5ITZB

Crystal structure of the sac domain of cpap in a complex with tubulin and darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
420
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNAKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Centriolar CPAP/SAS-4 Imparts Slow Processive Microtubule Growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 172
structure length 420
sequence length 430
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5itzB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5itzB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5itzB01
4TUYB 3VPAA 4TV9B 5LOVA 4O4IA 3RB8A 3HKBA 4LNUA 4F6RA 5JH7A 4TUYA 1W59A 4B45A 4TV9A 3WGJA 4U39A 4O4LB 1SA0B 4X20B 2XKBA 1FFXB 4O4LA 1SA0A 4O4JB 3RYFB 5LA6B 3ZBQA 4X20A 5JCOC 5MN4A 1FFXA 1W581 3JALB 3VOAA 5C8YB 3VO8A 4O4JA 3RYFA 4E6EA 4EI9A 4TV8B 4U3JB 3N2GB 3JALA 1W5EA 5C8YA 2XKAA 5M7EA 2BTQB 1TUBB 4TV8A 4U3JA 3N2GA 4X1YB 3WGKA 1FSZA 5J2TB 4M8IA 4ZI7B 2BTQA 5JCOA 1TUBA 4O2AB 3HKDB 3JARB 2RHHA 3WGNA 4X1YA 1RLUA 4DRXB 5LYJB 2Q1XA 2RHOA 5J2TA 4ZI7A 4O2AA 3HKDA 3JARA 5IJ9B 3ZIDA 4DRXA 5LYJA 3R4VA 5EYPB 5IJ9A 4ZHQB 5JQGB 4YJ3B 5EYPA 3JAWB 5CB4B 4ZHQA 5EZYB 5JQGA 4YJ3A 4YJ2B 1JFFB 3JAWA 3M89A 5LA6A 5LP6C 3JAKB 5CB4A 5EZYA 3JATB 5J2UB 1JFFA 4IHJB 3RYHB 4YJ2A 3JAKA 5FNVB 5ITZB 3JATA 5BMVB 4IHJA 3HKCB 3RYHA 5J2UA 2GVIA 4EI7A 3RYIB 2RHLA 4I55B 4I4TB 4DXDA 5MN6A 5ITZA 1OFUA 5BMVA 3HKCA 3RYIA 5IYZB 5MN5A 4I55A 4I4TA 4XCQA 2RHJA 4KWEA 3E22B 5IYZA 4HNAB 4X1KB 5KX5B 3C8LA 4O2BB 2VXYA 5GONB 4ZOLB 3E22A 3JASB 4HNAA 4X1KA 3RYCB 3VOBA 5JVDB 5KX5A 1W5FA 3V3TA 4O2BA 3CB2A 5GONA 4ZOLA 4EB6B 3JASA 3WGLA 3RYCA 3HKEB 2R6R1 5JVDA 2VAWA 5LXTB 3WGMA 4B46A 4EB6A 2VAMA 5IJ0B 3HKEA 2VAPA 2R751 1W5AA 5LP6B 4WBNB 5LXTA 3N2KB 4FFBB 5FNVA 1Z5VA 5IJ0A 2Q1YA 3ZBPA 1TVKB 3M8KA 4X1IB 5EIBC 5LP6A 4WBNA 4IIJB 3N2KA 5EIBD 4FFBA 3VO9A 1TVKA 4X1IA 5CA1B 4IIJA 3UT5B 4O4HB 1W5BA 4I50B 5KMGB 5CA1A 1RQ7A 3UT5A 5CA0B 4O4HA 3HKBB 4I50A 5KMGA 5LOVB 4O4IB 5CA0A 1RQ2A 2BTOA 4EI8A 4LNUB 1Z5WA 4F6RB 5JH7B
chains in the Genus database with same CATH superfamily
1W35A 4TUYA 2VQFB 1PRYA 1E9RA 2YWCA 2PD4A 4HXEB 4DMGA 5GGXA 3ACCA 3EQ7A 1OXUA 5AUNB 4WNYA 2DHQA 2ZYAA 1EDOA 1BYIA 1GOTA 5I51A 2HH9A 4ZOEA 4AY3A 4F8EA 3BVOA 2ZUUA 4HTFA 1UDXA 1WB6A 1ZK0A 4FHZA 5EJEA 4CMBA 4J49A 1PR4A 1Z45A 3CCMV 1P2SA 4Q9NA 1G8MA 1T6BY 3KSMA 5AI0A 3IDOA 5T6MA 1LC0A 1Z47A 3TYXA 2EKDA 1WA8B 4FX5A 1MAHA 2C97A 5KYKA 1FRQA 1WCXA 3HXLA 2QYSA 1FFGA 1R8YA 4BOYA 2BF7A 4RHTA 5I8ZA 3RAGA 3V1UA 2JEUA 3CYOA 2UXCO 5H02A 1JJIA 1RM4A 4PDLA 1U5BA 3KFLA 1JIXA 1YR3A 4URZR 4QU5A 1DELA 1Q95A 1QAOA 1SBQA 4A3SA 1QM5A 2B30A 5GONF 3EZNA 2QLNA 1ZUD1 4ZT4A 2X9LA 3QU5A 3PF8A 3JQ9A 1TMKA 1T1JA 2ZYSA 3AK4A 1A77A 1G1XB 3RRYA 2EATA 2CB9A 1MJFA 3TGLA 3V7FA 4PAQA 1VQ5F 4XWYA 1FQKA 2KW5A 2J6HA 3RAJA 4AILC 5LBTA 4QM6A 2XWSA 5K8IA 4RHAA 1KQSF 3RK1A 5H16A 2Y4UA 1B0ZA 4JP2A 5EKDA 2IYYA 1W1UA 3VPGA 4NMXB 1ORHA 1NUSA 4M53A 4R9RA 1IDN1 3FHLA 2XZOA 2G0TA 3D8NA 2BGLA 4KE8A 5GP1A 3WIOA 1IRXA 5AKEA 3W7TA 3LSYA 1PV4A 2ZI9A 2CJWB 3LNCA 5FBQB 3EGVA 5H82A 3L0ZA 4K86A 1FUUA 2XY4A 1YJQA 5L4LA 3JVVA 5T67A 2VFAA 1O95D 1PPJH 3T34A 3PXDA 3NX4A 1EFAA 2CCJA 1GNRA 1KYYA 2A57A 1RPZA 1Z7YA 4BIIA 5J4VA 4GR4A 4D4LA 3MRSA 2P0YA 1B23P 1CEZA 3D0RA 1KDZA 4IOLA 1VL0A 5T4EA 1GZ0A 2XADA 3REQB 1IUNA 3K5HA 4A6EA 2ZE7A 1ABFA 4JI5B 2G9UA 3O95A 3G3EA 2YY7A 1NVVQ 1I32A 3IMGA 3BD7A 1U3DA 4GP6A 2O3SA 5K1ZA 1WXWA 2G06A 1UXGA 5IJXA 1QRAA 4FFBB 4Q20A 2DBRA 2CEKA 5K3BA 2X1MA 2D1FA 4PZDA 1R18A 4Y2UA 1KOGA 1VQVA 4NJEA 4BB9A 4C3OB 4FYIA 4J9YB 3HB3B 3VTFA 4BO0A 4K46A 3WIUA 5EFOA 3ZE2B 3ROMA 3VQTA 2J3EA 4QX6A 3LA6A 5KTPA 1KVSA 1JU4A 2FSGA 2Q8PA 4HDKB 5D7NA 1TZ2A 2PX2A 2MYPA 1I3MA 1TQHA 4FYPA 1RFGE 5M34A 3DB2A 3UJ6A 1IOZA 2JFBA 3HDQA 1S8OA 3QMWA 4K35A 3M5WA 3OKCA 4X9QA 5L6LB 4DNFA 5GANK 3CYPB 4HWRA 2OCCC 4QXQA 3QOWA 4DGQA 1Y8AA 2ZDGA 3HWSA 4JJAA 1NTOA 1T9AA 3CG6A 1FQJA 5I9SA 1GXSA 3KO8A 4JI3B 3CVJA 5KYUA 4A6DA 4S12A 4LF8O 3MOGA 2QI9C 3UJDA 2CHGA 1AI6A 1PT7A 2ERXA 1C9EA 4DCOA 3PNPA 2G04A 3EIOA 2ZM6O 1EVKA 1Y63A 1TADA 5E79Z 1CUFA 3ONDA 2Q7HA 3HXKA 1ORRA 4Q93A 1DKUA 1WB5A 4FLXA 5AVVA 2MJLA 2OHHA 3RK0A 5FTKA 4D9CA 2HQSA 1ANKA 1TA4A 3L46A 4NARA 4I8IA 1ZXBA 4I1RA 4OA5A 3HN6A 3DC7A 4PPYA 3LYBA 3UEOA 3W5IA 1FXKA 3CUEF 4R40A 5K2MA 3Q0IA 4HAVA 3IKEA 1KAQA 1XZJA 3I9JA 3MS2A 1MLDA 2MSNA 5TGDA 1WAZA 1RCTE 1LI4A 2YWJA 5CR9A 3K1ZA 5HBRA 2JATA 4XUDA 3S7ZA 4JI0O 3UANA 1NJSA 3LHSA 4ITUA 4J1QA 2G38A 1DWUA 4ARUA 2A0WA 4ZZ2A 1VQNV 2HQSC 1B0UA 3OE7D 1AKVA 4ASUA 2F3SA 2V6GA 1JH8A 1PDVA 2DTXA 5A9SA 4ND8B 3RSOA 5LZ2A 2FW6A 3A1NA 3IQHX 2HLPA 5AT1A 1CJUC 4NTWA 1W6RA 1FXKC 4GYWA 3HCFA 4RSHA 4EEKA 5C53B 4MT8A 3UV7A 1Z22A 4TZKA 4FJCC 1ZRSA 2ITCC 3TTXA 5FUVA 2JJ8A 1JG2A 4DY4A 4PTZA 1VEWA 2YZ7A 4PIVA 4FMTA 1ODLA 4AMUA 5JRZA 4BVSA 3SYCA 1JEAA 4ZKDA 4MV4A 2PRJA 3C1AA 2BR4A 3HR4A 4IJ6A 2B78A 1G7TA 3O4IA 1NW4A 3EEYA 4DBLC 5EHZA 2PI4A 1J4AA 1KBOA 3IS3A 2OT5A 3L7IA 2P4KA 2V3WA 3EA5A 2X8JB 3FHCB 3FDXA 2W2LD 5GTHZ 4QUGA 1JA8A 5HK9A 1EZ4A 4DREA 2H4XA 1Z0SA 4O2AF 2HWXA 3ZLTA 1U3PA 2VHTA 3JWGA 2WINI 2FZLA 1T4CB 3R41A 3OEED 3C8UA 1VG8A 4MV6A 2Y48A 2G5CA 4XVRA 1EEXB 3L75H 1Q1QA 2D0PB 1ZBQA 4I3GA 3EW7A 3D3WA 5BMVF 1FU8A 2QTGA 1AP6A 1WTCA 3O8DA 4MR8B 1HETA 1FRVA 4MUHA 4RPKA 3J80N 1P5FA 3AI3A 5AOCA 3QG1A 4W4KA 5H9WA 3GCXA 4BQRA 3ND8A 4ZAZA 3A9VA 3CHXA 4LY6A 5MGBA 1STOA 4MRAA 2YUTA 1SC5B 4HDNA 5KNDD 1BJRE 4G2NA 1ZN8A 3UG6A 2OHVA 1UBLS 1IWOA 1H69A 4IUYA 4XX1A 2DPLA 5LWQA 4LMBA 2WHRA 2JJ2D 2J9YB 4NWOB 3CJQA 2VP5A 1VE7A 2V9CA 4DOMA 2H7YA 1ISRA 4N3NA 3CC8A 3RLFA 2BYTA 3K4HA 3LX8A 2ACVA 3TEJA 5I9BA 1GLNA 2PYZA 4UNNA 1W2WB 1P5JA 3KQKA 4C0QC 4XTCS 1IB0A 4BKOA 2Q7DA 4P31A 3ZRWA 2QRMA 3CONA 2ORYA 1VGVA 2NU9A 3WRVA 4GF5A 3ZDQA 3LOUA 1YQUA 3BWYA 1U2PA 3IHWA 5E4TA 3SEFA 1HSOA 4W7SA 4EGJA 3F9CA 1UP6A 5C81A 3IV9A 2VYQA 2Q9AA 4AX4A 2IJGX 1MA3A 2NYUA 2Q1XA 2WLHA 1QP7A 4K88A 4UOZA 3MCWA 4BO5A 2BY4A 4YY3O 1YZLA 3JS5A 2OLJA 3ECCA 4J8PA 3AKDA 4HADA 3WTBA 4WLFA 4L51A 1LBEA 1VL6A 2VSYA 1RJWA 4LRQA 5A2GA 3FCYA 2H1VA 1PD3A 1KO5A 3HVRA 1PVOA 2ZI5A 1Y6GA 3NTRA 4EG1A 3W5JA 1KFBB 3CKKA 4DAEA 3OT5A 1KZ7B 2WSSA 1HEYA 3MQFA 5GM1A 3FCUB 2XQKA 2UVDA 5HBGA 4H44B 1NXSA 4CDMA 4O4HA 1YZHA 3AR2A 1AD2A 3FYDA 1OH7A 1JR6A 1CUZA 4I9HA 3V5NA 3GZNB 5LUBA 4RKRA 3G9XA 3NYQA 5AD1A 4HN4B 4M76B 4J2TA 3WDMA 3ESXA 3ZWKA 1N2HA 1AY0A 5JDCA 3WAJA 1E5QA 1H38A 2IZ5A 3ZWDA 3L1HA 2AF4C 1UFOA 4NZYA 1ISHA 2WVHA 2R1TA 3IAM6 1MOPA 2FYTA 5DBHX 5EE3A 4EJFA 3NBMA 3K5WA 6PFKA 1BC5A 1FEZA 3BXZA 2IH1C 2EEPA 2J4DA 1DE0A 4D6PA 5AK6A 3P20A 2GRUA 1ZM2A 3TD4A 2OGWA 1VF6C 1NY5A 3H8VA 3PT9A 3C3DA 2XDQA 3F3KA 4RNDB 1PEDA 1BQ4A 1VDMA 3NHKA 4OUDB 3FB8C 1A97A 3F78A 4C29A 3UAYA 4XUGB 1Y0BA 1NW3A 2HU8A 2JEZA 2QKSA 2PZBA 5KO2A 1RKVA 2QRVA 4Q4CA 4JASB 3I7TA 3PWZA 4C08A 4KUEA 4MQ5A 5EAIA 3I4LA 1YNOA 2HG5C 4LCEA 4HMOA 4OH7A 1WXXA 2ZG6A 3CUKA 3KLOA 2F8MA 2CDCA 2FP4A 4R7CA 4HB0A 3ESRA 2YS6A 4ZKIA 4N3AA 3ZRVA 2B5WA 5BR8B 1RYFA 4RK0A 4JL6A 3URMA 4RLSA 4XTRA 2GM5A 4BQIA 3MTEA 1IV4A 2ADQB 1Z9BA 1SELA 1Y7TA 4GGPA 2V0GA 5K45A 2E49A 1OAAA 1X7ZA 2I7VA 3QHAA 1S76D 4CN8A 3V3TA 5JIBA 5IUJC 3E9YA 3DV0A 1L1FA 1W46A 2VDMB 1YL7A 3WLIA 4Q19A 2PYJA 3FKSA 1TGOA 1SH7A 3C8DA 2O2IA 4R69A 3V8QA 2VF2A 4TL6A 1PBNA 4LNUB 4NK5A 4KWIA 3CRW1 1CEEA 1ZOOA 1JMVA 3AY6A 1GTL1 1NBIA 2VTEA 4FD2A 2AK2A 2AOTA 1P2UA 1FMJA 4WK0B 2YV5A 3MF4A 3C3MA 2JNWA 2R8YA 3L79A 4M98A 4IUCS 3EQ8A 2FKXA 4Q02A 1YU9A 2H4WA 2IJIA 3IEXA 2WSLA 3CVOA 1IG0A 2RHLA 4DXDA 3RHFA 2FWPA 1GUAA 4HN9A 3NMUF 4TOIA 1Z6XA 1S3FA 4CZZA 5CUQA 1OSNA 2BGRA 3LI2A 3V4RA 2RHCA 5T7BA 3H1LH 2PGIA 5REQB 1XCPA 3UYKA 1Q7EA 1OLXB 2JLXA 4FYJA 1J8VA 2BGIA 3MWDB 1QQ7A 2OAEA 4HGYA 2WRZA 1D6NA 4WUTA 4ASUG 2G9IA 1Y1RA 5ITWA 5HP7A 4WACA 1BZYA 1J6UA 2CVOA 4GPAA 2WLKA 3UYLA 1X13A 2IZ6A 1AB3A 4Z9XA 4R16A 4NFYA 1LXCA 5AVQA 1W75A 1XNQB 3W8EA 2XCUA 2P4UA 5THQA 2XKAA 3TQFA 2KX7A 5COQA 2ORVA 1EVJA 4CC6A 2WM2A 1VJRA 4BP8A 3K32A 2PHZA 1M8GA 4ER5A 1GRCA 1XQXA 4MS4A 4BGEA 1DTWB 3W2HA 4MB2A 3HN7A 2XQJA 1Y7LA 3EBLA 1JKJA 5I7UA 4UCSA 3QKUA 4BB5A 3D3NA 2H9AA 3L77A 3L7YA 5CG1A 3DBRA 4OJYA 4GZLA 2B1GA 2P1ZA 4MROA 1Z8NA 4MLDA 1G16A 2GLUA 4WBSA 5JCPA 1KH2A 3A0BZ 3UB4A 2GZ1A 3AJAA 4OB7A 2AV6A 4JB2A 1ABBA 3GLFB 1NP7A 4CNQA 3HCPA 4R8VA 4FZJA 2O0MA 5HZGA 1RM0A 3ZK7A 3ELDA 5GVSA 1KQ3A 4ND7A 4JENA 2XQVA 3UUGA 3H04A 2YYEA 3GRCA 2QRHA 4NESA 3CLSD 3QFRA 1YB5A 1YFLA 2Q69A 1NVMB 2CXSA 5FNZA 2YDEA 3JQCA 2A5LA 1GCIA 2OFFA 3GW8A 3HEAA 4GL2A 4RTKA 4DMCA 3N0WA 1NJ5A 3TX2A 4MV9A 5DSTA 1EN4A 2LQTA 1JZQA 1WMFA 2OG1A 3X0DA 3PHCA 4A2WA 5AO9A 4DWWA 3SPGA 4UOEA 3QWBA 3ZDCA 4F9TA 1IX9A 4IGKA 2NZXA 2F67A 2Z4SA 2A2ZA 3E2EA 1X9IA 2LGWA 1YZTA 2GZ3A 1V0JA 3SE0A 3RVMA 4KQJA 2KM1A 3I6MA 4MAFA 3CP1A 3B1JA 1WB9A 2CCKA 4BX3A 1MOSA 1N36B 1BH6A 2GF9A 3K9LA 3OBYA 2ZR9A 4FFPA 2KG7A 3ZMTA 1KFKB 2H3HA 2XDAA 2JVKA 1O96A 4RL4A 1ZXLA 4FVMA 5KDOA 1JE1A 1G5FA 3MEQA 5MFZA 2ARKA 4WCVA 4JBXA 1D07A 3LUGA 1RCUA 1ZRMA 4ZI7A 5EVJA 2J0UA 3P9RA 3I6BA 1O94D 4P7BA 1KY2A 3VR4H 4QNHB 4KI7A 4NR0A 1ESEA 1NMQA 3CO0S 2JGLA 3W7BA 2VP9A 4DV3B 1NVEA 1KI1A 1GFIA 1V54C 4TZ6A 3JRNA 1R16A 1ZVKA 4IHKA 3LKZA 1U4NA 3HKEB 5EPOA 1F2TB 2E3JA 1KZ1A 1R4NB 1SVWA 2HVYD 3ROGA 2J8ZA 4PSUA 2CZCA 4AO6A 3DZDA 3RT3C 4G65A 1PGOA 2OHOA 2A78A 4I1YA 4H0NA 1IEQA 1ZBDA 3I01M 5HJEA 1CQIA 2WSSG 1ONNA 1LU9A 3GJ6A 4RAOA 4G63A 4M9ZA 3LO8A 5IBRA 1CK4A 1W0CA 2P6PA 4F6RA 2RB5A 2NSYA 1HUQA 3IR6A 5HYVA 3OCYA 3L71H 3E9CA 5BSTA 2N48A 4Y1RB 4RH1A 1U8XX 1SUWA 4UM7A 3RRBA 5H5NA 1RHJA 2IYLD 3LUFA 4JMLA 2DR3A 2HXGA 1P72A 3DXRB 5DM4A 2B1RA 1COWD 1JQLB 2D5CA 4L22A 4PFQA 4IUBS 2DU8A 4PYNA 3NT5A 1T3SA 5DH9A 1RKXA 1VE5A 3GYBA 4JLKA 2JAPA 4BXOA 4KWCA 5LD2C 3X1KA 1M1KH 2OO5C 5KREA 1KJYA 4QDKA 3G9QA 5JZ9A 3M6AA 1JAYA 1OYOA 3OZRA 4UCRA 2Z3WA 3BCSA 2V96A 1M67A 5E2IA 2JGEA 3V80A 1UOOA 3UY4A 2H1IA 2ANCA 5BSKA 3EDCA 2IKSA 3CX6A 3ABIA 1F6BA 1G0NA 1IONA 1G2OA 4QIWF 4LI0A 1E1DA 1CFZA 2XTMA 2C7GA 2V9ZA 3VPFA 3TR6A 1V6CA 4FLEA 5L7WA 1UAAA 4FEGA 2C7PA 4R1PA 3EPRA 4KZKA 3GJRA 2R00A 2C2MA 5TMEA 4LISA 5TIIA 2NLJC 3W04A 1GN6A 3Q7TA 4JTCB 4P84A 6Q21A 3HJUA 2BDEA 4XCQA 2YIBD 1J49A 4F4HA 3N58A 1MHPA 4KQFA 4BNKA 4XRGA 4WBNB 5JSZA 4MZDA 3Q10A 1C9JA 1YI2V 1RBZA 1VSQA 4ZI5A 2VATA 4PG4A 1CLUA 2OD7A 4GMXA 4KQXA 4A6PA 3FKSG 2K1EA 3S0JA 2HEPA 5FFNA 3TMYA 3K05A 3VJLA 3MTBA 3S8MA 1T15A 4RM3A 4MJ3A 1LRJA 3K72B 5JSKA 4J7CA 4BO6A 1U1FA 1VJCA 3IMEA 5F3DA 3TKLA 1I6MA 4MTOA 3NEPX 1WQ4A 4JOBA 4FZRA 3DLPX 1F4PA 3R4VA 2DTDA 4E5SA 3WHLA 3R66A 5JCXA 4C20A 2O6LA 1KK0A 4WLVA 3GNQA 3NI2A 2OTJF 3I92A 1KEEB 2F3RA 4JCOA 3UO2A 2FZEA 1Y33E 2ZVQX 2XUGA 5EPUA 3U4GA 4K3AA 4CF7A 1M1ZA 1F2DA 4DIUA 2VR1A 1AVMA 4BO8A 4R2JA 4CCSA 3RFTA 1SWWA 2HQRA 3HC7A 5JXIA 3O8CA 1VCIA 4QOGA 2PKEA 3DDHA 5EIBD 1MABB 4FGUA 2B8NA 4F96A 1NVXQ 1Y4MA 3RWBA 3BRQA 3ZUPA 1XV2A 1YZFA 3U3RA 5JSUA 5ER9A 1RZ3A 2FU5C 3D4LA 3LCRA 3L6RA 2WB2A 1U80A 1WNFA 4MVUA 3MB5A 1ZMOA 1GRJA 4D44A 1XCMA 4YT8A 1AUPA 3ZS8A 4C7MA 3IA2A 3P19A 1G6OA 4ZGWA 2ZPUA 1HSZA 1RQRA 2HRCA 2RHWA 3OE5A 4QUJA 3IP1A 3X2QB 1H4QA 1Q17A 2A8YA 3KYIB 3FKQA 1J0CA 1VJGA 2IV7A 2AG5A 3DTVA 2JFVA 1MAAA 4U7WA 4R1OA 1EDBA 4Z0NA 4BW5A 5JC1A 5F2VO 5FPSA 3ZOZA 1QO0D 3TR0A 2CNWD 4X24A 2BKLA 1BEEA 2RE8A 5LGTA 1P62B 4KAJA 5HA5A 3WJQA 1NA5A 2ZQZA 1RXYA 3MOIA 3I5DA 3DAYA 2P6NA 3B8MA 5DCUA 1P1HA 3FB7C 1NN3A 4FJ0A 5AJVB 1XRMA 3ZS8C 3I34X 2GWHA 2QG6A 1N5JA 5TV2A 1XDCA 4DIBA 3E89A 1H0RA 4MYUA 4ZD6A 1OKKD 2FW8A 4F3KA 3AM5A 5KHJA 2LFSA 4S35A 2IDKA 1OX4B 2NO5A 1LUVA 1GNPA 4DIMA 4AZ0A 1KDPA 2C4KA 1F12A 3SYMA 1ECPA 2V7QD 4QLAA 3WMEA 3NOQA 3BERA 4UKDA 5TVGA 3JALA 2I6GA 2C2AA 3GVHA 4U8HA 4M6WB 3B6MA 3AHCA 5TF0A 3D3KA 2Q3BA 2WR8A 3P5SA 3MZ0A 5I9MA 1TEZA 2ZS8A 3WL5A 2HSDA 3ODGA 1AV6A 4DT1A 1PQWA 1A8SA 5LQDA 3PLAC 4KP4A 2R6HA 2Q41A 2AJTA 1QPZA 3SM9A 1HG1A 1BXRB 4TTRA 4I4TA 3GARA 3TE7A 1PS0A 3PXGA 1XHEA 3I5AA 5AICA 3S2GA 1UKAA 1Y1SA 1E4YA 4A82A 2FEOA 1JFRA 1ENPA 1J1ZA 3UOWA 2HRQA 1BWSA 1KBZA 1BS1A 2PSHA 1SBCA 3KTDA 4H31A 4IEEA 2RGWA 3T1HO 1E99A 3GHYA 3BIFA 5A7HA 5F2KA 4BKQA 2IXTA 3OZTA 2JH3A 2P7IA 4UU7A 4JQCA 3VOSA 1KRWA 3EG9B 2MSDB 3F0EA 3PUXA 1B7GO 3MINB 2ZU0C 1P74A 1ZAUA 3SBXA 3TPFA 4MCIA 1LQUA 4UD2A 2IE0A 4B2IA 1ECJA 3GH1A 4M1YA 2O54A 3IVAA 5K01A 3TZBA 2GAOA 1J9GA 3KKEA 2IVFA 1XNRB 3T7AA 2CGEA 5AKZA 2EJVA 4QUIA 3LPAA 3O0TA 5DXJA 3W90A 3ASNC 4TMFA 5E1BA 5DNEA 1MVOA 3CCCA 5GW7A 4D92A 4P53A 2ZI3A 2WALA 4W9RA 5ERXA 2XX3A 3HB5X 4ZHVA 1O1YA 2YNMD 2GVZC 2JLWA 1NQVA 4WNAB 5MGNA 3Q1KA 1Z7BA 4TYWA 1BDMA 1OWOA 3QVVA 1VPDA 5BN3B 4RQTA 1C9NA 5HDQA 1LR1A 4L9AA 1RQPA 3MGCA 3C6BA 5EBMC 3BHNA 1PGNA 1ZJ5A 2M9MA 5E6RB 2ZRQA 5GIOE 5A4DA 4BR6A 2DETA 1HDGO 1ZH0A 4ACAA 2EIMC 2BCGY 2I87A 5ALTA 2PX5A 4JDPA 4KO8A 1P2VA 1Q92A 1YR8A 2FZVA 1YDEA 2ZAUA 3OCWA 1N6OA 3L04A 3D1LA 2OCAA 2SCUA 5AVMA 1WKCA 4RTQA 4JIGA 3MLEA 3HJAA 4NV0A 2NU6A 2QM7A 4Z7QB 3OFVA 4BEWA 2GPTA 3K04A 5K6AC 5L3SB 3WQBA 2A9FA 4HV4A 5CPBA 1MUUA 1Z7EA 3DONA 3PA8A 4IOMA 4RSRA 4G37A 3PXEA 2XJ9A 1FFBA 1N7HA 2FKNA 4TSRA 4EVSA 2TMKA 4UEQA 1H94A 4WRRA 1TXGA 4DJDC 2HW8A 1UQUA 4S1TA 3CCSF 1T9CA 2V59A 3T5PA 2I2BA 3TSCA 3AVTA 1K9MW 4QGSA 2Y0BA 5DYNA 1WD5A 4U7NA 3UMGA 1VZ2A 4DV4B 2BHRA 4BN4A 3CCLF 2R7AA 1O0SA 2PVSA 4OLBA 4EDFA 1JHDA 3EVEA 1RYEA 2ZAOA 2QP9X 4UDYX 4DR3B 1F8FA 4L76A 5EB0A 3UH1A 4RD6A 5E9QA 1XKXA 3FMOB 5FORA 3TIVA 2RH8A 3JYOA 1CRQA 4GMFA 5KSOA 3UFXB 1DHRA 4B3DA 3NV7A 3U4HA 2KLHA 3ILVA 1AO0A 4FCWA 1KOFA 4M0KA 4JVOA 1ZK2A 2IS2A 1C4KA 3OOHA 5EEHA 5LHIA 1OREA 1I3NA 3SSNA 1PD0A 3TTTA 1TAEA 1NC3A 1VKZA 3S28A 3V1KA 2VYCA 1IHXA 1NF8A 2PL9A 1FOEB 2CHTA 5E2AA 4LJ6A 3W6NA 1WO8A 1Q77A 2QTOA 2OL4A 3KL4A 1U65A 2AFVA 1RI5A 1XRSB 1HQYE 2P91A 4ZVKA 1ABEA 4RKEA 2M2IA 2XRYA 3FX2A 3ABQB 1H2ZA 10MHA 1P0PA 4MW5A 1R0BA 4KJZA 4EUFA 1RPNA 2W58A 5TT1A 2HMYB 2HYDA 5ULLA 4IXTA 3GDFA 3WYDA 3V97A 4UHBA 3MRVA 1AJPA 3U5ZB 1DDIA 1KI7A 3D3EA 3WGQA 1XRNA 3EZXA 5A2QM 4MW1A 2D5LA 1U90A 1DWQA 3L02A 1BCRB 3WK6A 3ICVA 4MW4A 1W30A 4MQEB 3E3NA 5KHOC 2WU3A 1SKMA 1H42A 3GF4A 4E32A 1WD7A 3ZGZA 3TNYA 1M6VB 1MA1A 1YFKA 1ID1A 1J0XO 1Y37A 1AHNA 4ENQA 5LQKA 1F9AA 1GM9A 3U0VA 1N2CA 3W0LB 1H48A 1C3XA 1I7QB 2C0QA 3I9FA 3IULA 3G5UA 1NY6A 5DHSA 2BBTA 4BQQA 2YZ2A 3G4SV 3WWYA 1XNHA 1A88A 5EMNA 1XMQB 5IVDA 2VHQA 1E3TA 3WWOA 1UADA 3UV3A 4DR2B 3I5UA 1WUJS 3I6IA 2NV0A 1BKSB 3EPJA 1UPUA 1YBAA 1E9BA 1Q14A 2G1JA 4M9XA 1DLIA 1SCUB 3PI7A 4BVBA 3IMFA 4LYEA 5DWVA 3PNMA 1HNWO 4EJSB 3UCXA 3AEXA 4U0KA 1P29A 3DFZA 1IZ8A 3FLAA 1BA3A 3AFHA 1V11B 1WCV1 3QW4B 2DW4A 4OXYA 2QVXX 1O6FA 5C2JB 3G71V 1FNKA 5IBCA 3E3AA 3K2XA 3TMKA 2AW3A 3ENQA 3A37A 2O0JA 2XGGA 5TMBA 4BMOB 2VZLA 4FHDA 2X7XA 2PSJA 4HH4A 5BYKA 5DI3B 2JH8A 2HSEA 1R73A 2E48A 2IF2A 4B3RO 3GZ4A 4AFNA 2QLLA 2R44A 1YGPA 4DRXA 4RZUA 1AJQA 3HRIA 3NVIB 2H2IA 5KPDA 2FHPA 5JJNB 1JDJA 1N34O 3R5TA 4LW8A 3ACBA 1OHHA 1W3EX 2GBGA 2Y6UA 3ADDA 4GO1A 4X65O 3SYNA 4PRYA 3VMFA 3A32A 3W3AH 4ETNA 3U16A 1D6JA 5EP3A 2UUAO 3G17A 1BTOA 2YJGA 5F2EA 3DC2A 2VLIA 3CX5F 1ZHFA 4YNBA 3NC0C 1ZD9A 3R5XA 2QUAA 4GGOA 1KZHA 4U0JA 2NZUG 3SXPA 4BT4A 4Q9JA 1S2MA 2I4RA 1XQVA 5EZYF 5IG2A 2HF7A 3K3PA 2JS7A 2UYOA 4BNUA 3TD5A 4DADA 2EINC 1KEZA 4K9DA 1XPJA 2QENA 4MPDA 3EQ6A 2ORED 2I6XA 1FYEA 1E9CA 1X8KA 1UBHS 1WXFA 2BMAA 1WDKA 2EJUA 2HIHA 4RTNA 3OESA 4IEIA 2WAYA 1QWOA 4IO0A 3M84A 4LDPA 2GCOB 1NMZA 3JQAB 4YPVA 5C8DA 5FCDA 3RHSA 3UIEA 1YXBA 3OIFA 1DXYA 1QFZA 2NNLD 2V0CA 1FW6A 1V8PA 3TTUA 4FGZA 2CTPA 3WFIA 1XL6A 3BWXA 1CJMA 1NFQA 4LRUA 2P2LA 1AKUA 2DTEA 2MDTA 2GWRA 2NTNA 4M1WA 3LNNA 5EIFA 1VSBA 1G9TA 3VI3B 2D1SA 1HEUA 2ATEA 2ZTSA 5G0SA 5ECYA 2IDZA 4LXUA 3TI7A 1G2QA 3O26A 3UJAA 4DC1A 2YHUA 2W70A 1E1QD 5DXAA 1A5ZA 4TSFA 1Y9DA 3B2EE 4L8WB 1DQZA 3K6RA 3ISTA 5BT8A 2ZXWB 8ABPA 1NYLA 1LTQA 4JJZA 3CNLA 5D8DA 1T8RA 3M3DA 3L7JA 3QUSA 1H65A 2EFEB 2WA3A 4DR5O 1MX1A 5K8UA 4V03A 1J8YF 3L7QA 4IDNA 4N8SA 1SZDA 3HXTA 4P0TA 1I4TD 3RTGA 4J42A 1GTVA 1SQXH 2YC0A 3A9UA 1KNXA 3DLAA 1Y76A 1YHQV 3AINA 4NK4A 1IQ0A 2JC3A 3RV3A 1DQRA 3PGVA 3EDYA 2Q1UA 2HLDA 2ZUVA 2FMLA 1YTUA 3A36A 3TRKA 3PNBA 2G9QA 3CWCA 1U0BB 1XJWA 2OCXA 1O08A 1TF2A 3S3TA 2A9JA 3AHHA 3HY4A 2UYYA 4I0XB 2C3MA 4NPAA 2ZQYA 2MYNA 2KGWA 1UJ6A 4ZHQF 2PG3A 3P2KA 4B71A 4NYMQ 2OXFA 1T13A 2VQ3A 2QUZA 3P2EA 4PDRA 3MWEB 3HDHA 4B33A 2V6FA 1K3FA 4G0ZA 5KNLA 1KJ8A 3UWMA 1Z2EA 1RIFA 1YMUA 5LKAA 2E74B 3ABMB 3OJWA 3N2GB 1JKMA 5BY1A 2ONZA 3I5YA 5ADWA 1RP7A 2A6PA 2O7NA 3E5HA 4J7XA 3K8ZA 3ELWA 1M6EX 1NNI1 1NONA 1DJLA 3QF4A 1O0CA 1SVIA 1AQ6A 1XZNA 3CCRF 1FMTA 4GKJO 1ZWZA 1SU4A 2R68A 3QVWA 2IYOA 1T0JB 2O0LA 2PZMA 1CDDA 1MXHA 1T10A 2G9ZA 4TWKA 2GEDA 1SJ9A 3OJFA 1JS1X 1YASA 3L6BA 2XQGA 2ZVPX 4EMUA 3ZCCA 1HXHA 1W36B 3ASOB 3UJ8A 3GRYA 1YZBA 5FUQA 1BCCH 3IJ5A 2ETVA 3GJZA 1YOVA 1UAYA 3TDMA 2MHCA 1A9YA 1VIAA 3KSUA 2GKOA 1TVMA 1SC6A 2QL6A 1ADGA 1E94E 2VSQA 3WL8A 3U39A 1EYZA 2WYOA 1KQOA 1HE5A 2A5FA 1W581 3KS9A 2O59A 2QD2A 4S3MA 4Q1DA 4C4SA 1IXRC 3PQFA 1UIMA 1B3QA 4J0DA 5FUXA 1I3OA 4B4OA 3KPJA 1ZUNA 3G9TA 3RS7A 1U8ZA 4WZBB 5HE8A 4QTZA 4G0NA 3JRWA 3LVFO 5DLQC 1Q0HA 4UFZA 3VQXA 1EI9A 5JAZA 1KB9F 4RPHA 2UU9O 3BJZA 7REQB 3LLUA 3VFDA 3OX4A 3T6KA 2ADPA 1XXHE 1L5KA 1Z4JA 4K05A 3VOBA 1XB2A 4ZHSA 4L0QA 1XTPA 3G49A 2O1XA 1ECCA 4GVLA 5BSGA 1HA3A 5BSFA 2K7ZA 3KZIZ 3OW2F 1DC4A 1UPBA 1BNCA 4N7MA 3JCZA 4EFKA 4KXYA 4XB2A 4B6PA 2XBMA 4QM7A 3G8BA 1T9KA 5DT9A 4CCAA 5MN4A 3Q2IA 4B5LA 3HM9A 1XRRA 1C4WA 4P83A 4UTOA 4URVR 1YRWA 4AKEA 1VG0B 2YICA 4R05A 4AMZA 4L0CA 1YTFB 4E4TA 1LKZA 3V7UA 2ZIXB 4UVHA 3AESA 5IHPA 3M0EA 1JMKC 4R3NA 2IV3A 4HT3B 3FZYA 5I3ZA 1MB3A 2PUAA 1NE7A 1G2IA 3COSA 2JFNA 3N8IA 1E9FA 4PZCA 1ZVVA 5E8RA 3ZD8A 1KY5A 4GKAA 1O8CA 1KIFA 1X38A 4EG3A 5DHUA 5FBZA 2X77A 3I2FA 3QYAA 1KJQA 1E69A 1GL7A 2IIPA 4PA9A 5MF6A 1AR1B 4OQQA 5EWLA 1P9NA 3HU5A 4C0KA 5J47A 3LRXA 4YR9A 3I39X 1J5PA 2ECQA 1HL7A 3U4QA 4RV5A 5KYXA 2H0RA 2PQMA 3N7TA 2JF0A 1M2VB 1SG9A 2HJVA 5AWFC 2PA3A 3WY9A 1Y81A 3A27A 2AZMA 1QQ6A 3AR8A 3FJ1A 1BHO1 1OFGA 4B76A 1IK4A 4D97A 2ZU6A 5CT4A 4LZJA 3FD6A 1X25A 1O8BA 2QAIA 1F20A 4QXAA 4B3MB 1W29A 1SHZA 2X58A 3IMKA 2QB5A 4JBYA 5IE9A 1XDUA 3C3WA 1XELA 1N6PA 2CLOB 4JKOA 1W4BA 4BVAA 3ZZTA 2LGJA 4QQRA 1OHHG 1WZCA 4GKKB 2Z57A 5HMMA 2M32A 1I2MA 2Q0XA 1RS0A 2FVYA 3IDFA 1GKYA 5F76A 5KYWA 3AY7A 3VR3A 4GICA 1XDWA 2JIQA 4RJKA 5IVPA 4UNQA 3VRHA 4MV5A 2JANA 4LZLA 5LMUB 1QGUB 4Q66C 4B74A 5JBNA 3IPLA 4HDQB 2EIKB 4U6NA 4KQGA 1NQWA 2EV9A 3IPCA 4KTTE 2EBUA 4MVJD 3EARA 1E0JA 2EBWA 1N25A 5T41A 2Q62A 1RC1A 3EIFA 3UGKA 4MI1A 5AKHA 4BP1A 4IV5A 4KR9A 1GPDG 3CH5A 4MICA 3INRA 4DSTA 1NHGA 1M72A 5H1YA 3QPWA 3BVPA 4YRZA 2Y6VA 4BVTA 5KZMB 2WP8J 1A8QA 4MJLA 1VMKA 4PAMA 4C43A 3KUUA 2OZVA 2F00A 2HGZA 4AZVA 4A10A 5HDBB 4X8OA 3B9BA 4N8EA 5IZ4A 2HEIA 2VJMB 3O8QA 1FP2A 2ZSDA 4URWR 4X00A 3VR5A 4IT5A 4UCOA 2PK3A 3D4NA 3E22A 3TCNA 4B85A 1PDOA 4YREA 2ZZKA 2ONKA 3OE1A 1Y7PA 4K9KA 1EBOA 3ANLA 2O5RA 3I6QA 3WSWA 4NCHA 4CS2A 4FJ1A 3DUWA 2Q27A 3VR6D 3WWEA 3FA2A 2YV4A 4JI5O 4JLJA 1NQXA 2D2XA 3BRCA 2WMOB 4QO7A 2FPUA 3RHTA 3P27A 4CTOA 2FLVA 4N48A 2QZPA 1J42A 1XRQA 4TSFG 3EA4A 2GPNA 1IUKA 3U62A 3WYFA 2YMPA 4J7AA 4XPIA 3FX7A 2B83A 2EGGA 1KJJA 3BHJA 4TVBA 3WXMB 1QR6A 2HT6A 1D6SA 3HUUA 3PX3A 3TGWA 4JVNA 3ZX6A 1LH0A 4OGKA 3QBTA 3W2EA 1ZSPA 1A2QA 3C16C 1S2GA 1OCRB 1FTWA 3IUBA 5ITZB 5HQJA 2Z01A 3U44B 3BABA 4TKUB 4EEXA 1LNZA 4YUZA 1ZLXA 3LDAA 4YQFA 3N2YA 2HLDG 1GN9A 4Z7JA 4JKYA 1QJCA 3H8WA 5BW6B 1W49A 1DEAA 1ACMA 3DVLA 2YJ4A 4DLXA 5KQSA 1OTYA 4XYBA 2ZAGA 2E89A 3WYAA 3L93A 4CLOA 3HKBB 4EI8A 4JI3O 2XZTA 1PTKA 1B6RA 1YK1A 3OP1A 2C98A 4ZZ0A 4MTGA 1YXMA 2GK3A 1D7OA 3UGQA 5JXHA 3BXOA 1H6CA 1OIXA 4QDOA 3CPQA 4LJ8A 1SOUA 3S55A 4DA8A 4EGSA 1XMSA 1TJYA 1D0IA 2HKOA 4FWTA 3OZVA 5K0EA 1IBMO 2ZWPA 2ZQ5A 3QJGA 1F38A 3HJRA 1IWBB 1XG5A 4YCCA 2L82A 3DEZA 2I3AA 3MMSA 1JFLA 3D8TA 3PRHA 1JR9A 5K8LA 2DZDA 4E07A 2R8BA 2IYEA 2HA0A 2A0XA 3I30X 3GP5A 3F6RA 1RFLA 4YP5A 3VDNB 2WJIA 4QRIA 1XVVA 2P30A 2FFJA 3CNOA 5TPWA 1OFVA 3WSTA 5E1DA 1VQ8V 4I2VA 2ZNIA 2ORIA 4JNCA 5B1OA 3DFFA 2OCIA 4UC0A 3BB3A 2OECA 3HNOA 1UK8A 1U0TA 3VM6A 4BVJA 3HAXD 1VBNA 3HZHA 2WIJA 1CHDA 5KUTA 3ER8A 5JFOA 3CKMA 3G5MA 1E3WB 4MS1A 6REQB 5AI6A 3WLQA 3RM3A 3PJSK 2VXOA 4JFRA 3EBPA 3A14A 2R11A 2AZDA 4B8ZA 3WYGA 3S7TA 3VQWA 5FNVB 4JWKA 1P80A 3MQWA 3ES9A 2BLLA 1DQYA 2E21A 4AO8A 2CNBA 1XBIA 5CFMA 4KN9S 1K7XB 3B51X 4IJVA 2XNJA 1NWCA 4IIVA 3RNLA 4ANFA 1VF6A 2QR2A 1RTTA 2GHYA 4B6GA 3FR7A 2Q9BA 1M57C 4H2DA 4S0ZA 2LJ2A 4CUKA 3K0TA 3QX8A 3ZZNA 2OUKA 3JW8A 3GP8A 3I2JA 3D8BA 1YZ3A 4E33A 3AG2B 3IUPA 3DCNA 3H11A 4LX8A 1EFPB 1L0NH 1Q74A 2VHEA 1EVIA 3FAVA 3CCFA 5JW6A 2HRDA 3AXTA 3NCHA 2IOHA 1CQPA 2J9FA 5D00A 1G1AA 2F9LA 4RJIA 2H52A 4H77A 2GCEA 1QYCA 2Y1GA 2QAGB 1K73H 5CFRA 1FNJA 1XZPA 4WFFA 4OXXA 3COZA 5JUWA 4KSBA 3N70A 2A9RA 4J0QA 4ROSA 1KU9A 1CUDA 1FNCA 3K2QA 2Q0QA 4CVNA 2PTMA 1PT6A 1I7PA 1HDCA 4EO4A 4S1NA 3HJCA 4X1IB 1KJIA 1ZS9A 2GUWA 3JYLA 4QOIA 3A6ZA 2YY5A 1CJTC 4B3SO 3ZBTA 3HK2A 5HZMA 1EM8B 1GKIA 3QJYA 1TT5B 4ESVA 5CBFA 1OWNA 3LYHA 1G66A 2H9IA 1MJNA 2VH5R 4Q4DA 4LH6A 4MX8A 1QF7A 3EUFA 1HURA 1KETA 5KSPA 4UZFA 4OXRA 2XGJA 4B6FA 2PRKA 3I01A 3EXHA 4AYTA 5EKTA 4KGXA 4GI3A 4GL4A 5LOVF 4F2GA 3DVAA 1XVIA 1T25A 4B87A 3PQ3A 3A3KA 1RWOA 1MC1A 4OQDA 5EUBA 1LLCA 4CG0A 1F2UB 2Q3HA 4EB6B 2D74A 2HMWA 4FM2A 1C7IA 4CKWB 1KKLA 3PC4A 3SHQA 2UZIR 3K9CA 1BL8A 4LGCA 3AVQA 4RVNA 4GYCB 1FTYA 4JJ7A 1TF7A 4G07A 4Y2GA 3C9SA 4HNGA 4CEIA 1UT5A 1J0BA 2KB0A 2JBAB 1NTRA 3F2IA 3EXHC 3Q11A 1QH8A 4X9XA 5KJEA 2QJOA 2QIOA 3HB9A 3O94A 1HDOA 3MTQA 5F9MA 1EU1A 2AE2A 3HMQA 4BNWA 1OQAA 4HBNA 3TCXB 2VYND 2WIGA 5LBUA 2XAAA 1XA3A 4RNCA 3K1TA 3LU1A 3P0RA 3UM9A 3UATA 4YJ2A 2FOLA 4WOCA 1QNLA 3NM6B 4UTZA 3P45A 3UA4A 1FFHA 5FV7A 5EY5B 3OZGA 2QTSA 2EKQA 4Y6QA 1EK6A 1YK0A 3AM4A 1X70A 1FVHA 2HPVA 3FOZA 2GERA 5JT1A 4R0VA 2JA1A 4QAJA 3TQQA 3K3WA 3HRHA 3OQMA 4D9NA 5IULC 4A8TA 1IURA 3PU6A 2NUAB 3CT4A 3WBFA 3CD6F 1GPNA 1ZK1A 1GNQA 3AX6A 2VRCD 1E61A 1Y9ZA 3D6NB 2XIQA 4YRSA 1JBKA 3KTOA 1MSWD 3BZBA 4NNJA 4E5MA 2AG6A 3DBLA 1E2EA 1TUEA 3TM5A 3SXJA 3H17A 1GY8A 1KZ6A 1Y8CA 4RCZA 4ALMA 2OR3A 1KGDA 1GN3A 5AW7A 1NXWA 3NALA 2IUUA 2GD0A 1J7JA 1O5OA 3COYA 3HP4A 4D9BA 1OAOA 3A70A 4UBMA 1JPXA 3CVWA 1H4SA 3QKTA 1RLTA 3KQUA 1PTJC 2O2XA 1D2GA 2OGUA 4NV3A 4DLYA 3QKRA 2R66A 1V8FA 5BR8O 2G82A 4L5AA 2Q73A 3ZTTA 4D98A 2IU3A 1N2EA 1DZIA 1KMHB 5EERA 1CQXA 2OHGA 1DIGA 4DZRA 3G0IA 1TL7C 5AW0A 4NENB 3FJOA 4DLPA 4B7XA 5FLXM 4MEBA 1QE0A 3FSGD 4NBNA 4RA9A 4MOWA 1USWA 1OAOC 1IXKA 5EMMA 3RODA 3OMXA 4M4SA 5L7YA 1E2JA 4FQ8A 4JYYA 1TEHA 1AH2A 3GGPA 3DDOA 4PTYA 1X7HA 4CMGA 2CZWA 1A76A 4QDUA 1V5IA 3N27A 1H6BA 4QT0A 4XRRA 3E2MA 2QZ4A 5CCEA 3UAVA 2C2OA 1TLFA 3JARB 1H2AS 2FI1A 3H7IA 4EYKA 5TDHA 4AULA 3KQOA 1IWPB 5LDGA 3UC9A 3HJGA 4V1CB 3VOUA 4HYYA 4ZJZA 4OHYA 2OKCA 4YJ3A 4CV1A 1EUCB 4IJQA 4WX2B 1QO9A 2JIOA 5AQ1A 1RDFA 3KFXA 1D09A 3IHLA 2AX3A 4GI7A 1ZL8B 2RNBA 3SLRA 4ZDKA 4MWCA 4MARA 4WK2B 1M7HA 3V7EA 4NCKA 3UA3A 3I9LA 1DC3A 1X86B 3GAFA 1CERA 4NE2A 4Y2XA 5TGZA 1T9ZA 2JZNA 4D6XA 1YRYE 4FTWA 1R3UA 4F4JA 2GKSA 3R4CA 5C0OE 2BFNA 4EJMA 1PZNA 2CVHA 1ZDMA 2J7PA 2JHGA 3DHNA 2VP4A 3UUEA 3R24A 3C9RA 2Z1NA 4O0LA 3LT4A 3OTWA 2QN9A 2QL5A 4QDJA 1T29A 1UKBA 4ZVUA 1F4VA 4EL5A 3KBBA 1ZJ4A 5HGJA 3SQMA 3MSXA 1UBOS 4WZAA 2D4HA 4MVJE 1XHLA 1KNKA 4R2HA 1JDUA 2FX3A 4EVQA 1GH6A 1XNQO 3CRVA 1Z29A 3KLMX 1AGYA 4I8DA 1JKFA 5CFNA 3RKSA 3L6EA 4ND5A 3GLVA 1E98A 3C41J 1VQMF 1N2JA 4B3TO 2OO5A 1KAGA 1SXGA 2D8AA 1CRWG 2I6UA 3FSEA 2HO5A 4DA0A 2FVXA 4NBKA 3BH0A 2VDWB 4B3GA 2IUTA 4LF6O 2HGSA 2G0NA 4HRYA 2O8CB 3ZXIA 3AFIA 4Y8VA 4O5AA 2AEEA 5EE0A 4ADSG 3SBDA 3EWAA 4XLZA 1UBJS 3MJ4A 4J0EA 4IYHA 2BEUB 4YCAA 3M2PA 2VQDA 5F51A 3LNMB 4MVXA 1PKEA 1QP0A 1SCIA 5BN5B 2HCBA 4M60A 2W2QA 4EITA 1SIWA 4WERA 2OD2A 4IXDA 2PT9A 3RSSA 3WLRA 1JFFA 4RZHA 3V2GA 3TPCA 2CXPA 1PO7A 1UODA 5C5EA 2FWNA 4Z86A 1KWKA 5K3DA 4DV7O 2R62A 1NN0A 1VZ3A 4ZHYB 2GFIA 4DZTA 2PUJA 5DHPA 4WW0A 5DNYB 1JF8A 2X0KA 2X6RA 3KJHA 2YS8A 1J8MF 1XZMA 4KRGA 3QSGA 4R01A 4JA0A 4QULA 2XGMA 2FWAA 4ZQGA 3LYUA 3VMMA 1RCFA 3HCBA 4ERHA 2F6RA 1TYBE 3KC2A 4E15A 1NMYA 1SA0A 2UAGA 3BN3A 2GXSA 3ISJA 2Z1TA 1BQ0A 2MINB 1AN9A 4HVLA 1VQKV 3P9KA 4PO9A 5AG2A 2H6LA 4KXLA 3PRYA 1NBEA 1ZH6A 2QPLA 1II0A 4WCFB 1N36O 1ZY2A 4QVKA 3WRWA 5GZ1A 4QPPA 3NTVA 1N77A 4QYXA 2H2DA 3MHTA 1QFSA 3KLBA 1U2DA 3G6EV 3M9WA 4TV9F 3OQVA 1P75A 2JJQA 1DRWA 5PNTA 3THRA 2RGGA 3H83A 3UN1A 1UUFA 7ADHA 3GI1A 1QBGA 2RC6A 4O2BA 4FFOA 1VL2A 3TCKA 4BFYA 2AD5A 3PNLA 3G7SA 4QJ4A 1KZ9A 1T5TA 5BT9A 4KKVA 5LGNA 3RO7A 2W2KA 4DV3O 2I1WA 3CVUA 3FDZA 3IBFA 2IHNA 4O59O 1XWFA 4IYRA 4P34A 1BRMA 3V4PB 1T9HA 4BRSA 5ALKA 1V55C 4ILEA 1U2DC 3MS7A 4FT2A 2WB4A 2VCYA 2CZQA 4OB8A 1E89A 4X8HA 4J03A 2DF8A 3DZGA 3R9IA 5M29A 4IQ4A 2BMEA 4YUAA 1VKJA 2JLRA 1XRLA 1W2GA 4ZC8A 1FKAO 4HGNA 5FKJA 2HLNA 4GYJA 4BZZA 2XRMA 2CK3D 1B4DA 3OOYA 2HADA 3ENVA 4QBFA 2FPMA 4PHFA 3ZV5A 1E1CA 1XYGA 2WJ3A 1SXJD 3R7DA 2IY7A 4CIAA 3AVWA 3ZQJA 4NJOA 1E9SA 1FXUA 2YRXA 1MN6A 2WT4A 4DLZA 1O9HA 4YALA 4GZMA 4LHYA 5B3AA 3EPHA 1GSOA 4J1SA 1E5DA 3C87A 4PS0A 1V9CA 2AYYA 1WCYA 4OMDA 4N6OA 4DUYO 4RANA 2C1XA 4MVJF 3D0KA 3GV0A 4BT2A 4JNKA 1M2HA 2YHIB 3NONA 1M6HA 3OW2U 4MRNA 3T35A 2Q4OA 1GM5A 3O1LA 5JY6A 1J56A 5AHWA 1O9BA 3CISA 1MW8X 4C6TB 5B2ZA 1S8NA 3U1VA 3TOVA 4LRSB 4L4XA 3ZNNA 2DSTA 5C7LO 3N2EA 3AILA 3FCCA 4FGSA 1Q1BA 2WJGA 4CCYA 4GCZA 1PG5A 3FUXA 2A7QA 4QBIA 4G09A 2GN0A 4RK7A 3RFCA 1MG5A 5DECA 4I50F 2O1SA 1P49A 2VHXA 4BUCA 3K5OA 4JI8B 5LPNA 2ZRNA 1V8OA 4C04A 2BAGA 3W1VA 2OHFA 3GZTB 1RP1A 3WZLA 3BL8A 4BMPB 4PR3A 2J0SA 4UUBA 3F5WC 3QI2A 5IASA 3WFJA 2WT8A 4P4NA 1GG8A 1SOAA 4MIYA 4BFTA 5EHGA 2JGUA 2AR0A 2WZBA 2CNLA 4IQGA 3KX2A 2E85A 2JI7A 1IDSA 3VO1A 2B92A 1U8UA 3AONB 4JVMA 4QBKA 4BNJA 5A2QA 2H0QA 1AHIA 5EE1A 2CMDA 2XQIA 4BY9D 1KMNA 2QTZA 4M38A 4YCJA 3FDJA 1QU9A 3ML0A 4JFAA 3A0RA 3O4GA 1RXEA 1Y5IA 1E2GA 3N4ZA 4HG2A 2BFBA 3BMNB 3GJ0A 5JQGA 3V42A 3PFCA 3MWGA 4TTPA 2AIRA 2O8EB 5DW0A 2DPXA 1SC1A 2PRSA 1I08A 4BWGA 5FX2A 1BKDR 2H4JA 4PY2A 2WMDA 1S6YA 2GAFA 4UZEA 4MVRA 5D1HA 1V2GA 3JSNA 2B4YA 3PR2B 1USUA 1JEYA 3MFYA 5I7SA 2IC5A 4ER6A 2VZ0A 3IIIA 4YCNA 2DBZA 4NR1A 3F4BA 4X88A 1GKUB 1U5CA 2P75A 5H70A 3DD5A 3L0DA 1GFZA 3NTOA 3PQDA 3L06A 4UTVA 4R7TA 5KTTA 4XDHA 4KYUA 1JRLA 6CHYA 3TN7A 2VWPA 4DMFA 1SMKA 2PRZA 5T4FA 2R85A 3LLVA 3SYOA 3USES 4MLCA 1A8UA 3PNOA 2Y92A 3T41A 3I0ZA 1JAHA 5K9ZA 3BB1A 1HG0A 4D9MA 4ICIA 1AN0A 1U3LA 5E8JA 4CG2A 3WGUA 4Z3DA 5ILOA 5EJIA 1XA4A 5HTKA 4QYSA 4MKIA 1DLJA 3THWA 1T9BA 3KTAA 4RF5A 3DO5A 2X0RA 5K6AA 1DIHA 1JJFA 3O65A 3RUIA 5KAMA 5DTIA 1R8SA 4ZHWA 4DR7O 4G25A 3T3EA 1EFUA 4YV0A 3BGOS 5A4AA 1AI5A 1REQA 3KTFA 4F1WA 4C8GA 3LK7A 1Q86W 2I2FA 2Q7XA 2AN4A 3FXAA 1QGAA 4ZCQA 4RGYA 2GD1O 4LCKA 2XUQA 3H9UA 3AOGA 4XBFA 4B7UA 5DYYA 1GRVA 1PI3A 4QGGA 1I5EA 3AUFA 3ZNPA 2AOUB 2OZLA 3IEPA 1VQLF 3L7KA 3SWWA 1A9ZA 2H5IA 1XN4A 2VDVE 2G08A 1ZWIC 2EIXA 3AF0A 1BXGA 1OIWA 1RFYA 3M70A 2OHIA 3EIWA 5JJJB 1XTZA 1R6DA 1X7PA 5KYNA 4PZEA 1MZPA 3SNKA 4UNRA 4U2FA 3F0FA 3QMVA 3DOHA 3PE4A 3A3OA 4FJ2A 1JPUA 1SY7A 4LV8B 1J7HA 3BCHA 3CJHA 2QWQB 4URFA 5BUZA 1XSEA 3EYAA 1BDIA 4PR0A 4G3XA 1KVTA 2LCFA 1H2NA 3M7MX 2J6IA 5CHYA 1FIUA 3LT5A 2I33A 3ZWVA 1XDBA 2WZCA 4EI9A 4XJXA 2ZATA 4ABYA 3SPCA 5CB6A 4URYR 1M2NA 1G9XA 3X1XA 5ALWA 2G5GX 3NU1A 4B62A 1YI1A 1RRFA 4QXRA 1QZUA 5LZ9A 2ZPTX 3K9FC 3TSOA 3ZDYB 1X80A 2PX6A 4ITRC 3BTSA 1RWVA 2C9OA 2CTWA 3A1UA 1Y1LA 2ACEA 4F11A 3U7QB 5C18A 1KEPA 3TLMA 5GONB 1XNRO 3L07A 3EULA 1YA4A 1B1AA 2QUBA 3MBIA 2Z9CA 5J5VA 3PIIA 2ECFA 1HRDA 3VR4A 3L1VA 2G1PA 4A91A 1ND6A 4HFNA 3D8CA 3ROTA 4YCBA 3RVLA 2FN7A 4KAFA 3VKGA 3MJFA 4XUCA 4OGQB 1ZC3A 4QPNA 5FUYA 5TQ2B 4NQ3A 7ABPA 1SXHA 1P6QA 2P06A 4ZCLA 2QX8A 2OB2A 2VA9A 2VNSA 5CT9A 2EKBA 4CRWB 4NBLA 3TDNA 3PICA 1S1MA 4MKZA 5DGCA 3NHUA 2G72A 3OCUA 4UNIA 1C2TA 3CCVV 3ZWAA 1E7RA 3CZPA 1R9JA 1IZ9A 2Q1SA 3S8EA 5AVJA 3CMMA 1SFRA 4P35A 3RYHA 1KKCA 2IEDA 2X5OA 3GQVA 3OPYA 2EZTA 3IMPA 5ICSA 1TCUA 4BLSA 2Q3DA 3OVMA 1P0MA 4X1KB 4LBYA 2DFVA 1IZYA 1W19A 1RHUA 3FPGA 3F9RA 3QO7A 3D43A 3EVDA 3P30A 1YKSA 4O2LA 3PQ4A 5F64A 3DM5A 3SZGA 2JZCA 3CINA 4RDIA 1PNMA 1JWAB 3GRKA 1ZH2A 4XWAA 2ASVA 3UAOA 2WJHA 3B48A 4DKJA 2R6CA 4IYIA 3M81A 3W6ZA 2ZSAA 1ZCJA 3E9QA 3S2IA 3ZJTA 4CIDA 1H2KA 2HZ7A 2HU2A 2Y99A 4CPDA 5IAEA 1GPJA 1H6AA 4CL3A 4KFMA 3R77A 4K6HA 4DV4O 1SUEA 4P1ZA 1D3AA 3VU0A 4HH3C 2H2GA 4OA8A 3B6KA 3NUGA 1Z74A 2D0OB 3F90A 2AMVA 3DPSA 1LVUA 2INGX 3ICQB 2CUZA 1GQYA 4NCJA 4DR3O 2FW7A 1A71A 4E3WA 2FQQA 4PAOA 2BPOA 2E37A 3STWA 2O6HA 3GDHA 3K6SB 3OH8A 5JTUA 3KJQA 1JA1A 5KPJA 3NFRA 3CGWA 3ZGOA 1ST3A 1DBPA 2HK6A 2JLZA 4C01A 4DG5A 3C3CA 1P19A 4K26A 3H18A 3JZAA 4CU5A 1C1XB 3A1SA 3CCQV 5J1TB 3HN2A 2I1VB 4AUNA 4HWKA 2Q7OE 3I1IA 4BZQA 1PQ4A 2QVYX 5K0TA 4MLPA 2W2TA 3JVIA 1K3EA 3FRJA 2ZSHA 4FNGA 3IDZA 4COKA 3AH8A 3CEMA 2VH2A 2PIAA 4GLJA 3QE9Y 4CTMA 1M4UA 1KPGA 1JNYA 3I28A 4EJ0A 2C5AA 3C43A 1Q81W 1P7GA 4FW8A 3UKJA 4FFLA 1ORIA 4PZ0A 4KVGA 5DTJA 4MUIA 3ZV3A 1K27A 1OI7A 1T0HB 4AZTA 4G56A 3STHA 4FOTA 3ICXA 5DNWA 4IGGA 3GLRA 1NQTA 1CQWA 2HMUA 5CYOA 2HO4A 4E1VA 4OPAA 3CXHF 3CURA 5AK0A 4ENRA 2QMHA 1Z07A 2CVPA 4A8HA 4CTJA 1KD1W 3DXZA 3JQRA 1EINA 3IURA 4FUTA 2VHWA 4OBXA 5ALPA 4P92A 3ORSA 2QOEA 3OJLA 1QIGA 4I1PA 1K0UA 5AM4A 2FSIA 5TNXA 5LQJA 1BVRA 1SG0A 4I6JA 1Q6YA 3QO5A 2JD1A 4BASA 1XXLA 4WA8A 3AM1A 2ZSEA 2IZ1A 5AK4A 4UXIA 4ZAYA 1LBSA 4J2OA 2OQ2A 4LCBA 4REMA 1BIFA 4O33A 4MDYA 3NEAA 3CC7V 4GPIB 1U94A 1RM5A 4H16A 4WFGA 1EZJA 4G9GA 4Y9DA 3DQZA 2QW1A 1TQ6A 2H1WA 4OPMA 3D6FA 4RHEA 4WGFA 5D3ZA 2YIAA 3G6KA 1SXJE 4CQMA 4H17A 2D59A 2OFPA 2WJWA 2ODNA 3N6VA 2FE1A 3PGKA 4HH0A 2C3UA 3SPXA 3IHKA 1DL5A 1URPA 3RROA 3PI6A 2HZBA 4DR2O 5H83A 1OVGA 4YXWD 1H66A 2NUTB 4EFEA 2W2MA 2NUBA 4M1OA 1M2KA 1QBZA 3VVCA 3RW9A 4D4HA 1CE8A 3SQNA 4NFHA 2X0LA 3U0BA 3QMMA 5FOUA 1XRPA 3ZGYA 2VWJA 4Q3AA 1OXBB 3LWZA 2ODPA 4BNNA 1E5VA 1GN2A 2OBMA 4UAGA 3C3SA 3OM3B 1G20E 4ZIRA 4O2AB 3GLGA 1ISGA 2P9JA 4ZYUA 1VG9B 1JDTA 2Q68A 2FH5B 4NHOA 2UYQA 2YV1A 3KOUA 4E21A 2A0UA 3WIVA 5BMVB 5CXSA 4D2IA 1UC5B 4TN5A 2NM0A 1OV4A 1B15A 3OFND 2XCOA 2E4XA 1RVDA 3GQBA 3CNBA 1X7XA 4XCXA 4U2EA 5K4HA 4FLWA 3GCDA 3KPUA 4C21A 5C46F 4D8VA 5G1NA 5IM4A 1ZOPA 1Q6IA 1PSZA 1Q1AA 3EZFA 3LC0A 4J43A 3N3AC 1T4DA 1PJCA 1FVFA 1R64A 1XO1A 4XQ9A 3M2TA 3SC2B 3F7MA 2DKOA 4FDMA 5FJ4C 4EO7A 2WA4A 4WOKA 1PGPA 2AXEA 1LTKA 1F7UA 1UMCA 4MYDA 2GDZA 3I23A 1P9WA 2L19A 1XVLA 1Y5LA 2FMXA 1L5OA 4XASA 5IT0A 3RW0A 1GRNA 4B44A 2B3DA 5EJ5A 3WMFA 1M2EA 3K0AA 5EKUA 3TXSA 1ZGGA 1GPUA 4YUYA 1NRJB 5GOZA 4L5YA 4LFAB 2WIAA 4RQUA 2C61A 1E3MA 4NLLA 1WF6A 3FM9A 2HA3A 4AN4A 1TW2A 3GHHA 2NGRA 3VIUA 1OFUA 3JWHA 1EJ6A 3RYIA 3ZHRA 1A7UA 3RIMA 2P5SA 3OM9A 2IYWA 4HNAB 3KR2A 3A9CA 1KC3A 5BW4A 3FHOA 4JT4A 3DW3X 1KAEA 3BB4A 3QFHA 4KXQA 5JZBA 1M9NA 3E1KA 2ZB3A 3IAXA 1XBTA 5K2OA 3RRNA 1QANA 4UM5A 1UBEA 4RY2A 1UJ2A 3PUWA 2P2NA 4MHTA 4Q4JB 1DJQA 1L5HA 4L3VA 3CY6A 1QQTA 1DUVG 1CV2A 3DVRX 1LS1A 2VOJA 4EJ6A 2W83A 2JFOA 4J11A 3LW7A 4ZT3A 1QRUA 2GNPA 1Z2GA 3G2JA 1DAGA 4P3XA 3PYLA 1MD9A 3ZRXA 2V65A 2CLDX 2PJUA 3F73A 2QU8A 3M82A 4ECEA 1E4EA 4OK5A 4B7CA 5A1JA 5DMXA 2GETA 3M6LA 3DYBA 2DLNA 2QRPA 3GVMA 2NZYA 4RUKA 1FNDA 1KI6A 2F8SA 4G1UC 2PS3A 1M1YE 2GSWA 4Z4CA 4GX2A 5ALUA 4FXOA 5TQ0B 2IP1A 1JX9A 2JFHA 2H6EA 4KGZA 1C7ZA 2REOA 2QSUA 3W5BA 2GRAA 3PHGA 2NQTA 4NNOA 2SNIE 2CLHB 4ZI2A 5JYCA 5LP6A 2EL9A 1HDZA 3FNHA 4EQ6B 3VPHA 2Q46A 3OPQA 1XMPA 2PYIA 5H7XA 2PZAA 2LCAA 1T36B 1H8HA 4S24A 3IT0A 2AXTZ 4BS9A 2PKYX 1LDYA 2VQFO 2ODEA 1DIAA 1Q1GA 3E1YA 1CK2A 3QITA 3EFFK 3PEEA 4D4JA 3DEHA 2XSZD 1Z0AA 4DA7A 1JHUA 1C5KA 5LP6C 4OBWA 2GNAA 2IEBA 4HGZA 1F0NA 4IGFA 1H4TA 2RHGB 2WIBA 2H2AA 1P31A 3ZN0A 2QN6A 1IN7A 3LVQE 3WYNA 2IQQA 2OV4A 3BS4A 3NH9A 1YC2A 4YMVA 4ACBA 1DUIA 3LSUA 4QRDA 4R1SA 3ABRB 3M4YA 4ESHA 2GD2A 4GPD1 1GPH1 5AOBA 1W48A 4WADA 3ITEA 1ADBA 1W8DA 4AECA 1T26A 2C9YA 3LA8A 2QTVB 5JFGA 3Q4HA 4NXMB 1I2ZA 2O57A 3NJ8A 3GB9A 3KG2A 4EPYA 4JODA 2CUGA 4KBYA 4JJ8A 1SEVA 2GQ0A 3CRZA 5K0GA 1N8RW 3WGOA 4OJNA 2EW8A 5L4SA 3JSLA 3CW2A 1RT9A 2ZJYA 1QGED 1Q0LA 4GUDA 1K7DA 4G4IA 2OK7A 3WL6A 1ZMBA 4BX9A 1EK1A 3GLHE 1BVYF 2X8AA 3OQHA 1Z15A 4H9GA 4MUXA 3H9QA 1XDZA 2Q3JA 4YCSA 3Q3IA 1R7RA 1ZD1A 3N2ZB 1M2FA 3Q5EA 2Q6VA 1ZMXA 2PU7A 4UPVA 5FA5A 4AY6A 3NPMA 3PFKA 2JGRA 4IZIA 3KVNA 4QE3A 4BT7A 1BFUA 5JHHB 4QXMA 5LHHA 4CQLB 3P0FA 2EGUA 1JR3D 2QTAA 3QXJA 4I5GA 4J91A 3JCMM 4NICA 5C35A 3SYRA 4DIDA 3SIVA 5KX5F 3L7CA 3DMNA 3LHFA 3V4SA 2A33A 4FMCF 1EKXA 2JVIA 4KFRA 5AVWA 4RTPA 2WHYA 4YMHA 1ZQ1A 1IY2A 5I4KA 1QIHA 1U3UA 3ORYA 2QY9A 2E5LB 4ZAXA 3DBHA 5HJ7A 3G0HA 5IARA 3FE2A 4PLVA 4CTNA 3LHDA 4IICA 2IJJA 4XLTA 5SV2A 3I9V1 2E4ZA 3C1UA 3NBUA 4L8LA 5JMOA 3LXRA 3GPIA 4HD8A 1CR6A 4XVUA 1OYYA 1DK1A 3BWMA 3N3BC 3KHSA 4U5XA 1GCGA 1MOFA 2QQEA 3AIIA 2VBCA 2H1SA 2X1LA 2ADMA 4HWTA 1ETUA 1G55A 3IFXA 3ZXYA 4UZSA 2HUNA 3ICWA 3E61A 4EG8A 4DB2A 4EW6A 1NJ6A 4ZMBA 1UKVY 5DSXA 3QTYA 4FYKA 1XVUA 2H8EA 3VAZA 4A27A 2QJWA 4Q1BA 1CX9B 4IDEA 2JLUA 3K31A 3S29A 1SNYA 1VQ4F 3JVUA 1VP9A 1I80A 2ISQA 3AWIA 4DSAA 3Q3CA 1U3CA 1ONBA 1OF1A 2ZIWB 3LSSA 1WPRA 4M1ZA 2DQYA 2EJTA 3BAFA 3CJRA 1RXCA 2WWYA 5L3CA 1KF0A 2IYSA 1U31A 2IHKA 3C7DB 1BO6A 2NUPA 3L7MA 2JIZD 1PWYE 5H6QA 5K20A 4X41A 3DXXA 4HC4A 1J5EB 3INTA 1Y7HA 1WDTA 3NORA 3CT6A 3IPXA 3JY6A 3PRJA 2RIRA 3EVKA 4GKKO 1OB2A 3A8TA 3F5SA 3W3AA 5BXZA 4LC9A 1ISFA 1APBA 4MPPA 3EN0A 3JZMA 4GOLD 2ISCA 5JZMA 2CFSA 1D1QA 4JJ4A 1OLSB 2I2AA 3KBOA 3VYUC 4KUGA 2DGDA 3DTUB 4NCBA 2UVQA 1E66A 3P0IA 2NZJA 3T9FA 4E4RA 1MAWA 1X39A 1ROPA 1JA0A 3LFOA 5BOSA 3NXKA 3BC1A 3OD5A 2YFQA 1X1AA 3JAKA 3VA7A 1NXPA 2H7CA 2OBYA 5ALQA 1EMDA 4ZO4A 2P90A 4DIKA 3S27A 4AJ4A 2QRUA 3D7KA 2VK4A 1F5NA 1PR9A 4CM9A 1V25A 2UYKA 4Y6RA 4UBKA 3GBPA 4D80A 3VAAA 2CDAA 1V45E 2NSLA 4UHCA 5FPTA 5AVTA 2OBFA 3I53A 4RK4A 3ELCA 4E22A 1IYZA 1JW9B 1YJ9F 3IAEA 5D6NA 1EFRD 2B25A 1FJGB 1M75A 4AKGA 4KQ9A 5EZ6B 5LYYA 1W59A 1IY0A 1B06A 5I7HA 1MRNA 3FYCA 1Z6YA 3BAZA 3WWCA 4DF3A 1K9VF 4XSGA 3VO8A 1EHYA 1BHSA 5GIPC 4GI2A 1M5RA 4I5IA 4QUBA 5GY7A 2QT1A 5HKLA 3V4DA 1M2OB 1GZSA 4CUZA 3CZAA 4MR7A 2PH3A 1BQEA 2QE7D 3ETCA 4IX9A 4Z4FA 5I45A 3RE1A 4JT2A 3EQZA 3BFKA 3WRXC 4FN5A 3E81A 5HF5A 1ZXXA 1HLFA 3GZJA 1YEWA 3QG5A 5KUKA 3GFSA 4HQ6A 1XPOA 1E9AA 3F3SA 4UASA 5AVXA 1G64A 4OHXA 3VU9B 3NTQA 1FUKA 1DXQA 1GPKA 4BVKA 2Y4NA 1YE3A 3ZWBA 5K99A 1QSGA 5EJ2A 4NCXA 1QHHB 4WKNA 1V6AA 2PH5A 3ECAA 5I9LA 2ZRJA 3GO4A 1NV9A 5FWXA 1JCHA 3KT0A 4FONA 3OZXA 4YRCA 3O1HB 1H8HG 4N40A 4ZOLF 3ZLBA 3VH1A 5L9AA 5A6SA 1CB0A 3IRVA 1SC9A 2MWMA 1T5HX 4PWZA 2D0DA 4LX0A 4ZVVA 5CBPB 5D5HA 4MVWA 2BSKB 3U48A 5CNIA 4YFYA 3HI4A 4GX0A 1R6BX 4I3FA 5L3RA 3GX1A 1AS0A 2DQZA 3CH4B 1QWSA 1VLVA 3WKCA 5BW5A 1SZXA 1TPZA 3ZMSA 5IRCD 2B21A 3M6WA 2YRWA 3LQ1A 3KQMA 2B34A 5JTTA 4DCSA 3ZLJA 2FMTA 1JWBB 2YJ6A 1U4OA 1W2HA 4DK0A 1L5ZA 5CU7A 1W5SA 2DUMA 6GPBA 3U3KA 3IIMA 5ESRA 4EBFA 3IP6A 4D4IA 1Z6AA 4PEVA 3LWNA 1EEHA 2Q50A 1XTJA 4ERXA 1C7EA 4PHGA 4O5OA 5BPHA 3IP8A 2YN4A 2CY0A 2O8BA 5THKA 1MMFB 4FT4A 4B08A 3DPIA 3E53A 2HN9A 1EG7A 2RJ3A 1GO2A 3IQXA 4IXNA 3B38A 2WHPB 1S9HA 3U4CA 1MT0A 1DXHA 1XZHA 2VI5A 4JLSA 2OVFA 4G4JA 3GC6A 3GFFA 4KH0A 1J70A 1XN1A 3ZCPA 4F3TA 4YCLA 1VB3A 1ODKA 2BGGA 1E6WA 2AQIA 1QAQA 1WWKA 2ZSFA 3CZ9A 5EGSA 3Q0EA 1SF9A 3WO1A 5EXXA 2AMJA 2P9EA 2JVDA 1XQWA 3T5AA 4ZZ3A 5FOVA 1YVWA 4G4WA 1W0JD 1GGJA 3U6KA 1YJBA 5CXUA 3H4VA 3GYGA 4JB8A 2JDID 2IF0A 3WR5A 1ZGCA 5EJGA 5DE3A 1ZYUA 1QS0B 3VX3A 2DWDC 4LCUC 2DXIA 1GSAA 4QOEA 1WW3A 3W7UA 3RIGA 3RTBA 2SBTA 3MT8A 3TRDA 3ANXA 1AVTA 3TW6A 1TPYA 2XNDA 4WA7A 1D2EA 2CTRA 3HL4A 1ADCA 1JAIA 4CH3A 2BP7A 4PZLA 3TQCA 1NRWA 1CQJA 1OJ7A 3ETGA 2GZMA 2WAAA 3T52A 3DKKA 1E7QA 3KYBA 1AZWA 2WG1A 1W5EA 5JAPA 4FC6A 3WOHA 2GEJA 1V4NA 4V3CA 3HXOA 2FQWA 2W2VA 2YC4C 3EXEB 1MG1A 1FX0B 4PA6A 4ENTA 4MP3A 1BGYH 1JU3A 3PDIB 2DFNA 3AYXB 4ZQCB 5E4JA 4PGAA 3CCJV 4FZ3A 1JECA 3SM3A 1LPBB 1D4AA 3GUYA 4S1OA 2W90A 4OH1A 3BKWA 2RBGA 4NKRA 3V1MA 1CJKC 3NBZC 1PTJA 2H63A 1OBOA 1Q90D 4WY8A 1U8AA 1EFLA 4ZV9A 2QN7A 3RJZA 1XMXA 1KZ4A 4TLCA 4RENA 1YVEI 5CA1A 3FOWA 5BORA 4CM8B 4AF7A 5HQ3B 1K6JA 1PNKA 5B1IA 3O9VA 1C9KA 4KGDA 1DRVA 1Y1PA 4HNSA 4U6SA 2ONYA 1US8A 4FZ1A 2HP0B 3T5DA 1NBAA 4TT3D 1XYVA 5TB5A 1JPJA 1PNQA 2P9QA 4CEJA 4IIJF 2PZJA 5B4TA 2Y69B 1FDOA 2BBSA 1G60A 4LOIA 1KC8W 5I7WA 2QP4A 2ZAIA 1U81A 5JAOA 5FA6A 4M86A 3KCXA 5K03A 2UYJA 1MIOB 1KEVA 1K5DA 1IV1A 2ZGVA 3BPZA 3WJ1A 3GJ3A 1P4RA 2XAQA 1I1HA 1JIVA 3I1FA 4TWAA 1D4ZA 4O4IF 4ZVRA 4U9HS 1JJOA 3SHWA 4RQEA 3OPYI 2NAPA 4DIOA 4IWNA 3GLIE 4JPRA 2WTUA 1GA4A 1DT5A 4QT4A 3AEQB 2VZEA 3BDAA 4D9GA 4UVGA 4ZFNA 3EWSA 3TEMA 3IKLA 4M49A 1TTQB 3OONA 1Q44A 1O77A 4YEDA 3G59A 2L2QA 2DY0A 3FHJA 5IU6A 2PX3A 2VJOA 4HYOA 4PBTA 3I2YX 1Q3EA 1IE3A 3C5VA 4YRPA 4HPXB 4L27A 4I5SA 1QGYA 4AS3A 4X45A 2HF2A 1RKUA 1IBCA 3T7RA 3I9NA 2C7RA 5IT9M 4I14A 3LPNA 1UI9A 3GEEA 3DFMA 2PR2A 5GADl 2BUCA 4LBZA 4IDBA 1TYAE 2E5FA 4N1AA 1UDCA 2WZDA 3Q0TA 1NJ1A 2WFLB 4DV2B 5GINC 3AU8A 3GWOA 1WQ3A 1KTVA 2VJAA 2CLKB 4M83A 1FXWA 2D3OW 4QSHA 1Y8QB 3O8BA 1VOTA 3FIUA 5H68A 2QWOB 4WK6A 4CG1A 1G19A 3P10A 1VJ0A 3BIOA 4V0ME 4G0QA 5E1OA 2HAEA 1MAVA 1NTZH 1FMLA 2E3CA 2BTQB 1JR3E 4RSMA 1CUXA 4WUVA 1EP9A 2X0JA 1C0KA 2N9UA 4X1YA 5IAKA 3CUYA 3K57A 3PWTA 1CCWA 5EVCA 2I1LA 1AK2A 2PLNA 4D8UA 4F72A 4YRRA 3K4PA 2DKFA 4RIGA 5JH7F 1TFUA 1EPUA 2QT9A 5BWNA 5LDDC 3HSSA 2OSBA 4XJSA 4CDGA 5DGXA 1MPXA 2A3RA 3OO0A 5AW4A 1FJHA 2VPIA 1J0AA 5ALLA 4P0PB 1MA0A 1X7GA 1VQ6F 3VKFA 1G8HA 2QLTA 3MFQA 5EQJB 4ID3A 1LSJA 5AFSA 2AMYA 1XWWA 1VMEA 2VPTA 4R2KA 2ARHA 2JFZA 3KE1A 3KE8A 1Q0RA 4E1AA 3P9CA 4BW0B 2FWBA 1V5FA 3L40A 5H9VA 2DUUA 5JS6A 3FPIA 1M6YA 1PWEA 5AUQA 4P81A 1E7MA 5CX1B 1GCAA 1KYZA 3I8XA 5EZQA 1Q7RA 4QQNA 1U02A 3K5LA 3QWHA 4N39A 3L72H 2ID7A 2XIJA 3UAZA 1W85B 2B7BA 3D31A 1IHUA 2YOFA 2QTFA 3KD2A 4TKMA 3W6UA 5FR1A 1ULHA 5BUSA 3REFA 3Q15C 4EUKA 3KLNA 2IQIA 1E63A 2BKVA 4A36A 1TU3A 4BZWA 3V7YA 1YS1X 1ZIXA 2V6MA 2OGZA 4XPZA 1UEJA 3AEKB 3ESDA 3PGMA 1PFGA 2NO4A 1T6ZA 5C34B 4EHHA 2G28A 2OVBA 2IH5A 1P7ZA 1DAHA 2D4AA 4KMOA 4QEKA 3HEMA 4I0WB 2XAGA 2BGJA 2ZBQA 5HE9A 2BH2A 4JYAB 1E8NA 2NT3A 1V4BA 1GPBA 1FXVA 2NN3C 2VHCA 2OYRA 3ZDRA 1P1CA 4X44A 3D2AA 4YLEA 2CC2A 1P1KA 1WVMA 4MYRA 2H5EA 2A30A 3W6PA 1OXTA 1WBDA 1IAQA 3W77A 2BR3A 2ZJ3A 3D1VA 3FVWA 1KXJA 4KOEC 3IE1A 4LBVA 1PZGA 3PNSA 3DE5X 2Z56A 4KDEA 2VRWA 4JZYA 5LUAA 2C5GA 3PV0A 4J29A 4REOA 4N0PA 4E5VA 1VQ9F 1QIIA 1QB7A 4MTCA 3T9BA 3G67A 1KDTA 2QBYB 3JQBC 1QDEA 3NRBA 2B0CA 2AJ8A 1E77A 1RJFA 3AR6A 2ZUFA 4AO7A 5ALYA 1P4JA 2Q29A 5F9HA 3R6DA 4J07A 2XNDG 2LBTA 1WE2A 1NPDA 2ASEA 4NAUA 5C37A 3RC7A 1DC8A 3ZBUA 2EGHA 4LF9B 2FC3A 1OD6A 1BX1A 2O3UA 3SX0A 3UMSA 1NURA 5TLSA 4GXTA 4MW7A 3KZXA 4GM1A 4G8JA 3DWEX 1P4SA 4RTRA 4M0CA 2ZJ2A 1TC1A 1J1UA 421PA 3JQQA 1GAJA 2XD4A 5EQTA 4LFCB 1CF4A 3GNTA 4EATA 5EJ9A 4Z9BA 3T7CA 3H7AA 3LM8A 2EHJA 1I10A 2VTBB 2Q5QA 3FFBA 3ZHVA 4ZEWA 4GM0A 3LDTA 3R8FA 1L1QA 3U3XA 2I3ZA 4FD3A 2XCQA 2CE2X 3OP4A 4BCBA 2XOKD 2Z2ZA 1NDUA 3LE8A 4IDDA 2FEKA 2UUBB 1HYQA 5IANA 3L8YA 5KTMA 1OLUA 1BZKA 4QGHA 4EMSA 1RQXA 3BD9A 3H5NA 3Q7PA 3LUCA 4FILA 5TC4A 1L7VC 3AIMA 2L42A 4H1TA 5FOQA 3HH8A 2OSVA 1EX1A 1N5IA 1TUBB 3S0YA 1CKEA 3WGKA 1VKHA 2G8LA 3OZBA 1GQSA 3VAYA 1A82A 2BEWA 4KLNA 1V39A 1R8QA 5DTQA 3G2QA 3FB5C 4TWJA 4YPFA 1M76A 4TXJA 2HHHB 5DDIP 1TW3A 4XWWA 3OU2A 2OTLF 3KT6A 5SYAA 2BT4A 3MBKA 4ZIBA 2VF7A 4F93B 1Y74A 1IHOA 4UULA 3PE6A 1G4HA 2GN6A 2PRYA 3MQ2A 1V16B 4LMRA 3OM8A 5A5DA 5U9CA 4F4IA 3AV0B 1CZOA 1SQ6A 2IYXA 3C98A 2WLIB 5LYJF 4JJ6A 2JKYA 2XA1A 2L69A 3B7PA 1CR2A 4RWZA 3QEMA 4I81A 4ZTBA 1MX5A 4ZRMA 3VYSC 5A9GA 1B8NA 5JAIA 5LQUA 1SRYA 3L8FA 3R3WA 3KZ1E 1IUPA 2Q8NA 3CF4A 2F1OA 3ZG6A 3KZCA 4HEJA 2C95A 3GEPA 2YEVB 1NVBA 1NJ8A 2Y67A 3UB2A 2VRZA 1J22A 2DT4A 1CVLA 4GG1A 3DOUA 1FNSA 4MITA 1RLUA 4DCGA 2EIJB 5CFOA 1E1RG 4H0LB 1X2BA 2C5HA 4UCQA 2W2NA 4E5NA 5EZYB 2FSVC 3G2IA 4FCVA 2JBWA 5KOYA 1SM4A 4KQEA 4EKGA 1PL0A 4NTXA 2DERA 3IXMA 1G21E 3N39C 2RHJA 1X42A 3KVYA 2VUIB 3I4CA 4O1IA 1F2VA 1EUQA 5FEMA 3OTFA 2QZSA 3VI4B 1KFJB 5HKKD 1J9ZA 1NU1H 2WMNB 5IDVA 3BG5A 1WJZA 5J1SB 1A8PA 1TVKA 3PQ7A 3GEBA 1M34E 4YMWA 5C8ZA 5TEVA 2YUAA 2IYZA 2VK8A 4RGVA 4MUMA 3L5OA 3TZCA 3AHJA 1QV7A 3X1WA 3AG4B 1AUQA 3PE3A 3V7WA 4BMSA 1QO7A 2BFPA 2VT6A 1EUZA 2R1UA 3GDOA 2ABWA 4KW7A 1R0KA 1RWBA 2FDCA 1U3WA 3GA7A 3UG7A 5HP4A 2ZTVA 2YXZA 4D7SA 3Q8LA 4ZYYA 3C74A 1Z34A 2RK6A 4AK9A 4F7DA 4JLNA 1U7ZA 3B5JA 1PX2A 1IY8A 2HHLA 3R0QA 3GYQA 3L4JA 3EORA 1W44A 3WGYA 2VF8A 3N8NA 4Y2HA 2CDBA 2AQKA 4KACA 1V48A 3RYCA 1LLQA 3IQDB 3F1KA 4LBEC 5B12A 3KJXA 1Y9EA 5EQFA 3H01A 2YFHA 3EXFB 3P0HA 3ECSA 3BMQB 1YULA 4JGIA 4R3UC 5B1BB 3RK4A 2JFWA 5KYYB 1OCCB 1QBKC 4KIWA 1MQSA 4QQKA 3LX4A 5HFMA 4WKCA 5D1NA 2AC2A 3T3MB 2GVNA 4UQOA 4YJGB 2ST1A 1VKRA 1CLEA 1D2DA 4UQPA 5BURA 4Z6KA 3I9MA 4IBOA 3UK1A 4V0QA 2ZITA 3L7DA 3EFOB 4KK4A 1UBNA 4ZHQB 4LJKA 2RMKA 1FCJA 2YDXA 3K09C 3DZBA 4DHEA 4Q7MB 1K86A 3PD7A 2CNDA 3QM1A 3GVXA 3RVPA 3M6MD 3BFXA 1DNPA 1GFWA 1HT2E 1AMOA 4NQZA 3PFHA 2DQ3A 4H7FA 2J3LA 1W57A 2ZRFA 4ON9A 1U9ZA 4PAWA 4OGGA 3KDAA 3C15C 4RULA 3FWKA 1LW6E 1DIOB 4JYBA 3B20A 1X7DA 2NN4A 3L7OA 3Q41A 3K1AB 1QZZA 2G25A 2RKWA 3A9RA 5KVCA 4EG5A