5ITZB

Crystal structure of the sac domain of cpap in a complex with tubulin and darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNAKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Centriolar CPAP/SAS-4 Imparts Slow Processive Microtubule Growth.
pubmed doi rcsb
source organism Homo sapiens
total genus 172
structure length 420
sequence length 430
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5itzB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5itzB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5itzB01
3HKDB 5CB4B 4ZOLB 3RYHA 5JQGA 5LOVA 1RQ2A 3N2GB 1JFFB 4IHJA 3M89A 5LP6C 3HKEA 4HNAB 4XCQA 5KX5B 4X1IB 3JAKA 1RQ7A 4M8IA 1W5BA 4F6RB 4O2BB 4TV8A 4O4LB 5IJ9A 2Q1YA 3CB2A 1Z5WA 4U39A 4WBNB 4I50A 5IYZB 3C8LA 3JAWB 3UT5B 4ZI7B 5GONA 4U3JA 4O4IA 5EZYB 4ZHQB 4FFBA 5ITZA 3WGMA 5MN5A 4LNUA 3HKDA 5CB4A 4ZOLA 5J2UA 3N2GA 1JFFA 2GVIA 2VAMA 3VO8A 2XKAA 4HNAA 5JH7A 2RHOA 5KX5A 4X1IA 3VO9A 3N2KA 4EI9A 5CA0B 2Q1XA 5J2TB 4O2BA 2RHLA 2VXYA 4O4LA 2BTQB 5LXTA 3WGNA 5LYJB 4TUYA 4WBNA 4KWEA 5MN4A 4X1KB 5IYZA 1W59A 3WGKA 3JAWA 1TVKA 3UT5A 4ZI7A 4ZHQA 4B46A 4IIJB 5EZYA 1Z5VA 1W581 4EB6A 5C8YB 5LA6B 5JVDB 2BTOA 2RHJA 5EIBD 3E22A 5BMVB 3JARB 5MN6A 3ZBQA 3RYIB 4TV9B 5CA0A 4X1YA 4O4HB 5J2TA 4E6EA 2BTQA 5EIBC 4I55B 5LYJA 3HKCB 1FFXB 5FNVB 4EI7A 5KMGB 5IJ0B 2R6R1 4F6RA 4O2AB 1SA0B 3JALB 1W5FA 4IIJA 3HKBB 3JATB 5LOVB 3RYHB 3RB8A 1OFUA 5C8YA 5LA6A 3RYCB 5BMVA 3WGJA 3JARA 3RYIA 3VOAA 4O4HA 4TV8B 1W5AA 5CA1B 5JCOA 3V3TA 5M7EA 4X20B 3VPAA 4I55A 4DRXB 4I50B 1FFXA 5FNVA 5KMGA 5IJ0A 4O2AA 1SA0A 3JALA 1TUBB 3JASB 4I4TB 4FFBB 4U3JB 4YJ3B 3HKBA 5EYPB 3RYFB 1FSZA 3JATA 2RHHA 4B45A 5LP6B 1RLUA 5J2UB 5JCOC 2VAPA 4X1KA 5JH7B 3RYCA 3N2KB 4O4JB 4YJ2B 3ZBPA 3ZIDA 5JQGB 5CA1A 3VOBA 5LXTB 4X20A 4IHJB 4TUYB 5JVDA 4DRXA 3HKEB 3JAKB 4TV9A 1TVKB 4I4TA 4YJ3A 1TUBA 3JASA 5EYPA 5IJ9B 3RYFA 3M8KA 3WGLA 2VAWA 5LP6A 4DXDA 4EB6B 2XKBA 5ITZB 3HKCA 1W5EA 3R4VA 3E22B 5GONB 2R751 4O4IB 4EI8A 4O4JA 4YJ2A 4X1YB 4LNUB
chains in the Genus database with same CATH superfamily
4BJ6A 3U1TA 1J90A 1MQAA 2YMMA 3FMFA 4OQNA 5J5VA 5L3BA 1FVFA 4FCCA 2OHVA 3UPTA 4C30A 1RRKA 2VHYA 3H5VA 3QXHA 2PRKA 2FJPA 1PYOA 3LHDA 1A2BA 1XZBA 1WNFA 3OEEA 4D81A 5FTMA 2BF7A 4MGZR 2BFEA 3GD7A 2NXNA 2YQ4A 2OSBA 4KQ9A 2RHGB 2IPNA 4ZO9A 3VDQA 4WCFA 2Q4EA 2QTFA 2OENG 4Z1MA 1YXBA 3HB1A 2H4YA 5HY2A 1E1CA 3RFTA 4B2PA 2KSQA 3C6QA 9LDBA 1L3BA 4OKIA 1OCOB 1MHPA 1TYBE 1ESMA 2B1GA 3BB4A 4UXHA 2AC7A 1G3UA 3HWSA 2JL1A 3ECAA 4I8DA 2DHQA 3HWX1 2DVMA 1VG8A 5B1BB 1Z2CA 3PGA1 5TARA 5TQVA 4ETWA 2YI8A 2EARA 2NU9B 3UHJA 3S55A 4L85A 4Q24A 3SIRA 2XNDA 3NJRA 3EGXA 4FN4A 3OE4A 3K6JA 1ORTA 3REOA 4F4CA 1XTBA 2W6NA 3OECA 2Z6VA 1QHTA 3HC7A 3TIIA 1P29A 3V4PB 2IELA 2WKWA 1SD1A 3EPPA 4PG8A 4I8XA 4L74A 2Q3MA 5CVDA 2B5OA 4GI3A 5KNCH 2H2GA 3U3KA 2VPTA 4FLMA 4KE7A 3K6KA 3ERCA 2L6LA 2ADFA 3Q3EA 1CY0A 5IHPA 1P18A 4HL6A 3EIWA 3WIDA 4X20B 3IO5A 5HIIA 4QE7A 4GLOA 3CEIA 2Z8YM 3WYDA 1DK1A 3TM4A 1GPNA 1E9DA 4D8VA 1II8A 4UOZA 4LCEA 3AEIA 3USCS 2P9JA 5A4FS 1QU7A 4HADA 1DXHA 3GRKA 2GBIA 5JNLA 1UMCB 4EEZA 1NVVR 3NXKA 3FG9A 1Y5IA 3KUCA 3VH1A 5LD2B 1W1UA 4GLJA 4I08A 1L7AA 3NGLA 2C31A 4HJRA 4JI7O 4XUGB 1IOVA 3OVMA 1XTZA 2YJ3A 3CZAA 4E07A 3B48A 1IV2A 3EF1A 2AVDA 3LCMA 4BNDA 5AW1A 1JHZA 4FGJA 2BKAA 1ODCA 5HF9A 3L74H 1XKLA 1E2PA 2FZ4A 5B37A 5IAJA 2GPSA 1T5EA 3U3ZA 3L75H 1RXIA 4N03A 5ES3A 3SYAA 3RSSA 3ZWKA 4ZU6X 5EA2A 4F3TA 4K6KA 3W6OA 5JAIA 4JXKA 3EVBA 3OIVA 2VEOA 1GGNA 1AU9A 3LQFA 5KPJA 2CLIB 3DS8A 3WB2A 4HTFA 1QHHA 4IL6Z 1JDUA 2ZWOA 4R2JA 5ER9A 4U7NA 3D6FA 4RKWA 3RA6A 1IMOA 5J4KA 4JIMA 2QRVB 1GGEA 2BBTA 1E7QA 2QL5A 2C9CA 4XYGA 2JIPA 3ABRB 3KBOA 3QY9A 1L5GB 2WKRA 3SEZA 1RPNA 2IVZA 1O5IA 3PDIA 4MK4A 4A26A 1E62A 3DA8A 4JJEA 2JAOA 1W48A 3ZCQA 1M8PA 4HQLA 4PPYA 1GNPA 4IDPA 2C00A 4BW5A 3R0XA 1V8ZA 3K2XA 2DPGA 3RVMA 3KEGA 2J45A 3UKMA 3GCXA 3G1UA 1YF2A 2A4KA 3DV9A 5KNBH 1ROPA 3L0YA 4EY8A 3WBBA 4MQMA 2JHCA 4KMMA 1KMQA 5T6MA 4B4OA 5IDWA 4FVMA 2VYQA 3HXTA 1TUBA 2GJ8A 3C8MA 1MW8X 2ZJ6A 4NJEB 1TC2A 4WX2B 3D3JA 1JG3A 2WM8A 4JQOA 1EXMA 4U7PB 4BKOA 4A2PA 3P9ZA 1R8JA 2PXHA 1L0LH 5A06A 2J9FB 4I1PA 2I66A 3OM0A 3SQXA 3O2JA 3IC9A 2G70A 3QTBA 3T4UA 3PNKA 2CGNA 1AB3A 3B1KA 4RVSA 1HLFA 1XDWA 4P4UA 1EIWA 3WHKA 5C37A 3TTSA 3RI3A 2RJ3A 2JDID 1X59A 4TTTS 1NXXA 1Y3AA 4NMHA 2FPIA 2ZR0A 4ZHYB 2OCPA 5K4GA 3BN3A 4ND3A 4QO7A 2C7BA 3OOWA 4UNRA 3RDPA 3K59A 1LLUA 3R9WA 4RJLA 2FDCA 5EJ4A 1Z7BA 4JLVA 4GPBA 2E5LO 5JOQA 3A9UA 1P81A 4BU1A 4IHQA 4R8KA 3JQ9A 2VQFB 5CCDA 4R1LA 1E4EA 1U9ZA 3R5FA 4YJ2A 2PPVA 1KBHA 2Q9CA 2RKOA 4IO1A 5H68A 1BDIA 4GPIB 1O7JA 3GARA 5C8YF 3O83A 1Y82A 1J0DA 4FGLA 2OFWA 5BSTA 1HRKA 4K9PA 1UEIA 4NDZA 3IH5A 2CMFA 1EXVA 2HK8A 3IGAC 3WZMA 1QIFA 1IATA 1UJNA 2RIRA 3NDBB 1QE0A 3NG1A 1P4GA 4JC8A 1HOXA 4GZRB 3PQ6A 3PD1A 1DCFA 4D25A 1IEQA 4CM5A 3FUVA 4QODA 2NTYC 2W83A 2NYVA 1A0OA 1TTTA 4I9QA 1P0PA 4DABA 3J7AR 4Q02A 3GEIA 1GRVA 2X22A 4NHEA 4ZAZA 3WIBA 2BFPA 4OHRA 2IDJA 2IZ7A 5IY5B 2BJVA 1AGYA 3A2KA 3EUEA 3X1MA 3T06B 3SYMA 2ADPA 1QGUA 1W35A 2ZZMA 3CYOA 3NORA 2V7TA 1FSSA 1RQ2A 2HBZA 1R4NB 3I6BA 3W6UA 5FHRA 3NHKA 1Z5ZA 2C54A 3CF0A 1KD1H 5BUZA 4BUCA 4BJ1A 2Q1XA 2P0EA 3WK8A 1T1JA 2P9QA 2XVYA 5JZ9A 2WNIA 4Z4CA 4IF4A 1Q3KA 1AUPA 1AO0A 4QUBA 3S1AA 1VH8A 1FYXA 2ISCA 4EFDA 2WMDA 3NFYA 5JNSA 2P67A 2JGAA 5CX1A 4IOMA 1VFNA 3CLSC 2FW9A 1FTYA 3K31A 1E5QA 4DHEA 4F2HA 4TKMA 3PFNA 3GUUA 3F5QA 3BWYA 3K6RA 1F14A 2J9RA 1M6VA 1N34O 4NU5A 3SFTA 2IH3C 1M7BA 3W79A 1RZRA 821PA 1GXSB 1RHRA 1N2CE 2G1KA 1N2ZA 4QDJA 5FL7A 1GUDA 1GM9A 4ZV7A 4G36A 1ZUNB 4BLPA 2JHGA 4IDDA 1YZLA 2AJBA 3ZCTA 4M9XA 4W5OA 3OHPA 5LZ9A 2Y9PB 4D0RA 1GO3F 2IA5A 3HCFA 5A9GA 3FNHA 2X6RA 1U0TA 4G4JA 1STOA 4NKGB 1PV4A 3KLMX 1HTBA 3U4IA 2I6UA 3OKFA 3LNMB 3O0TA 2Q8QA 2HS3A 3KJJA 4K6CA 5DE3A 1DOHA 3RAPR 4CN9A 3FIJA 1FC0A 1SBCA 2EJUA 2BTQA 2AN4A 5CLQA 4RM2A 5JDCA 1ZNQO 3I05A 4N7BA 4B48A 2DOSA 3U37A 2P4UA 4RZHA 2XCIA 3AO0B 4M22A 1FQJA 1R73A 5CDGA 1RXUA 1QYCA 5FLYA 2QRHA 3EA5A 4LN1A 4KV9A 1IQUA 2ZAYA 4B7XA 1I9CA 1DIRA 5K6AC 3G79A 3A28A 2CFIA 1EEXB 1O03A 4KUEA 4M76B 1RM4A 1NF3A 3LYAA 1DBWA 2J4CA 1S89A 3UXHA 1LDMA 5KQGA 2VRZA 1Z7WA 2C97A 4RF4A 2GCGA 4EHIA 2IKSA 4DJFC 4CG2A 4XX0B 2NSYA 3UW3A 3AQIA 3MTDA 1NIJA 2WHPA 1UP7A 5I9TA 4GQBA 4V0ME 2ASVA 5LJLA 1UMDA 1XG5A 5LUAA 1H8HD 2O8VA 4EK9A 4WZ6A 3GH1A 2GK7A 6ABPA 5E3IA 3SZRA 1XL1A 4DUZB 1Y76B 4JEHA 4PQEA 3K1JA 4EAAA 4QBKA 1N2OA 2JLWA 2BUBA 4UXNA 4EHLA 2IUYA 1DAHA 3FPAA 4FLXA 4IQ0A 2PGDA 1M1KW 2OP0A 3AYZB 3NTRA 2NZJA 2IBTA 1ZUQA 2VZ8A 1YNSA 2YHIA 3UJ9A 2WDZA 2BKEA 4J3FA 1OX4B 1T25A 1AXGA 1JKFA 5L3QA 5BPFA 3GJ7A 3L6EA 3GVPA 4JB0A 4ND8B 5JISA 4OGFA 1QIDA 2H2DA 3B13B 1JJIA 2OA0A 1AZWA 2XB2A 4KVGA 3TBHA 1KK2A 2Z9BA 1Q2XA 2O3JA 3DBRA 5ESDA 3MB5A 4Q12A 3AP1A 5TR9A 3AWIA 1AUOA 3PZBA 3JZFA 4KK3A 1E1QG 1H2GA 4LF6O 3N2KA 1ZOPA 1PGOA 5JSHA 3RD5A 2LTAA 2ZJ3A 3CPWU 1VKRA 3W8DA 2IY9A 1XTVA 1TO6A 5DM1A 6LDHA 5FCDA 3AZOA 4BVJA 1M3SA 2UKDA 3EOAI 4UE2A 2A0KA 1LQTA 3RYIA 1R4ZA 1KARA 4G0VA 1SA0A 4YJ3B 1JAYA 1YFJA 1WPBA 1AUQA 2O59A 2HKIA 3MHHC 4F38A 3SM3A 5AK4A 4IGIA 1H42A 5E2BA 1EK6A 3IAFA 4LRSB 1HC7A 4PG7A 1A95A 1PGPA 4B4KA 3KV3O 4ZGGA 1QQAA 3JZIA 4BAZA 3QU2A 3TFQA 3WMEA 3A4TA 4Q9KA 1F17A 4K35A 1QR2A 1Y6QA 3KJNA 3PFIA 4J4BA 3LPDA 1L2TA 4KYUA 1E98A 2PKEA 1RLIA 1WVMA 3F8SA 3UT0A 3UNXA 3CRMA 4ZJYA 1B7GO 3SQDA 1S2OA 2R7KA 1ZL8A 4EITA 3H9JA 1GDTA 4J49A 2XE4A 3OQJA 2D4HA 2YINC 2ID9A 1XMOO 1KOJA 5LJIA 1N3YA 1J1IA 3PJFA 4RHCA 2HSJA 3T41A 4W8HA 1B23P 4ARBA 1RYFA 4YY3B 3SWWA 3HFRA 3TXSA 5I7EA 3C3YA 2NO5A 4AMZA 3OD1A 4A10A 5LZ4A 4HDNB 4D45A 2LE0A 5K3FB 5DU2A 3LX4A 3P2MA 3HZRA 3GWKC 4KHPB 1JJ7A 4CEJA 3TPCA 4RHYA 5BWNA 3B5EA 4O2BF 5JZMA 2WB2A 3RT3C 1CJKC 4MRPA 1IOZA 1ADYA 2FQYA 4M0UA 5IDYA 2WUEA 3FNEA 3VYUC 4OM7A 3ICOA 4G8BA 4FI3C 4B81A 3R7DA 1WEHA 4JQYA 2I78A 3JCMM 2JFHA 5KHKA 4UQOA 4KAJA 1NQWA 5FLKA 3RVOA 1DIGA 4TTJA 3VPHA 1GR1A 1M2NA 1G4HA 1II9A 5DF1A 3V4FA 3E6AA 2ZYHA 3E27A 1LJUA 4MCIA 3UB3A 5DPMA 5A3RA 2XGJA 4BGEA 2MSNA 3OURA 1B04A 1QNFA 2LCAA 2AFIB 1Z37A 3F71A 2QR4A 4FB4A 4BIUA 1RM5A 4ZRDA 3EZ9A 3O93A 4M8KA 1K5DA 5EJ5A 3ZV4A 1H2MA 2QS9A 1JPNA 5DWQA 4CIDA 1G4YB 3GT3A 4DG8A 1JPVA 4CGZA 4Y6RA 4X9QA 4YROA 2VSQA 1QCDA 3V7FA 4BCCA 5IJZA 2ZPUA 5LM3A 4RAQA 1QFJA 1EESA 4N47A 2DUUA 1ZRNA 5SV2A 1MUUA 1VBNA 1LPSA 3ZTYA 4C0XA 1PNTA 1SXJA 3KS9A 4H7JA 4CCSA 5KVAA 1ZW1A 4P2BA 1IC6A 4IJ6A 4GCZA 5FFFA 4U02A 3I1IA 3DKVA 1DG1G 4NJOA 4ESHA 4LYGA 1AK2A 3UANA 2QTWB 3REQA 3ZWBA 2PUAA 4FYYA 3LOPA 4L5YA 1PFUA 4LHXA 4DTIA 4TL9A 1E63A 3RC3A 5AVWA 4FINA 4Q4LA 3EUWA 2ZCEA 4L28A 3O2NA 5BV2P 1U5CA 2VS0A 1C80A 5EMLA 3C43A 2AFHE 3R5HA 2VT7A 2Z30A 1P31A 1Y8AA 4LRTB 2QOEA 4EAQA 3L0ZA 4ZREA 4ZAVA 3CONA 1OI2A 2DWOA 4AW9A 3K04A 4BC0A 2BEUA 5MHTA 4OBXA 4GLFA 2CVHA 4TQ9A 3TJMA 4NBUA 3ZRVA 1NE7A 3B7GA 2RC6A 4DSTA 2Q6AA 4FLTA 3CQ9A 3WWPA 2VHWA 3ABSB 2WYUA 3GXOA 4A2WA 5DYGA 1XQ8A 3VJMA 1Q83A 1Z6ZA 5MDHA 1O4WA 3RIYA 3ZVMA 3T7TA 1I94B 1JHXA 2QQFA 3Q8HA 3A3PA 4Q7MB 1PD3A 2ZNJA 2VGNA 2ZBDA 4JOCA 1HBJA 2OV1A 3VH4A 3UJAA 4CLRB 4MRRA 3SPJA 1KYVA 3NIGB 5I3CA 5JJCA 3GAAA 3QX8A 1MEOA 2JHAA 3LE8A 1DTOA 3IHKA 4GQIA 2VJKA 3QBDA 4OQZA 1Z6TA 4HAIA 1JEYB 2D13A 3KLNA 1K75A 1UH5A 1R8QA 4E5YA 3AF1A 3T9BA 4LYEA 2P77A 3WMXA 3ZNNA 1NVMB 3QBJA 3PHBE 1D2DA 4HWSA 4HMOA 3L7OA 4KXYA 4PIVA 4PPQA 2OGTA 4A0QA 2SICE 1OLXA 2HSWA 2PLAA 5H5JA 2G9NA 3SG0A 4IIDA 5BNWA 3PFKA 2HW8A 3PHJA 4R84A 2OTJV 3AUUA 1BMFA 1JNXX 5LP1A 3GGOA 2QN2A 4V1CA 5J1TB 1KIMA 2P40A 1WLYA 3DFFA 4JJGA 2WZBA 1MOPA 1R3LC 3VZCA 4QECA 2CDCA 5K45A 1A7AA 5HKLA 3O1LA 4IICA 1QCYA 4DDMA 1W29A 1VKOA 4NESA 3HJRA 4DIEA 4LCBA 1X1DA 5JAZA 4MR9A 1WZNA 2K5UA 1DCMA 3BA6A 2HCRA 1SHJA 2QY9A 2NYRA 3LQ1A 3T38A 2JLZA 1H4VB 3PFCA 2WE8A 2REQB 3JARA 4MWDA 1XVIA 2Y99A 1XZHA 3OQOA 1YB7A 3BWMA 2ZS8A 1Q6HA 4G25A 4LF5B 3F3MA 2MYPA 1I0HA 1MDFA 3ROTA 3H5WA 1QIGA 4LFAO 4UHCA 4RYLA 2FXVA 1N8RH 2KM1A 4LY0A 4CG1A 3OLQA 1BFDA 1RZ3A 1H2ZA 1NMSA 1Q77A 3ESDA 1X9IA 4Q1VA 2F3SA 2ETVA 3OPMA 3G5AA 4JA0A 3UOWA 3ZWNA 2XYQA 3LC2O 1OZAA 4R3WA 1VQMF 2XHEA 1LQUA 4AZWA 1FUEA 1EFAA 1JQEA 4C0WA 1ZHHA 3LUCA 3UA3A 2WT9A 3EAFA 1C3LA 4KBGA 4YDQA 1HM5A 3CNNA 1A97A 2J0EA 3ICEA 1BVUA 1PGJA 2Z1TA 3K4HA 5J58A 5ULLA 3QMWA 3MHPA 3ACDA 1XEQA 3KZNA 4FIZA 4BO1A 1E1KA 4HYYA 4ICIA 5BSFA 3O3MB 3EY4A 1W9MA 2PU7A 4NHOA 2I71A 3GX1A 5AOAA 4GMDA 4QGHA 2BFFA 1BXKA 5ITWA 4RVGA 2ACVA 3RFXA 4CM7A 1VQMV 4NS4A 1RJGA 2VOEA 3AP3A 1H2WA 1BT8A 1RPZA 1AQJA 2IBSA 4R40A 1U0NA 2P9TA 4C4AA 1LDYA 2NWQA 2IU6A 5JTTA 1TZMA 2JGKA 4LRQA 4B40A 5ERYA 1XRLA 1OHHD 3I52A 4MUKA 5AW7A 5BYJA 2J3EA 4GE3A 2I76A 2VPYA 5AVRA 4CC5A 2JGNA 1EM1A 4OGKA 4BN4A 3RTAA 2X3UA 4ECEA 2YDYA 1HEUA 2UAGA 1T2DA 1A7KA 2GBCA 4FYPA 2ZXFA 1RI3A 2AJLI 2P41A 4XTRA 1S5JA 3C90A 4J91A 2WAYA 1UZMA 5DNAA 4IYJA 5AXBA 1NULA 5D1NA 1M2FA 2FN3A 3LVQE 1W73A 3Q8WA 5EP2A 4B5CA 4Q9DA 3SPCA 1J70A 5CBHA 4FNMA 4KFMA 2PYJA 1S8OA 1Y4SA 2WWHA 1J7JA 3LHKA 4GP6A 3EZFA 2VP2A 1DWPA 3E1SA 1FP2A 3O8QA 3LLUA 1DAEA 1QB8A 3MJSA 3QKUA 2I91A 3G85A 1JHRA 2X9NA 1DG3A 4D6PA 3UWSA 3FTQA 3WB0A 4JI1O 3DZHA 3W2EA 3HEBA 3K08A 4ER6A 3UJBA 2AR7A 2NT4A 2QV7A 3SZOA 2Z1DA 3SNKA 4BFVA 4OQQA 5CBGA 3L9WA 4TM8A 5HGXA 4DG5A 4AKEA 4IF6A 1E2QA 4CQJA 4JLUA 1CQJB 1B0AA 2YZNA 2ZYWX 4HZUA 5EVJA 1Q6UA 1Q7EA 1N25A 4G5FA 4W9NA 2VSFA 1W0KG 4GM0A 3RQSA 3NHSA 4WAUA 4RWEA 2LP4Y 3T8YA 3JZMA 5HIJA 2NO9A 3PV0A 1EDDA 5D5PA 4TSFG 1Y6ZA 3PA6A 2LCQA 3R6LA 1OUMA 2ZTHA 4IMRA 3OPYA 3PG5A 1NMEA 2XBMA 3KR9A 4KWTA 1N4AA 3PQCA 4FCWA 3HY6A 1QQCA 3RSCA 4EG0A 3WYCA 4X88A 2NMUA 3EGOA 4J42A 4GLXA 3HB0A 4Q3KA 4IXNA 5G4LA 2C57A 1SEVA 3N2NA 4BPBA 4PSCA 1Z5UA 3TBKA 3UMGA 1ATIA 1NUHA 5JROA 2XR1A 4YACA 1VQ9V 5K3BA 2PMBA 4MVQA 3JQ8B 4FHCA 3JVIA 2FMKA 3KKKA 4YS6A 4P3KA 5G02A 3QEMA 1ZGZA 3L6OO 1VQ8F 4Q9LA 1QRTA 1LLDA 4F2PA 1NIPA 2H52A 1B0PA 1L9XA 5LNK1 2YSUB 5DXJA 1E6UA 2R25B 4O08A 5LKRA 1XTUA 1Z75A 4KUHA 3T52A 2AV6A 5IM4A 3TZCA 1VHWA 1WXDA 3CSXA 4D7AA 3LPMA 4D02A 4E3ZA 1WB5A 1P60A 5K20A 4UUPA 1NR7A 3KOUA 1QGZA 1MNQA 5K3OA 3RIGA 2Y1FA 3N3BC 1JU9A 1UFQA 3UCEA 2O06A 3UC5A 1E7RA 2F9ZC 3IURA 1E9AA 4BT6A 2FX3A 1IN5A 4DV1O 5KQMA 2QPTA 5JFTA 1CVIA 3ZN0A 1SU6A 3L46A 3KJZA 2NUAB 1E8DA 1PZFA 1JFLA 1SUSA 2SNIE 3M5WA 4IIFA 1IXYA 3VR6H 4IP0A 1RSOB 2XCLA 3H11B 1W9HA 5DKFA 3X2SA 3R3ZA 1Q15A 4DLUA 3K16A 3KSUA 2DWEC 3T4DA 2ZI4A 4F4DA 2K1EA 4CDNA 3P0JA 2YXYA 8GPBA 2PX3A 3C4VA 1ZK3A 3V55A 1RKBA 4AY4A 1XZGA 1R6VA 1XROA 5ES4B 3V8PA 3I9OA 4P3OA 3PN1A 2OM6A 1NHWA 3OEED 1HNZB 2OEPA 4CR7A 2LDBA 2WA3A 1KTVA 3S3XA 3H1BA 1WMAA 4HDMB 2Y1XA 1XEFA 4YMUA 4Q9HA 4Z1MD 2ZJOA 2GAFA 3LP6A 2IHTA 3LI2A 2P6MA 5EKDA 3P96A 5HY1A 1DVRA 2X23A 2IYRA 3A9CA 2CV1A 3IBSA 1T0AA 1Q14A 1UEXC 5F7JA 4Q34A 2Q5CA 5CT8A 4UBNA 4I4CA 3AG4B 4C0QC 1IB0A 3T7AA 4Q3CA 4BVBA 3WJ2A 3WLFA 3C41J 1L4FA 4GGOA 1RFLA 4P3YA 5EJAA 2P6JA 2XNDD 2PUCA 3K5NA 3HU1A 2OCBA 1KY5A 1NONA 1XQ9A 4V24A 4PHZA 5E9WA 2JF0A 3ZHCA 1U2PA 2XRYA 3TLCA 4F4HA 3DSQA 1N2SA 5FI1B 3DTTA 3ORHA 2XA9A 3BXZA 1G8YA 5FBHA 3VH3A 4P33A 3Q9SA 5GOZA 2PL9A 4A7PA 2LP7A 3A0BZ 3K0AA 3LM8A 2DW4A 2DQSA 2OBBA 2GRAA 1XJCA 2CLOB 3TGPA 2QJTA 4YHBA 4D9GA 4KMRA 3QHAA 4QUDA 2X9QA 1J99A 121PA 4Y18A 1OXSC 4LP8A 5FWYB 1BMDA 2DTDA 2ZREA 5AM1A 2GD2A 3APOA 3QKWA 2MW2B 1S2IA 4DJAA 3KJHA 2CMDA 4G1FA 3ZNOA 3EF0A 4KN5A 1U0OC 3A0RA 2NQ2C 1XRJA 1VQ5F 1J07A 5CXUA 3VYSB 3PI6A 7REQB 3G17A 5JW6A 1EK0A 1AMNA 5JI3E 3H99A 2QZ4A 2DBZA 5LDGA 2WIJA 5JRZA 1OWLA 1RXSA 3CKLA 2ERXA 5BZBA 3CYPB 2QN3A 2XKBA 3VSDA 1S4QA 1WXGA 3D7RA 5JAMA 1RJ9A 1TM2A 1IBSA 3RRYA 1KI3A 3N4YA 3CUYA 4JV5B 3WGZA 2WLTA 3A1VA 4I1YA 1TU4A 1VPEA 4LHWA 1SVIA 1FE8A 2ZB8A 1DKPA 4CM6A 4G0ZA 2ZJ7A 1W52X 1GRNA 2I55A 5DRYA 4DRZA 2C4NA 2C4UA 5T3YA 4LF4B 4PX2A 3OMNB 3RHTA 2R9RB 2FCRA 5BT8A 4QPNA 3WLKX 3G7UA 3KO8A 3NQ41 1IPHA 4K0KO 4BWVA 1G3RA 3NT4A 2LUOA 1XEXB 1KQFA 2C7VA 4RMNA 2CVZA 3COSA 4EJMA 3I2YX 1LPOA 5FOTA 4QXMA 4AJJA 3V4ZA 5KB3A 3CZRA 2XUJA 2FKAA 1SHLA 3RE1A 1W2GA 4JNCA 3WICA 2VDUE 1CDDA 2FZLA 3U0ZA 4WKGA 4ZDIA 2N74A 1CZRA 2QRGA 4LJKA 4HP8A 2AD1A 1OLUB 2E4UA 2IH2A 1TQ2A 2IHKA 2UXCO 4H15A 2WQZA 4UATA 5EJGA 3UH1A 4J7JA 2VEDA 5FNVF 5DTRA 1Z26A 1X80A 4OXKA 3L4EA 4B6OA 2ATVA 3MS4A 1Q7YH 4C0BA 4PYIA 5D3QA 3UKOA 1WCV1 4X1YA 3SIWA 1JVBA 3DLTA 1QQ5A 4ZQHA 4GOXA 2M2IA 3D8UA 1M4UA 3IX7A 5DM60 4DZRA 4CWAA 3SKVA 5J4YA 3W04A 4AUEA 5I9NA 2W11A 4DEYA 1ZGGA 5JCOC 2F8MA 3MJHA 1OIVA 4MB2A 4RACA 1Y34E 1BDHA 5WRFA 4NMLA 5FAKA 4LJLA 4DRXA 3S0WA 4N18A 5EZYF 1M1UA 3S29A 3HEMA 1S0VA 1NI4B 4E12A 1SBIA 3SLRA 5CB8A 4UB8Z 1RAGA 2O2IA 2DSNA 3VHLB 4HGNA 5KO2A 5IABA 2B9VA 1NH2D 1GZSA 1FK8A 2Z3WA 3RVSA 2MTBA 2GZ2A 2FQQA 4BE9A 2HQRA 1PP4A 3I3FA 3OZBA 4FZ5A 2X19A 3ND8A 4O4HB 2OVFA 4ARVA 2BR5A 3DQQA 1T2CA 1ZQ1A 2XVXA 1VL5A 2P90A 5ICGA 4MEJA 3O7MA 4BKMA 1Y4UA 2AUMA 3PC7A 5IAAA 1WQ3A 3IAM1 3T5PA 2NGRA 5EQJB 3W9SA 1NYLA 4U9HS 2CL5A 3VU0A 2G07A 4GXRA 2VXOA 2GZDA 3ET4A 1GTZA 5LXTB 3UC9A 2P3OA 3KTDA 3TKLA 3H0EA 2RQ6A 2IYAA 3GGSA 4QICA 3NTXA 1NJ8A 4LJ6A 1KJJA 3M1LA 2UZ1B 4YI5A 2HV8A 5JQGA 1SCBA 2GHYA 5CMLA 5B3AA 3ASZA 3NI2A 5IJ9A 3K0TA 3FLAA 1GM7A 3Q85A 3V4SA 2HUPA 2F93B 3GCWA 4PZCA 4YDHB 1YQEA 3MUFA 4KACA 4JUBA 4YFVA 4XWYA 4K8OA 1T8WA 5G0SA 2DLCX 3UVEA 4Q1AA 1A2KC 1ESDA 5H9VA 3COZA 3MUEA 4P0QB 1UOEA 2JD0A 3IXMA 1M74A 4L75A 2R1VB 4WTOA 3C3MA 1G6UA 1J8FA 2HTFA 4C2TA 4A3SA 3O4RA 1U63A 2Z8YA 3LPAA 3B6NA 4J76A 1Y9EA 4L8LA 1OZGA 4BVHA 1M8KA 1DX6A 5IUNC 1E4OA 2Q3CA 2ZLBA 3IUJA 2J9XB 3A4YA 1KAGA 1ZN8A 4G26A 3EXEB 4W1SA 5BN3A 3DLAA 5HFLA 4OKSA 4LJ5A 5A5GA 3WGQA 2ZUDA 5LP6A 2FN4A 4CCAA 2HKOA 4G37A 1KUQA 2BI8A 4MHSA 2HL6A 4JROA 3WMWA 5H5NA 1FF9A 2MU1A 2RNBA 2WJJA 2XHZA 2A7XA 1D7AA 3AKDA 3BK7A 3L6BA 3HDGA 4RANA 1A9XA 2C82A 3T1HO 4UM9B 4GMHA 1TZBA 2C20A 3CC2V 3STWA 2ZRFA 2X6AA 1V16B 4UDNA 1U3UA 4WESA 4MV3A 2Q9LA 1NBIA 4OB6A 4O5OA 1GZ3A 4CN8A 3KKOA 2QYOA 1YTFD 3R6DA 1JI0A 2GN2A 4G5QA 5IT9M 4Z3DA 3AR5A 1RZRD 2I9PA 3VU3A 2Y1KA 1Q7BA 2E18A 1U8XX 3L71H 3I28A 5CRIA 4H18A 1GKUB 4Z4EA 5FL7D 3ZBTA 3H18A 2E0IA 3H8VA 3DBIA 3GRAA 4GD3Q 1W49A 2FPOA 4CKBB 2Q69A 3EFFK 3DCJA 3I1JA 1HF3A 3AK3A 1BQ3A 4B7UA 4BVTA 1EVZA 4KTVE 1EUDB 3MB8A 1VIYA 5FWAA 2I7DA 3MCUA 3NPMA 2Z1MA 4NPHA 2XYHA 4JB8A 4ZZIA 3ELYA 4DR7O 3NT5A 1FMLA 1CJTC 5AK0A 3UJNA 1ONNA 4M7PA 5IKEA 3SE0A 1YZ3A 4ZT7A 1R00A 2VPIA 3TPZA 3FJOA 3BJZA 4Q4AA 2G09A 4IQ8A 1Q6IA 4O2LA 1M6WA 1P45A 3JATB 2AS0A 3AJAA 1XBLA 4JC4A 3WBFA 2V59A 3EC1A 2PT7A 2LVBA 1P0QA 4ASUG 5FQOA 1H9AA 4RIFA 2GETA 2WWWA 4XBFA 1NXTA 4B6EA 3C1TA 2YOGA 4O2AA 3BPSA 1N5DA 2X9LA 1QZ3A 2PPLA 1KH1A 2PSSA 4PYJA 5G2OA 2ZT9B 4QPJA 4JLJA 3AEKB 2YFYA 1SNYA 4DSOA 4H0LB 4RFSA 1OPXA 4QM6A 3VGJA 2OILA 3G02A 3V8BA 2QV0A 1CN7A 3N8NA 1NUTA 3TZQA 4L22A 3HKEA 4BQRA 1OI3A 2D5IA 1XKTA 2NQTA 3GCZA 3H2GA 5BMOA 2ZINA 3QWAA 3SJBA 2CDYA 4JKOA 5HM8A 1KORA 3CMEF 1XQVA 5LOVF 4EW2A 2C5GA 4FVTA 5C81A 5IEJA 2H5EA 2UYJA 5SZJA 3WLJA 2HFKA 2CUNA 4DCGA 1H23A 4K81B 2WF6A 2C95A 3URMA 5E6SA 2QLTA 2ZIXB 3QVJA 4HBZA 3FTDA 3TMYA 1C0IA 5IC6A 5FFMA 5E7QA 4M6WA 4FM1A 8ATCA 3KOWA 1Q57A 2FN7A 2F43A 3JVUA 2MT9A 1DWUA 3N2YA 3SYOA 1GN6A 4ZHWA 1E20A 2IXFA 3NUGA 3CKYA 1YL5A 4RY0A 4CUJA 4YWJA 4D82A 2EX0A 3ZDZB 1JG6A 1RHKA 1D2CA 3R0IA 1IAVA 1X7PA 1NUUA 3H87A 1HK7A 3G8CA 5BUCA 2JD1A 3B6ZA 1A3CA 3TXAA 4LH6A 3HA7A 3WK7A 4YQEA 5C7YA 3LYHA 4GIBA 4GKJB 1NF8A 3LV8A 1L5WA 4AB1A 2XIQA 3DMFA 5CIWA 4ZVVA 2QVLA 3QE0A 4ANFA 2OWOA 4HY3A 3PEUA 4JI2B 3DFIA 4JUFA 2O3QA 2C8KA 2O6LA 4A15A 2VDJA 2EOAA 4MS4B 2YIDA 2QPLA 4CH4A 2PUFA 1KC8W 5BR7A 4NECA 4HOYA 2NO0A 2R68A 3SR3A 1F4VA 4GOKA 5BRAA 1IBRA 1FXWF 3FFXA 4PYRA 3GFTA 3EHBB 3LU1A 1PNOA 3OE5A 4J1SA 1MC8A 3EPHA 3TCKA 1TYCA 5KJFA 2P6RA 3IVRA 1XNHA 4QYSA 3BGDA 4RGVA 1RJEA 1QNLA 2IEBA 2ZJYA 3EGWA 3NOXA 4AECA 4CHTA 4JJ4A 1ZR2A 4I9NA 1PL6A 1K92A 4DPKA 1FRFS 5JASA 4I9UA 4M9UA 1UCFA 3NCTA 3Q5EA 3CEMA 3OZIA 4HWPA 1GSIA 2Y69B 4ITVA 1O08A 3MTEA 2PAFA 1ZC3A 4UCUA 4NYIQ 3CRW1 4B17A 5B30A 3HADA 2HF7A 2EW2A 3OTQA 1X3LA 2R2GA 2L0XA 5K0TA 4ROTA 4GP9A 3IOEA 2ZATA 5JVDB 2BW0A 1SUFA 4E5MA 2BHRA 2RI1A 4U8HA 5H3LA 2YBEA 4YT2A 2EJWA 1R18A 1BGVA 1FFSA 1V6AA 5K0ZA 3OFJA 2R9IA 2XUFA 1VJRA 1SCAA 3FHCB 3OAAD 4B43A 1PK8A 1DAPA 2RGYA 5CITA 4RQUA 1E5LA 1ZXLA 3VAAA 1T9DA 2UXBO 3LA6A 3W8NA 3MBMA 4L8VA 4L16A 1SKBA 1XT6A 4Y6SA 1FRZA 1BDMA 4IXMA 1YB5A 4ZCIA 3JZDA 4E51A 1WA5A 4Y0NA 2XB9A 3EASA 1NRJB 4ZARA 4AJIA 4O02B 2WD8A 2IOYA 4RPJA 3Q2OA 3SPIA 3CNLA 3CCMF 2W2KA 1OV9A 4TUYA 4X6UA 2EG5A 4O59O 1QYDA 1Q0RA 2E55A 4KLAA 3A9TA 2O48X 3I64A 1F4NA 2FETA 4PPFA 3OLZA 4G0MA 3OWHA 1SK8A 3HKCB 5HKKD 3ME5A 3I9FA 2XLCA 3RRNA 4G4VA 2IYXA 4E09A 3HUTA 3WGJA 5JD4A 3L7BA 2FW1A 5B7GA 5KOIA 2K1SA 3C48A 4IJKA 1YCGA 3LWOC 3N86A 3NS7A 5FT9A 1VJCA 4HGQA 5TMBA 2XUQA 1JYFA 1SXJD 4CJXA 4M9QA 1G1MA 1HYGA 4B7ZA 2ZB3A 2IW5A 5IYDO 5KTNA 1JHAA 1OLSB 1P9RA 1PL8A 1CIJA 2IJKA 1IB6A 4FMPA 1KI8A 2XMZA 5I5GA 3BFXA 4UHBA 2ZYUX 1X0XA 1HQCA 2Z57A 1MLDA 2ZS7A 4XEHA 3SZ3A 2R1ZA 1NVPD 2FUCA 4ZAXA 4FFBA 1EQAA 2QTLA 5FBVB 4HDOB 2UYKA 3ED1A 3OZWA 3LUKA 4FN5A 3G89A 3AFNA 1XNQB 3VO2A 3HXQA 5L3FA 2QXTA 2FRXA 1SIOA 5EXPA 1ECPA 4BQFA 3IUMA 3C98A 5E1MA 2N9UA 1IWOA 2AFIE 3W9YA 4S04A 1M6NA 2C84A 3K0GA 1GFWA 4RS4A 2UU9O 3PLAC 2YRXA 3ESJA 3IMPA 5FAXA 4DCNA 4PO9A 1KYTA 2WUDA 2EBUA 4X66O 4FFKA 5LZ5A 1U90A 3GWGA 3K9NA 4RD3A 5IC4A 3Q3CA 1NMQA 4Q9AA 1YAJA 1D9XA 2Z09A 5F7OA 2QGNA 4UVGA 1G55A 4CKEB 3H01A 2UZHA 4TROA 1JHOA 1BIFA 4YRKA 2VNJA 3C7CB 2AKYA 3E58A 3QA9A 1WP9A 5FUWA 3ZN1A 1GN4A 3WDSA 4KLRA 2HP3A 4FXPA 4RHEA 5AYVA 3K96A 1LLCA 4LVUA 3UMCA 1WKBA 2ITCC 1R4AA 2BOVA 1EVLA 1TYAE 3E35A 2OESA 4TRMA 3ADDA 5IW8A 1T8PA 1ZD5A 3DYIA 5HA5A 2JCXA 1WU8A 4BO0A 1U8YA 3OZEA 2I3GA 5BUQA 4ILEA 4N9QA 5L3SB 3P45A 3CX7A 4OL0A 4LSZA 1BMFD 1QANA 1Q20A 2GJKA 5L8VA 3U7EB 2OCDA 4KUMA 1U3GA 2BCGY 1N0IA 5FOWA 4ARAA 4PGGA 2C5AA 5EE3A 5H9CA 5D3MA 4YRRA 3GDGA 1DC6A 2DCMA 4HCJA 3I5MA 1E18A 4CM1A 1CDZA 3DBLB 5B4TA 2ARKA 3VGPA 3W2HA 1M1KH 2B0CA 4C6TA 3B09A 5IT5A 4UBLA 4GH5A 1GNVA 2VF2A 3D4LA 3IOCA 1CZUA 3OZFA 4MKXA 4B33A 5F23A 5LZ2A 5IBCA 3V1NA 2RKBA 2XGMA 3WDKA 4YRZA 3M4JA 4EYGA 4AQYB 1QR6A 4V0NA 3AVYA 3LDAA 4WACA 1T5SA 1E9SA 5K0NA 3W6ZA 4EA7A 3OUTA 4JFAA 1KETA 3HB9A 4DPLA 4E0BA 1IDOA 2UUOA 2VRCA 5H02A 4K2HA 3JWGA 4PSUA 5HJEA 4AUNA 3RJTA 4RCZA 3NCHA 3BORA 3HLTA 2QF7A 1B14A 5KVCA 2FOXA 2F4VO 1E0JA 1E3WB 4JOQA 4ZPJA 1JLRA 5GWXA 4DGQA 3GFBA 3AB7A 1HDZA 1M57B 1YZYA 2Q4OA 3QF7A 5M2QA 1HTTA 4YCMA 2A6PA 5CW1A 4TTQA 3DGFC 1VHTA 3RT7A 3R0PA 4U7GA 4C6HA 2VHZA 4R1OA 4RKFA 1QGYA 4XLTA 1ZEJA 1ZH8A 3L7YA 1UJWB 3DAYA 4BEJA 1GM5A 3IR7A 4JTDB 3HKBA 1QLNA 4C7OA 4LOJA 2IYSA 3D1LA 2ZBFA 5B1AC 3COYA 2XUAA 2IM9A 4O4LF 2G9UA 4MR8A 3SBXA 1FX1A 3H5AA 3AI1A 4OGQB 1W0CA 4B2YA 1L5ZA 1XZAA 4MQEB 4E1AA 2R4QA 1VCMA 3H8JA 1KKLA 4YAUA 2CFCA 2UZAA 4CR6A 2FHPA 2EIKC 2GN0A 2H9AA 2EDCA 2G36A 4C9BA 1T13A 5BOSA 1DIHA 3NBYC 5F64A 2A0FA 3W78A 4ZDWA 3DWEX 1P80A 4BT5A 2ACKA 2W0SA 3I12A 3Q11A 3EBLA 1WE2A 2AG5A 3D36A 2QW8A 2FE4A 5UKDA 4KFUA 2F00A 3P2KA 2ID4A 3ZBQA 3KKNA 5CA0A 2FVYA 1RZVA 2JGMA 3PYMA 4KH1A 1E9FA 3DUWA 1NLYA 1Y37A 5C18A 1KPGA 5CD9A 4D3ZA 3QYAA 5JEDA 4DM4A 3EGDA 1OCCC 1J2JA 3DLBA 5JR3A 4I1UA 2C5FA 1ZICA 4N5LA 1DG9A 2IFTA 1W19A 2IEDA 2UXDB 4CGYA 3PHLA 3E2MA 1J42A 1QH0A 3B2EE 4H33A 1VXOA 3KLOA 1YDHA 1HO3A 4EX7A 3U4QA 4D9KA 1JXOA 2EHJA 3IQWA 3W7TA 1MXHA 2EKPA 4KDFA 3H1HH 1X8XA 4TV9F 2WD7A 4PWYA 4L1KA 4A8JC 1V8OA 4RPGA 4YRPA 2C29D 4NOLA 5E4JA 4OMDA 1M2OB 4Z8YA 3NV9A 1B8UA 1YONA 2FY8A 4F46A 1JPJA 4MO9A 5HY0A 5HM6A 3GMIA 2A9PA 1PKEA 2B0JA 4JITA 4YMTA 2VHXA 1OE0A 3LRXA 1U1GA 3KIZA 3FDZB 4MSUA 1OFUA 4TWAA 2EX4A 3NVMB 3OAAA 3LBAA 2GJSA 1GO0A 3GJTA 1IUPA 1D0VA 3BJRA 1PR4A 1DDOA 2ZQ5A 1T9GR 4J7KA 4KQWA 1U3CA 2YZKA 2RKWA 4XPZA 2G5GX 5JZSA 4DV5B 1WUYA 1QTRA 3DOCA 2CH7A 4DY4A 4X64O 5KJCA 5DIZA 3TR5A 1CXZB 4I5GA 3FYUB 3NBUA 1PFWA 1F0KA 3SQOA 3M89A 1JH8A 1ZCFA 1KH2A 1ZL0A 3REGA 4BWFB 4GR9A 4ZI5A 4ZIRB 1GPAA 3ZD6A 3H1AA 3HLKA 3CISA 1C5KA 4D43A 1OAOA 4MYRA 1QIEA 1GRQA 1EB8A 1C9MA 4OJKA 1O3YA 5HE8A 4EGJA 5B3SB 3DE5X 5HF6A 5HKKA 1NMZA 4MWEA 2DPXA 4JVOA 1Z17A 5H4GA 3W77A 2P5UA 1TLLA 1EUCA 1SOWA 3TCXB 1N2EA 2VBGA 2XA1A 1NBMG 1WTCA 1LX6A 3KX2A 4MI9A 2EWWA 2K2QB 3CKMA 1P7VA 4G67A 2V9ZA 4UKDA 4DLYA 5E4TA 5L95A 3KFLA 5EMNA 1QV6A 3FETA 2CGOA 3E53A 3CNOA 2QLLA 3GIWA 3JQ9C 4B3TB 2Q7GA 3ZJZA 2B4KA 4EGAA 5AW8A 1US8B 3E4DA 4RTKA 4FEYA 5C5EA 3FUCA 1HNXO 4KQFA 4ZK6A 4KR9A 4P7JA 4PG6A 2FP4B 2KBEA 1JIIA 5BWCA 1G7CA 5FOVA 2GLXA 3M70A 3EW7A 4JJ6A 4B8ZA 1MVOA 3ETHA 4O1MA 2VWJA 1PNVA 2JVIA 2X0LA 3WLHA 1T0IA 3AR6A 1AI4A 1DEKA 4HKTA 1E5VA 3TTWA 3D3WA 4QGPA 2H94A 1X1SA 1D9ZA 3KYDB 1TGYA 1UFKA 1BCCH 1UANA 1VSTA 1N4CA 2O8BB 1MO5A 3W5UA 1WA8B 2F3PA 4YO8A 3DOUA 1DC4A 5IG2A 1JDZA 2WVAA 3UKDA 4FBLA 3OT7A 1SPXA 3SSNA 4WXYB 2EFHB 1Y81A 1E7MA 2DWPA 1F8FA 1NQOA 3INGA 1QLEB 3SKXA 1ZGJA 3IUPA 3FFWA 2QNIA 3SU8A 1NP3A 4HNAB 3QUWA 4W8OA 4YQZA 3ZDRA 3ECCA 2V0GA 3O3CA 5KTKA 1N78A 2GQ0A 2PRJA 3VPXA 4JCOA 3DFZA 4IBOA 4UEWA 5FO0A 1JKIA 3WLQA 1SUIA 4JI8O 5IWCA 1SXHA 3K2QA 4V0RA 5CG2A 3H1KH 4X6YA 3ZLUA 2NZVG 3AY7A 4A5SA 1AILA 3P5SA 3A1CA 2VXCA 5DGIA 3DZDA 1PD1A 3P2OA 4X45A 2PN1A 3ZMSA 1YJCA 2WINI 3IYLW 4JGSA 3GFVA 5CFMA 4K28A 1U7OA 1IY9A 3ICPA 4DWWA 3ACBA 3AFGA 1U6KA 3ZUPA 1KXJA 2YYZA 5IT9N 2YZ7A 1YHQF 2CZWA 3RUCA 4CMBA 5CVUA 5G41A 4M89A 3K0KA 3V8VA 4FW9A 1WHTA 3ND6A 3CKKA 5K8VA 4I81A 4MS1B 1CYEA 3FVWA 3NIFB 2OLKA 5BN5A 3Q4HB 4RFLA 5FBKA 2ZYVX 3KSAC 3GAFA 3QWIA 1SUBA 2A5FA 3O4HA 3WOVA 1W59A 4OXRA 1J1UA 2AG0A 1A69A 4BT4A 2OCKA 3N6XA 4R16A 5EIBD 4P4SB 4FYXA 1U2GA 1XMQB 2DXIA 1Z0UA 2PL1A 1H7MA 5CFRA 1MU0A 3ENNA 3OIFA 3TSWA 3IALA 4N5NA 1T36A 4K9OA 5JDCC 2HH9A 2ZJFA 3PEFA 4LHVA 1G9TA 3WGVA 3UEOA 5IDJA 4MVJG 2EC5A 5FL3A 3HFSA 4P93A 4RESA 3GFQA 3MWJA 5KYKA 3GLIA 3DWFA 1PNQA 2XE8A 6YASA 5GAPK 2N1BA 3OIYA 3QA3E 3ON5A 4IDBA 3MCAB 1GA6A 2HWYA 1YQNA 1RHUA 3KKPA 4II7A 3EXIA 2XYVA 4DV3O 1QYXA 1PG2A 3OIDA 1EAYA 4FSXA 4BEVA 2FWJA 4LXUA 3ZK8A 4GW3A 5HP8A 3UMJA 4UMVA 2Z3YA 6REQA 5F5XA 3E8XA 4C4YA 3UAOA 3D2BA 1IZ0A 1VKHA 1AKUA 3ANSA 1VLLA 3GWOA 2PNFA 3J81M 3CSSA 1XF9A 5EQTA 3UMMA 3JQBC 4LC0A 4RD6A 3CA8A 3DF9A 1P2SA 4MS2A 1YB2A 2F17A 4WZBA 3UUEA 2GSDA 2WVJA 3GG2A 4PTZA 1ZNWA 3H86A 3BDVA 4PLPA 4QNNA 4HXEB 4ZRNA 2W0MA 1UDAA 3K94A 2QWQB 1G5HA 4G4SP 1NF2A 4AF7A 3HN6A 2J30A 1KNXA 1E69A 2C4MA 2D8AA 3DR5A 3EMKA 3H1JH 4X3MA 2H1OA 5EESA 1CV2A 4M8LA 4AKIA 4UUJC 3O9OA 4BO6A 3IEQA 2OK7A 1HQKA 4UVIA 3CVVA 5EP4A 4MI3A 1JAXA 1K1EA 2RHBA 2QSUA 4QJIA 4TYWA 2BMAA 4AK9A 2RG1A 4TKVA 1QKIA 2Y48A 4IGAA 2PWBA 1UFYA 3V8MA 4MRMA 4PDRA 1XDZA 1V11A 2P2GA 4AO7A 2FPPB 2EFGA 4G0NA 1NX6A 2V6BA 3MGKA 2ZXWB 4C89A 3JTEA 1JB9A 4L8YA 2I2XB 3VM6A 5JPDA 3WYAA 4LRXA 3QF4A 1PV2A 1D2RA 3NHPA 2WHXA 2CFOA 4LZWA 4MLPA 3Q7RA 1NXWA 3DC6A 4ONEA 1Y9AA 5AM2A 1B42A 2ADOA 3KTAB 3RNOA 3DMTC 3TNDA 4YAGA 3HSSA 2W93A 5LGNA 1O5TA 2CLSA 2OCGA 1A2OA 1SMKA 3V7EA 2EJBA 1NW8A 1T4MA 5AO9A 4S0XA 1ILEA 2WG0A 3C7AA 4MEBA 1NP6A 2HA4A 3ZVNA 5TS3A 3TZKA 2YJGA 3R9XA 3NH6A 3G13A 2YWHA 1HDGO 4K8ZA 3TJTA 2Q5FA 3S2GA 1K0UA 1HI9A 1PV0A 4ALMA 2B4YA 3ZY3A 4DR2O 3P9QA 1X92A 1GUYA 3ABMB 4INJA 1Z47A 3HDJA 4HATA 1XLTC 2BOBC 3K0FA 3CMMA 3D5EA 1CBUA 4GYCB 2JFXA 4YAIA 2H8GA 4WUTA 1ZH2A 2ITDC 5CM2Z 2JJ1A 1V2HE 2DHRA 3L7DA 5KHHA 1EP3B 4G0UA 1KH3A 3V7NA 2X86A 4N0EA 1DBRA 1N4DA 1XYYA 3KSRA 1JAZA 1H38A 3CG4A 4MTCA 1UODA 2D2CB 2OXCA 5AUPB 1Z29A 3KAQA 2VAWA 4LGVA 1J24A 5DMHA 3WJAA 3TINA 2ZR3A 3UH0A 1SQ6A 4KPYA 5KA6A 4D8XA 3G2HA 4G1CA 2VC2B 2QQ5A 1XILA 4Y6OA 3AM3A 1RFYA 2EQAA 2OFFA 4NRDA 1CUHA 2C2BA 3EXFA 1YR1A 9LDTA 3H1TA 4K3VA 1KOFA 3EFHA 5JFOA 5DULA 3O95A 4WD3A 3IKEA 2XRZA 3E7DA 4WOPA 1Y8CA 2W6CX 5E9JA 3C6XA 1SK9A 3IQGX 4BFUA 5LMZA 2XOKG 1N6LA 1JEDA 4OY3A 4ENTA 3SYTA 1X7ZB 3HBLA 2ZR2A 4AAYA 2P8SA 1UBKS 1FLNA 3U9SA 1WWKA 5CB4F 4XJSA 1XQYA 3F0FA 4C81A 1SN7A 1Y9ZA 3NEAA 3SSOA 4ZQIA 3T5AA 1VQ8V 4LR3A 2CV0A 1GO1A 3ZWCA 1H2NA 3NUZA 2ATXA 3ZDAA 5AMXA 5EB0A 1M66A 5JAOA 3A6ZA 3V2HA 2B4AA 1REQB 2MINA 1EDZA 2NW6A 1L7DA 1SXJC 2EFDB 4G9GA 5H6QA 4U9IS 3PRJA 3ABQB 4R1SA 2W42A 3L4BC 5TPWA 1D0SA 4II3A 4LF9O 5DW0A 4BO2A 4FMCB 4MROA 2WTAA 3IESA 2CUZA 3CVWA 4KQXA 4JLMA 1MQ8B 1N5KA 3AK4A 3H5RA 2OQIA 3CLTD 2VZ9A 1VI6A 2IUSA 4FZ3A 2DY0A 2CSUA 5HQ3B 4CMIA 3FHTA 2QIOA 3WWZA 4D0LB 4Y2YA 2FTKE 4URYR 3EIFA 2V4UA 3ZE1B 4M1YA 2X2FA 3DAGA 5A05A 5AVSA 4WZZA 2WIAA 3ESBA 4URHA 3OQHA 4XQCA 3IO3A 3PSHA 4LRWA 3V80A 1JN1A 3NNDA 1HRDA 3KWFA 2GLTA 2EFYA 1H65A 1X77A 1EI9A 1FYVA 3C0KA 2M1ZA 1VSQA 4NMXB 3UQ8A 4G28B 1ZMRA 3BRWD 3JSLA 1DXYA 1JN0A 4ZWNA 4QGBA 2WAOA 3ZWDA 2AGVA 3LDHA 4ILKA 3PNLA 3U4AA 3BH0A 3I34X 5IFLA 5DHSA 4PR0A 5IF9A 2GYYA 3FYHA 4R54A 3F6CA 3ZXSA 2JRLA 4B9AA 4I9FA 5T4EA 5HVNA 2JVKA 4PS1A 1KEZA 1IBMO 4DL9A 2ROQA 1JQDA 1TI7A 5BMVB 2DECA 4IDQA 3CCEF 5KWEA 3CLRD 3RB8A 3AG1B 1XNRO 4UAJA 1JA1A 1QQTA 5DJ5A 1S2MA 4IUYA 5ALKA 4UCXA 1BG6A 5JXIA 1E8NA 5EC1C 3KJEA 3E7FA 4MT8A 1UT8A 1WPRA 1XZEA 2DT5A 1KE1A 1Z0IA 2DCUA 3QP9A 2YZ2A 3F47A 2EIHA 2XAHA 1M2VB 3G9ZA 2CW5A 3MHTA 4Y98A 1J21A 3L6DA 2F3TA 4DW0A 4EY3A 3SQWA 4ZYYA 5JHGB 2G71A 4XWKA 2I6QA 4P22A 2YZGA 3IGFA 1RI2A 4MVMA 2FSIA 4U9UA 1U8CB 2HY7A 2QN1A 2JFQA 3R74A 2UZIR 1SU7A 1GJRA 5JECA 3A1FA 2ADMA 1H4TA 2WJVA 2Z8ZA 4HDRA 4LF8B 1PX0A 2ZCJA 4JB2A 1DO2A 1Y4AE 3CUUA 2EGHA 4ZRMA 4E11A 4EFEA 2D1SA 3P0HA 5ENVA 3UHPA 2Q2WA 1PUIA 2VKQA 3EA4A 1PCXA 1VC2A 5CR9A 3B3AA 5HWEA 2V3WA 2WJWA 1I6WA 3G7NA 1QB7A 4ZOLF 4E30A 2OV4A 2OZLA 1SCNE 2YMQA 3HYNA 2QUKA 3EHDA 2P5OA 3E81A 3LDTA 4QXAA 1VQ5V 1E6CA 4OSOA 4ZHQF 3MWFA 2C77A 3H65A 3MYYA 3P4EA 1NQ3A 5IK2D 1LPBB 2IYTA 3U4GA 1Y74B 1Y8RB 3HCCA 4FEEA 2FPGA 3E9ZA 1EFTA 4JDUA 4OHFA 3JAWB 5DCVA 1LRKA 4DMHA 1NYRA 2BL4A 4KDRA 3ICWA 2F62A 1XTIA 2FR8C 4AKGA 2Q2OA 1T4CA 2QG9A 4WQMA 1MABG 1WL8A 4ECAA 4DY6A 4WECA 2VUIB 4FIDA 1Y42X 2B37A 3PJRA 1SO8A 2C58A 1BYUA 1U7WA 5LYJA 2ENUA 2ZOSA 4MUEA 5AVKA 5E3HA 3KWJA 1W1IA 3PUIA 2HT6A 4QQFA 1UWVA 1CCWA 1IJKA 1VSUA 3AR3A 1YV9A 5KSWB 3S0YA 1U02A 5C5DA 3DLPX 3U9LA 5TV2A 1SZTA 3TSOA 1H6CA 3BMNA 4A0FA 1HYQA 5GGYA 1AF7A 2LCFA 3QLUA 2JJ2G 3DVSX 4ENWA 3U44A 1ZXBA 2FDXA 3VBBA 3QEOA 5DEDA 1A9PA 1RM1C 1E6MA 4MLZA 5T5QA 2Q3EA 1XPJA 1OW3B 3G88A 3B12A 5FBWB 1P7PA 1UKCA 1MFPA 4BXOB 1K8RA 2BISA 3RAGA 2GR9A 4KDCA 1FPQA 3WGMA 2W6JA 2YCBA 3I5UA 3UB2A 2MIIA 3LDUA 3LKZA 1AKYA 4IKOA 2A7QA 1YZKA 2QP4A 1APBA 3AESB 5IMSA 1NMXA 1EJBA 1G98A 4LXTA 4BQSA 2PG3A 3L6CA 4OHWA 3EULA 1COZA 5IT9A 4TT3G 2IYFA 3PD0A 3F6YA 5ALVA 3DWGA 3FAZA 1QG4A 2ZWPA 4ZDKA 3X1ZA 4FGKA 2J6CA 4RGBA 5CN0A 1X7OA 4UE3S 3DLHA 1JA9A 4RF2A 3QPBA 5B3JA 5I6DA 4G4SO 4BIMA 3ZZTA 3ZHVA 3MAGA 5IZCA 1EG7A 4TLDA 1ZYUA 4MQFA 3L0PA 1M6HA 1PDWA 1LBEA 2EU8A 5CDUA 3FGOA 2CD9A 1A9SA 3I9NA 3ZZUA 1TT5A 1QFZA 3VDNB 5I7SA 1USIA 1EBFA 3U7QA 1Z33A 3O4JA 4GUNA 5BYBA 4BEWA 4P3PA 2J5BA 2PJDA 4CLDA 4Q66C 2XKAA 4MINA 4WFKA 1OXBB 4DBLE 4FYIA 2J1LA 3ZW7A 3NBAA 2B7CA 3QUAA 2ZRHA 2GFIA 2R6CA 1R7RA 1NNEA 2HRDA 4E33A 4CDRA 5LZ8A 2UUBO 4HNRA 3Q8XB 1C7EA 3TETA 4I0XB 5A5FA 3AEQB 4KIFA 3G8DA 1S7GA 3DM5A 3KCNA 3FVRA 1XALA 1XU9A 1U5BA 5BOVA 4W9NC 3W5SA 3PXBA 1Z38A 5IE9A 4Q1DA 2C2MA 4W7IA 2OV6A 3U4CA 2BSKB 5JPCA 2WWFA 3THOA 1N5LA 3SXUB 3LWNA 5CM9C 4YAJA 3I8SA 1R2QA 4BQQA 4B6QA 1L5RA 2QJ1A 4F3CA 2BM0A 3M8AA 2RHTA 2XB6A 3QITA 1IJBA 2H7CA 1MKYA 4G4ZA 2AJTA 4WN9B 3BZWA 3ZE2B 1TEXA 4FMTA 4G65A 1UFIA 4HUQB 4ERHA 2ZBEA 3D3QA 3NBKA 5B1NA 2HQ1A 1LVUA 2P4VA 2ZZNA 1UAAA 1RQXA 3FYCA 3NTQA 3WZ2A 4MJ7A 4U2BA 1X7DA 4E2WA 3MQ2A 3TZ6A 4Q20A 4ZZ0A 4MYUA 3Q0TA 2I6TA 3ORSA 5AVMA 3C9UA 2O2CA 3UGKA 5ANRB 2XNHA 3R6GA 4PY2A 4Q4CA 5CCBA 2PU5A 3A1SA 4LYHA 5BVHB 3ABKB 4G5YA 5JO9A 4I6EA 3GWZA 4LC9A 3DMHA 3ZNPA 3RT9A 1C8BA 1DRVA 3OA2A 4JLSA 4DNPA 5I3ZA 4UM8B 2GSMB 3EBPA 3HXMA 1OCZB 2YWFA 1GNTA 2XUKA 3K57A 3FKSD 4H7FA 4BP9A 4FDTA 2WA1A 2QRZA 1JIVA 4GZLA 3ROFA 1S2DA 1HL3A 2EZTA 5CT6A 3H4VA 4MOWA 2CE2X 2VF8A 3K09C 3NDPA 5TNXA 3UXMA 2Z2IA 1VIBA 3QK7A 1SIUA 1XZMA 2KG7A 3WNQA 2AKAB 1J6UA 4RQOA 5H70A 4NIMA 3AONB 4HNTA 3HRHA 2CNKA 2IGBA 2XH8A 2Y6UA 1W5FA 1EVEA 2VZLA 4F11A 2XAGA 3BE4A 3JX9A 2B2XA 1Q81W 2R8YA 3ZRWB 5HZGA 1LSSA 5D5HA 4A82A 2V7QD 4NCIA 1CG6A 1UBRS 1W2WB 1ISPA 1SKAA 3DE3X 3VCZA 2CLCX 2C1XA 3LX6A 1N9ZA 2XAFA 4JU9A 3IIMA 1E2MA 3WNBA 3AR8A 4NARA 4EB6B 1KJQA 4MS3B 2R62A 4MDHA 4O8ZA 1NOKA 5PGMA 3MJVA 1Z2AA 3BRWA 3QYJA 3RN4A 3AERB 4J94A 3VC7A 1UAYA 2I99A 1KDZA 3L02A 4K2AA 1P1FA 2GWHA 4DCSA 5C4GB 1AB5A 2R6DA 1LZLA 3UT5A 4P9PA 2Z2ZA 4BP8A 1R5JA 3AH8A 4WNAB 1PP9H 4JJFA 1MC4A 4PQRA 3B7WA 1GLNA 3M4YA 2EAUA 2E4AA 4ITRC 3NVIB 2VRCD 4Z1OA 3IQDB 3OJFA 4IVQA 4ZTUB 1TIPA 4B5KA 1IAQA 3IHTA 4GZ5A 1FP4A 1WZUA 4UJ3A 3SP1A 1KFCB 3AF6A 2JCYA 3HVIA 3QUTA 2WU3A 1AHNA 5H83A 3JR7A 3NNNA 1JJVA 3SYRA 3AEUA 4IEIA 1FCJA 1B76A 1RWBA 4BBJA 3SPHA 1SC3A 1HORA 1KC8H 5KX5B 4DLKA 4NCBA 1NSTA 4BMNA 5EWLA 2VPXA 4JEIA 2P78A 2G7MC 2R84A 5KINB 4U3JA 3HU2A 4LNUA 1M1YA 4RPLA 4BX3A 2FG5A 1LTHR 2QMQA 2GHTA 1TRHA 2AXQA 1JFVA 3JZAA 1NLMA 2WA4A 1FX0A 2J33A 3MSXA 3OHMA 2PZKA 1Z5NA 3CMEV 3EUFA 3RLIA 3DE7X 1EN6A 3T1TA 1JSXA 4CIVA 1H0KA 4FLFA 1JNYA 1NVKA 3EK2A 4E88A 1IPEA 1NJFA 3OPNA 5EC2C 1R15A 4RMJA 5CK4A 5HS6A 4J0KA 4XFKA 3TSCA 2ZWVA 4ZQBA 3ZBHA 3GLKA 4G85A 2OORA 3TDNA 3EEOA 3JASA 1P9NA 5IAKA 3E1GA 4DCUA 1BX3A 1OTXA 5IK2A 2H3EA 3NJ8A 5IF3A 3GJXC 2Q7EA 2B5UA 1J8DA 3TDKA 4PG5A 4PZDA 2Z8XA 4YCAA 4PIPA 1RW4A 5F9HA 4ALJA 3MJ4A 1GPWB 2WUVA 3QXXA 3KZKA 2PRYA 2P79A 5EBLC 2WVGA 3JQGB 4ARSA 1YZTA 2FYUH 3FSRA 4UEKA 1W4ZA 2X8AA 5B1OA 4O0MA 2O8EB 2HDNB 3VQTA 1T24A 1IK4A 4PYNA 2A79B 2AI3A 2Y93A 2XZTA 4YI3A 3J81N 4KPUA 1ZGBA 1L4HA 1W8IA 4JJIA 2V7GA 3M1XA 2ALJA 4BX8A 1CZOA 1F2TB 3B1FA 3CZPA 1F9AA 1TTPB 1ZOLA 3FGZA 4DLTA 3A06A 4RIEA 5HZHA 2QA5A 2E9SA 3MTGA 1R6DA 3QWHA 2H00A 2X6QA 5KTSA 1S1MA 1MABB 4JI6B 1J97A 5IARA 1G21A 1JYEA 2GERA 4Q0MA 2Z58A 4TMFA 3DAOA 2AN5A 1KJNA 4MCHA 2PTGA 5KSZA 1P1HA 1TQ8A 3I2KA 1TKBA 5C31A 4B7AA 1QO9A 1O94D 5K9ZA 1N75A 4F8EA 4DDVA 4UASA 1R66A 4G09A 4MVRA 1C9NA 3TVTA 4OQEA 2PFGA 3TLMA 5BNZA 4LECA 1R0LA 4FYMA 4BVLA 1YTUA 3QHPA 4RNDB 1HURA 1S01A 3MLEA 4HFNA 2C3MA 2RHDA 3MWEA 2C1ZA 5EI5A 2Q3JA 3JQPA 1JDBB 3SGIA 4M46A 3NUQA 1PE0A 1YR6A 1LK0A 3VXKA 3E8MA 2W4QA 3CWZA 4BVKA 2A8YA 3SJZA 1NLZA 1E6KA 1U0GA 3V97A 4HYEA 3THXA 4MJLA 1SDSA 5CVEA 1THMA 4RX1A 3LMEA 3BJEA 1JBKA 2OBMA 3P9IA 3DXFA 4C01A 5EWMB 2HC9A 2YJNA 3CCMV 3EXHA 5C1DA 1YU6A 3HJUA 3GDFA 2IPMA 3OCVA 5GINE 2BGLA 3V7YA 2PZSA 4B09A 3PCRB 4NENB 3IP7A 2FHSA 3DEYX 3IVGA 4HNHA 2RK3A 3K1AB 4RK6A 4UVHA 2BMFA 2GAOA 4JI3O 3FRIA 2Z04A 3SS8A 1FYEA 4C1BA 1Y3BE 2QI2A 1YS9A 4ZAGA 1KQSF 3QEJA 2YY6A 4O4JA 1R0BA 3U80A 3OEHA 3RS0A 4NEHB 2E49A 4QUKA 1WBJB 2A14A 3OY7A 2CVFA 4HVTA 4TT8A 2OAP1 2J3LA 4RQAA 2E87A 3X2EA 3BRSA 4OQ4A 4Z49A 1I8TA 4EUKA 4QYTA 5HFJA 2D1TA 2C9BA 1MC5A 1H1LB 4YRSA 4X65B 1U0FA 4QUJA 5CHEA 3CM0A 3E0QA 5D3KA 1ZNYA 3GMSA 3N6RA 2Y0CA 2KI5A 1DRWA 4WKNA 1VE9A 4TWZA 4XGIA 4PRKA 2QKCA 4JBWA 2Q99A 2W9XA 2NXEA 3PQ2A 4W4LA 4OHZA 1F1JA 4DT1A 4OLAA 5SZKB 4HNVA 3FMOB 5L6MB 2P9HA 1QZTA 1UDBA 4L50A 4X6XA 1ODKA 2QRMA 1OPRA 2XWBF 3QVGB 1ESZA 4NFYA 4M1SA 1ISIA 3A9WA 2GZLA 1DGQA 3FKSA 1WXFA 4S12A 4LDAA 1E1NA 5LP6C 5FYQA 2UVQA 1QHSA 2O19A 4HAZA 4HQKA 5H0IA 2UUAO 1O8BA 2QLMA 3ESXA 1Y3FE 2ZWIA 4IT5A 4NOJA 1O97D 3DCNA 3Q5DA 3VUEA 3KJQA 2W6OA 4WFFA 4FPXA 4DV6B 3HN2A 2GTPA 2NO4A 4OGGA 4C5CA 2G6BA 2O05A 3Q98A 1M2JA 1D2EA 4BE7B 1I10A 4JLAA 2UVPA 4S35A 2CEAA 1NG1A 3MAQA 3RADC 4HMPA 2PMDA 5AKXA 3OLVA 4INZA 3X1YA 2R9AA 2V7QA 3EGVA 1GFZA 3H97A 4X7PA 1EM8A 3CLTC 2DMXA 3K71B 4MV7A 2G8NA 2REXB 3H0CA 2PVPA 3AV0B 5DOZA 3PWKA 1CLUA 4D44A 1T9AA 4AJPA 1FS4A 4JI5O 1CVLA 4EQ6A 1G9XA 1XXLA 2GKOA 4YBRA 1J06A 5LOVA 2CF5A 4TL8A 2QWPB 1Q7GA 1ONOA 5HR5A 2O5RA 3PUYA 2XAUA 4PZPA 4HAXA 3OICA 5EE1A 3UG7A 4DYHA 5DNEA 3H1PA 2VJAA 2BEWA 3AG5A 3TRHA 5F5NA 2DZDA 4TXLA 3THWB 2HK7A 1MQSA 4RDIA 1N3BA 1OX5A 3JPWA 4GEGA 2GZSA 4RHTA 4WCFC 1R4MA 5B4VA 1ADCA 4IFIA 1DBFA 3FAKA 2W8BB 3DE2X 3TQIA 2CGEA 1B1AA 4U0KA 1SCJA 4ZYXA 2EF1A 1I5XA 4FOSA 4D97A 1G20B 5DYYA 3NOOA 2WR8A 3R5JA 4I1SA 2OXRA 3I45A 2GK6A 1TIBA 1R50A 5TSDA 1JVMA 1S8FA 2WF9A 3GRZA 3WXBA 3W6PA 1IPAA 5SY4A 4CQLB 3ONVA 2PBZA 3GP3A 3KXPA 2YWBA 2GI4A 2ZR8A 2ZSDA 3M7IA 3FLMA 4ZU1X 2BMEA 1SHUX 5JJBA 3NHJA 1UPXA 2BEVA 1TCAA 1SFRA 2D1QA 4NDNE 5JC1A 1MA1A 3AR2A 4Q6BA 3MJFA 4JXJA 1ZM3A 4JP3A 1T43A 1HDYA 2LR0A 3P32A 2EZ9A 4NLLA 3CVYA 4D7TA 1BNCA 4WY2A 4QYMA 3NIBA 1S3GA 1SH7A 3T7KA 3R3XA 3D9QX 4HG2A 1UJCA 3BF7A 1FXWA 2JK1A 3JYLA 3QMMA 3F7VC 4EJ2A 3RJ9A 3SJBC 4OPHA 1XQ1A 1S3JA 1JR9A 4DXWA 3WFVA 4FLVA 2VL7A 1FDOA 4D41A 1OXKB 2B3DA 3EQ6A 2GPTA 1FDSA 1PFYA 4MAMA 5CNJA 5J2UF 3WJ7A 2PGNA 3OU2A 4MVJH 3LSTA 4XGKA 1Y33E 2FPWA 2HRBA 4EMSA 4IS2A 2RGDA 4BEBA 4YUZA 1V5EA 2OYSA 1DKNA 4IKEA 3I9V6 1J09A 4C8EA 1E2JA 4LJRA 3NBMA 1A96A 3QFCA 4FMBB 2QAGA 4YREA 3GW8A 5CGQB 5JNRA 4QT0A 4B3MB 4ETNA 1K06A 3FDFA 4WEOA 4M99A 3F1LA 1CY8A 2O0LA 3VR3D 3I9KA 4BIOA 3FUTA 3O8OA 3PVCA 1NT4A 4KWCA 1GNRA 3JAMM 4HUTA 1VLMA 1LF0A 4UNIA 1YA4A 3NK7A 4KU4A 3F7YC 4GHWA 4DC9A 2BFCA 1CK2A 2JEZA 1SCKA 1ZINA 2IJJA 3OG9A 4V02A 3E0XA 1ABEA 1SKQA 1NV8A 3I04M 1Z73A 2FUNB 5EAIA 2HBYA 4FJ1A 2V7UA 3Q8KA 3FIUA 5LQMA 4BATA 4ZQFA 1PNMA 1SG0A 4DV4O 1KOLA 1W88B 3V1MA 2UYOA 3EFBA 1PZHA 1NE2A 4Q3BA 1MPXA 4YRBA 3QI7A 1CFZA 1Z4QA 3VV3A 1BXZA 1CQIB 1Z8DA 4WV3A 4Z9BA 2Z0MA 1ZUWA 4B3GA 1VARA 3K5MA 2CXNA 2NZWA 1DJNA 4XIJA 3Q6IA 4OGLA 4MRAA 4BVGA 1EP9A 2X1VA 3THYB 3CO5A 2YWCA 5KYYB 1LS6A 5KNCA 2GZ1A 1XAIA 1VZ2A 1ND5A 1WF6A 4GLLA 2CXOA 3KZOA 2CBXA 2W2LA 1GKYA 3ZHRA 3OCYA 2XY4A 1WB6A 2HJDA 3AJ8A 4I9WA 2ZR9A 5AW9A 3B6MA 4X7BA 3G9QA 3BMQA 1I2DA 1O94A 4BKRA 3T1YB 3U0VA 1XJWA 5ALLA 3SIPA 2BFOA 5DGHA 3DQZA 2JJ1D 3DV2A 1FU4A 1U7TA 3SYNA 3DV0A 5JH7F 2CHFA 1EVIA 2V7EA 2X8WA 5BN4A 2R7LA 2EG9A 1CVRA 3LO8A 5C8YA 5I47A 2WIFA 3LC0A 2B4QA 4PVDA 4C2BA 1T34A 4CYMA 4B3RB 1G63A 2D74A 4R1TA 1DMSA 1W36B 1KGDA 1T9GS 4BX2A 1ISJA 4QU0A 1XUOA 4NWIA 4LE0A 2C7RA 2HGZA 4M49A 3AUSA 3OX1A 3TJRA 1NQ5A 4YJHB 2NNUA 2WM3A 4E4RA 5GV7A 3FHOA 4CT0A 5C8ZA 1T6NA 5AW0A 5G0TA 4YMGA 2HXYA 4RCVA 3MWGA 1Q44A 4JGBA 4WOJA 5FBLB 1E3DA 4A8TA 1DBIA 3LWRC 2I3ZA 4C07A 2R6FA 2NACA 3JVHA 2W8ZA 1DTWA 1UC9A 1VQLF 4XD2A 3UW1A 3DNMA 2JBWA 3W5VA 3UWOA 4IIJB 1OGIA 1D2MA 4B6GA 4C4PA 4NATA 2GF9A 3TD6A 4BB9A 4BZPA 2JKVA 2FK7A 3CF2A 3BD8A 5CJJA 1WUJS 2QUJA 2JIOA 4NBSA 5H2FZ 4FE7A 3IUBA 1DQSA 3PT5A 4L9RA 5JRJA 3BHJA 5DB4A 1TM4E 4I9HA 4WH0A 1ID8A 2YVKA 1OB2A 1O0CA 3LX5A 1VQLV 3RSLA 2OZVA 5EIWA 4Q21A 5EP3A 2GOYA 3GH3A 4IGFA 3P4YA 1LUWA 1KL7A 2X6TA 4Z51A 4CEHB 4CCYA 4UTPA 1GG9A 4JJZA 1Y5RA 1I7QB 5J4LA 4KHZA 4P7GA 1SXIA 4QSMA 2QM3A 1VYHA 2GAIA 2IX3A 3WGHA 4M83A 3K8QA 1WZCA 4EUNA 4W8GA 4HJXA 4MR7A 5ITZA 2P62A 3CRQA 1NFFA 4L78A 2WJHA 4KPFC 5LC1A 5J2TB 2O23A 5FI3A 3TLXA 2QX6A 3J81A 2P7TC 3E5NA 3NHFA 1JG1A 4XDGA 5DXFA 3GTZA 2NU7B 4JI0O 1U31A 4QDZA 4PNHA 1FFAA 2ZDGA 5F7XA 4RVDA 3AVWA 4RUFA 4EJSA 4R7GA 2EQ5A 4FHFA 4BVAA 1I80A 4EI2A 5FOUA 3GLFB 4BLSA 4ZT6A 4L0QA 2PYLA 4I4TB 4BZWA 4B75A 1HE5A 1P8AA 1KZYC 4JX9A 2E1RA 2J0UB 3E1YA 2ZDQA 2QLJA 1PFVA 1C30B 1O95A 2CNBA 4YA6A 2Z0AA 4RZIA 4D9BA 3ZHBA 3BQ9A 5C3MA 5JSFA 2NX2A 4NABA 2C2GA 2XEDA 1VQNF 2SCUB 1FD9A 3PRYA 4RHFA 4ZYLA 1KFEB 2DHEA 2QM0A 1RVDA 1NY6A 2G1AA 3MFQA 4QOEA 3OSUA 5GIOC 3DQPA 1TQ6A 4D26A 3E2IA 4OL9A 2WPDA 5L45A 3TX2A 4ZVNA 1QC5B 1SOAA 4M0CA 1MNGA 1RRVA 4EPTA 3ZMZA 1AUVA 3STLC 3H7AA 1G60A 4UEQA 3R0QA 3KHUA 3IVAA 1VE3A 1NURA 1YIJF 4I7EA 4JLDA 3I01M 3ESQA 4GMFA 1P1CA 1PIWA 1XE3A 2Q46A 4CBVA 3AMVA 1I0IA 4B45A 5JJIA 4BLRA 4KMOA 4H1WA 4JI4O 1NU1H 4EUHA 4PQYA 4IHJB 4NG4A 4YGXB 3AOGA 1NBME 3JAKB 4DLBA 4Z2AA 4MUMA 4TXJA 1BHAA 3AF0A 3BL6A 5DNYB 4IRUB 2WHYA 2Q0XA 3S02A 1YHQV 2C5LA 4DS3A 1XMSA 1XRSB 1A4XA 1QDEA 4GPD1 3DVAB 1JU4A 4C0KA 1ZUHA 3L77A 4PM4A 5DBGA 2HA6A 2AG8A 2VQEO 2R4UA 2OBXA 2OFXA 4R2HA 1TTHA 3PVZA 1WDWB 5KTYA 2YWEA 2F1IA 1SUDA 3OX2A 2EBOA 2X5NA 3A6KA 4JAAA 4LOHA 2B5WA 2OMEA 2NV2B 1L6IA 4B3BA 4S2UA 4QBTA 2YH2A 2JIZA 5BSUA 5LQUA 2AOUB 1YC5A 3LZCA 1G3IA 3IKMB 1WR8A 1I9GA 2AKEA 4A1OA 1WAMA 1A72A 3RFCA 2WSSA 2VBIA 5EMMA 4HWTA 3VNAA 2HR3A 4KVZA 5LMUB 1W4BA 5JU6A 3SIUA 2WU4A 2CXUA 3E2PA 2JLAA 2GSWA 2OV8A 4B6JA 1QQ7A 2QL9A 3RWOA 5DHFA 3ZHUA 3ST7A 4JL5A 2ZSFA 4NOMA 4A4DA 2X58A 3K1YA 2CCJA 3OZCA 3WO1A 2YHSA 4KDEA 4PBRA 4CIWA 2OPHA 3TX6A 4I1RA 3KJXA 1BQ4A 5C4MA 4W9MC 3VO8A 1CS0A 2VSXA 5F2NA 4LDRA 4J0CA 3WGIA 3V4RA 2XDYA 4IW3B 1IVNA 4WKCA 4DKXA 4KR3A 4JYAB 4GR4A 3LT0A 2CYAA 3B5IA 3P0EA 1B1CA 3AI3A 2B94A 2O7NA 4Q4HA 2AZTA 3SM9A 5LLDA 4Z3OA 4UDOA 1RMTA 3RIXA 3CJHA 3RHZA 2YUTA 1FNNA 2YW9A 3RCBA 1C9KA 3L7MA 3AVUA 2FRDA 3W2TA 3K0EA 5IJWA 3G6BA 1PVVA 1SUWA 4X8OA 1KY3A 2WKPA 1Y5MA 1NY5A 2O1WA 2BVNA 4TV9A 1PT6A 2ZBRA 1QHYA 3O47A 2ZIMA 3VR3A 2W2VA 2W6JD 1U8UA 3W5CA 4LSGA 3INYA 1L0NH 5HIMA 3M34A 2HLDA 3LWZA 1O9HA 3OWOA 3UK1A 2E82A 2XGOA 1HYEA 3II6X 4BJ5A 3QZUA 3C9TA 5INTA 4N12A 1DEOA 4O2BA 3BFKA 4G23A 4MAFA 4WI1A 4RPIA 4TVBA 4EFMA 5SYMA 3RJMA 3ROXA 5LHIA 2GAAA 3I3OA 3OUZA 1O96A 4RLHA 1E61A 2AW3A 3D36C 4X91A 2A78A 3DEFA 3WE7A 1Y8QB 4A8HA 4DUYB 1OX6A 2Q3FA 1Q1NA 2N04A 2BGJA 4J7CA 2OBLA 5F51A 4C7UA 2XGGA 1GOTA 3R7WA 2WYWA 5EPUA 4WADA 1C2YA 4RAIA 4G6ZA 4EHJA 2YCLA 4MWTA 3OCZA 2AIFA 4D9EA 3PUVA 2DFDA 1EINA 1V1JA 4MVJE 1GZDA 2X5KO 3ETQA 2ZJBA 5LBIA 2VHEA 1NN3A 3CYQA 1CD5A 5TJHA 3FPCA 4UBOA 5BQXA 3RR2A 1EXDA 2RAPA 1JJAA 1F12A 2V0NA 2V7PA 4H13B 1DC5A 3O2SB 3P0IA 1R8YA 2XCQA 2D7JA 3E8FA 4BBZA 3KKEA 1H8EA 2ZFUA 3GJ5A 3GOHA 3JQ7A 5EHQA 2NVUA 2HSGA 3G49A 3TIXB 5G0VA 3RC8A 4UB6Z 2IIVA 3MRSA 2CXPA 5BQ5A 5CFQA 4QGSA 1SR8A 1L8QA 1RAAA 2Q3HA 1Q0QA 3SQLA 1LWNA 3SNHA 1MGOA 3HR8A 2P2CA 1KNJA 4KXXA 2EJTA 5A6SA 2VUTA 1PO7A 2WF8A 3CINA 2YV4A 4D42A 3FH0A 3K14A 4NNJA 5BW5A 3NTUA 3E20B 2DPLA 4QE3A 4AROA 1W5EA 2MCFA 3WL5A 3GJQA 3RWBA 3FYTA 1V54B 1KIAA 3L8FA 1PJAA 1E1RG 2JJ8A 2X4LA 3ZNQA 2HP0A 5IKPA 4Z6KA 1GMGA 2M7WA 1C3OA 1YJ9F 4BUZA 3MHSC 1KJZA 5ALUA 1M0SA 4G81A 1YZQA 2BT4A 5I7HA 1OAOC 3KXDA 2B9EA 2IF0A 5FP0A 4F1KA 2QT0A 2VHTA 1JXAA 1JIKA 1J5EB 5JCZA 5CU7A 4EIWA 3RTCA 2F90A 3E7XA 4GMGA 2WWVD 2CDAA 1TJNA 1IY2A 2D2XA 1R16A 2JW5A 4X7RA 2FV8A 4BFSA 1IJFA 4URUR 1S72F 2AN3A 3FOAA 4CQMB 1YJ9V 4NAHA 3TCNA 1L5YA 1H6BA 3HS3A 4N41A 4YECA 2OE2A 4ALNA 3T12A 1FYWA 3B7PA 1TZCA 1M34B 4JJ8A 4FWTA 5U1PA 2RHWA 1Z63A 1YRLA 1FFYA 3OU7A 1HY3A 4FDLA 5FTKA 4L4ZA 5DYIA 1JWAB 4TLAA 5JNTA 3ZTTA 5E1BA 3SFVA 4Q19A 3AKYA 3OZGA 3JQFA 1CP9A 1T8TA 3ASNC 4F6LA 2Z95A 1Y6GA 4PI2A 3ZXXA 3ZYZA 3Q7IA 4LFBO 1J2TA 3ZWYA 3JCUZ 3BHPA 2LGQA 5FPRA 1FRVA 2C3OA 2PGIA 3PQ5A 4MV0A 1C4KA 5C35A 2OB1A 2YY7A 2HPVA 4BFYA 4HLUA 1X13A 1C9DB 4PHTA 1QE3A 3UG6A 4E94A 3G82C 2FFBA 2CNOA 4MYDA 3P2JA 2DBRA 3OM3B 2OO5A 1YVPA 2B1QA 1QVWA 2IV2X 4FZ0A 5KYUA 1V55C 4F84A 1NFQA 1R1MA 4XFDA 4LXHA 1QGED 2QTVB 4K5QA 5F33A 1ZLYA 3QNWA 5IZ4A 1BW9B 5B1DA 4YUXA 3OZDA 2EBFX 4AG5A 3H13A 3VJLA 3EG5A 1VQ1A 4GC9A 4EF4A 4DA8A 4EVSA 2I0FA 4KV7A 2V65A 3N0TA 4UTVA 2P30A 2CK3G 2CV2A 4PS0A 4R9VA 1PEAA 4LHZA 1MO3A 2CLHB 1T0JB 4OOFA 2A0UA 1DAGA 4NBWA 2FEAA 5IMBA 3KYCB 3IV7A 2MWMA 4X84A 1TKRA 3LJKA 1P62B 2G5CA 4JZ2A 2PZJA 3W6NA 3BUSA 1O97C 5KOHB 1JG7A 2RC5A 4WFJA 1MB3A 3G9XA 1NL3A 2ANBA 4AICA 5BSWA 2FEKA 1BOFA <