4ZOLB

Crystal structure of tubulin-stathmin-ttl-tubulysin m complex
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
430
structure length
430
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha-1B chain
publication title Structural Insights into the Pharmacophore of Vinca Domain Inhibitors of Microtubules
pubmed doi rcsb
source organism Rattus norvegicus
total genus 177
structure length 430
sequence length 430
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4zolB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4zolB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4zolB01
5GONA 1RQ7A 5IJ0A 4TV8B 3C8LA 1SA0B 4O4IA 3RYCB 4O4HA 5CA0A 1JFFA 5JVDB 1W5BA 4F6RA 4KWEA 4FFBB 3HKCB 5JCOA 3RYHA 4ZI7B 5EZYA 3HKEB 2RHLA 3ZIDA 3JARB 4U39A 4TV8A 2VXYA 1SA0A 4M8IA 3RYCA 5EYPA 5IYZB 5JVDA 3WGNA 4FFBA 3HKCA 4ZI7A 5IJ9B 3HKEA 5KMGB 3E22B 4EB6B 3V3TA 3JARA 4HNAB 5LXTB 5C8YB 5BMVB 1TUBB 4O2BB 4X1KB 4YJ3B 3WGJA 5IYZA 5IJ9A 4O4IB 5KMGA 1W5AA 3E22A 4HNAA 5LXTA 2RHHA 5C8YA 2VAWA 3JAWB 3RYHB 1TUBA 4O2BA 4X1KA 5BMVA 1Z5WA 4U3JB 4YJ3A 5EIBD 1W5EA 5M7EA 3M8KA 5EYPB 3RYFB 4DRXA 4EI7A 3JAWA 2BTOA 4LNUB 4B46A 4U3JA 5CB4B 1TVKB 3VOAA 4TV9A 3ZBPA 2GVIA 3RYFA 4WBNB 4B45A 4LNUA 2VAPA 3R4VA 4X1IB 5LP6C 5CB4A 1TVKA 3JATB 1W5FA 4WBNA 4IHJB 3RYIB 3JASB 4X1IA 4ZHQB 5LOVA 4X20B 2R751 4DRXB 4O2AA 4I55B 3JATA 3HKBB 5J2TB 5JCOC 1Z5VA 4IHJA 3RYIA 3JASA 4O4LB 4ZHQA 4X20A 4TV9B 5ITZB 1RLUA 5JQGB 4X1YB 5LA6B 4YJ2A 2Q1YA 2RHJA 4I55A 5CA1B 3CB2A 3VO8A 3HKBA 5J2TA 5J2UB 2Q1XA 3N2KB 4DXDA 3JALB 1W581 5LYJB 4O4LA 5ITZA 5JQGA 4X1YA 5LA6A 2RHOA 4E6EA 5MN6A 5CA1A 2R6R1 3VO9A 5LOVB 5JH7B 5J2UA 3N2KA 4EI8A 3JALA 4O2AB 5KX5A 5LYJA 3WGLA 4ZOLA 1FFXB 5MN5A 3HKDB 2BTQB 5JH7A 2XKBA 1W59A 4YJ2B 4I50B 1FFXA 2VAMA 3ZBQA 4TUYA 4I4TB 3HKDA 5MN4A 2XKAA 2BTQA 3JAKB 4O4JB 3UT5B 3VOBA 5FNVB 4I50A 3N2GB 5LP6B 3RB8A 3VPAA 4I4TA 1FSZA 4IIJB 3JAKA 4O4JA 3UT5A 4ZOLB 4EI9A 5KX5B 5FNVA 3N2GA 3WGMA 3M89A 5LP6A 5GONB 5IJ0B 4XCQA 1RQ2A 4IIJA 4O4HB 4EB6A 5CA0B 1JFFB 1OFUA 4F6RB 3WGKA 5EIBC 4TUYB 5EZYB
chains in the Genus database with same CATH superfamily
1KQPA 4CRWB 4X94A 1SK9A 4MQEB 1FYJA 2GOYA 4MH0R 3VU8A 4A0GA 1REQB 1S02A 2RGCA 3H1FA 4H7IA 1OPRA 2KE5A 4NTZA 2DUWA 3TW0A 1AZTA 2GN1A 4YMIA 1EE1A 2PTGA 5FCDA 4NCHA 2ZZMA 3KOMA 4R2MA 5F3RA 4XH9B 1AJNA 2EC5A 4KW7A 1GPDG 3VJKA 1AN9A 1UM9B 1PVDA 4R2IA 4Z2YA 2QKAA 1I7DA 3JZIA 5IBRA 5H6RA 1NQAO 1WXFA 1D2MA 1S4QA 5E6SA 4MICA 5J2TF 2LGJA 2BFPA 3UMGA 3WYFA 1N0JA 3KDSE 3VU3A 1E3SA 2YI8A 1G59A 5KYNA 1DV2A 3HY6A 2QZJA 2FETA 3U4QA 1M10A 2OLEA 1XL4A 1YUBA 3OZVA 3STWA 4N3NA 2K4MA 4JAAA 3ZNNA 5GW7A 5EJAA 3QHAA 3QWHA 5AVTA 4E15A 1EU1A 1NLUA 2C0CA 3TZ6A 2IA5A 1KKLA 3MYRA 2OP1A 2C9BA 2CKMA 4XIFA 3NVMB 4CIDA 4ZU3A 3HXMA 4HRXA 1C0KA 4QWWA 3MOGA 5AWFC 1KYIA 3GPBA 1G98A 2L35A 1VE9A 2XNHA 1C0PA 4DYLA 4OJKA 5SY6A 1NZDA 3NTUA 3O2SB 1T3GA 3WC4A 5BY2A 4NTYA 4RFLA 3HGMA 2VWHA 3ZCCA 3CJTA 4PM4A 2HHHO 3D6MA 1M0TA 3DKIA 3HLYA 4QZVA 5BQ5A 2ZZKA 3L0PA 2UXBB 4JASA 4IEFB 3OQNA 1S7GA 3LK6A 3QYJA 1OLXB 2SKEA 4BT7A 1YZTA 4NLLA 5DHUA 3CUSA 1JKMA 5FBWB 1DKOA 1YQGA 4UBNA 4KN8A 3WLNA 1VQNF 3A9UA 3HY3A 3IQFA 2CXHA 3SQXA 4B3HA 4J3NA 2XWJI 3T5AA 3RV4A 2A5DA 3G17A 1KU0A 5AM5A 2ZQMA 3R3VA 5JCPA 3MPUA 3KVVA 1T8RA 2W2TA 3R0JA 5EIXA 3LM8A 9MHTA 3OGIB 3HO6A 2YXBA 2ZYVX 2BCGY 1J9GA 3AOGA 4Y9UA 1VQ9F 2H17A 4EMBA 1L5OA 1NNEA 5DE3A 3F67A 4A23A 3OFND 3DLBA 2EFCB 2AFRA 4M8KA 3WK9A 1B0PA 3ZBQA 1GKFA 4OXSA 1SG6A 1LUWA 2AOTA 3N2GB 2MINB 1XRQA 3LQYA 4JROA 4OTZA 2R79A 5A04A 1T29A 3AGQA 4EQ6A 1JVSA 5IY5B 4YLGA 1M8PA 1WW8A 4JQOA 1E79D 3UWSA 4E88A 3B60A 2RNBA 3E81A 3O90A 3S4YA 2EQBA 2ZATA 4OLAA 4AJJA 4K0RA 4OJTA 2J07A 3OX2A 5I9LA 3N9IA 3UAVA 2I7XA 1ODCA 1PFWA 5E6UB 1KI2A 1T0IA 1YO6A 1HKUA 4ZI7F 3GP5A 4RJJA 4C0XA 1L5YA 3ZOPA 2WIJA 1DTWB 4JL6A 3UJ7A 1P1BA 3EN0A 4E31A 3FB8C 2IUUA 3W1WA 3IL2A 2JFBA 4KR6A 1E7WA 2MSWA 3E3LA 4O4LB 4JVSB 3KEMA 1E1YA 4LS3A 1Q84A 5K8TA 4L3WA 4YXWD 5LOVB 4II2A 2FPIA 4I3GA 3EDMA 3UJ6A 2O8EA 1GVNB 1HNZB 4WFGA 3SF8A 4HXYA 4NZOA 1F4LA 4O1MA 1JQLB 2Q7EA 3A9VA 3QPUA 1VL6A 1AKTA 4ML3A 2PMBA 2YXDA 2HU8A 3UJDA 1XE3A 3VR3A 1ZCZA 3V8NA 1ZJ6A 5CK4A 1PL6A 2ET6A 5HQJA 5HQ3B 1U9JA 2N74A 1DHTA 1E3IA 4HQOA 1JUDA 3BSFA 3QW4B 1O4VA 1PLLA 3TBHA 1WXHA 5JCJA 4D8UA 1K3EA 4E14A 3OAAA 2HJVA 1KQOA 3UJ9A 4LCJA 1HY3A 4TVKA 2G9RA 1EFRG 1GLGA 2OCPA 4RORA 2YR0A 4QUJA 2M6SA 3QPWA 3VDXA 1F0NA 5KOHB 2WWTA 3IXMA 4RY8A 4QTXA 3IALA 4KQWA 4JEUA 4UVGA 3F7TA 5AM2A 4Y2TA 3ET5A 3DHEA 3TGWA 4Q4CA 4XJSA 1O9BA 1EKXA 3F5FA 3G8DA 3REQB 5AKIA 1M2FA 4FXPA 1C29B 2P2CA 2QVLA 3QEOA 3QA3E 4HQFA 5KNBD 5A1TA 1JB9A 2PYDA 3TZLA 1DKQA 1UC8A 5DSZA 4RY0A 1X4TA 1RW4A 4OQDA 3P9QA 5JMWA 3WMWA 2P4SA 1W76A 2V4ZA 5EXSA 4F5DA 4GX2A 1TIBA 1CWUA 4NI5A 3ABLB 2RGWA 1KD1H 1SCBA 2WW8A 4PN3A 5AVKA 1L8QA 1XMQB 3M8KA 3PGA1 1JECA 1C1DB 3FB7C 1U81A 1TIKA 3NVKI 4Y0VA 1XD8A 1QYXA 1YOVA 3ZZ0A 1Z36A 5A3VA 3ETDA 2UUOA 5EXEA 1Z4QA 3K71B 1KSHA 4RL6A 3BFVA 4QPJC 4LJ6A 3G82C 4H9GA 3IEIA 4HNSA 1V43A 3CGGA 1NE7A 1ZXLA 3QJ5A 1ENYA 1VQ4V 1OZHA 1F5NA 1QO9A 4GKAA 2QZPA 3V7WA 4MQ5A 2QRLA 3PTZA 4PW0A 5BWCA 4IJWA 1SVSA 2BGRA 2XWSA 1AHNA 4HNQA 3B51X 3W5VA 3VJRA 1XLVA 1PFKA 3IT2A 2CZGA 4FDVA 2V6IA 4AG6A 3ML1A 4PG6A 5HJEA 1U7OA 4IDCA 2NVOA 3GLIB 4DV5B 4NZZA 3B48A 2CXXA 1Y8ZA 2PKWA 4DHWA 4YJ3A 5EMKA 1L9KA 1V3UA 3R0VA 3AF4A 1H2WA 2HRQA 2HRDA 4DUGA 5IHXA 3AEQB 2I7VA 4NFHA 4QAJA 4EJSA 4KSCA 1CVIA 4P6VF 1YMUA 2VDPB 1TOAA 1MF7A 4K9NA 4DVGA 4UHCA 2AOXA 3JSAA 2QW0X 2XSZA 3PNYA 1ADFA 2QLFA 2YJZA 3E9ZA 1HDZA 4L5IA 1AKMA 2JAOA 1KGSA 1VB3A 5BSTA 1IOWA 4PZZA 3IH5A 4PHTA 2N75A 2X0KA 2IUSA 1YIJF 5C1PA 2ZRIA 3GAFA 3NVIB 2JGKA 4OU5A 2OXRA 4XASA 3TJTA 1K8RA 4N7BA 4PSDA 4CHGA 1DAEA 1UK8A 2Z1DA 5ELMA 1D6NA 4AP5A 5DWDA 3DL7A 5LDDC 3TKYA 3WLHA 3V7YA 4I08A 3TBFA 2VHJA 2DFVA 1EGMB 1MUUA 2A9OA 3GLHB 3TXYA 3LW8A 3C2QA 2E1RA 2QUHA 1KOJA 1Y6JA 5JAUA 1CUDA 2WEKA 3GFOA 1QR8A 2KSQA 2AFVA 2C3PA 2J6CA 2Z3WA 3REOA 3VAZA 4FYMA 3L9DA 1P1FA 3RYIA 3FAZA 4KITB 5IKEA 2PH3A 4EUFA 1XWIA 4GH5A 4YCNA 2UXCB 4NTXA 4YROA 5K3AA 5LIPA 2CJYA 3V8PA 3ZKAA 3X1XA 5JZOA 3OTHA 1BE3H 2DKFA 1Y4UA 4EELA 2R47A 2WYUA 1YWGO 3GGOA 5IHPA 2PY5A 3HHPA 3RVSA 1AJPA 4NQ3A 2ICAA 2X7JA 1OWNA 3V34A 4IIJF 1BS3A 3APOA 5ESXA 2A0LA 3VR4A 2FDXA 4JR2A 3SJ7A 1KBZA 3QBVA 4MV3A 4A92A 2LNDA 4D9BA 3CJQA 1YI2V 1NI4B 3STHA 3WFVA 2Z5UA 1K4KA 3QKRA 3U40A 1AQJA 5CXSA 1D2CA 2AHOA 1IEWA 2AFHB 4MB6A 1SQ5A 1L7VC 2AJLI 1VM6A 3QVUA 4C08A 4B8YA 3VZSA 3R24A 2PYZA 4X8AA 4BKMA 3Q88A 2PPVA 2Q1UA 4YQFA 2WQ6A 3LA6A 3SFZA 3RF7A 1AI6A 2NYVA 4WFQA 3V80A 5HY1A 4LN1A 3VDMA 1YE8A 1Y7HA 1RLMA 2ZANA 2VK2A 1TYDE 4E07A 4L28A 1X7ZB 2DWEC 1FDVA 4RQTA 1QTQA 3CXCF 2D2FA 5KAMA 5ES4B 2WTUA 2IPXA 3TW4A 4KRGA 3KHNA 4GPD1 4FS3A 3WDKA 3T06B 1TO6A 3PUXA 1FDRA 2WMNB 5C7LO 3ASVA 5CYFA 2R1VB 1UFKA 1NX9A 3EIUA 1ZK4A 3U13A 2DPHA 2VXOA 2O6LA 4II7A 2WA4A 1VBFA 2VUHB 4KKXB 5SZKB 3ZWPA 5IAJA 5B1AB 1K9MW 3M4SA 3F1LA 4P1ZA 4Y6QA 2J5XA 2IFTA 4C4TA 3LPDA 4K6CA 4K46A 3JQ8A 4U2KA 2P2YA 4CV0A 3SS8A 3ABKB 2EF1A 4FM1A 1OLSB 1Y4DE 1AQIA 5F98A 4EG3A 1IZ9A 2P65A 1WZIA 3O8DA 1ICEA 3GEDA 2HADA 2RI6A 3EC2A 2HMTA 2FK8A 1K5SA 4NIMA 2OECA 4KGZA 3FJOA 4D25A 1W59A 4DARA 1E8NA 1CQJB 1YZLA 3DQQA 1OE0A 5C9ZA 2IPAB 5KVVA 1OIWA 2Z1UA 3S3XA 1B8UA 4AN4A 4YAOA 3K14A 1SIUA 2ADMA 3T7CA 3D00A 2ASVA 3IPRA 3SIXA 1UK9A 5CLQA 2FP3A 4LHWA 4OLFA 3KL4A 5JCOA 2IL1A 2GB4A 4Y9RA 4C3UA 3IQGX 2GNPA 4C81A 3W5AA 2ETNA 2G72A 1EN6A 1E5LA 4KL1A 4MKRA 4F97A 5F23A 1SBIA 2XEDA 3S68A 3VV2A 1T2UA 4ZCSA 4TLCA 2R66A 2YDXA 2ZWPA 4FR0A 3ZLUA 1VMAA 3CMAV 3MTIA 2C3YA 1ADCA 4N76A 1DKLA 1FQJA 4EUNA 4YX9A 3IOBA 2LIPA 3NIDB 2IS6A 3TZHA 3DTYA 3D3IA 4U9UA 1QVGU 4JI7B 4W5WA 4AW9A 1I0HA 4M1SA 4OK5A 1GK9A 4QLAA 1K4DC 1HH4A 1VCOA 1IDOA 2I4TA 4IMRA 4LBEC 2BHLA 4GSLA 2H1VA 3K59A 4PLGA 2C5AA 2FWNA 3F9CA 1SBTA 1Z38A 3R0IA 4RLQA 1HE3A 4MS1B 3ZW7A 4DMMA 1ZD3A 2DY0A 1TK2A 3E2IA 3L1HA 3ZU6A 3BCRA 4B6JA 1CRPA 3RC8A 3K9LA 3LWRC 3CVVA 3VBBA 3C43A 4IH4A 4NENB 5HJ5A 1YD7A 1DTOA 1KF0A 2X13A 1I10A 3JQGA 3P97A 4WZBE 3H8VA 4C8EA 1FUIA 3TZKA 4BNWA 1RWQA 2Y0CA 4REOA 1NE2A 2ZRKA 1W0KG 3EPJA 2IAFA 3UHPA 4PNPA 1OFIA 1NL3A 3FTEA 3HFRA 4RTQA 3BD9A 1PSWA 5ALYA 1G4UR 1K1EA 4ZKEA 2GJ8A 2QT0A 4MMYB 1PWXA 3VM6A 5EBLC 2WA2A 2H29A 3FKSG 4WWHA 3IESA 4EGAA 1C4KA 5LBUA 1P44A 3U0BA 1K8AW 4R7ZA 5C1BA 2H1HA 2BGIA 2VCYA 3QOFA 3ICEA 3CM0A 5DX1A 1KNQA 2HF2A 3D8TA 1DBRA 1P17A 1S2MA 4HTFB 2HQSC 4PQGA 2JEOA 2BFCA 4QU9A 3PXBA 2CLFB 4KK4A 2A0WA 4BLVA 1XXHA 4YCDA 3CUWA 2JD0A 4GBED 4J3JA 5B1BB 4N03A 5KX5F 4IHQA 4C7OA 2OT3B 4GQAA 1XD9A 2Z1MA 4WY2A 4I9HA 2XDYA 3PZRA 3PPIA 4KLRA 4FVTA 5BORA 1DWQA 1X8XA 4KXMA 1MZFA 4BN4A 1II9A 1C7RA 6LDHA 1KY2A 1SQGA 1VMEA 2HSDA 4ZZ1A 4D4GA 4C7VA 4YJHA 3WGTA 2QWQB 2HSZA 3FNHA 4II3A 5FPYA 3OESA 4GLXA 3CZQA 1TAGA 1YKFA 3GDHA 4UUJC 1EDZA 1F12A 1R88A 2XDQA 3PE3A 4XM1A 1E2NA 1QWOA 2D5AA 4C7KA 3L4BA 4Z2WA 3PQ2A 4KLZA 3TDKA 3V9AA 2QR2A 4X6LA 4J9YB 2R8EA 3LYLA 3N3AC 1KYTA 3AU9A 2E3CA 2PNFA 4OHOA 5C1IA 1RAAA 1DFHA 2UKDA 4ARBA 2YBEA 4MIYA 1TYBE 3T5DA 2RQ6A 5KAPA 4YUYA 3LQ4A 1O57A 1UJNA 5I6DA 3DMTA 2VPYA 3DDZX 2H5EA 4NZ9A 4BVGA 1P2SA 4Q18A 3Q2IA 1WLEA 2WU8A 1TVKA 1QJCA 4GLJA 5BQFA 4OL9A 3GPCA 4DCCA 2G6TA 2JI7A 1WHSB 1KC8W 4F38A 3SYLA 3TMYA 1ES9A 4EX7A 1ZM3A 3BB3A 2NVUB 1Y3DE 2JARA 1BC5A 3EAFA 4YFYA 3LP6A 1ZYUA 1DAHA 1W88B 3R9XB 5BUSA 3VC7A 4IIVA 3OOEA 2RB5A 1MAAA 2HA2A 3WHIA 2AWOA 3DE1X 4LCUC 3KTOA 4TTVA 5HKAA 3TLZA 3CJHA 5IDXA 1QDLB 3ZK8A 1P8JA 4HD8A 1YKGA 4LYDA 1QQ7A 5CJJA 5ICMA 4AWAA 1WUJS 2OO7A 1NN3A 4GR4A 4F72A 3DW3X 3K8ZA 2XODA 3I64A 2IBZH 4N5HX 5EIBD 3WX0A 1GTVA 1XCJA 5AVZA 1HMYA 4FB5A 1V26A 1V55B 1N2CA 3A3OA 4O0MA 4FBLA 4AURA 4HF7A 3ZY6A 1UKAA 2JJ2G 4FLVA 3U0OA 3IBSA 5I47A 3C3TA 3SR4A 1ODJA 2FQ1A 5FPOA 2CUGA 1KVTA 1R3UA 1P0IA 1UBSB 2PUGA 3PNMA 1LSOA 3T5CA 3KB2A 2LBTA 1EJBA 3D6NB 5TEVA 2DPLA 4HDCA 1XRSB 3ER6A 4FFVA 3EVKA 5IARA 5F4BA 3UMRA 3I1JA 3N4ZA 1DF5A 5EHNA 2ID9A 3RIHA 3W79A 3D4BA 3I76A 5CUQA 1RPRA 16PKA 1OZ0A 3REFA 2EFGA 5TE9A 2WABA 1TK3A 3CFYA 4JLKA 5HS6A 1OH8A 1D9XA 3KYBA 3P20A 3WIEA 4WCVA 4TM8A 4DCGA 2RAVA 2IS1A 1ZZEA 1H5NA 1DIRA 2WLSA 2ZVPX 3O38A 2MU1A 2WLLA 1Y76B 3UQ8A 4LBYA 3CUKA 4NNOA 4MIOA 2Y6VA 1AHPA 1POXA 5AESA 4XOIA 3JVHA 3ROGA 4AJNA 4LNUA 1PI3A 5TPWA 2RH5A 5KHIA 4XTCS 2VBFA 3BG5A 1BNCA 2F1JA 4G5YA 3PUYA 3NK7A 2HK8A 2MIIA 4ICIA 2B2CA 5JS7A 1P62B 2TMDA 3DLCA 1SELA 4LRYA 4EI8A 4CL0A 1JR3D 5K4HA 4JC8A 4Q4HB 2FXIA 2N46A 5LN1A 1GMGA 4F1WA 2YWEA 1XLTC 4EPYA 3UK0A 2N04A 2WA1A 2XYGA 2ODPA 1UODA 4WFEA 1RYZA 1DVRA 4B3DA 3DO8A 2HK6A 4J7KA 1PVVA 5FLXN 3ABTA 1PNTA 3RWMB 3IUBA 1T3TA 2QNRA 3H11B 3ZDDA 2P5YA 3PPXA 1BHSA 2CXUA 2V8OA 5TV2A 4U5XA 4Y6RA 3L7MA 1JDJA 4NR1A 1B06A 3ZWAA 2PRZA 1IHPA 2HJWA 2VH5R 3H8WA 3K9QO 4F5EA 4D99A 4D44A 1TT7A 3I9LA 3KZVA 4L3OA 1PT5A 721PA 3HR0A 4BLPA 1UT6A 2HDHA 2EVWX 4KIWA 1MG0A 2AKAB 1Y3FE 3WFIA 2FMXA 1TAQA 4F5YA 3BA6A 2ODEA 4FILA 2BGNA 1K88A 4NF2A 3ZDRA 1H9CA 1Q14A 1DCTA 4TMVA 2ZIXA 4YTEA 3B1VA 3AJEA 4BE7B 4RDHA 4D0LB 1G3UA 3J81N 2RE8A 4PZ9A 1E2EA 1L7MA 3C8LA 1T34A 4QJ3A 1QAHA 4CIYA 1W5SA 1F2UA 1WZCA 1A2QA 4MEBA 4E2XA 1FS6A 5A3SA 2IHTA 5I7AA 1O94C 2CL6X 2QPOA 3KJHA 4E5DA 2X8JA 1XN1A 3FKJA 5CTJA 3K04A 4DLLA 3FUVA 5DX8A 4ZANA 2DWDC 2VJMB 2GEJA 3RK0A 1PK9A 4MW7A 3H5AA 2QTFA 4EGJA 5D7NA 2JFXA 2IW5A 3JAMM 2Q0XA 2C95A 1O5IA 2OCIA 4D96A 3UO2A 2YIBD 4ZRDA 3VVCA 1Z5OA 3ZHVA 1KSJA 1GV0A 4BP8A 5DM6V 3QEMA 5C3UA 2FEPA 1KKMA 2P6PA 2UUAO 2WIDA 3ASOC 2NYAA 1EFRD 4PC1A 2LW1A 3J81k 5CVJA 2I62A 1BMFA 1BQEA 3M9XA 1KQNA 1RI1A 2YWXA 1VE3A 4EW3A 3NU1A 4B35A 3O2NA 5KZMB 1OCCC 3WQSB 2Q2OA 1ZR4A 3SIUA 1H3NA 2IQIA 1JAXA 1UWVA 3FFXA 3RSHA 3IJ5A 3FXAA 3ZY4A 4ZJYA 5DN9A 2H2DA 2HFKA 3RSCA 3OONA 3ZVMA 4U3FH 3A1VA 3LT4A 1YQXA 3HYLA 4XD7D 2OVFA 4ND8B 1EXNA 4V3BA 2XJ4A 4UTVA 5LP6C 1R50A 1WD7A 4CU2A 4L9AA 3F4KA 4OY3A 2FPMA 1MB9A 3EHEA 2LD4A 2LVBA 2QYSA 3RG8A 4KFCA 3WNCA 3G7NA 4BNGA 5JSHA 3SK0A 4LC9A 3K2IA 3GRYA 1QF6A 3EG5A 4MAAA 2JBWA 2OD9A 4E2FA 4BJ5A 5FTKA 1PJSA 1TA9A 5T8KA 3JQ7A 5K99A 1Q16A 4F86A 2JGUA 2AWNA 3KB6A 1JSZA 3DZGA 3ANSA 2WD8A 4JI6O 2NUAA 2PUSA 1TGOA 2HN9A 4FI3C 3VPCA 1X77A 4TWBA 4OM7A 2G3YA 1SZJG 4JJGA 2NZXA 4DABA 3E7DA 3GRFA 2IXTA 1V11A 5HZMA 1V47A 3C0KA 2UZIR 4M98A 2P3SA 3MBOA 2R4UA 4IDAA 3V7NA 4URFA 4GWKA 1F23A 4LOKA 5H59A 1RXWA 5AW3A 3ZN1A 1GEGA 4P34A 3FROA 1TK9A 1Z9BA 4XI9A 2DVMA 4B83A 3G80A 5IKXA 1DXYA 1GP2A 5A7FA 4FYVA 4HNUA 1LPSA 1KD1W 2AOUB 2X1MA 2AW3A 1KQSF 4AJ2A 1RRPA 1ACLA 3T1YB 2OTLV 1O6BA 1H2MA 1D03A 1QK5A 4LBVA 2YRWA 5DNAA 1IZ0A 4O2AB 1L5LA 1PT8A 3IMEA 1EG2A 3TSOA 2GN9A 1COWD 4ARZA 3PDHA 5CM9C 1SUAA 3KX2A 1FPQA 2ZS9A 4QUBA 3DBLA 4BECA 3PDUA 3D54A 4H60A 2W2NA 2OA0A 4CUKA 1VIVA 1PFVA 1MO3A 3CX3A 2V7GA 3GR6A 4LJSA 1W5BA 4X0EA 3KKEA 5C37A 2XQGA 5FNZA 3FZQA 1SA0A 1Y74B 1PGPA 3JD0A 4AS3A 2PUCA 2ORYA 1H2GA 1Z4MA 4WCFB 5KLVH 2GDZA 1HX7A 1KEKA 3I01M 4G5HA 3CNQS 4ZDIA 2IYLD 4I8DA 4KQHA 2BUBA 1JB1A 4DMCA 3W06A 2DSNA 1H94A 1OLUB 2FF5A 1VQMF 1D6JA 2C9ZA 2WFLA 2BBSA 4LISA 4MRRA 2HAEA 3F3SA 1F4VA 2Q5ZA 2Q4EA 5DBGA 1RYHA 4N54A 4W9RA 1PD3A 3I42A 2H3OA 1BROA 3RT1A 4EFDA 3EZYA 3D8BA 3S2GA 2O7VA 1KEEA 4HQRA 1ZGAA 1NPDA 4HSGA 2A92A 1WD5A 1R37A 2VRWA 3K0CC 3K79A 3OUUA 3X1DA 3ZMSA 2A7WA 3QOWA 3FVRA 3UFBA 5M04A 1ZZGA 2B6NA 2XBUA 4RAOA 2PUHA 3C48A 5AVWA 4A6EA 8MHTA 1YT5A 3CPHA 2D54A 3H5IA 2IYVA 1FX0A 3W5UA 5JV5A 2PH5A 4CM9D 3G1TA 1KDOA 5KYWB 4RCYA 3NRBA 4FUQA 1KI1A 1NBMG 4YYEA 3CZ4A 1PZMA 4JP1A 3CUVA 1DO0A 1WEKA 5HCNA 2UYGA 4BVJA 1UBNA 3JPYA 1NGSA 1U9IC 4JVLA 3BVOA 4IZOA 5EGSA 3UOAB 1NI8A 4TV9A 3W4JA 1AKNA 3GO4A 4JI0O 3K4HA 2O07A 4CM6A 1UDRA 1WG8A 5ERGB 1H48A 3AYZB 4RL4A 1Z5UA 4ZZ0A 1MB4A 4CQLA 2RCVA 2PLRA 4C0WA 4ZYXA 2I6SA 1BW9A 3EWNA 2W6IG 5C5EA 3L6BA 3KSRA 1QV7A 3GUYA 3RU3A 3OEEG 3WXMB 3SPHA 1K9MH 3UFXA 3OMWA 2W4MA 4UD2A 4PA4A 3DV0A 4A2PA 1WB9A 2OYSA 4BE4A 5AUPB 2H11A 3O3NB 2OO5A 1JKJB 1R0XA 1JIIA 1BRMA 1KIMA 1NQVA 2XUHA 3ZU4A 1VHWA 1PHPA 3BJEA 1TJNA 5ESWA 3DB1A 1BXKA 3FHOA 5JSYA 5KWVA 1G5IA 1KAEA 4CH3A 3LAWA 2OILA 4ZJUA 1KPGA 2PZMA 4P22A 5DTJA 2NP6A 3JSNA 3G88A 4J4TA 4EMSA 2QKSA 1U6IA 3OPYB 3ZY5A 2HREA 1T43A 1MABB 2Y1OA 3CX7A 1NF9A 1XDCA 3ZHBA 2O1WA 3BHJA 2VBGA 1N0UA 2HA4A 4WESB 3LVFO 3O1LA 1Q2XA 1TM5E 1SXJB 2XCRB 1MN6A 3SHOA 2PX3A 4MPDA 2P9HA 3GWKC 1ZSPA 2B4TO 1ODEA 4Z4IA 4WLOA 5BQXA 1NF2A 3TS1A 4OFZA 1SETA 4IIGA 1C4WA 2ZRAA 3ZS9A 4P31A 2FUKA 5EMHA 2JAUA 4E11A 3EUEA 2EFDB 4OGLA 3JWGA 2QP3A 1KJIA 3U49A 5EBWC 2BJVA 2PRIA 2PE5A 5F2EA 2ZDIA 1QGYA 3O8QA 3LZCA 3N2EA 5K2MA 3TB6A 4UBLA 3TFOA 3B1WA 2HDWA 2WB4A 5EP4A 3AB3A 2JLUA 1UOOA 3DBRA 3IOYA 2BUAA 2XMQA 4J0IA 3DYBA 2GRUA 3D4PA 4Q9JA 5IBPA 1L7EA 521PA 3ICWA 2L17A 4FDAA 4HVTA 1XEWX 1KVUA 3D3QA 3IJEB 3DEYX 3UYLA 2C2AA 2BFMA 3FWKA 4TRRA 2IF0A 4OYYA 1YZ3A 3SNHA 3T9BA 5K6AC 4YLEA 1LJLA 4I9GA 1JR4A 4CH5A 5CXUA 1ZHHA 3TOZA 2WVJA 2Q6VA 3WGOA 1WZ2A 2R6FA 4C20A 4EJFA 2P0YA 4YPFA 3CE6A 1YQEA 4DM7A 3QOYA 4URHA 4DB4A 4KE7A 3QTLA 2H51A 1NC1A 2BFOA 3HWSA 3AFIA 3GJSA 2X9GA 3IX7A 2BCCH 3BGIA 3V5NA 2BM8A 2ECOA 1XQYA 4QYIA 2LZ0A 3KHKA 2AZDA 3GVXA 3U7EB 5K3EA 1H2FA 3ESBA 2AXEA 1JWLA 3ORYA 4W9MC 3HKEA 5F64A 3TXAA 3FWYA 2WKRA 3LO5A 4HQKA 3L04A 1K8AH 2WA3A 1NF8A 1J21A 3RVNA 3L73H 4R7TA 3G6WA 1IBMB 4A0HA 4RZIA 4E30A 5ALNA 3WRYC 4D9FA 2CUNA 1IOZA 1YZVA 4XVRA 3ELWA 1GTZA 4ZI3A 5C8VA 3TLXA 4H7KA 2GK3A 1ZU5A 1AUVA 2X22A 2GEKA 4TRMA 3IEKA 4ZVKA 3ENZA 1EWQA 1VBNA 5AM4A 4MWGA 2QXYA 2CF5A 1W0KD 5DULA 1Y6RA 2YC2C 4EECA 3Q15C 3RODA 1ZK3A 1PG2A 1UAAA 4PA6A 4WOKA 2HKOA 2XKAA 3ZLJA 4D3XA 4TLAA 2V0GA 5JXJA 2PGXA 5CA1F 3OKAA 2B5UA 3DP9A 4CTOA 4ZYLA 3FKSD 2QTZA 1MO2A 5IDJA 1C50A 5L7WA 2DYSB 1L4MA 3WKBA 4E5VA 2GCGA 3MWEB 3FH0A 3A6HA 3Q8HA 2HIAA 3UJPA 2ZWVA 5A4FS 5JSZA 4XYMA 3GCZA 1R15A 2B7CA 1HDCA 2CSLA 4FKZA 2PGNA 3DVQX 1I24A 5SYAA 1YB6A 2ZR9A 3RJ5A 5K3BA 5E7QA 1LVHA 5FEMA 1KK2A 2PQ0A 4MZDA 3AETA 2CT8A 1UWLA 3G1WA 2RGRA 2FI1A 4BATA 4MJ7A 4YBZA 2G9UA 2QSYA 4M22A 3P9YA 4C2AA 1T0UA 1U0JA 1JFSA 3N4YA 2P6YA 1J0BA 2W2QA 4V1CB 3WU2Z 2C03A 1Q7YW 1UJ5A 4RKWA 3AHCA 1UZMA 1A4RA 1YAHA 1E6CA 1P2VA 2C2WA 3KWFA 2LCIA 1BJRE 2FJ0A 3T1HB 3WPWA 1DIBA 3RS9A 1Z8HA 3AG1C 2XAAA 1UXJA 4MKXA 2NU6A 4Y2XA 4KO1S 2IYXA 3N86A 3ZQ6A 3I5UA 2FJUA 2QRUA 2VYVA 1HR0B 1SKQA 3WYDA 3INGA 3MMXA 1O03A 3GUCA 5EZYF 4N0MA 3CNHA 4XOUA 4B3RO 3WDLA 3F97A 2OUKA 3G2LA 1OH7A 5EJ6A 3S1AA 2VYNA 4G4GA 4K05A 3MGGA 4XWOA 1L7NA 4E3ZA 3EGEA 4HEQA 3PRKE 2K1EA 2PN1A 4FGKA 3ZJYA 4JZ2A 3NT4A 4NCKA 4A4DA 5LA6A 3HWUA 4QRIA 4OI4A 2WMDA 3PCTA 3ABOB 1AN0A 4MUYA 5E2IA 5KINB 1YR3A 2AI1A 3NC4A 3T7IA 1IUOA 4Z7QB 4OQFA 2BZSA 3UJNA 4ACBA 1FNNA 3C41J 4UHKA 5B12A 5HKBA 4RH3A 3K09C 2X4GA 4NCAA 3DLTA 4PWYA 4BVFA 4QT4A 2CMDA 3CLHA 3NIGB 3QTBA 1NVMB 4L5AA 5I7UA 2YV2A 5JVDA 4KRXA 3UXHA 1P5ZB 3OIDA 2DERA 1ZCFA 1ENOA 4KN9S 3P2MA 4AAYA 3WAKA 1JR6A 4LPKA 5CFRA 3KKZA 3MMNA 3UNXA 3LYAA 3TL2A 4P4LA 5JI3E 5HM6A 1M67A 4N12A 3RIXA 4P36A 1NVFA 3AVYA 2Z9CA 4DJ5X 3SWWA 3RJ9A 1YB2A 4OIFA 1X1EA 4PLFA 1E8MA 1XTRA 4G0MA 1ZMOA 1EFAA 2HEIA 1IVYA 3ENVA 5FHRA 4D4JA 5ALIA 2GZ2A 1G0NA 3AM5A 4D56A 4RZ2A 1CE8B 4WVLA 1FP2A 1U7HA 4N01A 2XVMA 1W41A 3HR8A 3CF4G 1XTPA 4O02B 2ZM5A 4WN3A 1VQ4F 3D1JA 2QWNB 1G21E 1I4DD 4JI5O 2ZXFA 3WRWA 4JYCA 4XUDA 3IA2A 4P7BA 4U0KA 4WPGA 3OLYA 2PL1A 3CBGA 4PONA 2W2PA 5DHSA 2Q5LA 3UPDA 3PUKA 1LTHR 4HVAA 1U43A 2QQEA 2QX8A 2GUGA 3CS3A 2QE7G 3L0IB 4G2NA 1J8MF 3IAM1 1NZJA 3EYWA 3ZK7A 1W57A 4HAZA 2JAQA 1RJGA 2C5HA 5F5LA 4LVUA 4GDMA 1HORA 2E4AA 3ZCPA 4FB4A 2GHQA 1G9SA 3OMAB 3DJYA 3QPVA 5PNTA 3SC3A 4TLBA 3VH4A 1BQ4A 1KJNA 4LJ8A 5DH9A 3GN1A 3KOXA 4MQBA 5H2FZ 4KQKA 1XT6A 2FRDC 4XSVA 5ILQA 5LGNA 1OHHG 1RQ2A 5GTDA 1CQIA 2ZJOA 3AK1A 4RQOA 4KCGA 3IPAA 3MUEA 1AKQA 4JLVA 1YQUA 1ZICA 3TLCA 3MCAA 4AO7A 4B81A 2YHSA 3BCCH 4I4LA 1M7BA 3BMQA 2IHBA 4I6EA 3V1LA 3F1KA 3I1YA 3FPFA 3TW6A 4HOYA 3Q11A 5KSPA 1E1KA 4D81A 1Z35A 1JEQB 3HXKA 3CN7A 1KZ1A 1BKSB 4IQGA 1J7KA 1LNSA 2ZKIA 2EBOA 621PA 1SQBH 3W2HA 2CXSA 4TPKA 3X44A 3JPWA 4D3DA 3SC4A 4NK4A 4Q0MA 2NV6A 2BF7A 3TUIC 1AS2A 1JT9A 1UQUA 1SS3A 3U9SA 2XI4A 4D42A 3EY9A 4KHPB 5EC1C 2XCSB 2ZNIA 3MCQA 4ER7A 5JANA 2BHTA 1ZVVA 4I1UA 1PW7A 3IQDB 3CTPA 3PYMA 4BMCA 3WB9A 5LMNB 3T6KA 2VGNA 3NDJA 5CDYA 3DMHA 1X7YA 3OW2U 4AECA 1AGPA 4WNYA 2VQFB 3P4EA 1NVXQ 2CTRA 1OWLA 4WKGA 2CVHA 3I2FA 1XEFA 1PCXA 2QTVA 1EJ2A 4UEOA 5AH0A 1XU9A 1FXWF 2W0SA 3VOTA 2FG7C 4F2WA 4HG2A 2O5VA 1Z56C 3W3AA 4JZKA 3U0ZA 2XYQA 1BHQ1 2R85A 2GPJA 1OTYA 1V54C 1XEAA 5CNJA 3OU6A 1HQYE 2NVBA 4MJLA 4QA9A 1YI2F 4U7WA 1UP7A 2LWIA 3CLRD 4X3LA 1AS0A 1XZ8A 5SZHB 4PYKA 1VIMA 1P29A 4AXXA 4K35A 3QHPA 3R0QA 1EZ4A 2F9MA 2PEYA 2OK7A 2H1RA 3PE6A 1SCUB 221PA 1ECCA 2IBMA 3E20B 4TZ6A 1L4GA 4JLOA 3PQFA 1R8SA 2DQ3A 2R8RA 2QIPA 3KSAC 4GXQA 4JYYA 2CDYA 2HRZA 1VBKA 4AZSA 3SZGA 3EVCA 3GRKA 3DHVA 5CT5A 1G2IA 1K7FB 5JW6A 5CP8A 1KC3A 5EESA 3UEOA 4BV2A 1IM5A 3KIZA 2IC5A 3ZS8A 3DT6A 2PAAA 3PLRA 2HMVA 3I6IA 4B6EA 1H2XA 5C35A 5DIZA 1Y7TA 5FBLB 2XASA 2GK4A 2R7LA 1BO6A 1UBRS 3ZJTA 3WLTA 3DLHA 2OXIA 4JOBA 3WISA 3M34A 4GKKB 3DVRX 1V9CA 1LF0A 2RB4A 2IYNA 2R7NA 4UNNA 3FOZA 1M9NA 2L0XA 2MSDB 3KZIZ 4CV3A 1QBKC 4G0OA 4F3RA 2PBRA 4ZVTA 2OR3A 3FNIA 4MSWC 2WOJA 4NE7A 1UFVA 3A05A 4BMPB 3JALA 3KALA 3TL6A 1FLNA 2FH5B 4F9GA 1AZWA 4H13B 4PAOA 5JEDA 1GZ7A 4P4SB 4P53A 2G80A 4BFXA 2IYUA 4NXMB 3G79A 5DGHA 2D8MA 2R70A 3E03A 2VPQA 1W46A 2QJOA 2PGLA 2GUZB 5AKHA 4L6AA 2Z56A 4X85A 3QKWA 4TL7A 3ZXYA 1YL5A 3R5TA 4X44A 3C7DB 3JSXA 4HYQA 3AERA 1S5JA 2PH7A 4BWFB 4GOKA 2R1TA 1BN6A 3MGKA 5K8UA 4YUXA 4XUGB 4KREA 3BF8A 4US0R 2Y48A 1IN7A 2H4WA 1NXPA 4JYZA 5DDIP 2Q5CA 1SIBE 1RVDA 4K6OA 1GNTA 2BMEA 3HDYA 2YYEA 4RV4A 4TQUS 4KBYA 3BTUA 4DADA 1SCNE 1PZNA 1JLMA 2XPCA 3CMAF 2C4UA 4EPRA 3NBXX 2YBDA 4YY3B 2JK0A 3WJ2A 3MLAA 1DAMA 1CK4A 3F0GA 2O8NA 2QZZA 1J0EA 1VSVA 4JTDB 5J2UF 4XCQA 3HABA 3VFDA 1YRQA 2DX7A 4S1VA 3RI3A 1ZLYA 4JCCA 5K0BA 3DFMA 1PEYA 4QPCA 5DK4A 4W4KA 2QA5A 3E5NA 2A94A 2PLAA 5JFTA 5ECYA 5D5PA 1H6DA 1W8DA 4QE7A 5IYDO 3DZFA 3LX4A 5A9SB 2GWRA 2GSWA 4HNHA 3SIPA 2BH2A 4QXMA 3H5NA 3ZJUA 4P80A 1FU8A 1CQZA 2J9FA 2HY7A 3WQBA 1YXMA 1BDJA 3QEBZ 3F6MA 2GFIA 2NZJA 4F91B 5FWXB 2JG3A 1QE5A 1NVUQ 3VSDA 1TLTA 4ND5A 2UZHA 2B34A 5FUYA 3LCJA 1GO0A 4M37A 3CVXA 4KGVA 4B6SA 3G0BA 1OX4A 4UKDA 1OZGA 1G8FA 3SYQA 1EFVA 2G04A 1I33A 4XTRA 3I34X 3H2IA 1BWPA 4DLBA 3RYTC 3KHSA 5EHGA 1ZVJA 4P3PA 1T0PA 2A78A 2QGNA 5JMPA 1DJQA 3K0BA 3I72A 2Q8PA 3CJRA 2XCOA 3EZ6A 2OHGA 3DWEX 1OIVA 4WKNA 1YTFD 3TQRA 2AOVA 4QC2A 4PY2A 4P7JA 2FZKA 3CX6A 1ZBQA 3DD5A 3HVUA 5HJ7A 2ZTLA 3DAFA 3FX7A 1DO8A 3H19A 4Y98A 1S2IA 2J3JA 2YZKA 2AC7A 1TU3A 1WSWA 5JXHA 2DTEA 4LRSB 1KI8A 4OREX 3CRW1 1UBGA 2GN8A 3WO0A 1T4GA 2C07A 4DXDA 1I3OA 1H22A 1R4MA 3FYTA 1U2PA 1VQVA 2R48A 4KQIA 3DDNA 3NKFA 4MV8A 2W6NA 4NWIA 4TZZA 2CXTA 3SS7X 3J80N 4DR3O 4QYWA 3FLMA 1VQ6V 4P4NA 2FDCA 2ODTX 3AESB 5CIYA 3WHKA 5JDIC 1GUYA 5NULA 4FOLA 2W6ID 1U3LA 3NAMA 3BQNB 3OEED 3BB4A 5TJ9A 1AGRA 4E08A 4MWZA 1AMOA 4PX2A 1I2BA 4FLFA 3KOUA 2V4DA 2MYPA 4LX0A 4IJMA 1ETUA 2C61A 3EC1A 1R10A 1SQPH 5B7GA 4Q9AA 1QX4A 3I7TA 3LUJA 1IMJA 3MLBA 2WU3A 4CUJA 4B33A 4AFNA 5CVCA 3NHRA 4TTJA 1MX1A 1V8BA 1XVIA 2WAOA 3LYUA 1UXOA 4GGOA 5JBQA 4LZAA 4QREA 4RJ2A 5ARBA 3M33A 4IGAA 3CRQA 3IKVA 3RABA 3NTXA 3R40A 2WLTA 2GAJA 1JHYA 3EISA 2QZ4A 2E18A 2ERCA 3P0EA 5JECA 1JQAA 2QNIA 4I4CA 1LBQA 1BU5A 1T2AA 2AJ8A 4WXMA 3HVKA 1EJ0A 3TINA 1XLUA 2IX3A 4YMWA 4FYKA 3VKVA 5JLAA 4PHHA 3NYQA 1CJTC 1VA5A 1VG0B 2YVKA 1V35A 4RMIA 2QQ5A 4CKWB 2RARA 3KSMA 4EWLA 1BXGA 4F9EA 5B3SB 2P3QA 4CG3A 3GMIA 3IOMA 3TECE 4CM5A 4Q1BA 5LC1A 1VQ7V 3U3DA 1UJWB 1RXVA 4I55A 4DLAA 4KB5A 2REBA 5J5VA 4YMHA 5H3CA 4CUZA 1MPXA 2JJMA 5ITSA 4MROA 2MSCB 1WXQA 3ESCA 2HGZA 3HYSA 3W4KA 3LHSA 2OBLA 5JJ5A 2Z5LA 4R1MA 3DCJA 4EEXA 1WY7A 1E1LA 3UWOA 2IJJA 1PR4A 2HP0A 3F0DA 3LBIA 1NPYA 5EUMA 1YRHA 3WP0A 421PA 1TCVA 2H6EA 2JRLA 3SVZA 3U4AA 4Z9XA 1O4WA 2EWWA 1A7UA 2CNDA 2GEUA 4R50A 3P0RA 2NV2B 2VJOA 3U48A 4X66B 4KO8A 5HEKA 2IPOA 2D0IA 5LSAA 4FIPC 2B2NA 3U10A 3RRYA 2A57A 2XXAA 3OSUA 1S7CA 3LBAA 3MT0A 2IW3A 1FQKA 1HDIA 3GMSA 1U5AA 3QTCA 5JO0A 2QDXA 3B52X 1E2GA 3P5BA 2IXAA 3DBHA 4BB0A 4U9IS 5JAMA 3TVDA 1G66A 4RA9B 3KETA 1VQ8V 4G24A 5D6OA 5KJ1A 1BCRA 4JBNA 2BEVB 1NVAA 4IIJB 2ORWA 4EY7A 1N8TA 4K8XA 3SBEA 3R6TA 3CCJV 4A6PA 4F71A 3CYQA 1K75A 2N0SA 3MZ0A 4MR9A 1BSVA 4C0QC 2ORIA 5HNKA 2P6RA 5GANK 4GXTA 5JFGA 3TFWA 2PZFA 4R2JA 2X0IA 1Q7YH 1S77D 2EWMA 4IOKA 4KO2S 4BGEA 2NUTB 3RA5A 4FMCF 4UV8A 3DG9A 2NXWA 3ONVA 4UCVA 3LT1A 2FEKA 3EQZA 1DUIA 1Y6XA 4TTRA 4WZBB 3KQLA 3GN2A 1GNLA 2IU0A 3MUNA 4A9AA 4JI3O 1O5TA 4JQCA 1RXIA 2I34A 3H84A 3MJHA 1L3IA 1X2EA 3RU2A 3SYCA 2BM0A 3KXLA 3OR7C 1ZNWA 2ZVQX 4YC7A 3EQ8A 3U44A 1EVKA 1VF6C 3D3EA 1Z06A 5I9BA 1DZIA 4EIWA 1DX6A 2H1FA 4BLOA 4XAQA 5D3ZA 5IDYA 2BL4A 3UY4A 1WETA 1KKDA 3ZZ1A 5AHRA 1VOTA 4YIPA 4J7CA 3VA7A 5BSEA 2GERA 1P31A 1CVRA 3HCPA 4M0UA 4B0PA 2J7PA 3QQ5A 3HNPA 4NY1A 5KAIZ 1JA8A 1ISRA 2F17A 1NI5A 5IAEA 1LVUA 2P75A 4LGYA 2Q49A 4EAAA 2H4XA 3OIVA 1K5PA 3CSSA 3ZD8A 1FMJA 4DY4A 3TLEA 5EZ6B 3ETLA 3D8CA 3H1AA 4NJEA 5BMOA 2XD4A 3WNVA 1CJUC 4PRKA 4HH1A 4EL0A 4JB3A 5KHOC 1TC1A 3HJUA 1FYWA 3ZRXA 3EORA 3GEMA 4QPPA 3NVKE 3RA6A 4FYHA 2Y77A 3ABRB 4I1RA 2OAGA 2FSVA 1C7ZA 3KAPA 2IY9A 2V9PA 3HDJA 2OLJA 2RIPA 2H1IA 1S01A 4LR3A 3SYOA 1U6KA 1P6UA 4KIUA 2EX3A 3BMOB 3ZI7A 5AQ1A 5FJ4C 2EIJC 4MWOA 4F6EA 1DEXA 1N92A 4FTWA 3MHSC 4JEMA 4LDJA 3ENNA 4L2IB 4DDWA 2X4LA 5LHHA 3IQHX 2HSWA 3OFJA 3MB8A 4DV6B 2ZB8A 4BKUA 4R8CA 2HIGA 2GTHA 3CR3C 1M0EA 5BOSB 3WGKA 4BP1A 1DEOA 3WIOA 1T6ZA 2A6PA 2QMHA 4X89A 2J6HA 3C7TA 5FBQB 2XT9A 2ZT9B 1J25A 1CX9B 3C4VA 1G1AA 2VQEB 4FD2A 1MTZA 4X6YA 3R74A 3P5SA 1G5PA 4GRDA 3JAWA 1XRMA 5G53C 2JGAA 2GCNA 3UAZA 5L95A 2Y71A 1A4UA 1RYDA 4ZQGA 2FTKE 5FPRA 3QXXA 2FP4A 1JQJC 4QVIA 2X1LA 3LOPA 1EUQA 1V1RA 1H5UA 3RE1A 3MRTA 3IP5A 5U4QA 2C2MA 1WWKA 1DNPA 1OMOA 2DWPA 1S5LZ 3I5AA 3GYGA 3ZQJA 2RGNC 4MV5A 3PT9A 3WY9A 3LUBA 2YNMC 4MS3A 3GBVA 4ZT5A 1H0KA 3PDCA 3K16A 1SC3A 2EKPA 1Q1AA 4UNSA 4RV9A 3ZGVA 5EMLA 3V46A 3ZHZA 4P32A 4M86A 1FSGA 3WNQA 4FS8A 1TU4A 4O4HB 2ZPTX 5BYAA 3Q8WA 3WKCA 3DYVA 1VIBA 1F17A 3ZVLA 4U39A 1I5EA 1Y7LA 2YXYA 4S1OA 2V1UA 3U7HB 5JNRA 4JLSA 3TE7A 5KOYA 3TXSA 3E8BA 1FUEA 5FOQA 1NBIA 2FR1A 1PNVA 2H1SA 2GYYA 3T9AA 5B30A 1IY9A 5LZ5A 1DF4A 4DV0O 2AE2A 4MR7A 2PVPA 2JD2A 3OJFA 3B3QA 1IDSA 4Z1MG 2NG1A 2C3OA 1GZVA 3RFRA 2R6R1 2C97A 4EZBA 4B3JA 2Q4RA 3DDHA 4CBVA 1S8OA 4R8LA 4B1FA 2GBLC 3QFCA 4MRNA 1JS1X 3THWB 2WYWA 3AFMA 4H1WA 3MTJA 3NAGA 4PZLA 3VZRA 1GQSA 4AMBA 2OTLF 5FYQA 2D1FA 4ZCTA 3LKVA 3ZMVA 2VJKA 2V7WA 2UUBO 2V97A 3EIFA 1IV2A 3CZPA 4DPMA 4DBZA 3KFXA 3UENA 5BWBA 5T5QA 5L3GA 1QF9A 2FYUH 1VLJA 3EZXA 1JAHA 3AF1A 3TETA 4WK6A 5K0FA 5EPOA 4TKVA 4K8ZA 1Y6FA 3FAVA 2OGSA 1I6WA 2Z9BA 2ODNA 1NH2D 1OHHD 2YX1A 4ZT4A 4JKYA 4LSWA 1Z75A 1SC4A 4L1KA 4JY7A 1DOHA 2KM1A 3EXEB 4MB0A 4B7EA 2PSEA 2PMWB 4C2UA 3HKBB 3FSJX 4ED9A 2ZIUB 4BRSA 3V2UA 5IM4A 3B1FA 4JDPA 3VBEA 1R9NA 2Y0EA 3BIWA 1W47A 3G8CA 1K8QA 3G5MA 1K5HA 4YRKA 2Q3EA 2F64A 4UUPA 3UAXA 5IUJC 4LDZA 1H66A 3ZDFA 4R2XA 4OQYA 5JEEA 2UVPB 3WLQA 3K06A 4GPBA 4C7BA 1VHDA 1T8PA 3MGBA 1XUOA 2X40A 1FDIA 1FMLA 3IKJA 3QU7A 2VDMB 3K0TA 3ROQA 2XGSA 1X80A 2VNAA 1VL1A 2XCTB 4QDOA 2ZRGA 1T4CA 1FB5A 4O4JF 3R7LA 3QE3A 3QTTA 2CL7X 2IY7A 1ZUIA 2V6BA 4DK0A 1XL6A 1DJNA 5BN4B 1TKCA 4Q4JA 3NHYA 3U37A 2JVKA 5CDTA 3ND6A 3T2MA 5KUMA 2B4KA 4PGGA 5AVSA 3PRYA 4DR5B 1HNXB 1GQYA 2I6DA 3KQUA 3JASB 4JT4A 1AQYA 3NYIA 2AGVA 2VQDA 3T80A 3EXHB 1YDXA 3JD4A 2REQA 1FS4A 2CE7A 3HUUA 4FLTA 2E5FA 4Z4EA 5IZCA 1JHXA 2XWQA 3SPCA 3KQYA 2GTSA 4LY3A 1YRAA 3T3GA 4P2GA 1XZNA 2J5BA 4NK5A 5JT1A 5JPIA 1DAOA 2ECKA 2F1KA 1EUZA 2IEIA 4PIMA 2H2GA 2JJ1G 5EJFA 4DDVA 5LMCA 4PR3A 1ULTA 4BMNA 5IBQA 4RIEA 3HN2A 5BWLA 1E1CA 2VNIA 3M6WA 1YBHA 3AFHA 1M34E 1EMDA 1SQSA 2YHIB 1KDZA 1FFEA 1YUMA 2X3UA 1NM5A 3IBFA 1A1SA 3U4CA 1PHRA 1TZCA 2FPKA 4CODB 1GPLA 5HGXA 5IM5A 3GEGA 4DCMA 3A6EA 4UNRA 3KE9A 2ZYHA 4B47A 4LF6O 3WAGA 1X52A 2G7ZA 3EH2A 4OP1A 2XNKA 1U7TA 4MA0A 4KIGA 4MGYR 1H8HA 3GBPA 2IZ7A 2PMFA 1GEEA 1MJNA 3TIGA 3HMQA 2C29D 2FWPA 3KSBC 3GELA 4OGGA 1GGMA 1SD1A 2QGFA 3JYHA 3BWBA 4C06A 3CLKA 4M9UA 4OXYA 2PG3A 1F6BA 3IUJA 3PC4A 4CEHB 4J49A 4XRRA 1A04A 4DLXA 1FE8A 2V59A 2H3EA 4LF7O 3FYUC 1WF3A 3MTGA 3PR2B 3K1AB 1OFVA 3GJ6A 3H1LH 3DC2A 5KTRA 3OBWA 2QBYA 5HXAA 5H9CA 4RSGA 4Q12A 2X7XA 3BKXA 4A7PA 2YXEA 3K58A 1WSAA 3WICA 1SXGA 2JIRA 3P26A 3SSNA 1TW3A 3N7TA 2PTMA 1XZDA 5LNK6 1W5AA 4B3TB 2O8FB 2DYRC 2CLKB 2XOKA 2C4WA 1M93A 2QRPA 3BJRA 1BWQA 2DFPA 4KYTA 5AK3A 5IT5A 4R9NA 1FLAA 1FXKA 1U3DA 3EF3A 3ZHCA 1CUBA 3SYPA 2QW8A 1Y9ZA 3J7AR 1RLTA 1VCNA 5BXQC 5CYGA 4PELA 1XHXA 3FHJA 2JCVA 5FB3A 2Q6TA 2W2VA 2V9ZA 5LQJA 1EVZA 2PGIA 2CLMB 4J1TC 3THYB 4C4AA 4CYMA 4M3NA 4H0LB 2E4VA 1CUHA 4YAFA 4KTVE 3SQDA 3QHDA 1VGQA 3SQOA 2OY0A 4ZHWA 4LWSB 1G8KA 1HZZC 2EP7A 5F9HA 4ISCA 4EVSA 2HWUA 4HWPA 1FRQA 2DY1A 3UB4A 4V0KA 2GR9A 2O0LA 4HH4A 4IT5A 3IR9A 2M9MA 3BILA 1UT5A 2VHYA 5IJ9A 2WI8A 2E5LO 2YHUA 1GSOA 4DCNA 4XLZA 4GQIA 5K8IA 2Z1NA 4DILA 5B1IA 3TI9A 3NHWA 1J6UA 3HDGA 1KGDA 1VE6A 2NACA 1RDFA 3ZQ4A 1RBQA 4YAUA 4XDYA 2WQZA 3EFEA 1KWKA 4J9ZB 1KY5A 1VQ5V 2WINI 4RVCA 3RT3C 1EZ1A 2AQKA 3WGVA 4LXTA 4PZDA 3ZVRA 1WE2A 5JCXA 5DM2A 3CCEV 2OCBA 4JL5A 4D79A 2O5CA 2Z83A 1MVLA 3RUEA 1F4NA 1KMHA 1DDIA 3IUNA 1UPXA 4RKQA 2IIQA 1FRVA 4QRDA 1Y1QA 2HA0A 4GMDA 1XQVA 3OM0A 1G2PA 2NV0A 3W9SA 3HO1A 1FJGO 3E15A 1EIWA 2Q1TA 4Y18A 1B73A 2OXTA 3R5SA 4OI1A 4P3OA 4OD0A 3M99B 2RGEA 4AO8A 3UCSC 3KZOA 2I9KA 4OMCA 2NTNA 2P4HX 3BXOA 1OVMA 2FX3A 1ARZA 4R1SA 4ZALA 4BNYA 3PJRA 3GVPA 3ZWWA 2VNHA 5ALOA 1PBTA 3ZGLA 5EI5A 3JR7A 2C83A 4MGZR 2ZJZA 1QLJA 1E2MA 2Y1GA 3EA5A 3G89A 1U0EA 3NCHA 3NMUC 5HF9A 2OV8A 3H87A 1U0OC 1ZN8A 4ZVPA 2WOOA 2OHIA 3ZMUA 4MDEA 4RS4A 3FWNA 3ER9A 5EHQA 1P0QA 1OBFO 1UBOS 1QM5A 4ZA2A 3BEOA 4KV7A 5ICGA 1KS9A 3NLLA 2UVDA 3CVJA 3PWTA 1O6GA 3UCFA 4IS2A 4CMIA 1E1RG 3ZP7A 1YZGA 1R27A 4ZD6A 1HDEA 4JVNA 4KH0A 3RB8A 5C1OA 2R4QA 1Y66A 4AQYO 4H0NA 4EUEA 5TB5A 1YHYA 4N9WA 1NF3A 1JRLA 4DSNA 2I1QA 4OHMA 3A1FA 3F6BX 4MV1A 4QOFA 3M2PA 2A9RA 3PTLA 1UMKA 2Q9LA 4TGLA 3E5MA 3UT6A 2AZ0A 2F67A 1HTBA 5DBHX 2FWBA 2IPLA 4LXUA 3S99A 3JWHA 2UYQA 2SBTA 2E5WA 4L0CA 3UK6A 3HJGA 3SXPA 2OORA 2O3QA 2W2MA 3QY0A 3R6DA 3OP4A 2L82A 4LRUA 3UG7A 3AOEA 3L4JA 2WAMA 3I0NA 4JT9A 4QL3A 4DANA 1BXRA 1WS6A 1B26A 4D0NA 1GRQA 2HT1A 3BXPA 3GFVA 2NTEA 1H1TA 3BJZA 4NFSA 4BWVA 3LTEA 1GSHA 1QBZA 4P98A 4RFVA 3PIIA 3AKZA 4Z5XA 2NXEA 1G8JA 3CF0A 1OVGA 2HJGA 1ZA1A 5CGZA 4V0SA 4G6ZA 2A14A 1RXCA 4K86A 5DIFA 1W0JA 1XZJA 2JFZA 4FFBB 2IGTA 3LUGA 4TSFG 2CJPA 4GQBA 2XYRA 2OIEA 2I29A 1I4TD 4OGKA 3QH4A 4NYIR 4KAFA 3RAJA 2ZE8A 4H2DA 3VSCA 2GETA 2H08A 4AJLA 3H5LA 4K9MA 4XR4A 2YXPX 4UEQA 2AKYA 5HKOA 4RACA 1RPZA 4RD2A 3W78A 1O9HA 4M0DA 2BI7A 3L71H 3RVLA 4WBNA 5AOAA 4ZHQB 1NT2A 5CM2Z 3DBIA 4M49A 3EW7A 4H1TA 3WQRA 5FPPA 4DGSA 4RESA 3A1WA 2I2AA 1WHTB 4RV5A 5KQMA 1TZJA 1S5HC 4IJVA 3WGIA 4V3CA 1BE0A 1DUSA 3OFSA 4UQPA 5L4SA 1U2QA 3HKDB 3I28A 3RGGA 1IYZA 4ECAA 3B5JA 2PGOA 4B79A 3AUTA 3TW8B 3MFQA 3T3NA 1HT1E 1PSZA 4HMOA 4AKSA 1GGNA 2FWJA 4KXUA 1ODFA 5HIMA 1IH8A 4N5LA 3A2MA 4JQSA 1ZNQO 1Z4JA 3IJRA 2P1ZA 1C7IA 4N7MA 3GJTA 4WAUA 3V6MA 2EIMC 4Y2SA 2H52A 1I2DA 5FLKA 4CKBB 4HNAA 2HHHB 3TD4A 2KBFA 3QBTA 2RHWA 4GAEA 2QMYA 4M9RA 3TDNA 1MU0A 3L1VA 4IIXA 4CIBA 3EIQA 5IYCO 1IY2A 1TCCA 3CNBA 1RM1C 3G9XA 3AF6A 5K45A 3MN1A 3H13A 2EX1A 3PX7A 3QZUA 4O8ZA 2RMKA 3D7LA 4LMBA 1E20A 2XGJA 1R6BX 3IIIA 3VR6H 1YCHA 4ISBA 5LBQA 2XJ9A 2E85A 1Z73A 5BXZA 5E3IA 2MYUA 1MENA 4ZYTA 3K72B 4KQFA 2IU3A 3CC8A 3B5EA 2CD7A 3VNRA 1GG9A 4QQKA 4P0TA 4MEJA 3GMDA 1TX4B 1ST2A 2O52A 2CGEA 1ULHA 3FCOA 3SJCA 1V8DA 5ALGA 1S5PA 2QT1A 1A9YA 2VDVE 1IRXA 1B3BA 2CVLA 4N0EA 4QGGA 4N41A 1RJ9A 3JWJA 4W99A 3OUFA 4YDQA 2IHVA 1F0PA 2QTRA 5JMOA 4N1AA 4TN5A 4I9UA 3L6UA 5EY5B 3HN7A 3OKFA 1RHMA 4UHDA 5BWMA 4Q7LA 1QGED 5HY0A 2VHTA 1NXSA 4Q4AB 3WHLA 5I7OA 3C6MA 4ZOQI 4YCJA 2Q9CA 5KNCA 4MRPA 4GRAA 4BX0A 4QTTB 1A7AA 2QVGA 1NSFA 5KTSA 4BX8A 1RCTE 2JJ8A 3PICA 1UPUA 3KZNA 2QXTA 3P19A 2C96A 3ROFA 1OJ7A 1JQDA 3PQ3A 1PP9H 4L0MA 4RCZA 1HOTA 1Q11A 4GL2A 3INTA 5BSUA 1W9HA 1P61B 4DNXA 2TRSB 1EUDA 1OOEA 3NC0C 3KKLA 1VLQA 5CT9A 4YO7A 3ID6C 4QBHA 2WUWE 1WDKA 1SM4A 2BDTA 2GWHA 1ISMA 3T1NA 3U7RA 2OENG 2HBYA 3P0FA 2NUPA 4DHEA 1M1KH 1DEAA 4XVQA 4EG8A 1OGYA 3SYKA 1W5TA 4DEVA 4L15A 1TAUA 2GVIA 2XDWA 1W85B 3M7MX 3NW9A 3B2EE 3G59A 2Y3IA 3PHCA 1UZNA 3E89A 1OXUA 4L4SA 3PF9A 1V3VA 5JRDS 4X64B 3ZE2B 1JOYA 4PQEA 1ZL0A 4RF3A 4F84A 4CS2A 4DM3A 3TCKA 2P5UA 2UU9O 1E18A 5H5NA 1JJ2F 4MCHA 1QU2A 1R6XA 4E7PA 3WA6A 1HT3A 2C94A 1Q22A 3K0KA 4UBJA 1U8AA 3FOEC 4ZAXA 5FWNA 4RFSB 4XX0A 5F2NA 1OILA 4JBIA 4ND2A 5EZSA 4J4HA 4R1LA 4EYSA 4HB3A 4QGAA 1UBUS 5EQDA 5HDQA 4E4EA 5LHIA 1R8YA 2GK7A 2B3TA 1QTIA 4TL9A 4RMGA 4KWHA 2HXGA 5EQJB 4G1BA 2WF6A 5ISMA 5IYBO 1TM3E 1NTMH 1I2AA 2P2NA 4NZMA 4L73A 3HYTA 2FG6C 4UXNA 2OZKA 2GRJA 3BQ9A 3O9ZA 1QKJA 1WCWA 2PX2A 2IV2X 3K9CA 3U3JA 5BURA 3NOQA 1GN3A 4NEQA 3FYIB 1ZHOA 3IHKA 2FFQA 1QVWA 2WPDG 1Y33E 4Z4GA 3LVRE 4RTSA 1Q50A 3EUWA 3H65A 1E66A 1JWAB 4BZPA 3AEKB 1Z74A 3HL0A 3OIFA 1OUMA 5LP6F 3X2QC 1DBSA 1AG9A 2A0YA 3DPSA 4KXRA 2E4UA 2K5UA 4X62O 1GCAA 3VR5A 4R83A 1T6XA 4EKDA 4F4FA 1XPOA 3OM8A 2FPWA 2ZSJA 1D4ZA 5CB4A 2VWKA 5CHYA 2ZR7A 1Q19A 4FW8A 4QPDA 4AMUA 2JJ2D 4KBGA 3SXUB 3HZOA 4IFIA 3QMPA 3GQBB 4F06A 3IDZA 3R3SA 3QI7A 4ALLA 2EJRA 2Z1TA 1NJ6A 1W93A 3ZWDA 2P3LA 3OURA 4KACA 5AK5A 4FI3F 3MJ4A 4M0PA 4N23A 4PSUA 3ASYA 3TLGB 4A8TA 2P6JA 4J1SA 1PJ2A 4XEUA 3FTQA 2M32A 4XGQA 4NYKA 2OMEA 4QQNA 3H3JA 5DGXA 4MKFA 1NX6A 4IJ6A 4PQFA 4I1OA 3L7KA 4Z1MD 2JLAA 2ZCVA 4EJSC 3H1GA 1NU6A 1XQ6A 3MJCA 4L5YA 1JIKA 1N77A 3N76A 3QBDA 4FQ7A 4M99A 1KZ7B 2ZRQA 2G7MC 2RGGA 2ZVJA 3BWDD 1PKEA 3MS2A 2AJDA 4B74A 2G9NA 4DCVA 4AKHA 4JSRA 1LS6A 2XAGA 3JYLA 1GH6A 1U4NA 1G21B 3K70D 5JAZA 1WP8A 3GJ8A 3EE6A 1B6QA 3OJ0A 4IVNA 4UFOA 1Y82A 1N9GB 2QEQA 3NVDA 1KARA 3CH4B 4G0WA 4Q3OA 2EGUA 5FF9A 1N2GA 4IHJA 2W6MA 2W0FC 3RVDA 4JDUA 5EUQB 2B98A 4FPXA 2TMGA 2O0JA 4FDUA 2H2FA 2ZCEA 2B9EA 3DZJA 5CFPA 2W2KA 3H99A 4ZQHA 4ON9A 5T4FA 3PHJA 3HP4A 4GC9A 1N36O 3V4ZA 4MJXA 3G6KA 3KJEA 3WI7A 3R7BA 2PWAA 4RABA 3T5TA 5JNTA 5GONF 1UFYA 2JRIA 1KDTA 1V9LA 1CEQA 1L4YA 4DM4A 1L5NA 4NMHA 2V58A 5JNLA 4GYJA 2IX9A 5M2QA 5JAIA 3VPHA 3C3MA 1SQVH 1LQTA 2H48A 3P9KA 4R3UC 4MW5A 2X1HA 1NVWQ 4CKCB 3T38A 4QICA 2VDUE 1P2TA 5AVMA 4HEHA 3CE2A 3H0EA 3INNA 3PJEA 3HGQA 5AKKA 1U8XX 3NWEA 1P60A 4ZVVA 3M1XA 3PFHA 2D8AA 5G0UA 5F7OA 2M1ZA 3QE2A 1QVFF 3R2JA 1MJ5A 3Q8KA 3HG7A 3SC2A 1SHUX 1I0ZA 1R0WA 5CJPA 1FEZA 5FOXA 1RIFA 3PEVA 2VUIB 2FEMA 2OZBA 2YV3A 1JR2A 1MDFA 4J1QA 2Z0MA 4ZCIA 4C82A 3IAEA 1CS4C 4N3BA 2XAQA 1BCSB 4MV6A 1R2QA 3H42B 3QV1A 5H83A 1VQ6F 2ADPA 4KWEA 4BZWA 1QPBA 2F6RA 4HFJA 2FPLA 4YDSA 1CB0A 2GZSA 2QM0A 3KYCB 5HIAA 1E6WA 1GXSB 3K9NA 3MQWA 1QH8A 4UUAA 4ENWA 5TR9A 4AC9A 4NTWA 2V54A 1GRRA 5IT9M 3NT2A 3S27A 4G1UC 4ZQEA 2LO1A 1GKKA 2X0FA 5J2TB 2J7KA 3LF2A 2ZAIA 2XCLA 1JNYA 3B3AA 2YN2A 1K2WA 4IFTA 4YMTA 4ZAZA 4XQCA 4A1OA 5FAXA 1A9QA 1XDGA 2NOAA 3L7DA 4C21A 2JIZA 1M6VB 2W37A 3QKSA 3BL6A 3TZBA 3QVTA 2WD7A 4KR2A 1K73W 3KKMA 2RCYA 3L6RA 2BKLA 1USGA 1ZITA 4CM4B 4HX5A 1H47A 3B9PA 2VYQA 1HP8A 3KLMX 1H0RA 2ZS8A 4RTJA 1ZW6A 2J1LA 5IWAO 4HZUA 3ABMB 3ZYCA 4YBRA 5DYTA 3ETHA 1Q7CA 2YIAA 3GOQA 4DWJA 2CUKA 2O1SA 3V1KA 4K26A 1A9XA 1IZYA 4QNNA 4B5LA 4PSAA 1MIOA 1AS3A 4ZEMA 1HSZA 4PU0A 5AHWA 3MD0A 5JCOC 4RUEA 1EWKA 1QOZA 1VMIA 3JQAD 3PQ5A 3DMPA 2IUYA 4RZUA 3JQFA 4OQPA 4DJFC 3IELA 5LQNA 1JA9A 1H6BA 2G67A 2JGMA 4FMBB 2QOEA 1Z7BA 1T36B 2XKBA 3SLKA 1VQ7F 3LPCA 1GN6A 3Q7EA 1TI7A 4I7EA 4B4VA 4JNKA 2IQ5A 3HEMA 2MJLA 2FPPA 2ZJ2A 1JG1A 3W2IA 3TDMA 1FX1A 2R87A 5FBKA 3PFNA 3KLOA 3PXXA 1CP3A 5J4YA 5E79Z 1HWYA 5GTIZ 2WV9A 2DJIA 2WG0A 1PF7E 1R8QA 1EVEA 3VTAA 2HPHA 3OH8A 4AKTA 1YEWA 4C7XA 3HDQA 4YHHB 4IXMA 3RDPA 1RAHA 5F3WB 1H1DA 1YB5A 1E3WB 3KT6A 4ZICA 4HQNA 3U3XA 2CDAA 3L70H 1YJCA 3HLKA 2IS4A 5K4AA 5FO0A 2VLBA 1W36D 2G5PA 4HFMA 3CUYA 2LKDA 5TMPA 3B09A 2W8BA 3AG4C 3Q7QA 5TGZA 2EZUA 5A4AA 2XY4A 1RWWA 2GEFA 3H6GA 2R6DA 1G0OA 4LC0A 5B4UA 4U5QA 1QPGA 3ICVA 5K2OA 3UKDA 3WGZA 4Y6SA 2D3OW 1BGXT 2QUIA 3ANXA 4WA7A 1BEUB 5BRAA 4X5OA 4IDNA 3DOEA 1Z16A 1CEEA 2ZBQA 4EFMA 3JVUA 4W5JA 1Q6YA 1CUGA 4GIBA 3DZDA 5LYJF 4NICA 5KHLB 2PD4A 1GU7A 4HUJA 3ULKA 2P7IA 3BORA 1RRGA 3IEVA 4ZI7B 4Q34A 1J1IA 1VQ8F 5L7YA 1PGQA 3CKKA 5F2KA 1GA1A 4AG3A 1CTQA 4RWUA 2KG7A 2G5CA 3E8HA 1OBVA 2OCCC 3SHTA 1PNKA 5FTLA 2J9XB 3OE7A 1X59A 2WMOB 2A0FA 5KHKA 1FJXA 3IJ4A 1HKHA 3CCJF 4NHEA 4U7JA 1L4FA 2X0NA 4J16A 4L50A 4K81B 4NARA 3GG9A 3LW7A 5CD9A 4PD4F 5E6RA 2ODBA 4ZODA 4N3GA 2BV3A 1YRLA 2IYTA 4BJ1A 2P7TC 2PRJA 4BW0B 3UXMA 4D6YA 3L8YA 1XMIA 3I4LA 4I1SA 4ZREA 3I8XA 3I92A 4ACAA 4M4SA 2YWGA 3B77A 2NU8B 2KLHA 4M1ZA 1G17A 5P8WA 2GXQA 2Q3JA 3LWQC 3OQIA 3GJ5A 3V7FA 4MW8A 2HJSA 1HM5A 1IV1A 1M2OB 2PZKA 1E1RD 2AFIE 2V1DA 1DQPA 1DCMA 2J9GA 4DR4O 3ANNA 4MXDA 1ECPA 1J7JA 2I8LA 1NBMD 2BFEB 5KYTA 4C29A 3L7QA 1T0BA 1VG8A 3IBYA 5THXA 1N75A 2QLLA 3K35A 1CHDA 2AUMA 3T61A 3L1UA 1QKKA 2R5WA 4ZAFA 3C8HA 4CS3A 1IXZA 4OX9O 1HE1C 3L4BC 3FTCA 3CH6A 4Q20A 2O8CB 5FV7A 2PMDA 2BMJA 2X5KO 4UDOA 3CC7V 1T9HA 1M66A 3A4NA 3DMTC 1QH1A 5G0VA 1W87A 5DLEA 2WHRA 1YJQA 2G07A 3X2FA 3O31A 3QGMA 3RIGA 4B62A 4JUIA 1EVQA 1PTKA 1YU6A 2O2IA 5G2OA 1ABBA 1R9MA 2XTMA 4Q9HA 3OJWA 4P7FA 4YRLA 2EFEB 2J8ZA 3ETJA 3QXCA 3MRXA 4WT7A 1DJMA 4D45A 2GLUA 3KYJB 1AM4D 4BP9A 1MJFA 4R1NA 3B78A 4LI3X 3ZD7A 3BMNA 1P74A 2AXPA 4TSFD 2YFHA 8OHMA 1OASA 1BE6A 2OHFA 1I6LA 4CS4A 4JH0A 2PUEA 5ALVA 1W3EX 3ELDA 1UAYA 5DNCA 4W7SA 3P71T 1FVHA 1ZINA 3A3PA 2XE4A 4FBMA 3HWX1 4WZAE 3DUFB 1Y8AA 3HVHA 1G6KA 3CEMA 5KTMA 3BH6A 3G8BA 2WJZB 1SZCA 2X1VA 3LC0A 2GILA 3EODA 4K2HA 4PTZA 1K6XA 2C5SA 1N9ZA 4PHGA 4YGXB 4DV3O 4QDXA 3OZXA 4B9AA 4FU0A 3WQQA 4DR6B 1JKFA 4BHTA 4D4HA 3MINB 5FUVA 2P2LA 1FTYA 2C58A 4ESEA 2OCKA 4M9SA 1KMNA 3LVBA 3M9LA 1JD1A 5I8ZA 5HM8A 1HEYA 3PXEA 2O7NA 2W0XA 1WPXA 1Q92A 4C7JA 5TPZA 2EEPA 2I3DA 4X95A 4OA8A 4NAVA 3STXA 2V03A 1NMZA 2ZB7A 3HCRA 4RH0A 4MCAA 3I61A 3D0QA 5DM1A 4RMHA 3BK1A 3CPWF 3LDDA 2PSJA 4Q1FA 4HX2A 2I2BA 1NVGA 1P1HA 3QELB 3KIPA 2MSLA 2PL9A 3WLKX 2JBHA 5BN5B 4NG5A 3RUDA 4C76A 2PJZA 4KPFC 3PHBE 3A1UA 2O2HA 1C30A 3A32A 2B4AA 4IMJB 3ABQB 1ZUD1 1TM4E 2PZGA 1TUBA 1Q81H 4L78A 4C1NA 1K8XB 2DBYA 3DTUB 4V0OA 5LMUO 2YQZA 2F00A 2NAFA 1V5IA 3OUTA 1MHTA 4C1BA 2WIFA 2K1SA 2XRYA 7AT1A 1H4QA 4HRYA 2Q4TA 3HO8A 2O6HA 2CK3G 4EZIA 4GWLA 5BVHB 1EVJA 1IVNA 4PG5A 1NOJA 1OH5A 4TKUB 1X1AA 3FDIA 4MQFB 2EBHX 1KMCA 3UGKA 4REQA 2XOEA 1YR9A 3QUWA 3N05A 3ZWVA 1UBEA 4WXRA 1RACA 1Q5PA 1QAQA 4UBIA 1QV9A 4Q1VA 2J48A 2W2LD 4UFPA 1DBIA 2Q7GA 1T10A 1T5HX 1GFZA 4UE2A 5L3SA 3JARB 4DA0A 2HBQA 1ODKA 4NWOB 3K5MA 2BJWA 4PYMA 1KRXA 5J9PC 2CV1A 1NBME 2E9SA 4KR0A 5FO1A 4I5IA 2KB1A 1QGAA 2GXSA 3AXTA 3IS3A 3LX8A 3EGWA 4MS4A 5H7XA 4G07A 1FVFA 2Z43A 1YTFB 2G82A 3DYIA 5KU7A 5AVQA 3CRRA 4J0FA 4XB1A 3IOEA 3GP3A 1UMCA 5LB2A 2D4AA 3RR2A 4EPWA 4RVFA 2IEZA 3ZR4B 3AFNA 1Z29A 1SESA 5F21A 2ZVDA 4TUYA 3T7KA 1M72A 4I2NA 4EG0A 2QJFA 3VNUA 3IAS6 2ZD9A 4L8FA 3KU4A 2KPOA 3QYFA 1GQFA 1XALA 2FZEA 4XXHA 1US8B 2AXQA 1ENVA 2BHSA 1U3TA 1L1RA 1QB7A 2OHWA 3T3DA 3BXEA 1M0WA 3A04A 3EDYA 2C7RA 3UWDA 4GBGA 3UVEA 1AB5A 3TOCA 2X5OA 4FK8A 1QUFA 2W90A 4LJLA 4DJDC 1SB8A 1TL7C 4IL5A 3L18A 4S05A 3U56A 4JSTA 2PUBA 1SVNA 3I2KA 1F8FA 1KO4A 4F3TA 1T8UA 1YK0A 4ND7A 1JIUA 4MV0A 3PPVA 1E99A 4QARA 1NJIW 2WWWA 1FVOA 1M1KW 3SNKA 4J91A 2QN6A 3HPLC 5CH3A 2I54A 4RLFA 4MQUA 1F6WA 2SKCA 2YOFA 2QXUA 2CN1A 4IV8A 2I55A 2ZRCA 4UVHA 2ZWMA 1EVLA 3ZRWB 2XZTA 1S8AA 2JAHA 2J0EA 1VGVA 2GPWA 1QZTA 1QLEC 4F21A 5J3JA 1ZP6A 4IIFA 3NYWA 1ZU4A 3A9WA 3DKVA 5ES3A 3GJ0A 3RFFA 2XUJA 2R84A 5H3LA 4JKOA 5JIBA 4YWHA 1R3DA 5J47A 1D4OA 2Y27A 2WPDD 2XQFA 3QVGB 5T8KC 1YI8A 2A1TR 2QG9A 2QLBA 4L5CA 2QRJA 4NYIQ 2N48A 1YVDA 4Q00A 3GZTB 1JX9A 2GH1A 2LRHA 2GD0A 1FAFA 2OCXA 5J9FA 1FW8A 4EY4A 1BXZA 4CEIB 3HACA 3NBQA 3PFBA 4JNCA 2PGAA 1COMA 3BSYA 4O25A 1VPWA 4KQ1A 4ZV4A 3HCBA 4UHBA 2BGMA 3THXA 1I08A 1UKVY 1TTTA 3C3SA 3A6JA 3K6SB 4INAA 1V8ZA 1R9JA 3FWPA 4CMHA 1ZONA 3NV7A 4I5GA 1RP3B 3NKVA 3AV3A 4Q03A 1T8YA 4P30A 5ADWA 3BICA 4UE6A 3UUWA 5BVGB 1PEKE 5DOZA 3PD0A 5F5XA 2PHZA 1FBTA 4DW1A 1EX7A 2JHGA 2AN5A 4ZXPA 3VZPA 1EK6A 2PKCA 3DV9A 4HWSA 2EIKC 4BW5A 2QE7D 5JRJA 4XUCA 4Q3AA 2JH9A 1ZIOA 4UCSA 1WVIA 5KKAA 2IYYA 2X5NA 2PU7A 2NGRA 1KIFA 5A2QN 6ADHA 1FL9A 1PU2A 4JZGA 1YZFA 2ZUVA 2JCXA 1HPLA 1AC5A 2JIQA 1VQ5F 3OZ7A 3CCEF 3GRCA 4G8JA 2PA0A 1ZD8A 4Z9YA 5KX5B 4W9NA 4IY1A 1DT5A 4CR7A 2J9RA 10MHA 1ZH8A 2F9FA 4C5CA 2ZSBA 3KYDA 1GAWA 3RTAA 2GZRA 5DNUA 3AI2A 3KUXA 5ALJA 2FN7A 2GKOA 3KBBA 3M7IA 3I04M 4LXHA 2PRYA 2BR3A 1RPOA 5E1BA 1JA1A 2FHPA 5E9JA 4UOZA 1CIJA 4CMCA 1P7PA 1C4OA 4MOWA 1Z6QA 4KXLA 5LXTF 5C8YF 2A1UA 2O2XA 3A9RA 3RAGA 3PNSA 3RBXA 5TSDA 3A14A 3ETCA 3HWRA 2ITDC 1CUXA 3GA0A 1H5QA 5IN4A 5G41A 3ZWOA 4BB5A 2C4TA 2COKA 1I7FA 4ZK2A 4TTAA 1QAMA 4C6TB 2QUAA 3EJ6A 4WDQA 2QRNA 5A3RA 5KWJA 4KXVA 1HFKA 4AD8A 3PF8A 1O1YA 8ABPA 1NC3A 5JAPA 3P8ZA 3LX5A 2JC3A 1W4BA 5CDGA 1HMPA 4TMWA 4HNTA 4K28A 3USES 4KUEA 2WJGA 4FFMA 5DLQC 3UYKA 4G3XA 1KY3A 4I4TF 1JG3A 3T4ZA 2PKRA 3PPYA 4RTLA 3HB3B 4DT1B 2Y4UA 1K73H 4HDNA 3H97A 2B7LA 3N8GA 4FHGA 1IN8A 3T1CA 4PQYA 4RIIA 2OO5C 1JQEA 4QOIA 1U0HC 3N0TA 4NZYA 4ZRNA 2NNUA 2OV1A 1QHEA 1XCMA 1ZJ5A 3RFXA 3IP6A 3QLTA 3UQYS 1JAZA 1V1MB 5JNWA 4K8OA 2C7PA 4DYHA 2DTXA 1P2UA 3CP1A 4RHXA 1VF7A 4EQZA 3OZTA 3WLJA 3JW8A 2ZJ3A 2RKWA 1CIVA 2VHZA 4C30A 3ZE8A 1X2BA 4O2LA 2X6RA 3HXLA 4GFDA 2A84A 4EFBA 1NTZH 4NDZA 2R9AA 1FUUA 3W4IA 4B48A 4L8VA 4KYVA 5FR2A 3LQQA 2RGDA 4LRTB 4NMXB 4M8IA 4TS4A 3FF1A 2IYRA 1ILWA 3W5IA 1WKBA 3HMKA 4ARVA 3QUSA 1P73A 4HDRA 3BUSA 4JJ7A 2QI2A 2A79B 3ZRSA 1KA9H 1WA8B 3CEPB 1ACMA 2EQ5A 3KLPX 5FBVB 3V00A 4IJUA 1M34B 3OJXA 2J09A 2G1UA 3EVNA 5BNFA 3RYFA 2ID7A 4POOA 1E9DA 2P9GA 3ZZNA 2NSHA 4HZGA 4ZAVA 4RD3A 2ZDIC 4RGBA 4PS0A 5K8CA 4H18A 2WIKA 1A5BB 4EKWA 4YRBA 2Q1XA 2Z8XA 4CMGA 3ZOZA 4M46A 3QVLA 1I4WA 2W2XA 2D5LA 1EK0A 2FSPA 5L3BA 5CMLA 4BVSA 4EARA 3AB8A 3F78A 4R9RA 3OE5A 2GPAA 3WNDA 3BRCA 1UEJA 3SLGA 3WLMA 1CCWA 3WGMA 4KXWA 5L45A 3EBPA 3STVA 1L5VA 3B40A 3W9BA 2LCAA 4K2AA 2GN6A 1UADA 2CYAA 4HL6A 2UZ1A 2DHEA 1RC0A 2P5SA 3VQXA 4R0MA 1P91A 3VV3A 2IDMA 3U7IA 1S72V 4D7SA 4DGQA 1P4SA 1D8TA 4F2GA 1VQKV 5I8WA 3BDAA 2ZXWB 3PI6A 4H17A 2QRVB 5JXIA 1G8MA 3ZUGA 3O3MB 5JXGA 2Y2UA 4Q3DA 1WBBA 3LJKA 4BY9D 1MOZA 5IH7A 2PLNA 3SQWA 3AGKA 4JLWA 5TDHA 2AG0A 1Y3CE 2FV8A 5FOWA 4J7AA 1S6YA 1E4OA 2R9RB 5KO2A 3RS5A 2BTQB 3WIVA 3E9QA 4OUDA 3DP7A 3ZEDA 1XNHA 1HBJA 4Y1RA 3MAGA 2UUCB 1QANA 3O4JA 3P30A 3ISVA 2XQKA 5TGTA 5JS6A 3MJTA 3SZMA 4G23A 3E58A 3JTEA 1X19A 4PFSA 4GZ5A 3DXYA 4FZ5A 5EWJB 3Q9NA 4MW4A 4FNAA 5LWQA 5DRYA 4D9KA 1ZS9A 3O75A 1XTTA 3OT1B 1WTAA 4AUNA 2O0KA 1T5BA 2H7YA 1FFWA 2VDQB 4L8GA 1Z6GA 5DBIA 3VTZA 3G0OA 1NOIA 4RMNA 1XP5A 2XD9A 3DWGA 3FGPA 2GARA 4J7ZA 1MAHA 4CT0A 4TT3A 1JI0A 2PLWA 2VSXA 5FUWA 4NABA 1Y5NA 5JH7A 4HDMB 3MLEA 3NX4A 3TJZA 3F5WC 3LMEA 4ZTZB 4BEVA 1QCYA 3D3WB 3GEEA 2I1LA 3CY6A 1R66A 4NBVA 4MVJI 1N4CA 3BE5A 2V5AA 3VR6D 3SKVA 1S0UA 4H0CA 1DLJA 4KQXA 3IGFA 4L57A 4A2CA 2QJRA