5ITZB

Crystal structure of the sac domain of cpap in a complex with tubulin and darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNAKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Centriolar CPAP/SAS-4 Imparts Slow Processive Microtubule Growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 172
structure length 420
sequence length 430
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5itzB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5itzB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5itzB01
4ZHQA 3HKBB 1SA0B 5IYZA 5LA6A 2XKBA 4EI7A 5FNVB 2RHJA 2Q1XA 3WGKA 5KMGB 4O4JA 4TV8A 3R4VA 3HKDB 3ZBQA 4WBNA 4U3JB 1W5FA 3JAWA 3C8LA 5JVDA 4X1IA 4LNUB 5J2TA 5LXTB 1FSZA 1JFFA 5CA0B 4KWEA 3HKEB 4X1YB 4O2AB 5GONB 5LYJB 3RB8A 4IHJB 5LOVA 5LXTA 3ZBPA 5J2TB 4O4IB 3N2KA 3JATB 5EZYA 5LP6B 4YJ2A 4B45A 5LYJA 4U3JA 2BTQB 5GONA 3VOBA 4FFBA 2Q1YA 3WGJA 4E6EA 4IIJB 5JQGB 5MN4A 1W5BA 5JH7B 4EB6A 4O4JB 4I55B 4LNUA 3UT5A 3RYIA 3RYHB 4WBNB 4X1KA 4YJ3A 4F6RA 3JAKA 4DRXA 5CB4A 2VXYA 5MN6A 4TUYB 3RYIB 4U39A 4O4LA 5EYPB 5J2UA 5KX5B 4M8IA 2R6R1 3VO9A 4EI9A 4IIJA 5LP6C 4DRXB 1FFXA 3CB2A 2RHHA 4TV9A 4ZOLB 3VPAA 3E22B 5CA1A 1RLUA 4O4HB 5IJ9A 4FFBB 2BTOA 1TVKA 2BTQA 4I50A 3N2GA 5CA0A 5M7EA 2VAWA 1TUBA 3RYFB 1Z5VA 3HKCA 5ITZB 4X20B 3N2GB 1TVKB 1FFXB 4I50B 4O2BA 5C8YB 4ZI7B 1JFFB 5JCOC 5KMGA 5IJ0B 4O4LB 5EYPA 3WGMA 3JARB 1W5EA 3JALB 5JCOA 3RYHA 5IJ0A 4EI8A 4EB6B 2VAMA 4TUYA 4O2BB 5C8YA 5FNVA 4I4TB 3RYCB 4HNAB 5EZYB 5LP6A 2XKAA 3N2KB 1W5AA 5EIBC 1SA0A 4ZI7A 4O2AA 4X1YA 1OFUA 4X20A 4O4HA 3ZIDA 4O4IA 5JVDB 3JAWB 4ZOLA 4XCQA 5MN5A 1W581 3HKEA 3HKDA 1W59A 5J2UB 3VOAA 3JASB 3V3TA 4TV9B 4B46A 3M8KA 4I4TA 3RYCA 3JAKB 4X1KB 4YJ3B 4F6RB 5EIBD 5BMVB 1RQ2A 3JARA 1RQ7A 3JASA 4TV8B 5LA6B 2VAPA 5KX5A 4I55A 3UT5B 4DXDA 5JH7A 2RHOA 5BMVA 1Z5WA 5CB4B 4ZHQB 3JALA 4YJ2B 3HKCB 5ITZA 3VO8A 3WGNA 2R751 5IYZB 4IHJA 5LOVB 5JQGA 5IJ9B 3HKBA 2RHLA 3JATA 1TUBB 3E22A 4X1IB 3RYFA 5CA1B 3M89A 2GVIA 3WGLA 4HNAA
chains in the Genus database with same CATH superfamily
4LYHA 4JYBA 1WNTA 4HDNA 4WJZA 1A4XA 1V8FA 1A95A 4ZMSA 1Y4ZA 3FAKA 1G60A 1GQYA 3MAGA 1D8AA 2UU9B 2CK3A 1NU8A 3KSZO 2Y0DA 1DWQA 4KIGA 3TEJA 4YYZA 1HPLA 1DAGA 5KNDD 1T9ZA 2CLSA 1BE1A 5FNVF 3JAMM 2G7ZA 3VQVA 1RZ3A 1U6JA 4XX1A 3D54A 3W4IA 3C1TA 3ASYA 5JRZA 3E5NA 1WEHA 1EK5A 1XQVA 4QSHA 2ATVA 3U49A 2FHSA 2KJQA 2DTXA 4LY3A 4QYIA 5AIAA 1EDBA 1XSEA 3DFFA 5IHXA 5AXAA 3N07A 2JDIG 2G82A 3AUXA 1AVMA 3OD1A 3KQUA 4XX0B 4EG3A 1DBRA 3VZQA 1F2VA 2GFQA 3C8DA 3N0XA 2Q1YA 2FW0A 3FSGD 3HCOA 5JBNA 3LU1A 4JI7O 1SD2A 4ITRC 1N5LA 1Z22A 1YR3A 4F4IA 4NVPA 4MVQA 2C9DA 3VTZA 3GLGE 2EEZA 2NU7B 4Z9XA 2GZ1A 3ROZA 2LGWA 1L4FA 1JG2A 3H2SA 3LWDA 3STVA 5E9QA 4NYIQ 5BPHA 4MUMA 2PXAA 2QQEA 4R9NA 1KI1A 3KSBC 1VIMA 1NYLA 4GMFA 4EHIA 1W4AA 2XGGA 3DDZX 3N75A 4BIUA 4LJSA 1K06A 5C32A 1J7JA 1CXZB 2QD1A 5HWEA 2VYQA 1Z8DA 2V9ZA 3A2MA 3HA5A 2Y3IA 1IJEA 1FNSA 4MGEA 5TGDA 1BDBA 4BU1A 4DB4A 1RA4A 3N2EA 1XTIA 2RC5A 3FNFA 5D00A 1G8PA 2FPIB 3L0PA 2PAAA 4R40B 4IXMA 4R2JA 4JOQA 3OE1A 4IDHA 4NCXA 1R4MA 3COZA 3L72H 2F43G 4IDOA 4PWYA 3NWJA 2ATCA 1M0WA 1J24A 2P4QA 1VDMA 2VRCD 5DBFA 1Q0RA 3CZ5A 3QJYA 3TLCA 2C98A 2H4WA 1BHAA 1KVQA 2FMXA 1NKVA 3TJZA 3LDAA 5I4BA 2JA2A 2R2GA 1W0JG 3K9NA 4X0EA 3VR3A 1LZLA 4I99A 2X9LA 3FR7A 3J81k 3ADOA 4QOIA 1YB4A 5LWQA 1FX0B 5JH7F 3IEMA 2C82A 2IUSA 2R9AA 1TQDA 2M6SA 3RF7A 4XGKA 4Z51A 3Q3CA 1E9CA 4GVPA 2DR0A 3DMPA 2D5BA 3QPUA 1EXVA 4WK6A 1G4AE 1T5EA 2OTJF 4LE2A 1UPCA 1DC4A 3UJ8A 3Q6NA 4PC1A 5FLEX 3RW0A 4AUEA 2QSYA 1OPRA 5CXXA 2BHNA 2VNJA 1RZUA 3KYDA 3NJ4A 4O4IA 2ZLBA 4OOFA 5AW0A 2ZCEA 1U65A 2HZ7A 3KYCB 3MFQA 1K5QA 3I55F 2C97A 2HPAA 3CISA 4UTXA 2WABA 3GGSA 4MWOA 4BFYA 5AVJA 3V00A 3YASA 4ICIA 3MVEA 1GAXA 1U7OA 1XTRA 1KJWA 4JC0A 4QNRA 4L22A 5IBRA 1C0EA 3SQLA 5LIRA 1GO1A 2EQAA 1WDTA 2GAIA 3H86A 5EXSA 3A3PA 2GESA 2IZ6A 1SKVA 1X94A 1YRWA 2EW8A 3EARA 4NMHA 1S2OA 1O6FA 1XU4A 3AUAA 3KPWA 3BMOB 1F1BA 1ZZEA 4RD1A 1CE8A 1WZ2A 1X42A 1O77A 4KYUA 1OLUA 5KYGA 4I8IA 1P2UA 3OIGA 5EHXA 2CVOA 1UFRA 3SNKA 1DAPA 1K9VF 1Z25A 2OBLA 2YFHA 4HDQB 4PSVA 1SUPA 3EXEA 1GO0A 3G2LA 3BSYA 3O93A 3OX1A 1BG6A 2GEDA 3DAHA 5KUTA 3CYOA 4KR3A 3EEFA 4HDAA 4D9IA 3TWOA 4GE3A 1E9AA 1OT5A 2V7QA 2W6ZA 3ZMSA 2OWDA 2EP7A 3UPTA 1G8SA 3AY0A 1A72A 1T5DX 1QIFA 4NCHA 3GJQA 4KE6A 5LVAA 3FBWA 4ZXFA 1AA6A 2WYVA 5FWNA 1U7UA 1GUYA 4RZQA 3FFAA 4H35A 1KK3A 4UE3S 3R7LA 4KV7A 3Q12A 2XRFA 2CC2A 3C14C 3NUQA 1GZDA 4NJMA 2JFUA 3W8EA 1PL4A 1JZSA 4V3BA 3T1QA 4AO8A 5KYUA 3UOGA 3HBFA 4B48A 3RSHA 2IVFA 5KOYA 3AONB 3I04A 1B1AA 4CH6A 3H5AA 3CE6A 1VSUA 3BFPA 4KUEA 2M6KA 3A9CA 4DMGA 5FR1A 3UF0A 4ZHSA 1GNPA 2PH5A 2YWEA 3B85A 3K1ZA 3L01A 3KT6A 5BQPA 3VQTA 3CCQV 2B69A 2YYAA 1AS3A 4TS1A 1M33A 1Y1LA 4CIBA 2ZITA 1PQ4A 4L0DA 4DQKA 1SKYE 5K0GA 1VQLF 5EQTA 3EXFA 2X3FA 4P8RA 1BCRA 4MICA 4OI4A 5MF6A 5EJ7A 3SVTA 3Q7PA 3AVWA 3D81A 2QX4A 4DPLA 2EW1A 2G1AA 1XBLA 1PV2A 3VTAA 5AW4A 3D2BA 2QAGB 5AJYA 3MCTA 1T1IA 1WXFA 1ZHOA 3SN6A 1SZPA 2L19A 3CT6A 3GCGA 1T35A 1RYHA 4PGHA 5D6NA 4MAAA 1RMQA 2H4HA 3PNKA 4XE5A 1WXXA 1VCHA 2FZCA 2CXNA 1RXIA 3E1SA 1RKUA 1U0GA 4FCTA 1EWRA 3BA8A 3AKCA 1J25A 1XTQA 3G5TA 4L0MA 4YFVA 4EEZA 4TMTA 3R9XA 5A0FA 3L0SA 1SVNA 4MUNA 5KOHB 2VRZA 3CHXA 2YW9A 3L18A 4X3PA 2RKBA 4NSNA 4RHYA 3RVMA 4RESA 1DE0A 3T8YA 3UC9A 3HB7A 1S8AA 2ZJ6A 4LF8O 2A5LA 3GR6A 5A2QN 3K4HA 3NC0C 4FYVA 4A8JB 2J0EA 4N5DA 4OVKA 2LDXA 4LXUA 1Z5PA 3STZC 5KWIA 4UBJA 1M56B 4Y1FA 3VSEA 3TNFA 2W0XA 1YFLA 3UICA 1QX3A 4QULA 3CMEV 1XA0A 2DJIA 2QOEA 4I4TB 4KP4A 3NEYA 5FOVA 1BSMA 1XLUA 2VYFA 4NZYA 1DRJA 1JTFA 4B0PA 4QPJC 3O85A 5KHLB 3HN2A 2FGKA 4GX0A 4UXIA 4AJ1A 4YRNA 1TIKA 3LRXA 3CSDA 2ET6A 3W2HA 2C2BA 4I9UA 4G0PA 1I2MA 4ENSA 3G2KA 3FKQA 3JQ8B 1VZ2A 1QMPA 4KUGA 1GTRA 4Z9BA 3FY4A 2H7YA 4RQFA 2GBFA 4WFJA 1A9QA 2EHDA 3I2GA 1WDWB 5B5EZ 1G5PA 4CS2A 1YZUA 2IJJA 2IU4A 1VKZA 3ESBA 3LUAA 1C1DA 1RQ7A 3QKTA 1BS3A 1SZDA 3K72B 4WSOA 1E3WB 3PFIA 3TCXB 3TFQA 3OLQA 2NU9A 4Y98A 3PQDA 1CUDA 4KXNA 4YMSA 2ODEA 4M98A 3D3NA 4MSWC 1ICIA 2X0NA 4W9MC 1HA3A 4MDYA 1MABB 3WBFA 4DWWA 5I7EA 3HCEA 1YFJA 2WIKA 1R4NB 3OMXA 4N0EA 1CLUA 3EDCA 3T06B 1K6XA 4BX9A 2UVQA 5I9MA 3AP1A 3BFJA 4ZOAA 4LCUC 1X1SA 2OHIA 4HMQA 4CMGA 1ADYA 2AUNA 3PTAA 4Y6PA 4FMCB 1DJMA 3IULA 1D1TA 1E3TA 1KEUA 2I6QA 3FZYA 4TYNA 2PYJA 4LNAA 4ZO4A 4EI7A 4QGSA 1TE2A 2DJ5A 4HAZA 4JASB 3NVAA 4N6OA 1DMSA 3K14A 4NENB 4HS4A 3ZY4A 5DLEA 2OCCC 5HW0A 1Z9BA 3OMNB 3RVRA 4DAEA 2PYIA 3FWNA 1ZSPA 4GR9A 4YP0A 3WSTA 2WA3A 2WAAA 3LCRA 4NDAA 1QDEA 3L7YA 1MT3A 5HY1A 2FEKA 1RYYA 3VNQA 1X13A 2P2GA 3DMRA 3PFWO 5AHOA 4KNYA 4X64O 1U4OA 1UBLS 2PZKA 5K0LA 1GYRA 3W0LB 4CNBA 1U8YA 2A35A 2CW5A 4JV5B 3ESJA 2HLPA 1I32A 1IH8A 3D5TA 3O5AA 4LF9O 2HIHA 2NXJA 3FUVA 1HT2E 2HQBA 2LTAA 4AAYA 3RS3A 1TL7C 1G20B 4D96A 1KQFA 3ETQA 4FFBA 1T3ZA 1QIGA 2WINI 4ZAZA 3SZRA 4BC0A 4E3ZA 5I7RA 4MW9A 3UCXA 1FCJA 5J63A 4E12A 2YS6A 3KOZA 4WINA 4JSRA 4XJTA 3D36C 4B08A 3M8AA 3BXOA 4I5DA 4J1TC 4GU5A 3D3KA 1Q0QA 5A05A 2CJPA 1W36B 4BQSA 2WSSA 3D4BA 1TJ4A 5IY5B 1JSRA 5JWHA 2CCKA 1AROP 1P7WA 2JCYA 2ZS9A 3RAEC 1T5HX 1YDHA 3K79A 2Z2ZA 4O4HB 1IX9A 3UUEA 4K6CA 4M36A 5FDFA 2H00A 1JAYA 1T5IA 3UOAB 4C8EA 2QA5A 2Y1FA 3ENNA 3SXUA 5EBWC 1YCHA 4L9AA 621PA 3RG8A 1WVIA 3OY2A 3OMIB 4J7KA 5DASA 4KXXA 3PAFA 4RK0A 1POXA 2QWXA 1XILA 1P0IA 3LC2O 1TEXA 4C4TA 4E2LA 3TNJA 1IULA 2HA7A 3BXXA 4YYEA 3MJ4A 1Y8RA 2QQGA 2H1SA 2YWDA 1NDQA 4JC5A 4QEKA 1AE1A 1X7XA 2FRDA 5IH3A 4DJAA 4O2BB 2DWUA 1U28C 2EC5A 2WSMA 3I5XA 1XEQA 4TKVA 3K32A 4Q20A 3SHQA 4DMCA 2FPIA 2H4JA 2QVCA 4ZI7A 1AP6A 1UDCA 3BE6A 2Y0IA 4OGWA 4NPCA 1CVLA 4OHFA 3DM9B 4P1ZA 3SD7A 3RK1A 2CMDA 2GZAA 5LYJF 3QMPA 4TROA 3JAWB 4E2XA 4NCKA 4C20A 4LPKA 3A9RA 5HJ2A 4CBVA 3LCVB 3M84A 1B43A 1CVRA 1K1EA 2A9PA 3LQYA 4GLLA 5IJZA 5K09A 1PJ4A 5NULA 3DFMA 1L7EA 2B4YA 4JKYA 2JGKA 3C90A 1BQ3A 1VSBA 1WVGA 2X22A 3CX3A 3NXKA 3PICA 1D7OA 4IKEA 1C5KA 2PGDA 4G56A 1GNSA 3SU8A 1M34E 1XHLA 2CEAA 4RJ2A 1JMKC 4RCYA 4C0AC 1Z5WA 4EW3A 5B1YA 1R8YA 2HX1A 5LJIA 4NF2A 3IVMA 3QPCA 5DBOA 3RASA 3AEKA 5FL7D 4F8EA 3KRTA 3PIIA 1Y0BA 3G2MA 3HCWA 2JFOA 1LK7A 5E9AA 2JI9A 1XHFA 1ZO8A 2Y71A 4DKXA 3GU3A 4JDUA 3TUIC 1M6EX 1MAUA 3IA2A 4DR6O 1VLLA 3TZKA 1JTEA 4XA8A 3WO0A 3GJYA 3WJ7A 1WU8A 3LSSA 2JIQA 5FFFA 1JI0A 5K3FB 2QR5A 3H1JH 4NG5A 4FNGA 2QWOB 2HEIA 3N6VA 3ELCA 5K6TA 5ADVA 4U7DA 2FB9A 3WLEA 1E4OA 2JK1A 3R5KA 4U7TB 2L2QA 1J49A 1YJ5A 2PKXA 2PLAA 2VBIA 4UXNA 2ISQA 3ICCA 1DC6A 1G8KA 3KEOA 3PL5A 4WGFA 1JBKA 1OGIA 1JSXA 2EX4A 3LDUA 4YLGA 2P2NA 2IHKA 3ETGA 4V3CA 4ZEWA 2JGDA 3PI7A 4PPNA 3ZNOA 2OCKA 4TLAA 2V65A 2D8AA 4RZHA 1U04A 2B20A 1US8A 3HCCA 4FDLA 3T12A 1G2OA 1WXDA 4FHCA 1QU3A 4P08A 5IDVA 3UJDA 5JTUA 4BZQA 5LYJB 3RB8A 4YI3A 1I9GA 1KB9F 5J2TB 2Z4TA 4A5OA 1XZEA 5FPPA 1Q15A 1UJBA 1X1TA 3AK4A 3LT2A 1IUPA 2O23A 3DZ8A 4L2IA 3TGWA 3GH3A 2CLKB 4PYKA 5IARA 2ITCC 4JV5O 3STLC 1W5BA 1JEAA 2AR9A 2IPNA 2QJTA 2XY4A 3AG6A 5KNDH 2IH2A 2QNRA 3OIYA 5E7JA 1A9XA 1VQVA 1I9CA 1OC4A 2GN4A 4J0GA 3F4KA 4IIBA 2JFFA 1B8UA 2D1RA 1XI1A 1J0XO 5EWJA 3WGYA 3NPAA 1KEEA 2O8BB 4V0KA 3NXSA 2HZBA 3U6KA 4M1TA 1CY4A 3T4PA 2MINA 2CTPA 1KDZA 1E89A 3S2IA 3RUCA 3WRVA 4P83A 2F9MA 2IDKA 4JAAA 3FJ1A 1FRQA 1K6IA 4YUZA 2BSKB 1AO3A 3IFXA 1O8CA 2IITA 4E09A 3GWGA 3OOEA 3STUA 5EBMC 2OOKA 2ZAUA 3C6ZA 3THOA 3CRNA 4I4IA 5UKDA 5A4KA 1G7RA 4JZGA 1U28A 2E4YA 2OBNA 3LT5A 1CR2A 4TKVB 3UXMA 4OXIA 2P67A 5LJLA 3O65A 4CN8A 1OASA 1J0CA 3SIUA 2CVPA 4G36A 2DYSB 3MQWA 4HAVA 1T4CB 3J80M 1XF1A 4J03A 3RV4A 4PXSA 1EUZA 2HS4A 1NQTA 2UDPA 5AJTA 2BMEA 3IVRA 4ETWA 1PT5A 1MAVA 2GS9A 3WMGA 1C7RA 2VUUA 2H5IA 3HDTA 4W1RA 3AOEA 5L3RA 3C0KA 4YCMA 1JWBB 3OZ7A 1SZXA 1VA5A 4UEKA 4OK3A 3S0HA 5JALA 4TTAA 3NT5A 2OYQA 3NASA 1NFFA 1CEZA 3BQMB 5GQSA 4K9MA 5CIYA 3CC4V 3NYQA 2XBUA 3PFHA 2WNIA 1RR6A 3FWYA 5CN0A 4RULA 1YR8A 1J1IA 5E7QA 1ST2A 4WVFA 3T4DA 4RJJA 2IV3A 4B3TB 2O7VA 2PKCA 4PVCA 4H27A 5KWEA 3W7TA 4ZOQI 4L3WA 1RRKA 3MLAA 1EA7A 3C8UA 4YAUA 2WB2A 2R0QC 3BIJA 3T5BA 1QG4A 2ZTVA 1XLTA 1V43A 1HBJA 3J7AU 2J3QA 5G3YA 4YDRA 1WXWA 1I7FA 1X1QA 3PYMA 1MTOA 4JJ8A 5ELXA 4WKGA 1PJ2A 4BGUA 1UMCA 2JEOA 4OQLA 5JS2A 3ZV6A 1NR7A 2GZMA 1EIZA 1T29A 2V9PA 3LHFA 5GMOA 1Q81H 2PSJA 3OKAA 4JI6B 2PRZA 3OKFA 2W98A 2CDNA 3PXCX 3E48A 1G55A 3FOBA 4LIPD 4AZ0B 5AVXA 1V0JA 1ADCA 3BE5A 4NYJQ 1VQ4F 4EJSC 1U9CA 2WJVA 2LO1A 5JCJA 3WQHA 1TUEA 2ZSIA 3IMPA 3OCZA 2XNDD 5I7OA 2XB2A 3QIAA 3SJAC 3DHYA 3NRBA 1Z16A 5DW3A 3F5MA 2YW2A 1BWSA 3DNFA 1YCDA 2G5TA 2R79A 5B2FA 1PF5A 4J1NA 3A10A 3P9PA 1B3RA 3O95A 3CUTA 4DLKA 3G80A 2IF0A 3QBEA 3AG2B 1CIPA 4ZMRA 1W9HA 3CGWA 4LJLA 4RGVA 4XIYA 5FWDA 2C7VA 3RUEA 3SAJA 1CIVA 3ZWBA 4BDTA 4BV3A 1RZVA 2WJ6A 3KIPA 3NHYA 1Q82W 1Z75A 2QWRB 2PTMA 2VI5A 3SPJA 3F6YA 3FI9A 4OLFA 2YVAA 4K7JA 1QLEC 2QTHA 3RIYA 4BPRA 3VNUA 3I5DA 4OBEA 2W2KB 4AY6A 3L46A 1XHEA 3ED5A 5K4GA 4OHYA 4UREA 3D7KA 2WICA 2MK3A 1ZP6A 4BTVA 3HPRA 2BMVA 3IIEA 4IZIA 4I3GA 3ZE2B 1TAGA 2IPAB 8ADHA 4LF4O 2A8YA 3NTRA 2OZLB 5C5CA 4CQLB 5EJGA 2WLIA 5TT0A 1DQNA 2BJWA 4XCVA 3QVUA 1H48A 2NSYA 4ZKDA 1N5IA 3LPCA 4BAUA 2WF9A 1QTNA 4CC5A 1L4MA 3TLAA 4BP3A 1ONPA 1P2FA 1TA9A 1WZIA 3GBVA 1T9GR 2AJLI 3FGOA 1BXKA 3OX3A 4LVCA 2Q67A 4PRYA 3SHFA 3BE8A 2CNBA 1WB4A 3IDQA 4TVKA 3OM1A 3RYIB 3AFNA 3KVYA 4YCCA 2E89A 5KSWB 2OBBA 2H92A 1W52X 2VHCA 4HUJA 4R8MA 3Q3HA 4HDRA 5LMUB 3BMNA 4IXTA 2OV1A 4Q39A 3SYNA 1CEEA 3ET5A 1IIBA 4I4LA 5FF9A 2PGOA 3O84A 3SYLA 4Z53A 1X0XA 2QF7A 4KXUA 5ICEA 3ZW7A 3HCRA 1PFGA 1Z6ZA 4MEAA 3NK7A 4LHEA 2F8SA 5BQ5A 1X8LA 3PDCA 4YRZA 5IDQA 3JQGB 5TR9A 3INGA 1MP0A 4G1CA 3SIPA 4ENVA 2V0CA 3KKLA 4KK4A 4BMVA 1C0KA 3EGOA 4N8DA 3L4BC 3ILYA 3U0ZA 1RWKA 3WLTA 1A2BA 1E9BA 2G8LA 3ABMB 4LGYA 2HYIC 2F1HA 3MTBA 5KTKA 4R8KA 3KSAC 2ZXFA 2DFKB 5LZ8A 3A06A 2PVCA 4UVDA 1LDMA 5LIPA 3PE4A 1VJGA 2WLLB 5IJ0A 1T2UA 5AKEA 4G0WA 2XI4A 2QTFA 1NTKH 1DJNA 4FYJA 1SBZA 1XDBA 4Q4JB 3CVXA 1BE6A 3W5JA 2DU8A 5CYFA 3QVGA 1JGTA 4HXEB 4PZCA 3SFTA 5E9WA 1O57A 2G70A 3C8MA 3ELWA 1DWUA 1G21A 3QVOA 4KDCA 2P27A 4GBED 1GR1A 3RC7A 4F71A 5AW3A 2ZT9B 2JFPA 2IYSA 2PGIA 3DGFC 3E9DA 2VDLB 4M9XA 1KAOA 4C8IA 4UVAA 3C98A 3L84A 3OI7A 3DLAA 1JLHA 4D7TA 2GCGA 2P7IA 2YWFA 2A2ZA 1SAYA 2HDNB 3CQ9A 3IOMA 4V0RA 1R0CA 4O3FA 3BOSA 4OYHA 4HNTA 2BGRA 3GFFA 3ML0A 5BXZA 3CS5A 1XDUA 5DM4A 1VF6A 3SR0A 3G79A 2MSEB 4KDEA 4DLSA 2AFIA 1AD2A 3T0FA 1XFAA 4BHTA 3STTA 3J7TA 3QI7A 3CLSD 4P3NA 4DS3A 5L95A 2QG9A 4JLSA 2KW5A 1WSDA 3TIFA 4R3NA 4OHWA 2X9GA 3ABZA 3V55A 2BFCA 4V0NA 1SBYA 2PXXA 3VOTA 3LO5A 2CDRA 2FPKA 3AOGA 3M89A 4K88A 2YC0A 4ZHVA 3N2YA 4WL0A 3ZDEA 1T15A 4QBHA 4F85A 3R6WA 2NNWB 2WLKA 3SC6A 4IVRA 4YCLA 3C7TA 5E6SA 1ZG3A 4KH0A 2ZZNA 3THXB 1U2TA 1CJUC 2W6JD 3OOJA 3I6YA 3Q9LA 4UU8A 5IYBO 1P6QA 2WMNB 3BCRA 4II7A 4YCAA 3RH0A 3FNBA 4AWXA 5ED0A 3QJGA 5FLXN 3ITNA 1HDIA 4NESA 5ALJA 3HDVA 5KMGB 2J8ZA 2HI0A 4D9GA 3B53X 3KXIA 3O8BA 1Q1NA 1J5EB 1KMMA 3I09A 3UAYA 5HUJA 4QPNA 1W5FA 4M7RA 4XXHA 1MSDA 1AMUA 5CVCA 2AK3A 4MKHA 5DSZA 4DM4A 3QEJA 1ESMA 2SBTA 5BVGB 3MAQA 1PJ8A 2I1WA 3EZ2A 4QGAA 1ST3A 3OE7A 5KOIA 2FOXA 2UZ1A 3AW8A 4I1UA 1OGJA 2XXBA 3ZXSA 4W1SA 1ODCA 1U1CA 2XNCA 5TPWB 4LCKA 2VHWA 4LWZA 4EGFA 5FPQA 1I24A 1RHQA 3RBXA 3LX8A 4HOYA 4LF4B 1W88B 2P7HA 2YIMA 1SCAA 3PPXA 3PYXA 2OGTA 1H9CA 4N7RA 1ZCFA 4Z9AA 4KUHA 1TGYA 3ANYB 3EEQA 4IOKA 1K7FB 2VZLA 2IIVA 3NO4A 5TF0A 4C0XA 3EXHB 5IAJA 3GJTA 5AH0A 1K75A 2PA3A 5CHEA 3TLZA 4AI8A 3ACCA 3UOWA 5LL6P 2QR4A 4WLEA 1FFWA 2FKNA 1UDXA 4M22A 2WOOA 4INOA 5CLGA 1T0IA 4KG7A 2A1UA 1C9YA 4KV9A 5K0FA 1X7GA 5EC2C 2Q2NA 3E70C 2QL5A 3VTIC 1Y8CA 3HHEA 3KV3O 4NK4A 4OMCA 1AKTA 3P9IA 4XM2A 5DZSA 3SJZA 4BVEA 4R8SA 3A31A 5HQ3A 2IS1A 2DOSA 1GV1A 3JRWA 2OMKA 5DM1A 3CG6A 1NUSA 1YQ9A 3TDMA 4FYYA 4S04A 2O8FB 3OTIA 2AIFA 4G37A 1QGUA 1C2TA 2JATA 2OGWA 4L4XA 4MS4A 4QREA 3HJAA 4XGRA 1VE3A 4C0KA 2QS9A 4IXDA 1M2NA 2QD5A 4MGKR 4PPFA 3QFCA 4JXZA 2OXRA 4MUAA 1QP7A 3LSQA 1F2UB 2RFLA 2GXUA 2RGWA 5F12A 2GTAA 4LH7A 3P32A 2PYZA 3D8NA 3LV8A 2AXQA 1NSFA 3N05A 3D2AA 4IDNA 4LYDA 5DGDA 1HYBA 2GHTA 3I8OA 1E7SA 4YTEA 4R4JA 4KSYA 5AIBA 5JJIA 1J22A 2ZULA 3PQFA 4KLRA 3UM7A 1LBQA 2CJFA 2J4DA 1ZIPA 2JZOA 3ANNA 3JQ9C 4RMNA 4JLPA 3AETB 3GARA 4MQ5A 4DV3O 2ZJ0A 5AKKA 2Z6UA 3QPBA 4F60A 3UH1A 4D74A 3CX7A 2CJYA 3GD7A 1NFRA 2CBGA 1YGPA 3LPLA 2BZGA 4HB2A 1PLKA 2JAPA 5CBHA 4BFTA 3T5PA 4PHTA 3GJRA 4WK2B 1NS1A 1G3UA 4KE9A 4EA7A 1X39A 5EIBD 4BFCA 4NV0A 4BMNA 5CXUA 4F1KA 1VCIA 1ZJ4A 3THSA 2O19A 1UZUA 1H2WA 2F3QA 3FYDA 2WPNA 1QH8B 1NQWA 2F7SA 1ZD3A 1XC7A 3A4YA 1YGYA 2W2PA 2Z5UA 3KSMA 1KBQA 1I6KA 1JX6A 2ZNJA 1PUIA 2YMLA 1FXVA 3O8NA 5EJIA 3E9QA 4AZSA 1DCFA 3SYAA 1Z82A 2XIJA 3WGTA 3N8NA 3ZXXA 4RZIA 5DNUA 4K0RA 5D85A 2HR1A 2ZT6A 3DZBA 2ZIGA 1TUBB 2C5FA 3RV3A 1BYUA 5EJ6A 3CCRF 3PNSA 2ICAA 4RVCA 2XB9A 1WJZA 5B36A 1C8KA 1F0NA 1T26A 3JQ7B 4OEHA 4G8CA 4JEUA 3GEGA 2RI1A 5KCMA 4BFXA 1JEQB 1U2QA 3IILA 3JD3A 4MQ6A 3GZTB 3KQWA 3N76A 1SBQA 3JTEA 2ZYWX 5BNFA 3LKZA 2YV5A 4IIFA 1NTMH 4DIMA 2Q4TA 2X4IA 1K3FA 4QO8A 1TU0A 5CAEA 4BWAA 2PF4E 1CQPA 4L3OA 2G8NA 1K7YA 3ETNA 4UPDA 4JL5A 3BA9A 4AQYB 1JNYA 5EE1A 2YQZA 4Z4IA 3W6NA 3SZMA 4HMOA 4EIWA 3SGIA 4G0UA 1YI2V 1ZRSA 3FDFA 2C07A 2WP0A 4Z0HO 5LOVA 1JMYA 2EKDA 2X6AA 1CNMA 2W2TA 2XLBA 4ZEMA 2C7RA 1J70A 2V58A 3ZKWB 3OTWA 4UUPA 2ODWA 5CFNA 5I8PA 1XTTA 2XAGA 1Y9EA 2REXB 3KETA 1FAFA 5TLSA 3V7WA 4FLXA 1J2EA 2ZYHA 5HGXA 3W3AD 1MNQA 3CJRA 4C06A 4EHJA 2HL6A 3OPNA 4RF4A 3UMGA 5DWQA 1ZJJA 1IATA 1YDFA 4U63A 3X2EA 4HVLA 3IFSA 4JASA 3C39A 4NENA 1IY0A 5BURA 4C2UA 3VR4A 4HAYA 4AYTA 1S72F 4LDRA 4S12A 2Q99A 1GJRA 3I34X 1IPFA 1QVGU 3A1CA 4LHSA 2XYHA 3DMDA 3SDLA 3FLAA 3VJRA 5LHHA 4PCAA 4V0SA 1D9XA 3TW8B 4KLNA 3Q1KA 4EUNA 4L72A 1GFIA 1YRLA 4PAOA 1GPUA 1ZD8A 4FFBB 3QU5A 2PFKA 3I1YA 4EY8A 3BJEA 1U7WA 2QP9X 1ZIDA 1RI5A 1T9DA 2IZ0A 1SXJA 3DOOA 1P3JA 4NDZA 2WNHA 4LOJA 4RY2A 3WGVA 2NM0A 2JCBA 3QHPA 1U02A 4CW7A 1YQUA 2ERXA 3S0JA 1AI5A 4PTLA 2YCBA 4A6DA 4YRMA 4FYPA 1RZRD 1N33B 5JHGB 1IOWA 5JISA 1H85A 1JQBA 2PMEA 4CCSA 1NF3A 1CRWG 3HYRA 3PEVA 4E22A 4D82A 4HAIA 4C6SA 3I8XA 3QEAZ 1L8LA 1A8SA 2FDXA 2G67A 2HCFA 1AJEA 1HQKA 2PJDA 5CXQA 4QBKA 4DEXA 1LPMA 4G23A 3WLFA 4CETA 3HDGA 2X0FA 2O07A 3OZRA 5CFLA 5CMUA 5LQRA 3OTOB 5C4MA 1DELA 2AA3A 2FZWA 1IJBA 4G4IA 5E9JA 1SERA 5JS6A 3B1VA 5EIBC 4AG6A 1SCJA 2NP6A 2N9UA 3G1TA 1G7CA 3G7SA 4ZVLA 1TC1A 3EVZA 3ZIDA 4WRRA 3EG9A 4YMLA 3AK1A 4I6JA 1MQ8B 3L4EA 1NBHA 3HA3A 4YJ2F 4OFBA 2ENUA 1FMTA 3RC2A 4QARA 2Q5HA 5CK5A 2JJQA 2D5AA 5CLHA 1B1CA 3WK5A 4JI0B 1TX4B 1GO3F 1JDZA 1HM5A 2HWUA 3BEOA 4GBGA 4FHGA 1GGFA 1SVKA 3UAXA 1T0AA 1K73H 3R9WA 2VBGA 5U4QA 3DMHA 2AOTA 3FYUB 2Y77A 3ADBA 1D3AA 4JLDA 3K9GA 1N6HA 1LSUA 5LUBA 1NONA 2IU6A 2BE9A 3E83A 1XZDA 2GAFA 4KN8A 3ZVMA 3ZIAG 2X86A 1GTL1 2VJPA 3N87A 4REOA 1LSOA 4CDRA 2Z58A 4H1TA 1R64A 2O1SA 2ZRJA 5F76A 3IE0A 4BVKA 4BNZA 3MPOA 2GHYA 4HZUA 1KQOA 5H3HA 4A6EA 2WKQA 3DKPA 1G3IA 2QAGA 3AP3A 2W22A 2I7XA 4JJ7A 3ZW9A 1QRSA 2WSSG 4PN3A 3KC2A 1AN0A 4G5XA 2VJOA 1Y3IA 3IKEA 2H63A 2QSAA 2DN9A 2IIPA 4JB3A 4KFRA 4X8LA 5TPZA 4P7KA 4B5CA 4EBBA 1CYDA 4TUYF 4REQA 3ZV7A 4K6HA 2XCSB 3P20A 3TD6A 5BRAA 1U0EA 3V1MA 3TXAA 1K3EA 1TM7E 2ODQA 1G7TA 4BY9E 1QRAA 3ZCXA 4A2WA 5BRJA 4N5HX 1D2NA 2ZR8A 1Q0TA 2ONJA 4CV2A 1BX0A 3DBIA 5BN4B 3PB3A 1JB1A 1Y5NA 1VQLV 2FZ5A 2V1UA 5B4TA 1PZGA 4JEIA 1MQ9A 4ZVSA 2Y1LA 2P6PA 4Y18A 2XUPA 4ZJZA 1XPOA 1F4MA 1DAFA 3MT0A 4GYYA 2HMWA 4J0DA 4W9NA 3ILXA 1B76A 2AC4A 2HNAA 1E2MA 1XAIA 1KY3A 4M8NE 4LWPA 4MUGA 4J8PA 4RKRA 4D9MA 2AR7A 5CX1B 5C3UA 3DTNA 2FSVA 4AZVA 2FPGA 2LCQA 2AS0A 5JI3E 1F2UA 3QLVA 4GZ5A 2PFGA 5A0TA 3WRYC 1Y6RA 2IXDA 4OXQA 3T5CA 3TG8A 1H4TA 5JAIA 3ESQA 3HU2A 2Y6VA 3PVCA 4MVRA 5FPRA 4DIOA 2RBKA 4XRRA 5JAMA 1QAHA 3ZVLA 3MF4A 5CA0A 3UWOA 4S35A 1F06A 3FNHA 4TMWA 1JKIA 1IXBA 1MT0A 1UMDB 2BGJA 1OUMA 4RSMA 3PQ7A 4F9TA 3X2SA 1JL3A 2WWGA 4UATA 5IULC 3DR3A 2FSFA 4PSDA 5I7FA 1V8PA 3EQ8A 3LUBA 4J41A 3LZ6A 4CMIA 5KMGA 1KXZA 1JR3A 3MLEA 1N78A 1H65A 2DECA 1UZMA 2B92A 3D8SA 3DE4X 3BC1A 2R4QA 3EQ9A 5T3YA 2BI8A 3VR5A 1YHYA 2NUPB 4IGIA 2JK5C 4R51A 1N33O 1G1AA 1M8GA 4ZDIA 5AI9A 1ZUQA 1YXMA 1UEIA 1ZAYA 2F4VB 2I4MA 3E9NA 3TM4A 5BWLA 3KKKA 2E4UA 2CLDX 3ZZUA 3JZFA 4BQNA 1TFUA 1GKLA 1Z17A 1VMIA 2DRIA 4NBKA 1T4MA 3NJ8A 3S5UA 2XIQA 1CJMA 1A3CA 4UV8A 2V7BA 3H7IA 4C0LA 5TMPA 4PX2A 2QAIA 4NHOA 3GAFA 3IUBA 3SGLA 4CFZA 2GNAA 3D7RA 3EXEB 1GTJ1 2C20A 1DC7A 2XWSA 4R2HA 1TGVA 3BJRA 1AB5A 3IERA 4RFSB 1CVIA 1CQIB 4RM3A 1U11A 3T94A 2L82A 3MN1A 2CZWA 4M0UA 5AVSA 3GUVA 3R3ZA 1RWQA 1K34A 4YAKA 1LKZA 2F62A 4C76A 5K5EA 1AK9A 3LTEA 3TRDA 2X3YA 4JFRA 4UNIA 3LC1O 3VAYA 3SZ3A 2Z1EA 1DBVO 3S3TA 4M9QA 3T3EA 5JAPA 1Z4MA 2WTEA 4Q3AA 4DMUB 1RLJA 3BXHA 5EIFA 1B74A 5DHAA 5LBIA 2Q3EA 2IS6A 2QEXV 2HDHA 5D01A 1RJDA 1ISJA 1XZMA 1K5GA 3MG9A 2ID4A 1EZVH 1HRKA 2WUFA 3HO1A 3DKVA 2X0DA 4Z54A 2GJKA 4GXQA 1SXQA 2JAQA 3QO7A 1NY6A 3PR3A 3UWSA 4JYZA 3R5JA 4TLEA 1PQPA 2NU8A 5IU6A 4H6XA 4CMEA 1DO2A 2ZRDA 3BY6A 2FXIA 1PZNA 2HBQA 2MDTA 2X5OA 2HRQA 5C93A 2PXCA 3Q7SA 5JFOA 3W5DA 4OX9Y 2C5LA 3NHJA 1Z4PX 1QCEA 3FMOB 3ANTA 3LNMB 2XD9A 3L6RA 5T67A 4WLUA 1CBUA 1DS6A 1T6YA 4ACBA 2XOEA 1DINA 1BHBA 2VQFB 2AB0A 3L9WA 4CODB 1G59A 5DB4A 4FDTA 1XEWX 4N9QA 4OK6A 4F45A 2Q5LA 1VJCA 1Z62A 2ZYSA 4OUDB 4TRNA 4X8HA 3G2IA 3HAXD 2FSIA 3AB7A 3DO5A 3ADPA 4EB6A 1ZUHA 2AMJA 4FZVA 4J16C 1N0UA 4YEDA 1EZZA 4DLRA 3KFVA 3TD2A 1EIWA 1A5SB 5BN3A 1Y4DE 1LBSA 2G1UA 3H11A 4PSKA 3TQSA 5E1BA 5FO1A 4H7DA 2DAPA 4UU1A 4C22A 4N54A 4GMDA 5IX8A 4UNPA 1MLDA 3O6VA 5ITSA 2V9CA 2ON6A 2Q2VA 4RCVA 4WKPA 2FNAA 1RYZA 2A7XA 4YJGB 3VPAA 1W1IA 3P30A 4R5HA 1QIEA 4I7ZB 5IC4A 1ONOA 2XF2A 3AERB 3CFYA 4RTNA 1GM5A 4R8CA 3KFLA 1FLVA 2P6MA 1P1FA 3AEYA 3EODA 4HWRA 4QNMA 3ZN1A 4JLUA 3RRZA 1H4SA 2PR7A 1R66A 1UZNA 3FKSA 3RYFB 1OPXA 2EFGA 2OFPA 1VHJA 4RDIA 3H83A 2YZKA 3ZUPA 1FFXB 4RAIA 2QX9A 1Q0SA 2QV7A 1ZIYA 4KAFA 4WV3A 1OXVA 3E03A 4YR9A 3OE4A 3MS4A 1T5SA 2BGMA 1XD8A 1N6PA 2G3YA 5LNK6 3SVZA 4AKHA 2VCEA 2QTZA 4MLZA 1EX7A 4MVJE 4DT1B 3CCUV 4PPQA 4ZI2A 5CX4A 1FFAA 4HMPA 2HNBA 2ZVZA 1M8FA 1P29A 2FWAA 3AP2A 1C1HA 1Y4UA 5JSYA 4Q47A 1N0JA 4ZN6A 2IJHA 4OHXA 1PUXA 1VE7A 1P5JA 3PGJA 4C3VA 4WZBB 1YZ3A 5K0CA 4GM4A 3EFOA 3MRSA 4NABA 1E6WA 3CJHB 4A9AA 5KYYB 4Z3KA 4W9NC 4JWTA 1C0IA 3W4KA 4YC7A 4RDCA 3IS3A 5CK4A 1FUUA 2Z8YM 2I1QA 1ZMRA 2CB9A 1CK4A 1H94A 1PO7A 1ZK0A 2FG7C 2QQFA 5FJIA 5FTKA 4LEIA 2EBHX 4MSUA 5JS7A 4J0HA 3U4CA 2VAVA 1P5HA 3HBAA 2G0AA 2C2YA 2J3JA 3ZD6A 1FFDA 4HGOA 4KQHA 2YJ4A 3ZI7A 4F6RB 1CQJA 2WZQA 1JHAA 1KBOA 4G0QA 4HDMB 5BSGA 2VJAA 3SYTA 3L8GA 1OROA 3K0FB 2PUCA 4DXDA 5HCNA 4A0SA 4NUTA 3NDJA 3L7QA 3WWZA 2ORIA 2IYLD 3TTSA 3VR2A 3GLSA 3Q0EA 3JALA 3FM9A 3OOWA 4HATA 4KXVA 2GR9A 1I5OA 4NQRA 4EEXA 3ABLB 5JYBA 3IMCA 1H2YA 1U5BB 2WU3A 4ENTA 4RL4A 4EPRA 2FZEA 3MDSA 3FIJA 4M0MA 1PRYA 2BAGA 1RRPA 4N0DA 3SIXA 2GVIA 3OU2A 2W0MA 1ZRMA 1YZBA 4H17A 1CUCA 4P4LA 4QAQA 4LSWA 4I0XB 4UVCA 2DQYA 3CCCA 3EUWA 3KAJA 2HKIA 4E08A 4CLDA 4MVUA 1GKIA 2I22A 4IWNA 3V1YA 4CV1A 4PV1B 3CLVA 3DBHB 4QRHA 4CCYA 4HFJA 1U0SY 1QCYA 2W2LD 4FX5A 1FJXA 4UVHA 3PV0A 4FZ3A 4IG4A 1RM3A 2VXOA 3HFJA 3SCZA 3U7QA 2H5LA 1ODTC 2F8LA 2MSWA 3BMCA 4J4BA 1QQAA 1UZAA 3WIBA 4MRNA 4E5VA 3G9UA 2JVJA 2ZCVA 4M21A 1CD5A 2WAMA 4KVAA 3ILSA 1Q74A 5H02A 1Z7YA 2WFLA 4LHWA 5KJFA 4QSMA 3VMFA 5ETJA 4FW8A 4OP2A 4B3RO 2WPDD 5JO0A 1IXZA 3K0SA 3EF0A 5CU7A 3NAQA 5LDGA 2C4KA 2OHFA 1ECGA 2PWBA 2X5NA 3A0RA 3OETA 1DJLA 1G6OA 3ZO8A 4LF7O 4EKWA 1EDEA 3A6GA 4IIJB 4IDQA 2WLJA 2VQFO 1U5BA 1ZDMA 2D0IA 3F46A 3NVMB 3PWSA 5FO0A 4CMBA 4ESVA 3L0DA 1WU7A 3BH6A 1EAMA 2ADMA 4IOLA 3GFRA 4DV2B 3ONWA 3A36A 3RLIA 1EFCA 1HYHA 2H1LA 1QHGA 1H2RS 3O03A 2PMWB 3TMAA 1Z88A 1C9EA 2COEA 4FLWA 2H7CA 2GO1A 4U2DA 5PNTA 1CHNA 3ZKAA 1UBGA 2UVDA 1YZQA 4UMVA 2GF2A 4DA0A 2C4VA 4YBZA 1DWOA 4PDRA 2J9YB 3EUAA 1YZVA 3LUJA 4FZ0A 3PDHA 3TZQA 2EZUA 2RGNA 4TYYA 3VI6A 4NVRA 4HS9A 4TZKA 1NW4A 4OPHA 1Y37A 1ZL0A 2VHJA 3HLYA 4DMHA 1H0RA 4MTLA 4DC1A 1XNQB 4H15A 3U09A 1XAHA 4HYQA 1M5IA 1PJTA 1JFFB 5DHUA 5DSXA 3WNVA 3IDSA 2PY5A 1PGNA 4HAMA 2W9XA 1GXSA 2DYSC 2R4TA 4OL0A 4EFKA 2AYZA 2ZYDA 1OBHA 3W6PA 4J90A 3EFFK 1QHHB 2I4IA 1R27A 1O5IA 2LP4Y 3GGCA 4G4JA 2F48A 1USUA 2CKDA 2I29A 3PI6A 3PHIA 4YT4A 1PX0A 3U6BA 3VR2D 4ALJA 5JSZA 4LRQA 3G4SV 5EWRA 2Z9DA 5ICMA 3PGLA 4TRJA 3F90A 4TKZA 3BA6A 2IEZA 4YJFA 5A3RA 4BB5A 4ARUA 1WB5A 1QC5B 1MG1A 2EFJA 2GYWA 2HT6A 4KODA 3WL4A 2XOKA 1UEXC 3B89A 3W3AA 2Y68A 1A8HA 2P3OA 4WECA 2W70A 3TXSA 1X59A 1FP7A 5IWAO 2O3JA 3GA7A 5AKJA 3KD2A 4ZHWA 4V1CA 2B8WA 2ODMA 3D6VA 4JLKA 3K3PA 3TNLA 3ZQ4A 4CEHB 4JAVA 1RIIA 4WFAV 5K05A 1G8AA 1HORA 3GZ4A 3ISTA 3K9LA 2YMMA 1AR4A 3N2LA 1OJHA 4BEJA 4BUJA 5A04A 4NYMR 2OGUA 4ZHYB 2X7JA 1TYCA 3D3IA 3RVZA 3AB3A 2A9HA 3FCSB 3KYJB 3MWLA 3NP7A 4IMJB 2PX4A 1CV2A 2UYOA 3N28A 4MV8A 5KNCA 1LPNA 3TSAA 1KH2A 1NF9A 3RODA 1ZJ5A 3RF6A 1NW3A 1JZQA 1BMFA 3NT2A 5DNAA 1W8DA 2FPMA 3JQBC 3DP9A 3LXXA 2FKXA 2ACWA 2GA8A 2XITA 3LKDA 4G2NA 3VU3A 2EIKC 4EUSA 3AI2A 3LP5A 4BRUA 4WFGA 2ALEA 2Z5FA 3K9WA 3GEEA 2XAUA 1VHQA 3APOA 2O50A 1Q2XA 1VMDA 4FFSA 3G5LA 4ZOEA 3VNVA 2QLFA 3RBAA 2P06A 4HH1A 4LJ4A 3WYAA 1UKEA 5C7LO 3KQTA 3CF4G 2PX2A 2DKNA 2RG7A 4LYYA 1G98A 4RBNA 5DBEX 3UT0A 4YDSA 1ZD2P 3B5EA 4Q4CA 4DA4A 2DOKA 3ET4A 1L7PA 2FP4B 4QEZA 2IHZA 5ELMA 3G5UA 4GM1A 3RUHA 1JI3A 3G8YA 1MQSA 4EABA 3E0XA 1FTGA 2HSGA 2EJUA 1HSZA 2YL2A 5HOQA 3G68A 3ABLC 4BT3A 3IQXA 4GQIA 4PXYA 3T1VA 3VR5D 4MJLA 4LNUB 3K5LA 2UUAO 1EFRA 3AB8A 1CZRA 3E5HA 4G28B 2B0CA 4CTOA 4LZNA 4HNUA 2LFRA 1PFWA 4I5GA 3GMDA 4B3SO 5JPCA 2EGGA 2PT9A 3DXXA 2XV1A 1A1SA 2OK8A 5BV7A 4MVXA 2X9QA 3T99A 4TYWA 2BBSA 3UMYA 3RARA 1RM1C 2IP4A 3GH1A 3W2EA 4E6PA 1E96A 1GPYA 5MN4A 1CZLA 1L4YA 1HOXA 1RAFA 4G5QA 4P3YA 4WNIA 3U0VA 3WFZA 1SXGA 4D3DA 4K46A 5JZMA 1KJ9A 3HCDA 1MCZA 1RSOA 4DV1O 1QHIA 3C41J 3M6LA 3H2GA 5CDFA 3NC1C 2AFIB 4Q7KA 5AVKA 4D4MA 1CR4A 4JI0O 4FZ1A 2G38A 5HXUA 3KYBA 3TRFA 4DBLE 4F86A 5KX5B 1QD9A 2VGNA 4YLYA 5ALNA 1AXEA 1QOZA 3ZDZB 1QPBA 4YP9A 3AHHA 3RPEA 1B4DA 1XCMA 1UK7A 2D2EA 2WWRA 4FYKA 4OY3A 3RFUA 3TPZA 3L0BA 4RHTA 1YDXA 3ORRA 1RLUA 1BS9A 4FKZA 4QWWA 2XUHA 1A32A 1U4NA 2IYAA 4LTMA 1GZVA 1T25A 4WZZA 2HP0A 3UMCA 1ISFA 4C89A 1Z2PX 2MTBA 3PHGA 1C29B 1QVFF 1IB6A 4M0EA 2XMZA 4M46A 3UNXA 2GV9A 2P4VA 3UAVA 1EUQA 4RU1A 5THQA 1XZGA 1RPJA 3PJEA 4FXOA 4LRXA 4X93A 2C8LA 2IUFA 4XB6B 4RDHA 5IC6A 1BGYH 2W8BB 4ARZB 5CLFA 1C0LA 2PLWA 3RUAA 1N3LA 3U10A 2TSYB 4MK4A 2W6ID 3LT1A 3SX4A 4TVSA 2H4ZA 1KDOA 4BT6A 2ZJYA 2IUTA 3N8IA 1DLIA 5DLQC 3UJ7A 3CMMA 1SQFA 5KQRA 1Z0UA 3GGPA 1M5UA 1N92A 5TPZD 4IF6A 4JLVA 2C7PA 2J07A 4Y30A 2Y1OA 1IOVA 4R1LA 1VSVA 1K8YB 3K70B 5JCPA 2O14A 1ZNQO 3FGPA 2ECKA 3WLLA 1U7ZA 3W3ZB 4KKVA 4TN5A 3V6MA 4DL9A 1HKHA 5KAFZ 2Q3CA 3FHJA 3KJGA 4OJKA 4A16A 2UXDO 2YH2A 2Y48A 3RVYA 2FJ0A 3HCNA 4GUAA 1E2GA 4UHJA 1Y8RB 2TYSB 3CKMA 1SG0A 4YACA 3P1JA 2XUOA 3BHPA 2AOUA 2VDJA 4HCJA 2UYHA 2B78A 3WAJA 1C4XA 1D2MA 5AI5A 2PKEA 5LP1A 1JQJC 3DYBA 2OBFA 3B1ZA 2AKYA 1SCUA 1XQ1A 5EOVA 4O3MA 4QPCA 2DUJA 3ILVA 1D0IA 4ZT6A 3RO7A 4YJ2B 4Y9RA 2JLUA 1KKUA 1J8QA 2Y9MB 3C48A 3H9VA 4JP1A 3X44A 1P0MA 4FIZA 4DYHA 4UUJC 1EN5A 1JQAA 2XF8A 3LMEA 1TQ4A 1LUAA 1N2GA 3OAAA 4R69A 1Y74B 3UCFA 1EE2A 1K8AW 1J1UA 5C31A 3ROKA 5L3EA 4X62B 1KZ4A 4FU0A 4L5IA 4PNHA 1SGWA 5EA2A 5EBLC 1QGYA 1JAIA 1ACLA 3WR5A 4FHZA 3WQQA 3ZGNA 3A1EA 4NFHA 3O4FA 4KPFC 1NHGA 2HF9A 3M6UA 4YRLA 2C4UA 3KB6A 1IUOA 3EIQA 3WIDA 1S2IA 3R3YA 4RAOA 5ELLA 1S7CA 1O58A 3RC9A 5ALHA 1KR5A 3N4ZA 4GNRA 3C74A 1ZK2A 3AF4A 1UXKA 1Z73A 2V5VA 4PN7A 4JP8A 1BQZA 1V7ZA 1RC8A 2X9NA 4TRRA 4D02A 1WE2A 1TM2A 3DKRA 1JHOA 1SWWA 3I62A 2GZ3A 4ZPXA 4H3KB 3AI3A 3MXOA 4NFYA 1WV0A 4JTCB 3VPBA 1SPXA 5DMXA 2OYCA 2DQKA 1QDLB 3HSSA 3V80A 1P1CA 3D1LA 4TWJA 1T43A 4YV2A 1ZYUA 1FYEA 1IOZA 1XMJA 2AE1A 2HPVA 3UBTA 3VSAA 3O2NA 1K33A 2ZJOA 3R7DA 3QMMA 1IOLA 1QHXA 5A6SB 1W0KD 5K0NA 1NYTA 4HT3B 1VH8A 1NWHA 3IO5A 1KVRA 3PC4A 5I8WA 4Q05A 1JJBA 3HA2A 1UJ2A 2LPMA 1XCGB 2WG1A 3HZHA 4BZZA 1S72V 2IXGA 4FBGA 4LTDA 1FFXA 2IU3A 1XA4A 5FPKA 5KTRA 4ZAFA 1KRWA 3BPSA 5DN9A 4IYJA 4ABMA 2I3BA 3QF4B 3CEPB 3O1IC 2GJ9A 2QUKA 2ISSD 1JAXA 1VPWA 5JJNB 3HEAA 3ULKA 1C4KA 2O0HA 3LO8A 3X3HA 4CLXA 5GADl 2H1OA 1IZYA 4C7KA 4HRAA 2IRWA 1A9TA 4ETIA 4MTXA 1Y8QA 4CKEA 1P2DA 1G6Q1 4JT8A 1V6SA 3M7MX 3KB2A 3SMQA 1RU3A 3VPFA 4YQFA 1QHEA 4LZWA 5G4KB 5J4KA 3VTKA 2HJHA 3ER6A 4LWOA 1EH5A 3EVGA 1XEAA 4DCJA 2O8NA 2B36A 5EXPA 2RGGA 2Z5GA 1KEWA 3PF9A 3L7OA 4XIFA 2HA4A 2JFQA 1P1JA 2UV8A 1NQ5A 1XL0A 3INYA 4B7CA 5CBKA 2WFMA 3HPQA 5EJ8A 4TLLB 2HHLA 1GPMA 1FNKA 3GVXA 3Q85A 3TN7A 1Z63A 1PJQA 3F5TA 4WW0A 3PFKA 1Y76B 1L8OA 1A5AB 1KJJA 2LGJA 3KHUA 2VWJA 2VLIA 3BL5A 4FNMA 3DWGA 4HKTA 3WB1A 5FUXA 4DUPA 2HJVA 4DY6A 4MYSA 3CVUA 2W11A 2H4YA 3CUSA 4NEHB 3FPLA 4GSKA 5HILA 3WKEA 1IY2A 2ANBA 3Q11A 3TK1A 2O4UX 3MS2A 1WIWA 3FB1A 4QOEA 2XMGA 3H1KH 3JD0A 5JSQA 2B33A 1D6NA 2JHPA 3GLGB 2ONKA 3IUNA 4Y1GA 2VNSA 3MC1A 1JXOA 3RSFA 5BSMA 3I55V 2FFHA 2XUMA 4KIJA 2N75A 4L9RA 4PZ9A 1TLTA 3LH5A 4DZTA 1XLVA 2Y1WA 1BEUB 4YJ3B 1VARA 2KLHA 2J3HA 3PFNA 3G6EV 1D2DA 1Y6JA 3LLVA 3OPYA 4FEAA 1O8BA 4D41A 5C5DA 3QELA 3T95A 5IMSA 1O4VA 2JGMA 2WG0A 4ODIA 2IW5A 4ROSA 3S40A 1KO4A 5AT1A 3DT6A 1R1BA 3VJMA 1XRGA 4MYDA 2JFVA 5TQ2A 2EP8A 4G88A 1AO0A 1G20E 4MUXA 2EDAA 1N6LA 4MWBA 1KKMA 3H1LH 2GN0A 1E7KA 2NN3C 4PW0A 4TVOA 5JEEA 2J87A 4YV0A 4BR6A 1E2KA 1NQOA 1R18A 3GJ4A 5K8CA 1JVNA 3T7KA 4PX3A 1UEJA 3L73H 3DMTA 3WG7C 5CVTA 2RGYA 1AKQA 1KI8A 1OLSB 4Y6GB 1GTMA 4C14A 3C4QA 3VZCA 5JBIA 5H83A 2COKA 2IEBA 4BFVA 2Q6LA 3N27A 1P7ZA 1XTPA 1WCV1 2VDWB 4GPZA 3ZU6A 5KYWA 4QELA 2BHTA 1O6GA 1WXEA 2O06A 5JFGA 4RTOA 3VR5H 4BJ5A 1PFVA 1WD5A 3GLFB 4HWKA 4DRZA 5LZ5A 1QBKC 3R0ZA 5A7HA 1TA8A 4B40A 2MMCA 4BOYA 3BRQA 4O0LA 2ZATA 5DRTA 1TCVA 2P3LA 3BXFA 5FIUA 5JCZA 1HDZA 1K0UA 3AEZA 4BBJA 1X7YA 1CDDA 2D2XA 5KYUB 3PHHA 4YQYA 5L6LB 3H75A 3K5PA 2QTLA 4Y9SA 1FYXA 2BHSA 1CY6A 1LPAB 1NQ3A 1ECCA 4BNNA 1YBMA 1YO6A 2RI0A 4UTVA 4LDJA 4XR4A 2FU5C 2I33A 3QVKA 4MQBA 5P8WA 2PCLA 5F3RA 3E6AA 2ZU6A 1E2FA 1UPAA 4XFKA 4A7PA 2I8CA 4W99A 2VDMB 1IY8A 1P74A 1UJMA 1WP7A 3IPYA 4P34A 2EWMA 5E0KB 2XWJI 3EGEA 2JBAA 5SZKB 2AW9A 3SYQA 1Z83A 2ZUCA 3CCFA 2VPZA 4JJ6A 4IIVA 3IHLA 4ARCA 3KS9A 1ZUD1 1LBEA 5B5SA 1B93A 4UBOA 4QBIA 4ENWA 5FD8A 1HX7A 3L7MA 4J6EA 4H1UA 2HSZA 1TYBE 4CF5A 1BMFG 3I01A 3OCXA 3G23A 3VH1A 3SYPA 2D7CA 3T80A 1HEYA 1SVUA 4UAUA 3AF5A 2JRLA 2Q6IA 2QMZA 4Z8XA 1USKA 4YMHA 1QYVA 2XMPA 4HEA1 1YCFA 2AZ4A 3K9AA 4ZT5A 3CZAA 4YT5A 1QIDA 2QMEA 1MJGM 1CZHA 5CB4F 3NBQA 1SK8A 1PLJA 5L6MB 3QGMA 1B6GA 1A04A 1CUIA 1X7DA 1ZHHA 3I7TA 3MTGA 3OUUA 2QXUA 5ALFA 2GGSA 2C2GA 2JEXA 1C7ZA 4CR7A 1G2QA 1RQNA 3L7JA 4RVGA 1GPH1 1IPEA 3BWMA 1K3TA 1P80A 2F17A 4XCXA 1YJ8A 3DEYX 4ZP1A 5ABPA 5I9LA 3H2ZA 3UQ8A 2O5EA 1FIUA 5A4FS 1K7DA 2CYBA 3S81A 4OM7A 3J81M 2AD5A 2VRWA 5U9CA 2F9FA 5AESA 1JTVA 1FDOA 3DZKA 3U7GA 7REQA 3F9IA 3PGXA 3VHXA 1P9RA 1FNJA 4I1IA 3BEHA 1OX4B 2ZAMA 5CJPA 4WAUA 4JBWA 4OREX 4FMDB 3DTVA 3LOQA 3JYNA 2XEDA 3OTFA 2V3WA 2L17A 2L42A 2P2YA 1IG3A 5DN6A 2YKGA 2JF0A 4JA2A 2Q9LA 1VIAA 1G291 3EXHA 4TYQA 4BT5A 2YTZA 5JSHA 2ZXUA 1Q83A 4BIOA 1SKUA 3KAKA 3Q9SA 1S89A 1ISMA 1FSGA 1NAHA 1Q19A 3DDHA 3FI0A 4L78A 3VO8A 4MVJH 1DEAA 3WDMA 3F1LA 2FE1A 3CH6A 3LUPA 1QTIA 2PWYA 1EVLA 1X9GA 1YA6A 2BONA 4QVIA 3PNMA 3EXAA 4EA6A 2H2FA 4EARA 4IDPA 2B2XA 3AZPA 1Q8RA 1B8PA 1VCMA 2GETA 1F5NA 1SOMA 1X2BA 2FSHA 2WHPA 3AR4A 3OFJA 1XDWA 1XZAA 1YMQA 4RIIA 1IZ8A 4UOEA 5JRDS 1QNFA 1RBMA 1GGHA 5EPOA 3KVOA 1VGRA 3PP8A 5EGSA 2BM0A 3BB1A 2PPVA 3DAOA 3SSMA 3TE6A 3OUSA 1OQAA 1LK0A 2AD1A 2DULA 1L5QA 2R6JA 2Z57A 3JPWA 3QUCA 2NNUA 3DL2A 4EGAA 3PR2B 5G1PA 3FSGA 3IVAA 1TMOA 2VA8A 1Z4NA 3FSJX 5JLJA 4F3RA 1CJKC 2RHMA 4DNPA 3FBAA 5ES4B 1VG8A 1Z6TA 4L4YA 4X92A 5IM5A 3CLRD 3H6HA 5DPMA 2BFFB 4LAFA 1OCRC 3S5JA 4TSFG 2HJFC 1SHTX 2JIZD 2NPOA 2P6UA 4KOEC 5D3MA 1QGED 3OY7A 5EUBA 1TTQB 5IT4A 4N03A 1APBA 1WN7A 1RRFA 4K9SA 1FDSA 1TOAA 3B3FA 1N2OA 4EQZA 5H9WA 1JY8A 4FYWA 4QXPA 3QUTA 3AEXA 2BFDB 1MHPA 3OQVA 4MTCA 2BMJA 1YIOA 4CZZA 3BD9A 4GFDA 2B6NA 2ST1A 3FROA 4PHGA 4ESOA 3O8RA 2PUTA 3GLKA 3H3JA 5CD9A 2LCAA 3R5HA 4QUBA 3QKRB 1YRAA 3IEQA 4OOEA 3FOCA 4HEHA 5DNCA 2J0UA 3B60A 4D0GA 5SY4A 2Q7XA 2WJYA 1ZSVA 1AS0A 2NZWA 3L9DA 2JJ1G 1FMJA 4BNIA 3C24A 4TMZA 3QJ5A 3I8SA 2OD9A 3GRZA 1FYVA 1OLSA 1VL2A 3C7KA 4MITA 4P5EA 4AB1A 2O8CB 4KJZA 5G1NA 4Y9UA 3W1WA 1JN0A 4JS0A 2NVWA 1I5RA 5EXTA 4ZVQA 1PUJA 1JT9A 4HDOB 1NX9A 3IAHA 4OHRA 5FHRA 1G6KA 5AVUA 3NHLA 3R3HA 2WM8A 3T3MB 2YHUA 4YCSA 5ITVA 3SWWA 4C4XA 1MW9X 2MW2B 3BZUA 1U0RA 1TRKA 3JYQA 4IYRA 1Q1ZA 4N3AA 1UCFA 3GYQA 4Q7JB 4DM3A 4WXHA 2FZLA 5BSEA 4YCNA 4E2ZA 4EGQA 4YIPA 1VMAA 1W29A 4E4TA 4JYAO 3I30X 4R05A 3QU2A 4FD3A 3X0DA 4LY9A 4O33A 4RQAA 1PEDA 2D1TA 3C7DB 5D1NA 2EJCA 2GD2A 3PUWA 4JNKA 4C7VA 1B23P 1HUQA 4ZRNA 3PT5A 4F04A 4H77A 3RLFA 3ESDA 1S2MA 1CKEA 3OO1A 1D1SA 1XRMA 2IIBA 3URMA 1ZX1A 3EF1A 4FI3F 4DE5A 2WMOB 2VPPA 4IS3A 2W6PA 2YZMA 3IDAA 3KVVA 4POAA 1XLTC 1N9GA 3ZGVA 2X8BA 1TQ6A 4MKFA 5EKTA 4UCVA 4BE7B 4AY2A 4XCQA 3DXYA 3RNOA 8GPBA 3R0IA 3GZJA 2Q8VA 2QJOA 3IRUA 4GOMD 5TJ9A 3KOOA 3L75H 3UN1A 1PZHA 2J0UB 2WF5A 3E2IA 5FTNA 3ZOZA 1ONNA 1Z07A 4XDJA 3DD1A 1I7LA 3RSOA 3F2IA 5JASA 4PIMA 2QTSA 1NBME 2ZWVA 4AZ3B 5A4AA 4DR5O 4D9HA 1JEQA 1PWHA 1XMSA 2OK7A 4KACA 2H6EA 4ZCMA 4HY3A 1IONA 1NBMA 2P5TB 2XVMA 1ULTA 1UOEA 3A4NA 3G0DA 3HFGA 4TZTA 3U7IA 1NX6A 4C05A 1H5QA 1BU8A 2OB1A 3DNMA 4LC1A 2FR1A 3KTFA 1E98A 1H0KA 2O7SA 4J0JA 4B1FA 1YI8A 1KMCA 4MYTA 1GDDA 2ZVYA 3CVYA 1DG9A 1DT3A 1NXSA 2C2HA 2EZOA 2V59A 4Q01A 5TSDA 2R8BA 3OJCA 2D0DA 5KVQA 4JI2B 4ZEVA 5EKDA 1QIMA 2OHJA 2P9ZA 4ZYYA 3CF6R 3KZ1E 5FFNA 4C9BA 5LA6A 5CCXA 4KR0A 3UG7A 2VTVA 5FNVB 1EVEA 2IL1A 1CJCA 4JT9A 1HMPA 1W94A 4G09A 4G97A 5F7OA 3QH4A 1V1RA 2QTBA 4M7PA 1XPUA 1HQDA 3T1YB 1H2BA 3RSQA 4O5OA 3CLKA 3NDPA 3E7PA 3LZDA 4YX9A 1SM4A 1TFRA 3C5EA 2QYTA 3ZD9A 5HM6A 5LGUA 3A6KA 4YXWG 2E55A 3ZXUB 1QIIA 4R9SA 4IXWA 2O2DA 2G6TA 3CZCA 1RLMA 1Z2EA 4G9GA 1W42A 1L0BA 4IKPA 1B0PA 2HG5C 4B45A 1ECPA 1FYDA 4D2IA 2Q5JA 3HP7A 4Q00A 4CGZA 3QVWA 2Y2UA 3VX4A 4EHKA 4LFBO 1E6EA 3HHPA 1PD0A 4PZLA 1ORRA 2VTKA 2GF9A 1NVAA 2BCCH 1CE8B 1QFZA 1FNDA 2XVZA 3ZDXB 5HSGA 2UXBO 1JUDA 3B38A 1OVGA 1PNLA 1XLWA 4ZBMA 1TEVA 3Q3EA 1XMOO 3BICA 2R6R1 3U80A 4DV6B 1EX6A 1IV2A 3RJ5A 5HFMA 3L7LA 1RPNA 1REQB 1Y66A 2GCNA 1ZJ6A 2OBYA 4M49A 4NYIR 4X6UA 3GBPA 2ZCJA 1M1KH 4MUEA 5THKA 5JAUA 1KSJA 3BFRA 4RTMA 2IY8A 5B58C 1KAQA 4J0QA 3NM4A 1TVKA 1ZWKA 1M34A 2C2KA 4C07A 4RXUA 2DR3A 3I12A 4JEHA 1VPEA 2PR2A 2NQ8A 2G72A 4C3UA 3H2YA 3SIWA 4BKOA 3ABMC 1O95D 2J7PD 2ZCUA 4UU7A 3WP1B 1B04A 1OZHA 4I9NA 4ECAA 1JXMA 5BYAA 2QE7G 4IVPA 2DT4A 3GB9A 3W6UA 1LTHR 1YL6A 5JARA 5AFSA 3WB2A 2GJAA 2EAUA 4JYCA 1ZL8A 1A5BB 1E5VA 3KBOA 1SIBE 3LPAA 3N6RA 3ENZA 4R84A 5AVOA 3DOEA 3VYUB 4AQ7A 3P2EA 1CF4A 2G1JA 1DDIA 3OOHA 6Q21A 4UVEA 4RYDA 4PGGA 1TJ5A 4YGXB 1A27A 1PK9A 3M3HA 1JQ5A 2Y69B 1L5SA 3DV0A 5HRCA 4R7TA 4ZT4A 2A0YA 2UXNA 4ND1A 4MHOA 4NZZA 4AVYA 4A27A 5AM2A 1NJ8A 1VQKV 2ZDQA 2LDBA 3C1AA 3CUVA 4ILKA 4KYVA 3RSSA 4BRWA 2VDVE 3CF4A 3WMFA 1NRXA 4F56A 1Q6IA 2E74B 3DHVA 5EJ5A 2Q0HA 1UPBA 3O1LA 3U0OA 1THGA 4E0BA 2NP7A 3K9FC 2JBAB 2FB5A 2BT4A 3OJWA 3R3XA 2AZ0A 3KYIB 4XEHA 1CP9A 1Q2UA 1SKBA 2RAFA 2A94A 2MINB 3OLYA 1WA5A 4NXMO 2XDAA 2ZBVA 5ICSA 3KZKA 3I04M 2H5EA 4I9FA 2DPXA 4GF5A 3FFQA 1VA4A 1X8JA 2JIBA 1QH9A 2I3DA 4YECA 3ZHYA 4FM2A 1LPOA 4IWXA 2R7KA 4HJXA 1F3LA 1V8DA 1D6MA 5A6SA 1ENOA 4QTUB 1QPGA 3G4SF 3ETDA 5K4AA 4D1YA 5A2QA 2ZWMA 2UZ3A 4MKIA 3LHIA 5JAZA 1JFSA 4XDGA 4MO9A 3BORA 3OZEA 4Q03A 4XLZA 3KSRA 3ERNA 3A4VA 1KIMA 3AM3A 3JZAA 4Q9KA 3K31A 4TZ6A 5CA1B 1R37A 3UMBA 3AG4B 2GPWA 2YY7A 4YGYA 1Z6XA 4HQ6A 4LDQA 4PC6A 4M1WA 3CXHF 1XQYA 1S9HA 3IV6A 4Y2GA 1Z0AA 5J4YA 1C3JA 4MUKA 2IHVA 5B1EA 3R3SA 5B66Z 1NKDA 1L0NH 1F38A 2FSGA 2OLKA 2FUCA 4QWMA 3EVAA 5BSFA 3QYJA 2XQGA 2YVUA 4IJMA 4JI2O 1QGUB 4BVQA 1X86B 2YOFA 4D8VA 2WHXA 2Q27A 4D9NA 2PHZA 1KYTA 4ROTA 4LDAA 4JXJA 4UAVA 5CFQA 1E2NA 4XWTA 1PJBA 5L3GA 3T5DA 5A2GA 2ZDIA 4KWIA 5HZMA 4X65O 2IUEA 3APQA 2TMKA 3EZXA 2HRRA 1NA5A 1B00A 2ECQA 1TM5E 2Z6VA 4GEGA 3OM8A 4QE3A 5E3IA 4ZDWA 4IHAA 2A1UB 4H7IA 4WOCA 2P4HX 2G4CA 2I8AA 3CPHA 4JJGA 4P58A 3NGMA 1OYWA 1NUTA 5DCVA 4QHYA 4R98A 4BNYA 4D9CA 3W5AA 5JV5A 1MSWD 3H2IA 5AQ1A 1I0IA 2BBOA 3REQA 3FB5C 3ORFA 2GBLC 1SC1A 3IODA 1NLZA 3HB0A 1F2DA 1AQIA 1NXXA 3P0JA 1ZOSA 4U39A 1ZJYA 1YEWA 3L1JA 1JDBC 2CUNA 3EGIA 4OAPA 5FWYB 3LBFA 3ZNQA 4DLTA 4E1AA 3ANMA 1ZY2A 3WNQA 3L5KA 1RRMA 1OKKD 2EIMC 1OFGA 3EEBA 1RYFA 3LT0A 1CJBA 2XYPA 2WD8A 1JJOA 3OHMA 1E2PA 3C1OA 3N2GA 1XI2A 3B6NA 4H31A 1S9DA 1YBAA 6GPBA 2QLMA 2AXPA 2AYXA 5IF9A 3L77A 4DV4O 1FVXA 1VHDA 1LV8A 4JVLA 4R8VA 4C5BA 4KPGA 1BO6A 1YZTA 4M0FA 1QUFA 2PRJA 4ZI7B 1FRFS 2RKWA 4ECEA 1MEEA 1EM1A 2OV8A 3AILA 3JARB 3PVSA 4AWBA 4BLQA 4Q4AA 1GN2A 5DGCA 5FL7A 4BNHA 1E2JA 3TYXA 4F97A 4BV2A 2NZUG 3BRWA 4KR9A 1VRCA 4EKIA 4FFRA 2YUAA 3SQDA 3V46A 3VAZA 1I5YA 1D09A 1YOBA 2A9OA 2VOEA 3IBCA 5FJ4C 3AJ8A 4OSEA 3KTAA 5LFAA 5GAJA 4LW8A 5HXZA 1VBFA 4TOIA 4COOA 3LGSA 5AKIA 3C3AA 4INZA 1N9ZA 2FX2A 2PQ2A 2W43A 3UWKA 2XHBA 1TPYA 1C50A 1UBRS 1FSPA 1FXSA 2X0LA 1EVQA 2ZSUA 3GA5A 1X1DA 4MV1A 1YR6A 5DXJA 5BQOA 3X1ZA 3RW9A 1NIJA 1QR6A 1BU5A 1P1KA 4HUTA 3JVUA 1B26A 3GZNA 3HVIA 1W6RA 2LVBA 4AL4A 5DNWA 3TSYA 1IHPA 3OUTA 3VU8A 2WI8A 4Z4CA 2H4FA 3IR7A 1C9DB 3JWIA 2JNBA 4L50A 2XNDG 2YIBA 2AIZP 3Q15C 4GGOA 1S8NA 3LSYA 4OH1A 3KE1A 5H9VA 2JGRA 4RFVA 1N7GA 1SRYA 3UT5B 4QBGB 4DSZA 3EGDB 3GRYA 1AKNA 2VVTA 3GFOA 5F4ZA 3OM9A 3DAGA 1JFVA 1DUSA 3MJTA 2DQZA 2XUDA 3DT8A 5ALXA 4L85A 3UWPA 4HQOA 3Q5GA 3OQNA 2JGJA 4A3SA 3IKTA 2ZBRA 4ND5A 1AOXA 3O3NB 3NHRA 4WBXC 3GHZA 3OE5A 5IJ9B 2JIOA 2YXZA 4EJ2A 4CXMA 1NVVR 2ODTX 1NM5C 1YMVA 2AMTA 2LQTA 5EMKA 3FUCA 2KG4A 1QDUA 4DK0A 1L3CA 1MAHA 1KP2A 1IN7A 1U2DA 1U8UA 4B71A 4IX1A 1OFVA 3K5NA 1V9LA 3CC7F 5EHGA 2YRFA 3QELB 4DW0A 2IJKA 1Z8NA 3OUFA 4J7XA 4O1HA 5IF3A 1V7CA 3LJKA 3OESA 4HEA6 4UXHA 2ZJ5A 3TW4A 4OKIA 2JH9A 5DLYA 2B5WA 4V0QA 1R5OA 2PHNA 1MV8A 3O21A 3TOVA 1RC0A 4DTCA 1YR9A 3HJNA 5H5NA 3A9SA 4EYOA 2VKTA 5BSVA 3E8BA 1NQVA 2FPRA 3SE7A 4OYRA 3PENA 3DBLB 2E5WA 2ZSDA 4CM3A 1Z6YA 1J7HA 4ATNA 3PLRA 1RJFA 2WVHA 2NADA 4XZ3A 1W1WA 1T0BA 1EDOA 1NBWB 1GNQA 1Z0FA 3QKIA 4UMDA 4EZBA 4G86A 3I9V6 3BILA 5LCXA 2WIFA 3A6DA 3CX4A 4O29A 3VCZA 1MIOA 3AG1C 2ECFA 3QWIA 5C8ZA 2OPBA 5HUHA 2OWEA 5JANA 3SJCA 3QX7A 1TB4A 4P6VF 4BO3A 1SBHA 4MINA 3LTNC 4IBOA 1VE6A 4R41A 1SF9A 1WLSA 2UYQA 1GKYA 3H05A 3L6EA 1GLNA 1BDMA 2I3ZA 1DK1A 1LNSA 2SKEA 2Z2JA 3DKIA 1MDFA 3OIWA 4M1OA 1BJTA 4Q3CA 1KFCB 2H06A 3RKSA 2FTKE 3HY6A 1U96A 5DGTA 3W1VA 4H44B 3P9NA 3B1YA 4PONA 3RT9A 2JFNA 4X8OA 3GHHA 4B74A 2BDTA 2W58A 3T7CA 1WZEA 3I3SR 4EW2A 2AJDA 3V1NA 2EJ7A 5FCDA 3QUBA 2NLJC 4I50A 1ZMOA 4MUIA 3W06A 3AR9A 3CCQF 1U3FA 3QF4A 3EH1A 3OW2U 3M1XA 3U4GA 3G17A 3VU1A 2JLZA 2QZ4A 4BT2A 4QRIA 1E1KA 3WGOA 5DIZA 2I7VA 3PNLA 5F2EA 2VJDA 4QYTA 2GMWA 4EDHA 3TECE 1R16A 5FQOA 3ONNA 5F52A 4HQLA 1E3SA 1T1GA 4O2BF 1A9XB 1LU9A 1U1GA 4XARA 4N48A 4EEQA 3ZGOA 1C1XB 1IXMA 4C01A 1J2UA 2YHAA 1JWLA 1GTVA 1UK9A 1DJQA 4M99A 3VSCA 1TJPB 1W2HA 2LWIA 1P75A 2O5RA 2FN9A 1HC7A 3NW9A 3Q3GE 1J6UA 4AJIA 5B7PA 3EOAI 5BWMA 3ZE6A 1THMA 1JIIA 2DCUA 2P2CA 5B55A 1NJIH 1EEHA 1Q22A 4AZ0A 1F9EA 3CMCO 3CCVV 4KQEA 4LRUA 2H2DA 3F6SA 3IO3A 4ON9A 5AOCA 4ABTA 1IRXA 1PX2A 1UJNA 4KFMA 2HNKA 2XYGA 2Z98A 3OJLA 5LBUA 5GOTA 2CVFA 2H0RA 4UARA 3Q8KA 3FTQA 4FQ8A 4LA4A 1Y6ZA 3CLTD 4GO1A 4IV5A 1D8TA 2GA9A 2YV4A 1T0PA 1ADJA 1C7JA 1Z6GA 2GVZC 5ECGC 5LA6B 4PZZA 4BW5A 2O2XA 2OPHA 3PEEA 5IANA 1XDGA 2QVGA 1QQBA 3PDIB 3CVOA 4Y67A 3B1FA 5E1OA 2HBZA 3ENWA 1NBIA 3PUKA 1TU3A 1MJ5A 2QN8A 1PT9A 1HP8A 1N2HA 1Q92A 3Q7TA 4H7KA 4CIXA 2QBYB 1L8DA 2R6CA 4J0EA 3C6MA 5DNYB 3KOYA 3OFND 4X7RA 1W2GA 1E7YA 4FIPC 1ODSA 1YZGA 2X1MA 5AHKA 3KAQA 4YROA 1DO0A 4ONEA 5HKLA 3W77A 2QW0X 3OEHD 3BQ9A 4CFYA 1UC4B 4NTWA 1L3BA 4I0WB 2XH8A 2PQMA 3CKYA 5G1OA 3RT7A 3SXPA 5A5DA 5FV4A 5IKMA 1R5JA 1A7KA 1HR0O 3OX2A 3R5FA 1OCZC 5CGZA 4YJGA 2Q21A 1OZFA 3F97A 4RJIA 2D06A 4EVRA 3VOUA 1DT5A 3OC0A 4HPWA 2QAGC 5DLPA 3BMXA 1I3OA 1KI2A 1W30A 2VOJA 4R3UC 2C9YA 4L95C 4QXRA 1R0ZA 3FB6C 1RKVA 3EY9A 1JD1A 3RBZA 3EMDA 3PIDA 4KE7A 2AEJA 1IZ9A 3LPDA 4RF5A 1HLFA 3ZE0B 3UXHA 5AKZA 4RD3A 4TMKA 2OCHA 1MDBA 8ABPA 4I0XA 2IZZA 4D9EA 5DHFA 1NDHA 2JHCA 3DOJA 1KC1A 4NMMA 3O1HB 3ZBPA 1M75A 4MEBA 4C4AA 3AU9A 2JLWA 2ZM6B 1E2EA 4EHFA 3T3OA 3A3NA 3U31A 1FDIA 2XXAA 3C3KA 3D0RA 1JDSA 3KSDO 3PD0A 4Q9NA 4UE2A 4AMUA 5HIAA 4EL5A 5K9ZA 3C3PA 1YVRA 1KEPA 2Q8PA 3LL7A 3R1IA 3ABKC 4U7GA 1VB3A 4RHUA 3RC8A 2FN7A 1XDDA 2GM5A 3RADC 1IN8A 3LRTA 2O57A 2ZI6A 3P9ZA 4I1SA 4WJKB 3RC3A 4A03A 3WAGA 1L5OA 5CH5A 2QKYA 2H1CA 1IQPA 6ABPA 1Y4SA 2JLQA 4C6TA 3ELYA 2WKSA 1KTVA 3ROEA 3OZDA 2XCTB 3AVTA 3DAPA 3M5PA 4C4PA 4B3DA 1V9PA 3QWAA 1TM4E 4UHEA 2HYDA 4IJQA 1VKNA 1DTSA 4O2AF 2Y4NA 2G36A 2ZTSA 3FCCA 4MPRA 1E7MA 4OBBA 4S24A 1JHPA 4DUYB 3DZCA 4S1NA 4TQAA 2F1MA 2JKVA 2IHTA 2YHSA 5I3CA 2CMFA 1BXZA 3QLUC 1K88A 2QTVB 4NONA 3CJHA 1ZMTA 3ABRB 2H2IA 2J67A 2ATIA 3IP9A 1QCCA 5DNEA 1IUNA 1W48A 2I2CA 2GPYA 2J7KA 1FXKA 5CYOA 5EK0A 2R1UA 2DVMA 1IEWA 1N1EA 4GYCB 2W4IA 3DE5X 3I2FA 5EUCA 3SKXA 3UH0A 4DRYA 3OECA 3F2VA 4YIKA 4HAUA 1NE7A 3HP4A 5KVAA 3PPWA 4BX8A 2WIBA 2JIMA 2WEKA 1E6MA 2FFJA 2PU5A 1P6UA 3NHBA 1CJVC 1LGYA 3E1YA 1B0UA 5D86A 1NRWA 2NTEA 2CN1A 4B3BA 5GZ1A 4FZRA 3F74A 3B2EE 3I4FA 4RY8A 3OFKA 2YFYA 2P40A 3LCCA 4H13B 3B2EA 3HBMA 1S5LZ 4WH0A 5HK8A 4GI5A 2QX8A 5T6BA 721PA 4NAHA 4HYOA 3W7VA 5FB3A 5M5BA 2EJWA 4LJKA 5EXDA 3FSEA 1Y1QA 1WMSA 3VOAA 5LLSA 2KTUA 3H2BA 1YDGA 1GA4A 1BZYA 4EX7A 5L3QB 4LG1A 4M76B 2JLSA 3LP6A 4FFPA 2VAPA 3OMWA 3RKUA 1OREA 1FJGO 2N3ZA 2BKLA 2OCLA 2ONZA 2V97A 2XQIA 1T5LA 1RPTA 3GT4A 3QKWA 4MS1B 3DWFA 2VHVA 2JAHA 4HZIA 4QXAA 4BLRA 4MVJM 3UCEA 2PZAA 2OO5C 4JVSB 4DJTA 4I19A 5LN1A 1DEOA 4IIHA 4NKRA 5T64A 5EWMB 4EFDA 2G9IA 4Q4HA 2MSLA 3KB1A 2Y92A 1EBFA 4TTIA 3UB4A 2H08A 3U4IA 1KAHA 1GZ7A 3C85A 2QY9A 4L5YA 3L1VA 6ADHA 1FNCA 1WHSB 2RB9A 1IU9A 1WNFA 3FHTA 5H70A 3NHKA 3P2OA 2P78A 1YJNF 1KO1A 5BW8A 1VIBA 5AK4A 3WWOA 2ECPA 2HVKC 5L45A 3QBTA 1XRRA 1XXHE 2WNSA 1I94O 1HDOA 3V32A 3E20B 2HCRA 3QG1A 1TK3A 2GEFA 2ZRNA 3V4SA 1PGPA 2ZUEA 2P91A 3OAAG 3D01A 3CC8A 3P8ZA 4FUQA 2Z1MA 4GYKA 5JCXA 1PZXA 1OH6A 4RXMA 3E05A 3RVPA 3TQOA 3MJCA 3WHKA 2K4MA 2Q1SA 5IKOA 5L3DA 2BFCB 4OHCA 4R1SA 1Y3DE 1URFA 1II0A 1A7AA 1EXMA 3C3DA 1AU9A 3I3FA 3E8SA 3E15A 4J4TA 3V2HA 3C9TA 3VYTB 3RAGA 1XKQA 1Z34A 4WN9B 5KQPA 1BEEA 1DIGA 1P60A 2QZZA 3ANLA 3NFRA 4DRXA 1HE4A 3MMZA 4US1R 3HVJA 4YAJA 3RG2A 4DEYA 4QTYA 1GYQA 3D3WB 5JATA 1UKZA 4L16A 4EGCB 4LSGA 3NR7A 3B9BA 4YRIA 2OB2A 4XUGB 4U7NA 4HGZA 1ZUNA 5KNDA 3FAVB 5D6OA 3HJRA 5AVMA 4ZJYA 1SHJA 5KYWB 2CK3D 4G9EA 3IAUA 1HMYA 4FFVA 1J95A 1OLXA 3LVFO 4HSEA 3H01A 1P2TA 1P7CA 1DXOA 2C5HA 3OICA 4HZUB 4JGGA 2GH1A 2IDMA 3AFHA 3CJQA 5BVGA 1E2QA 3N59A 1RRGA 4P35A 4XYMA 1E9RA 1GYPA 3EFHA 1YUMA 4XLLA 2RBEA 3UJ3X 4PR3A 4HTFA 1AZTA 3AEQA 2D5LA 4YMIA 5T4HA 1NC1A 1MRZA 2NUTB 1QFSA 4NE2A 2YJNA 5KVCA 3OMLA 4HB0A 5IZCA 1V35A 1BJRE 1FDTA 3AIKA 3L9XA 4AJ2A 3ASNB 2AN9A 2VL7A 2Y0EA 2I6RA 2HMYB 4KZPA 3VU9B 2P6NA 4Y2QA 3B3QA 5B6IA 2OL4A 1PJCA 4XQ0A 3ZRVA 3ZCCA 1EYZA 3NEAA 4TUYA 2JLBA 2CDAA 2CTQA 2QLJA 3N7TA