 2W6PA 3TZBA 4WNAA 4CH3A 3DMHA 2WLLB 3NVKI 4RJTA 1G7CA 5I01A 2CCJA 4UM7A 1HR0O 3ZJYA 1EZJA 3FNRA 2O14A 1HY3A 1X39A 1X86B 5TVGA 4DB2A 1W30A 4BO8A 3G0IA 2GDSA 2MYNA 5DFAA 4CQMB 1QZTA 3VHQA 4M7PA 1POWA 4WLFA 1F5SA 3PDIA 2IK8A 5EVJA 3KQQA 3OC6A 1FXWF 4HDNA 1E0AA 1VP7A 1ZL8A 3BRQA 1A9OA 4DR2B 4FN4A 1E7WA 4CIBA 4UBOA 1VPWA 4YRJA 3PPXA 1N6OA 1Q6ZA 4P4LA 2VP3A 3NAQA 1LRJA 3WO1A 1JTEA 1F2UA 1UZAA 1GTMA 2WTEA 3PCRB 1EWTA 1PAUA 2HR1A 3EARA 9ATCA 1IJBA 1UINA 1QR8A 4MVJA 1QLHA 2GUWA 4MUKA 2AVNA 3DVSX 3VH3A 2VXYA 5ILGA 3O73A 5K6AC 2JLCA 3ETLA 3V1LA 4JUAA 2NXCA 2PVPA 4N0DA 4LYGA 5D5PA 3E8BA 1ZN2A 1R8SA 3F97A 2H4WA 4PZ9A 1GZSA 1NVXQ 2INGX 3AKEA 3FPSA 3IV7A 1S0VA 3LZCA 3OTFA 2Y77A 4JWTA 5EC1C 1RAAA 3R76A 5HP7A 2WIDA 1MOQA 1CZHA 3HVHA 1J33A 2HL6A 5HWSA 3AR3A 1M90H 3L7AA 2PS9A 5I9SA 4HFRA 2HCBA 3PNBA 4GPZA 4OBWA 4Q3LA 3O1HB 3CCFA 1GUBA 2V54A 2Q1XA 1GHTA 4BNKA 1SOAA 4N65A 2I71A 4CLXA 2A92A 5L3QA 3I6ZA 2A2ZA 2Z5VA 1XCPA 3WGVA 1YIDA 2NTVA 2EXXA 3TWOA 3WWPA 2CHTA 2W0FC 4MP8A 4FMCF 3TOZA 5DNCA 1GKFA 4LWQA 4ZCQA 3QI7A 4LXHA 3RSGA 2WKPA 4U0JA 4TRJA 2WQZA 3F74A 3WVNA 4DMKA 3HI4A 1E79A 1HG1A 1XTBA 3FOFC 3R0JA 5L7YA 5BW8A 1BWQA 2RI6A 4B62A 1OPXA 4HAZA 2CVLA 2FLVA 5EBMC 3EB9A 2AWNA 4YRNA 4XWOA 1YK0A 5JNRA 1JZSA 1QQ5A 3R3YA 4BYGA 5FWAA 4FU0A 5C4IA 3U7JA 2ZB4A 2VUSA 3GVIA 2ILVA 3EVFA 4LHYA 3QVLA 2X5XA 3H2KA 4MROA 4X89A 3CZ4A 4FCCA 1TEZA 2N42A 3R40A 1U65A 4MAFA 3OGIB 3KSAC 1OBCA 3AIOA 2QRKA 4UCWA 4B35A 1BQ3A 1A04A 2ZJ1A 3OQIA 2YWXA 4RVDA 4DC0A 2BISA 1R3LC 4ARVA 2AFHE 4DPKA 4XLZA 3SYCA 1BGWA 3DYIA 2PMFA 4L8FA 4BXOB 1XYGA 4OA5A 1WSAA 2CH7A 3V7NA 4KIJA 3CSXA 5KQSA 4N21A 3K0AA 2JLQA 3H0EA 3SQNA 5DX1A 1ONIA 2YWGA 3CLTD 2JAWA 3DBHA 4V0KA 2VDPB 5HW0A 4IHJA 3M7MX 4U7JA 1WHTA 3TFQA 1DT5A 1IUKA 4MEAA 4NXMB 3LM8A 1YTFB 2GUZA 3O2JA 5GTIZ 1VBFA 4RGBA 3UMGA 3OIFA 3A1NA 3VYWA 1JLLA 2LV8A 2ZE8A 3H6KA 1NH2B 1YZHA 4E4EA 1R6DA 4K1XA 2V59A 3PJGA 2W5UA 3RJTA 2IUFA 4KREA 2FR8C 4PNPA 2RDMA 1L5KA 5KHGA 1ZIOA 1SCNE 1U0SY 3LJKA 4ZDIA 2JFOA 2HHHB 4RDIA 3FZNA 2WEKA 5D6OA 3TS1A