5ITZB

Crystal structure of the sac domain of cpap in a complex with tubulin and darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNAKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Centriolar CPAP/SAS-4 Imparts Slow Processive Microtubule Growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 172
structure length 420
sequence length 430
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5itzB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5itzB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5itzB01
3JAKA 5CA1A 4U3JA 3HKCA 4I50B 4I50A 4IIJA 4O4HA 4YJ3B 3VO8A 4X1KB 2RHLA 5J2TB 4O4JB 1Z5WA 4O2AB 5CA0A 3RYIB 3C8LA 5J2TA 3WGNA 4B46A 4I4TB 3M89A 5LP6B 5JVDA 5IJ9A 4TV9A 4EB6A 1RQ2A 5J2UB 1W5FA 5JVDB 3VPAA 3UT5A 5LP6A 3N2KB 5LOVA 5IJ0B 3VOBA 3N2KA 4YJ2B 3JATA 1RLUA 2GVIA 3VOAA 4DRXB 4I55B 3JALA 4FFBB 5LYJB 2VAPA 5KX5B 1W581 4O2BB 4ZOLA 3RYFA 5LXTA 3N2GA 4TUYB 3RYIA 3RYHB 5CA0B 3JASA 5JH7A 1W5BA 3N2GB 4WBNA 5IYZA 1JFFA 3HKBA 1OFUA 3E22A 3JAWB 1FFXB 2VAMA 4TUYA 3WGMA 2RHHA 4B45A 4TV8B 1W59A 5IJ9B 4EI7A 4O4IA 5JQGA 3HKBB 1W5EA 3WGKA 3M8KA 4U3JB 5C8YB 3JARB 4X1YA 4ZHQB 5ITZA 3RB8A 3JARA 3VO9A 2VAWA 2BTQA 5FNVA 4ZHQA 5ITZB 4O4HB 2RHOA 2RHJA 4U39A 2XKBA 2VXYA 4I55A 5MN4A 1Z5VA 4O2BA 1TVKB 3UT5B 4FFBA 4I4TA 4X1IB 4EI8A 3JASB 5CB4A 3CB2A 5KMGA 1RQ7A 4KWEA 5CB4B 4YJ3A 3WGJA 3JALB 5LYJA 4IHJA 5EZYA 5EYPA 4X20A 5JCOA 3ZBPA 3R4VA 4F6RA 4ZI7A 4O4LA 4TV8A 3V3TA 1JFFB 5IJ0A 4LNUB 5BMVA 5EIBC 4F6RB 4ZI7B 5LXTB 5LA6A 5JQGB 4IIJB 4E6EA 2Q1XA 1TUBA 5M7EA 3JATB 5EIBD 3JAKB 5JCOC 5LA6B 2R751 2BTQB 5FNVB 4X1KA 5LP6C 5CA1B 5KMGB 4O2AA 3RYHA 2Q1YA 5GONB 1FSZA 5EYPB 5J2UA 1FFXA 3HKCB 3HKDB 5BMVB 4X1YB 3ZIDA 4LNUA 3ZBQA 5C8YA 4X1IA 2XKAA 3HKEA 5KX5A 4DXDA 3HKDA 5MN5A 4DRXA 4ZOLB 3RYFB 1TVKA 3RYCA 4M8IA 3WGLA 2BTOA 4WBNB 5JH7B 4O4JA 1W5AA 3RYCB 1TUBB 1SA0B 4HNAB 4TV9B 4EB6B 5MN6A 4O4IB 4X20B 4YJ2A 4XCQA 1SA0A 4HNAA 4IHJB 5EZYB 5IYZB 5GONA 3E22B 3JAWA 2R6R1 4EI9A 3HKEB 5LOVB 4O4LB
chains in the Genus database with same CATH superfamily
1FTSA 2C83A 4GZLA 5EUBA 1IHUA 2Q4BA 3LYAA 5JT1A 4EEQA 1X80A 3GEDA 3HCWA 2PLRA 3COPA 3I55V 4M87A 3ITKA 3AG3B 1II0A 1YC5A 1EBOA 3UANA 4BUJA 2A9QA 3S5JA 1SQVH 3ZLTA 2N05A 5EZYF 3L8YA 5GONF 1GCGA 3SMVA 3O9VA 3RNOA 1M76A 4B9AA 2GA9A 1OT3A 1JR3A 3WMGA 1XCLA 5HDBB 1PL8A 3BE4A 4HG2A 4XUEA 3SZRA 3PFIA 3QVGA 2D5CA 2VP5A 1NQAO 5F7XA 4D1YA 3PFFA 2D1FA 1WEKA 4MS3A 3SVLA 1W94A 3KC2A 3NHSA 4OQLA 1JALA 4G4IA 2H7YA 3D5TA 1P5HA 3OOEA 3ZTWA 2P69A 4KVZA 7REQB 1CQIB 2VUSA 1OBVA 1KFEB 2BY4A 1JVNA 2VH5R 3FLAA 3M34A 4YASA 2X42A 1FXKA 4XDJA 5FI5A 1PRYA 3R3HA 4A0FA 3CCEF 3ONDA 4JI3B 4GHWA 4C9BA 1AB6A 1T5EA 1R5OA 3C97A 4LJAA 3B1JA 1M3SA 3LSYA 4Z9BA 3RTBA 4ND8B 1OHHG 1Z56C 3R0QA 3WGTA 2JS7A 1DE0A 1U31A 1ZK4A 2FUCA 4N8DA 3QSYA 4YHHB 1H8ED 2B21A 2B6NA 2Q0AA 5H3HA 3KKZA 5K6AA 3QNMA 4ZEOA 2Z58A 1SKYB 1QQTA 4NY1A 1P1HA 1RZUA 1MVLA 2GUWA 4G4SO 2VXYA 4J76A 4MR8A 3U62A 1R0LA 4JP3A 5DTJA 4EW3A 3CCUF 4Y6SA 4EATA 1Y37A 3KKMA 2POCA 2ZE6A 1UI9A 4WLFA 4X91A 4Q4AA 4PHTA 4RANA 3NT2A 1I1NA 2AQKA 1VGVA 3VR3D 4BJ5A 3MD9A 5KVQA 2WWRA 3ZZTA 2G9IA 1VQ9F 4PWZA 4UXJA 3THYA 3WDKA 3CSXA 3VPXA 4E21A 1RAEA 5ALRA 3ONNA 1H3FA 2XV1A 4L9SA 3TR5A 3WC4A 1EP3B 1FRQA 3HMQA 3L7IA 4FZVA 3N59A 5BUZA 1GTZA 3IEIA 4AK9A 1HT0A 1DAFA 1F2TA 1O96A 3KVNA 4P7KA 3UKJA 3CF4G 5B1HA 1XQ8A 3WA7A 3F6SA 4OK3A 5K0NA 3TFQA 3AVTA 1SQ5A 1SVSA 2CKDA 1BG6A 1PJTA 3DZIA 3LM8A 5JADA 3W78A 5KQPA 4IV8A 4EAQA 4Q12A 3PNOA 4TOIA 1UEIA 4HYYA 2RGYA 3HDTA 3K3WA 3O47A 1VGRA 1GNVA 1FVOA 3BMQA 5LL6P 3PUZA 2VSFA 4JV5B 4FKZA 2Y69C 3T3EA 3WWPA 5KTPA 3FZGA 3ENZA 5EYPB 5GV7A 4J3NA 1KZ7B 4R4JA 4D6YA 2ZUDA 3NASA 1KMHA 4ICIA 4K6OA 1WMSA 5ICCA 2VHTA 2X8LA 1PE0A 4NG4A 1WB8A 5CM2Z 4BU1A 3DDUA 4WLEA 2EU8A 1IK6A 1FXVA 4F4IA 2X9QA 1MMMA 2Q7HA 1IVYA 1T8YA 2P4UA 4CKCA 1I32A 2UYNB 4DKJA 2IXBA 3D3NA 2Q29A 2BFEA 3IVRA 3B51X 1E9EA 3MJCA 3IHWA 4B4UA 3M9WA 2HEPA 3ZHSA 2B78A 1JTFA 1C29B 2AQHA 4IDCA 4R83A 3OJOA 1YBMA 2H92A 3LXUX 3DEKA 4PZDA 4X8HA 2ZD9A 5EZYB 5EPOA 5JY6A 2CMGA 1G4AE 1XRPA 2JB9A 2P2SA 3ECCA 3K5MA 3E1KA 4M0PA 4RABA 3O8NA 5FA8A 3SHQA 1L5WA 3U44A 4TXMA 1ESMA 3ROQA 4O4LB 1O0SA 4LGYA 2RBGA 2IEGA 1V25A 4C4WC 3WGUA 2YJ3A 4U3FH 2ZRPA 1W0KA 3V42A 1EE1A 3VI3B 1M1YA 3LC2O 4LK3A 2I6QA 3F1LA 1NPDA 1EK0A 3PSAA 4B7CA 2C8VA 3PHJA 1J1UA 3I01M 1V1RA 2WU0A 1R3JC 4AKTA 4DCTA 3PDIB 1YR9A 4TSFA 2W0FC 2BBSA 3BFKA 3UQ8A 4BWGA 5CCBA 5HJ5A 1FXWF 1WU7A 2AXEA 3NC4A 1CZKA 3R5KA 2PHZA 4RDHA 5HZGA 3CJHA 1OV6A 4AU1A 3SEQA 1JHYA 4Y6PA 1G5HA 3BL8A 1SCDA 4KXNA 1QTNA 2FPOA 1Z2GA 3J7AU 2HKOA 2QQFA 2N04A 1RXVA 3MTBA 5TPZA 3ND5A 5EP2A 1F2UA 5DXJA 1B2RA 1C14A 4PG6A 2D00A 4F1WA 3W7AA 2ZRMA 3PC4A 1D5AA 3WB0A 2R65A 2QSYA 3B9RA 1OFGA 4HI0E 1AK1A 3QMVA 5IBQA 3NBAA 2FPMA 7ADHA 4LBZA 3EH2A 1FP6A 4R51A 4RJJA 5BXYA 1H2GA 2WLLA 4KWHA 5IJ9B 5GGXA 3E53A 4B33A 3SR2C 1ZCFA 4RULA 5E6RA 3GMDA 3P9CA 4PNEA 3IHTA 2PMFA 4XSHA 5AKKA 1UBKS 4O4HB 2EFJA 2J3EA 4K8ZA 5FBHA 5C4MA 4JKOA 4O3MA 3SYRA 4MI1A 2KJQA 1UDBA 2C2WA 1HQDA 4MVRA 1KQOA 4CTOA 2V7QG 2D2FA 1T9ZA 2J32A 4J7CA 4X94A 3K94A 4URUR 1WB7A 1H48A 3GVPA 1GZSA 4PYKA 4RSRA 5HUQA 2IGTA 5FLXA 3B3AA 4YHBA 4IHJA 2ZREA 1LPAB 1F6BA 1SVOA 5JW6A 1VIYA 1USWA 2TS1A 4FBGA 3ULKA 2BFDA 2XWSA 5I5GA 1F2UB 1U9IC 5AVZA 3F47A 1YONA 2P22C 5IC5A 3AG4C 3FMIA 3EFFK 3JPYA 3QTLA 4ZOBA 1P4JA 3IERA 1R0RE 2GYVA 4DCSA 1MH1A 1NP3A 1O6ZA 2EAUA 2P8JA 3G5LA 5B55A 5HTOA 5JJJB 2AGVA 4NNJA 3KB6A 4LJ8A 4QUDA 5CDFA 3ERCA 3K58A 1I2BA 4XAQA 1A4XA 5AKJA 4GYKA 3LWZA 5FORA 4RQOA 3L5KA 2F23A 1FP2A 2WY2D 3UAGA 1T2VA 1ZGJA 1QU7A 1ODIA 1NI5A 3QWAA 5JS7A 5A2GA 1YS4A 8ADHA 4DF3A 3Q9LA 4LZLA 5L3GA 1J8VA 4IXMA 2F17A 4BQRA 5IDXA 5KYTA 1LBTA 5B1SA 1KORA 4J6EA 2YZGA 2BAGA 5A02A 1VSBA 4C4RA 4Z8XA 2G1PA 1C2TA 2N46A 3BFPA 3M83A 3E7XA 4RCVA 2FSFA 2Y1CA 5CT9A 1ADBA 1VJDA 2EIJB 1AMOA 4ER5A 4UVCA 4CLHA 1NMQA 3UMRA 4DOMA 2UUCO 2DECA 1KBZA 1A71A 1T0BA 1WCYA 3G1TA 3O85A 3QKRA 4KXXA 3GLGB 4X66O 4XYMA 1IN5A 4IWXA 5H59A 2PRZA 4FE3A 4MKZA 5T6MA 4MCIA 1ZM3A 2H4WA 4AY2A 3T3DA 1GRJA 4YUAA 4NI5A 4H3HB 4HWRA 3FAKA 1DAMA 1WLSA 3JQGB 4WZZA 1ZX3A 1S89A 1XP5A 2QIOA 2XQFA 3DNFA 3OESA 4GBGA 4JELA 4JWKA 1Z62A 1JF8A 1TO1E 3CLRD 4JD5A 4YMWA 3DCYA 3CWZA 3E2PA 1QLEC 4JJ4A 2GCOB 4FYJA 3AFOA 1Z5NA 1J06A 2YN0A 4DMKA 3KZXA 5DYIA 1RYDA 5DN6A 1Z82A 3EF1A 4M8KA 2E4VA 3RV3A 3WMWA 3AILA 2CDBA 4WDQA 1QAOA 5IBPA 3CC7F 1I6LA 5IDVA 3ZV7A 1MJGM 1TCUA 2QXTA 3GHYA 4DSAA 3SXJA 3SR3A 1R5NA 4V0QA 2Z3YA 5FUWA 3SK0A 4F9GA 2QT1A 5IY5B 4KH1A 2EEZA 4RTNA 3GLFE 3GRZA 3RBVA 4GLFA 2IP1A 5FADA 2HPZA 2RHMA 3ZE6A 2ZSDA 5JFGA 1H3NA 2EBUA 2QAGC 3JZMA 3OSUA 4N82A 3DXRA 4OQMA 4YAEA 5GZ6A 2YY5A 3TW0A 4B3MB 2VDLB 1JNYA 2AB0A 1JPVA 4UTZA 5ER6A 1Z5ZA 1GRRA 1P18A 1T3TA 3G2QA 4DHEA 1Z4OA 1DLIA 2JGRA 2H4FA 2QENA 3GJ8A 3GLUA 4V0KA 1Q57A 2GVZC 2WHYA 1YIAA 3M4ZA 3WNDA 2C5GA 1M93A 2HA6A 1E20A 4U0KA 3QBEA 1AH2A 3NYIA 5AKHA 4XRRA 2I1WA 1ZL8A 1M7GA 2H1FA 1QFMA 2Q6IA 2IFTA 1PEDA 4K88A 2ZKLA 4Q3DA 4WK4B 1D9ZA 1T29A 3FDZA 3L1JA 1DELA 1WVIA 3M81A 2JCYA 4MVJF 1R9JA 1U2DC 3V7FA 3F73A 2Z9DA 1RBZA 4X1YA 1ZJ4A 1Q6UA 3WISA 2AMTA 1N2CB 1XYGA 1Z4KA 2CMHA 3EVZA 3HYNA 2XKBA 1E8NA 3MINA 4MAMA 2LDBA 3U1TA 3RBAA 2ZIXA 5JNUA 2JGKA 3UMJA 4ZT7A 5LQDA 4PS0A 1Y66A 5IS2A 3AIOA 2HPAA 3LBHA 4NTWA 4Q9AA 9GPBA 1UMDB 3RN4A 3BTOA 2J3DA 1JQBA 2Y71A 3K6RA 3EARA 2FLKA 4LZOA 3SYTA 5L53A 1Q6ZA 2P4HX 2VVTA 5IH7A 1E3SA 1JG7A 4HX5A 3CW2A 1X7XA 5D6OA 2AEJA 3I04M 4LHVA 1XU7A 4CIXA 2JAPA 4A23A 1IZ0A 1XVUA 4C6HA 3VU0A 2C54A 2O2CA 4FDMA 1VSQA 3BF7A 4KPUB 4I4NA 5ES3A 5EUCA 3VYSB 3KCYA 2E5WA 3HUEA 2A33A 2CLCX 2D2IA 3LUPA 2CLOB 3CD6V 3VMFB 4OL9A 3U4MA 1TUBA 1C0KA 3BWYA 3EGXA 5BRJA 3J80N 3DT8A 2DR2A 1EVQA 3CF0A 4LVOA 4NL4H 1H38A 1TVCA 3DAOA 1KVUA 3U4GA 3VZRA 5LXTF 5GONB 3UMCA 2G9VA 4GOKA 1V35A 3HEBA 1FDUA 5EN4A 4Z7QB 2K7ZA 2XUIA 4HY3A 4TXNA 3KQYA 1DLBA 2GNOA 3JQPA 1PCXA 4QOSA 3IJ5A 1X80B 2QZSA 1Z36A 2DP4E 3A27A 3G2PA 1CD5A 4LX0A 4QTXA 3WMEA 1Q1BA 2XCTB 2MR6A 4KQEA 4P31A 1GM5A 1GTJ1 1ONNA 2X8JA 2JHAA 3UV7A 2EZPA 1X38A 4F4LA 2ZJ6A 3OZ7A 2X8WA 4RE6A 5B1NA 4BFTA 2JIMA 3R7BA 2Z6UA 2ZBRA 2UXDO 2OCBA 4Q7QA 3I2FA 1RWOA 4Q93A 3I62A 2BMEA 2J08A 2QTBA 4KDRA 4MUIA 1X2EA 1QNFA 3CIFA 2AOXA 4FHFA 2EIJC 3A1EA 1NM5C 4M76B 4NZYA 4Q24A 2ZE8A 1DMSA 3WGVA 2CWDA 4MTFA 2IIBA 3WWYA 1HDCA 2GDJA 1G38A 3DVSX 3GEEA 1QQCA 2ITDC 1YBHA 4NMLA 5GQSA 1U6JA 3HVUA 4F96A 2FQWA 5GIOC 4M9SA 4RMJA 4EUEA 4HAMA 3O03A 3HH8A 4M0CA 4MEBA 4OYLA 2GXSA 3H84A 4ZAXA 5JJ5A 3TLAA 1DC8A 1NAIA 3Q4GA 4NZPA 5G53C 3AM5A 1YITV 1G59A 4HAYA 1YZHA 3QOYA 1TFRA 1VKJA 1NYQA 3IQGX 4J0DA 4DMFA 2OBFA 5BW4A 4BLWA 3BA8A 1K2VN 1XZMA 1I51A 3GK3A 1NLZA 5FUQA 1RKBA 3JCMM 1A1VA 4MRMB 1RT9A 1TM1E 4G8CA 4IUDS 2X3YA 1E1MA 4Q66C 3DOJA 4UE2A 3L05A 2ZCJA 3DC2A 1E5QA 3CEAA 5EKSA 3ST7A 5A0TA 1TUEB 1Z2NX 4OJQA 1O03A 3GLIA 1YRBA 3NVIB 2AD1A 3PEEA 4TS9A 4JUDX 5JAMA 1K5QA 1YV9A 3FY4A 2EG5A 4NDZA 1KDZA 3A9SA 5C7LO 5H7XA 4CC5A 1IHOA 1E2EA 4EYSA 3RUDA 1BDIA 4G1FA 1GGMA 1NXVA 4DW0A 4BT2A 1EZZA 1LSUA 3HZOA 3RYIA 3GRVA 2QVXX 2G9UA 1JIXA 2VUIB 4I5FA 3ZWAA 3TTTA 1WVMA 1POXA 1K8ZB 3P7MA 4AB1A 4X88A 2WE8A 2ZANA 1ZEJA 2PO7A 3HUUA 1G0NA 1XXHB 4W5JA 5D1HA 2WP8J 3UHJA 2Z6AA 3OEHA 3PRJA 4FW8A 1RYEA 1WU8A 2VQFB 2MHCA 3HJFA 2FFHA 1KRXA 4D9NA 3DC7A 1U8FO 3HXQA 1XD9A 3C39A 4PYIA 3RK4A 2G83A 1JBKA 3OQ1A 4C78A 4LGMA 4B6RA 5HHTA 2GTIA 1BHO1 1VHLA 2YBDA 4KQ1A 3DKIA 4A2QA 5EBLC 3SLGA 1GUYA 1OYWA 5KTOA 4TWKA 1XZNA 2QMHA 5C35A 1W8DA 2HOQA 3PT5A 2A9JA 2H65A 4Y2SA 1G64A 2NMUA 3DMYA 4Z9AA 5TGTA 2NUAB 3V7UA 1VL1A 1ZD2P 2ZT5A 3DB2A 3BICA 1U3PA 3QEJA 4TLBA 2EP8A 1R0KA 2AC7A 2B4RO 3IAFA 1GU0A 4FMDB 5I4CA 1LI7A 1JVSA 5A1TA 4QDKA 2OXEA 3IBTA 4MUNA 4G1BA 1YUNA 4NESA 5ELXA 3K05A 2I3ZA 3COSA 1JUDA 3L0DA 5FR1A 3FE2A 5IF9A 5JH7F 1P2VA 1L9XA 1Q3HA 2ANCA 4JLAA 4YQFA 1LK7A 2A0UA 2WG2A 3UXMA 1C4OA 5ENVA 5JD5A 4FLXA 1Q17A 2IF2A 3H05A 3WG7C 3CWQA 1U40A 3E5RA 3MCWA 3OJFA 4P4UA 4UNPA 4XIGS 4XM0A 5JQWA 3C3JA 5KTYA 3HSSA 2M7WA 4QLOA 3K0SA 4QULA 4WOBA 5K05A 4LNUA 1WKVA 1GQQA 3HN2A 5E2IA 4WMLA 1HEIA 3NJRA 3M6UA 4PYQA 3LKBA 3LYHA 1IAQA 1NP7A 4L5JA 4UQPA 2X0FA 4ZODA 4MUJA 1KAQA 1WV0A 4O4JA 3A1VA 2II6A 3DWIA 3P9RA 1ULUA 4IRUB 2VUUA 4J90A 4NYJQ 1V4VA 2XGSA 3TDKA 4RPGA 3VCZA 4ZRDA 3D5QA 5JSFA 3JSXA 1P4GA 3KYJB 2LBXA 1S02A 5ERXA 3E22B 2EW8A 2Y3IA 4KQ2A 4OV6B 1QU9A 4MPPA 4NJMA 5A0VA 3CCQF 5FBKA 1LDNA 1PGNA 1IUNA 1UKEA 2UZAA 3MF4A 3WFZA 4BGUA 3HKCA 2QAIA 4I50B 2FYTA 1AGNA 3LXXA 4JU9A 3EDRA 5HMMA 5JANA 2EQBA 3K4QA 4TL6A 3RUFA 3HJCA 4GPEA 2XYRA 3KHTA 1YZQA 4RNDB 3L75H 4O2AB 2QU7A 3S44A 1R4MA 2NUPB 2NZWA 4PQRA 5AVKA 2XUDA 3ROEA 4R5MA 5A3JA 2FOXA 1W4BA 3D4PA 4L51A 1SCNE 4QE7A 1M1KW 1QVVA 2RCYA 2TSYB 5DTQA 1AJNA 3VQVA 1AXEA 3P32A 2I1LA 4DCOA 5L9AA 3MQFA 3N0XA 4DMCA 1CNFA 4C4YA 1YS1X 1EUDA 2Z09A 2VHJA 3M1LA 4MPRA 3S2ZA 5L3QB 1XZFA 1T2CA 4NBUA 4MKRA 1YQXA 2A0LA 2ZUTA 4C76A 3PL5A 4MLCA 1T2AA 5EOVA 1HDJA 3IUQA 1YH3A 4OXQA 3NDJA 2IZ1A 1MOQA 1YQQA 3PIRA 4XPZA 3PPWA 4FP9A 5BWCA 3C6ZA 4X65B 1ZGAA 1VQNV 1HUQA 1LUVA 3BCSA 3GFFA 3JCUZ 2HA4A 3C90A 2QEXV 1R6UA 2QG4A 1Z0JA 4QPPA 4P2ZA 3DAFA 3HS3A 4UVEA 5LLSA 3W77A 1OB2A 4KO2S 3WK9A 2ZM6B 4NV3A 1SUCA 2QRPA 1U2QA 4LJLA 4HXEB 1I4EB 4GMDA 4AZ0B 5CYGA 3B09A 5I5EA 4GC5A 1U8XX 1R4NA 2AFHA 2XA2A 2AQIA 3DMPA 3JVIA 5JD3A 3OEEA 3VUEA 3O0DA 3U3JA 4I36A 3LCJA 1GUDA 4TKVA 2KSDA 4IYJA 3R7DA 4EY5A 2JLQA 1FLDA 1SEPA 3AUAA 4DXHA 3IE1A 3V4FA 1AHPA 4ZVRA 4PNHA 2HY7A 5HVNA 3I9LA 4XTRA 3JVUA 2XGJA 4GR4A 3M6FA 2ISQA 3DZCA 4ZWNA 4DR2B 3IJRA 4I5IA 1BCCH 4KN9S 4ZU1X 5LP1A 3I4LA 1OUMA 1U04A 3GA5A 3MJ4A 5DISB 5KQSA 1JMVA 3A25A 5C0OE 4IICA 1KO7A 5DBIA 1ZN8A 2IZ5A 2QSJA 3HMKA 1CFJA 4RZHA 3ZWNA 5I7VA 3DG9A 2XHBA 1BKDR 4IIDA 1KP2A 3BS4A 4X64O 1NU8A 1Y34E 5GM1A 3C3AA 3RROA 2B99A 3M1AA 4KQ9A 5LJLA 1XCPA 3W5HA 2YZ2A 2ESRA 3B1YA 3EIEA 5FNVB 1IL0A 1DKOA 3JZAA 3N0VA 5DW3A 3SGLA 4BKUA 4BNUA 3W5DA 1YO6A 3MN1A 4F11A 5MGNA 4G4ZA 3BWVA 1AB5A 5I9IA 4D9KA 5K0TA 1PJ8A 1DBQA 3C8HA 4WN3A 4RLHA 4TLCA 1LJLA 4PR0A 3A0BZ 3KTAB 3K92A 3M6IA 4JUIA 3CEIA 2GEDA 3K12A 1AF7A 2IY8A 2PSEA 2X5JO 3ORQA 2ODPA 4XOUA 5LUBA 1N5LA 2XQJA 4PYRA 1AU9A 5CX4A 4X89A 5IHPA 3KQMA 3VH4A 2CZGA 1NQVA 2B5OA 1GY8A 1NQOA 4FYXA 5IVIA 2X3UA 3DF7A 2FZWA 4C7OB 1G6KA 3SHFA 4CIWA 2FE1A 2V7GA 3JQAB 3N53A 2Q1TA 1RYMA 2WPDA 2YCLA 4MKXA 5CUQA 1L5OA 1NMEA 4XPIA 4D6PA 5A6VA 4YCCA 4CPDA 1B8PA 2ORIA 2XWQA 4YIPA 4LZWA 4BMVA 3GJXC 1P74A 4W5HA 2GXQA 4OXXA 3QX8A 3RAJA 1SCJA 1H8HA 1E2HA 2KBEA 2NN3C 2ZTVA 4OGQB 2F1KA 4MV5A 2N74A 2ZU0C 1YAJA 2YUTA 4KIWA 4L16A 4L5IA 3TLXA 1R6TA 4PLCA 3VI4B 3R6WA 3GYBA 4DC0A 2NMVA 2G6TA 1SUPA 4BWYA 5AUQA 1L2TA 4LRTB 2D7CA 5JTUA 4B1FA 2REQA 3BCCH 1SCBA 1TLFA 4YJGA 5A06A 2GJKA 4P4SA 4DDMA 5I8WA 4A16A 3N5KA 4E03A 2NU6A 3BWDD 4I1SA 4J7AA 1Y4ZA 4JAAA 5AM1A 4ZVSA 2FRDA 4GZ3A 1HL7A 3B1XA 5CJ2A 4IS3A 5C80A 1MJGA 1NUPA 2GLTA 2IU6A 2R7AA 3NKFA 1HLDA 2X5OA 4IGAA 3P4XA 3WLLA 4P98A 5JSYA 2PX3A 4N0QA 4QFDA 3UKMA 1FRNA 3D59A 3H1GA 3E8BA 3IUSA 3LRXA 1R64A 1J5EO 1Q3KA 1ZK0A 3N6VA 3Q7QA 2P2NA 1QX4A 1H42A 1C0LA 2D5IA 3L0ZA 1QHYA 3SEAA 4B7XA 3FUXA 2K9PA 3TSAA 2XCSB 2UYCA 4DLYA 4Y9TA 1KQFA 3KTOA 4D8WA 5C8ZA 2R6JA 3BMCA 1XF9A 1E2FA 4FHDA 5B6PA 4BVRA 4R2XA 2WMYA 3AY7A 1CUJA 4PTZA 4KAAA 4KL8S 4QXRA 2VP6A 5JYCA 2VTVA 3QLEA 4ZHQB 3BIXA 2WWWA 3A1SA 3FSJX 3OTOO 3LGXA 3EVGA 2AJCA 2AZDA 2W6JD 5J1TB 3ZGXA 4UOEA 2ZROA 3SQOA 2GK7A 1FJGB 1YJ5A 4JIMA 3K9BA 2W2KA 4PDLA 2Z9CA 4QGHA 3F78A 3K7EA 3FVRA 3FMFA 3ZD8A 4AFNA 4ESHA 2PZ8A 2BH2A 3EVBA 1PU2A 4URVR 4KSYA 1K6MA 2M6KA 3OA2A 2OHGA 1TF5A 3R9XA 4Y2HA 5DYGA 5TPZD 1O77A 3W0LB 1NI8A 5TGZA 3QLUA 3K0TA 2E9SA 3CC4V 2CXHA 4QHTA 1AUOA 1HYHA 5BYJA 5TS2A 3RO7A 4WFEA 1VQ9V 1BQEA 4H1WA 5TR9A 4ZV4A 1CUVA 2GD1O 3W2TA 3FYTA 2GXAA 2BTEA 5EJ7A 4JGSA 3BSFA 5E0KB 1C8BA 2HA0A 3RKSA 1H2ZA 2B34A 2VF2A 2NG1A 4IJKA 5D3MA 2CYCA 3H1BA 4J11A 1YE8A 1W2WB 4OH7A 2BTQB 1ZI8A 4IIJF 4WPGA 2K2QB 3GRCA 4PZ0A 1PZEA 4PFQA 3QW2A 5LQKA 1IEVA 5CNMA 4DAOA 5EFOA 1EFAA 3KIPA 3GJSA 4L15A 1G2PA 2PMCA 4JZGA 5J4VA 1DKMA 2UYOA 3FNEA 1SURA 1G16A 1QYVA 2J9FB 3E61A 1JVBA 3IEPA 2DH5A 3MXTA 1AILA 4HNQA 5DHPA 5DHFA 5ECWA 4COOA 4G63A 5L6LB 1XPJA 3PUVA 1GNRA 1NNLA 2ZQ5A 5I9TA 1EEXB 1ZUD1 1Y7LA 2D1YA 2GZHA 4PFSA 5ECGC 4CCWA 4ENVA 4L4ZA 3CPWU 1L5FA 1WUHS 1C30B 4PHZA 1O6CA 4UEOA 4KR3A 2DPXA 3FCYA 4OB8A 1JJVA 1L4BA 2YWGA 3WKDA 4EY3A 2PRKA 2B1QA 4FGSA 4JS0A 2KYRA 2NO7A 4DSZA 4JI6B 1FD9A 4MQUA 1PQ4A 4N5HX 2FWJA 2HJRA 3TKAA 3FTPA 5MDHA 4Z2AA 1GTVA 4H3SA 3F7YC 3OW2F 3C2QA 2O8EA 3LF1A 4BP3A 4MS2A 4R54A 1Y9AA 5IYZB 2G4CA 3QVVA 4WAUA 3WWDA 1I4DD 2PLFA 3HZZA 4OIMA 1I1QB 3BGOS 3GJ4A 5EP4A 3K09C 4NU0A 1XVIA 4ZOCA 2D1QA 4AS1A 1JLLA 2EV9A 3S02A 3CUTA 1A8IA 2PNFA 4NYIQ 4O4HA 3KSBC 3BD8A 2RHLA 1CB0A 1MO4A 2QMOA 4JP5A 3BGIA 4EMUA 4ZARA 2RG7A 2WJIA 4E5VA 3KUKA 3SJZA 1S2NA 3HA5A 1TJPB 3EQ8A 1YR8A 3HO6A 1VCMA 4H9GA 3FB5C 4Y2PA 2W00A 2GNAA 3VR4D 3O8QA 5JWRA 3NVKI 2EFYA 3FWKA 4DQLA 3LMKA 5LGTA 2FPXA 5AHRA 5KQMA 1DQSA 3LPMA 3F67A 2R4TA 2W2LD 3M49A 3J81A 3I9NA 2I8AA 3JATA 3GT7A 1N8RW 1YMUA 4GI1A 3TL3A 3C4QA 4GYCB 4DRXB 1I94B 1Q0SA 2IJKA 4CBVA 2CT8A 2ALJA 1U2GA 1Y48E 1F0NA 4RJKA 2EP5A 1FNMA 5DLYA 3FR8A 5B1DA 4JSRA 2G9NA 3K35A 3GFSA 3G49A 3T9DA 2QA5A 3NHPA 3PQ7A 4RHFA 4PG8A 4F4CA 4HAUA 4F7WA 4H7PA 3AJDA 4ZYXA 4O8CA 1ORQC 3B5JA 2UXCO 1I4WA 2GEKA 5AH0A 1ZK3A 3FCCA 3PFCA 2P30A 4I8DA 4S3MA 3KDSE 5AQEA 5BURA 1MHPA 1Y5IA 2NU7B 2QN7A 2X6RA 2XUAA 3BHJA 3E18A 1FXHA 2YOHA 1JRLA 4AYXA 4PR3A 2R84A 1QP8A 3PX2A 3JQDA 1ISGA 3VI6A 2J45A 3R66A 2E75B 1VIMA 3IIKA 4UAGA 5EJGA 3TOSA 5A5VA 3PUXA 5JZVA 1CP3A 2CUKA 3D3WB 2Y1LA 4PD4F 1ZWIC 2WDPA 3WYCA 3ILXA 4RZSA 1U7OA 1QBGA 4A0RA 4DHWA 4ZKIA 3SDBA 1VE7A 2XVXA 4ZAVA 5AW6A 4E5YA 1L5LA 1TAQA 1GOTA 2BI4A 2ETVA 4ZGGA 3KPWA 1C7RA 4G1EB 1RPRA 2ZDGA 4W4KA 2B30A 2ZWOA 3G4SV 1G8PA 4YT5A 5ER9A 3WLKX 4LYDA 1R10A 1U7PA 3G8AA 3KT6A 4R7ZA 4FT4A 2CNWA 4AJEA 4EA9A 1GCOA 1QZXA 4QUGA 4LBEC 3F6MA 1VHJA 1SBCA 2YL2A 3LK6A 3NETA 5KYNA 3NBUA 3C7DB 5EL0A 2HJSA 1PYOA 4DMUB 1D2CA 2VBGA 2VT6A 3NTVA 3ZP4A 1DAKA 3ELDA 5GAJA 3AG2C 2CCKA 3R0IA 1NBEA 5EJ2A 4Q3OA 1VG1A 3LOQA 1D0SA 1Q95A 1T1GA 1TW3A 2DM6A 3FR7A 4JP8A 4KQHA 3AR7A 1LS1A 3C24A 4MKIA 3SJUA 2IZ6A 4BO0A 4QPJC 1BWSA 5FWYA 4Z1MG 2W6NA 5K20A 4GCZA 1U1EA 3DVAB 3RSLA 3FDFA 4CI0B 1OJHA 2IQ5A 4J3JA 3PTLA 1RAIA 4L07A 3W2FA 2I76A 4MVJM 1PSWA 2LP7A 1HYEA 2C7QA 2VT7A 3B5IA 2E4WA 1S8AA 4NE7A 3RYFB 5TSDA 3BPSA 1V95A 3TH5A 5HRUA 2ZIUB 3BF8A 3L72H 1GZDA 2V5UA 3OGIB 3P4EA 3QXXA 1TZ2A 2NVWA 3HLYA 3L1KA 4MCJA 4X6XA 2P06A 2XE7A 1M4UA 2HIGA 2IYYA 1R4AA 5A6SB 1FCJA 1YFJA 1E3JA 4MKHA 3LHSA 1EDEA 3F6PA 1W47A 4LOAA 4NYMR 2YXYA 4BY9D 3H1FA 3ZY3A 5A6SA 1MC5A 4JEUA 1B93A 3DF9A 5A3RA 4FYVA 2QYOA 3VZQA 1V1MB 3GCZA 2A3RA 3ZDXB 2WQ7A 4ADSG 4TMVA 3RODA 1ZQ9A 1XEAA 3CYQA 4PELA 4JTDB 2FX3A 2Y1FA 4ZYZA 5AVUA 1GM7A 1OLUA 2P9CA 2YUIA 3FLMA 4NZOA 4EGJA 3PDCA 2AF4C 3K70C 4GC9A 2XNCA 1TIBA 2QTHA 2DQZA 3GZ4A 3CN7A 2QZPA 1G60A 3P0FA 3TXXA 2AXNA 3K57A 4JI2O 121PA 5JVDA 2PXAA 1UF9A 1KPGA 4YAFA 4ARBA 3Q5EA 4RTOA 5AW0A 2RH9B 2FMFA 2P9YA 2OORA 5AUOB 2PL3A 3PFBA 3FOCA 2KG4A 3DGEC 1TO2E 2VTBB 3EVEA 5DGHA 4DPLA 1E0JA 3QKSA 3M1XA 1YKFA 1P3JA 2OTLF 1UZAA 3VPGA 2AW3A 3SHWA 1DX6A 1XC7A 1YKGA 4TVOA 2XDYA 3SJBA 4IKPA 5FBZA 2PFKA 2QU8A 4NS4A 4DLSA 4DA0A 2BBTA 4HAVA 3PFHA 2O54A 5FWDA 4L4SA 4Q48A 2FJUA 1VM6A 4Z0HO 3KJJA 2C5FA 5ALUA 3WGMA 5CBPB 2PWAA 4KYIB 4FINA 1N1EA 2VCEA 2IYAA 2WVGA 2WLTA 4GM1A 4HDMA 2QTSA 1IOLA 3ORYA 5F21A 4CF3A 4YDQA 5C7IO 2Q4TA 4X71A 5AFSA 4O0LA 4QQNA 4UJ3A 1HH4A 3SBDA 3KKNA 1GFZA 3PHLA 3E7DA 4IX9A 2D6FA 4UHDA 2ZKIA 2PNJA 1DKNA 2QKYA 2JGUA 1J8FA 1Z8HA 2BHRA 2P2YA 2OYCA 5K03A 2CFCA 4EJFA 4NMHA 2RBKA 3C7AA 2PUSA 1ZQ1A 3BSYA 4MR7B 3DUFA 3G9TA 1JXMA 2PZSA 1O94C 2Q5EA 2VSYA 3L7YA 3NT4A 4GEGA 5CVJA 5CEEA 3HJUA 1P0PA 2HRUA 3LC7O 3P3NA 3T4ZA 2ZBQA 1GN3A 4QOHA 3W6UA 4NR1A 3AYXB 1Z4QA 3LUHA 1PNRA 1SOMA 3AC0A 3L0SA 5G41A 1SZPA 3S1SA 1XZAA 2ONZA 2R00C 4EL5A 4QJFB 2CL0X 3SIPA 4QGPA 1PR9A 3H11B 1XHXA 1M6WA 5LZ8A 1U3VA 3SBOA 1YRLA 6PFKA 1IEWA 2GETA 4KQXA 3U3RA 3KCQA 2CFIA 3LOUA 1NJGA 3I64A 4JVNA 3GPCA 3JATB 1SU4A 3H9BA 4H31A 4LHSA 4JL5A 4JEIA 3OUSA 1XEWX 4MRRA 2OYQA 3TNLA 2V7BA 3Q10A 2MIIA 5FF9A 2SBTA 5HRCA 3GP5A 1FMJA 1OQAA 1J7JA 1NMSA 1P9RA 1W9MA 2J6IA 4YJ3F 3HB3B 2GAFA 621PA 4G5QA 3B9BA 3R3UA 3ORRA 1WV1A 4TSFG 2BF4A 5T4HA 4AKHA 5JXHA 3LF2A 1MOFA 2ZNJA 3NKVA 1F6DA 4YN3A 4LV8B 1UPBA 3RWRD 1OLSA 1IIRA 4LYYA 3TSZA 3KELA 3AW9A 4N0MA 8OHMA 1I9CA 3DO6A 4G0UA 2DUWA 3BVOA 2O2YA 4RL4A 1IBLB 2HWYA 3FTCA 1MSWD 2FUEA 3LDGA 4FEEA 3A0HZ 1A50B 2NV2B 1L7DA 3FNHA 3TVTA 4UEWA 1G19A 4GVPA 4RCZA 5DM2A 4V24A 1M2OA 5C4IA 3FAVB 3RFRA 4LF5O 1O1YA 2OZLA 2ZBFA 1KXZA 3C0KA 3OQPA 3RAGA 2I2DA 4TV9B 1CJUC 4FM2A 4LYEA 2QZJA 2VQSA 3T06B 5GIPE 4AQYO 2F8MA 2I4OA 3QWFA 1G2IA 4LUCA 5DRYA 4K0KB 4BNTA 1KDVA 5KUKA 4WWHA 2I87A 3NZEA 2R6R1 4EI9A 2HDHA 1IB6A 2QSUA 3OOHA 4MMYB 5F2VO 1F14A 1Q2XA 1Q11A 1P2BA 1QHHA 5FJIA 2A94A 2BBOA 1E79A 4G0WA 4PC7A 1FTNA 1PJ3A 1Y8RB 2EKBA 2QM3A 2W2MA 1V8PA 2DCMA 1RBYA 3SIUA 1E3DA 5IDJA 2Z1NA 4R98A 3E8MA 3N2NA 5F2EA 1RI4A 3W2GA 1PQUA 2XDAA 2OV1A 4GOMD 1M5IA 2L18A 4I5DA 4M3NA 1WZCA 2XUGA 5CA0A 3KSAC 3S70A 1SESA 1IHPA 4LZNA 4TS3A 1EXMA 3WJ7A 1JS1X 1W48A 2OM2A 3AUFA 3F3SA 2QUZA 3UGJA 2PBFA 1XKTA 5KHKA 2KX7A 3Q1LA 4ND6A 5DCYA 3SDSA 1WJZA 1NMYA 5EWJA 3ZWMA 4EBFA 3U13A 3QVTA 3WYFA 3CZAA 1R0XA 1VQ4F 2BM1A 1ZLXA 1Z5GA 3VGJA 1EFPB 3N2KA 1OPRA 1TQ4A 3UMFA 3PC7A 4TZTA 4BJ6A 3VISA 3KJKA 3EGIA 2J5KA 2SICE 3VOAA 3KFXA 4I81A 5TT1A 1EXNA 1V11B 2VAPA 3KDAA 1PS0A 5J63A 1RPNA 3UQZA 4V0LA 4I99A 1YJ8A 4Q4AB 2F1IA 2VIIA 3JPWA 3ZNPA 5DECA 2FJPA 4EMSA 1HE5A 2XZPA 2M1ZA 4PA3A 4NH0A 4ETIA 4D98A 2Q6LA 3WOVA 4JN6B 1LQTA 2UKDA 4UDXX 2UU9O 1Y5NA 2GESA 3BA6A 3I28A 2I03A 3SYAA 2ZVZA 4HFMA 2AW9A 3OGCC 1RLGA 4LW8A 4MVUA 3GA7A 4FYPA 4UBNA 2WKSA 4J94A 3VGPA 3OQBA 5DX8A 4BMOB 2OXFA 3JV7A 4C43A 5LA6F 4UFOA 1T4CB 2A79B 1G5FA 2FAXA 2F3QA 1G8GA 3P26A 3V9AA 3T1VA 1DCTA 5BNFA 4J2TA 3GPLA 4BY9E 4KJZA 2W6MA 3C3CA 4FFBA 1G7SA 1Z5PA 2A5GA 1M1KH 2BBWA 4P53A 2YVQA 2C4MA 4GLLA 3PEUA 1U0RA 3DJYA 2JCVA 3O8BA 5E1MA 1QCEA 4P54A 4IIHA 1LBIA 1VZ3A 2ID7A 2Q1UA 4UUQA 1W2BF 2Q7EA 3RASA 4CMAA 3H16A 4FZRA 1BDBA 1GGJA 3DLBA 4WCVA 4ZJPA 4DLBA 5LYYA 2DOKA 2CZWA 1XL0A 3H0CA 4TMFA 4BNIA 4FILA 1D4OA 5EC2C 3IP7A 1Z35A 3PHGA 4RBNA 1KWKA 1ACMA 1XLTC 2X3FA 5LXTB 3ONEA 2YJTD 1J5EB 1UODA 3IUPA 4OHKA 3X1DA 2LBWA 1KVSA 4JLNA 5BW6B 3WAGA 5B37A 1PBTA 4Y18A 1BL8A 1YULA 1RWVA 1MJHA 2C96A 3ABTA 2BUCA 2NNLD 3IPCA 2ZXWB 4MQBA 2J7PD 3R75A 2HP3A 4GW3A 2LO1A 2PPVA 3IO5A 1NM5A 2R25B 5I9NA 3FCXA 3KZVA 2ZAGA 3EDCA 1W49A 3P1JA 5A2QN 1RYBA 3DGEA 2XD4A 4P2BA 4WNCA 1KHTA 3H2JA 3TW8B 3ZG6A 4YAWA 1BSMA 2I66A 3BXPA 2ZIOA 2WSSG 3FYDA 1FFXA 2BRUA 1QVWA 1N0HA 2PZFA 3H1AA 1BXKA 4LCBA 5BXZA 4UCXA 1QNLA 5CIWA 5G0UA 4AG3A 1CIVA 4AJNA 4EKYA 4YV7A 2R7MA 4RPCA 4IDAA 2FNAA 2PGLA 2WM9B 2Q7GA 2QNBA 4M60A 4ZD6A 3KQPA 3WYEA 4F5WA 2NXJA 5IANA 4LNAA 5EJFA 4MW6A 3LDFA 3QA3E 4OLBA 4MTLA 3OMNB 1DCMA 1N75A 1M6VA 1SOAA 3QK7A 3M6VA 4C0HA 2C42A 4Q6BA 2BTOA 1Z7BA 3JS5A 3KUXA 4JVMA 2XITA 4DC9A 4DQUA 5KAIZ 2B25A 1KBOA 2GHTA 2XCUA 2P4EA 4FFRA 1JDBC 1E18A 4PX3A 4MRNA 4QGFA 2QDXA 2FR0A 4XWGA 4YCLA 5L4LA 5AVMA 2ZIGA 4YGXB 1XWFA 3HJBA 1GNLA 3RC2A 1Q7BA 2O6LA 2F9FA 1Y63A 3OZDA 3C48A 4BVEA 4R2MA 3V4VB 4NQZA 1KXJA 4P5EA 4D9MA 2B2NA 3QTBA 4M0DA 1E1RG 3IOMA 1T8WA 2C57A 1N57A 2W6PA 1P7PA 3KQTA 3R0XA 4LPSA 3VO2A 2NTVA 3AP2A 4EVQA 2ZSKA 4UHHA 2DT8A 3LK7A 2IYTA 2H9YA 2LXNA 2R60A 2V3VA 3UB4A 4QJ3A 5DNUA 1UMKA 1P44A 4MYTA 4OFXA 1LRLA 2ZJFA 4EG8A 3BXFA 3EFEA 3GX1A 3MMSA 4L22A 5JBIA 1MIOB 3OJCA 3IDOA 4ZVLA 1X9IA 1VQMV 4JI7B 1HW7A 1LF5A 1UK9A 1NNI1 2WYUA 3CNBA 4RVNA 4EEKA 3PA6A 1NOKA 3O9MA 2R11A 2YKGA 3O4IA 5HMLA 4U6QA 1QXSA 1ZZEA 2GOYA 2I3AA 4C3ZA 3R77A 1I2CA 1QU2A 3LL4A 3F5TA 1A04A 2A86A 5SY4A 3DW1X 4A2WA 1UP4A 2RCVA 1YI2V 1X1SA 2RIRA 3B6ZA 5H70A 3LPAA 4QLBA 4L95C 1PKEA 1GA4A 4BL5A 3PUJA 1FS4A 1DADA 2PTGA 4UNRA 3OPQA 4R9SA 3ANSA 4Q9KA 2CBGA 4MGIR 1MHTA 3A2FA 1U9CA 1Y74A 5ALOA 5FP0A 1FYWA 2FW7A 4CV0A 3EVFA 2DT5A 2ZKOA 1OJ7A 2HMTA 2WKPA 4DRZA 1W55A 1YJCA 2HYIC 1X39A 2P4SA 3HCPA 2RD2A 2H16A 4BRWA 2PXCA 5T41A 4QYIA 4NAVA 1J2RA 1Q1GA 3GB7C 3CLVA 3ESAA 4WZAE 2CNWD 1AHHA 1Q1EA 2NZVG 3OTOB 3V7EA 2VPXA 4H18A 3TB4A 4AJ2A 1WNFA 4L50A 3LNMB 3TPCA 3AEYA 1X42A 3C8ZA 2R7LA 3GDWA 3I92A 4UXHA 1D7OA 1FTQA 2BOBC 3NIFB 2VKQA 2Q2WA 4NBTA 5JS8A 2VK2A 3A26A 3E2IA 1R18A 2X8BA 4UCOA 3OT1A 5K8VA 4K35A 1V5FA 5HYVA 5F98A 3CKLA 3ABLC 1QG4A 1JKMA 2DCUA 3DZJA 3F1KA 5FA5A 4CKEA 1MEEA 4X65O 4GP6A 5PNTA 3V6LA 1PWYE 3QUBA 2QKSA 4FFWA 1AUVA 1EINA 3T9AA 2YNMC 4I6EA 3R0ZA 2DH6A 3RIXA 1N8SA 1VQLF 1OCRB 1T9HA 2GZAA 3IEQA 1C0IA 1W96A 3CCMV 1A27A 2YJ6A 4L5AA 2GBLA 3NM6B 4K9LA 1KJWA 1AZLA 1U0GA 2YNMD 1D2EA 2QEXF 1COZA 1FTGA 1G55A 4RUKA 4AJHA 4A91A 2FDCA 1JW9B 2XXAB 1RMQA 3U4DA 4N48A 4ZRNA 3THYB 4F85A 4H7KA 3SHTA 1R50A 2QM8A 3P0HA 4NENA 4XGRA 5DU2A 3VJRA 1AG9A 1GN6A 4FIDA 4I1PA 1IEXA 1MIHA 3QV2A 4FHCA 4QUIA 1SZTA 2RHDA 3L6BA 4ZXPA 5CD9A 4QSHA 3MRTA 5DIFA 1HE4A 3AHGA 5AM0A 4GECA 2F64A 4MUHA 1R8QA 1F7YA 1JI0A 3I12A 2JIRA 3NEYA 4ZT3A 1J8QA 2PT5A 3T7AA 4CGYA 1RAHA 3J81M 1QDUA 3DLIA 1XA3A 2NQ2C 1T0AA 2ZK7A 3QA9A 4TTQA 4TT3D 4EFNA 1KBHA 2Y4NA 1H0KA 1JWBB 3AOEA 3W6ZA 2OT3B 1R8JA 4B6SA 4G4SP 3PNLA 1HLPA 1SA0A 3MLEA 4Q3EA 2CDYA 4HAXA 4B2PA 5KJ6A 3K73O 2VWKA 1RJ9B 1E2NA 1WVGA 1JQ0A 4RXMA 2YXLA 4M9QA 4EF4A 4ARIA 1B73A 1JDBB 3VC2A 4HBZA 3UO2A 1GO3F 2R8BA 4CM4A 4DIFA 1ULBA 2ZRQA 2GZ2A 3GGCA 3LQKA 3LNTA 4BHTA 3V2GA 5IVHA 1XP8A 3FHOA 4H2DA 3CWBH 5ESRA 2ID8A 4P4SB 2QR5A 2IYSA 3ETLA 3W9UA 5DI3B 1XN4A 1INLA 4HEA1 3NP7A 4CV3A 3A31A 4YP0A 4NMMA 1NKDA 5CFNA 1BN6A 2Z2JA 4CZZA 3IKFA 1RC0A 4OSEA 4BWAA 2AE1A 1SOVA 3EIUA 4TT3G 3GJ5A 3OFVA 1G20B 1ACJA 1PGOA 2FSIA 4R3UC 4LBYA 5T4EA 4CZ2A 4XQ0A 3IBCA 1U8AA 5L4SA 2J5BA 5E1OA 1Q91A 2WAAA 2YUAA 1JPXA 5EIWA 3BJIC 5D8DA 2HK9A 4GMFA 4DR3B 2UXBO 2J46A 3KVOA 4KO4S 4EDHA 2OMEA 4RZQA 4A7PA 3V80A 3RJ5A 4XYGA 4BZZA 5BVHB 2PANA 1KI6A 3WWZA 2DHDA 2VJLA 5LUAA 2VPQA 1FY2A 1DUVG 4KLAA 1VYTA 4MRVA 1T36B 3MGKA 2ODMA 4OPHA 1V47A 4DV2B 2ZIEA 1NTRA 5KHIA 4RHCA 4EKDA 3O3NB 1LFAA 3OZVA 1BD4A 5EAIA 1MEOA 3E81A 4PIMA 3T5DA 4MTXA 2QDKA 3RJTA 4JF3A 1KE2A 3GXBA 4S1NA 2PGJA 3CLUC 2IM9A 3C3EA 3JARA 1M1NB 5FHRA 3I9FA 2KE5A 1P60A 3AKEA 1COWA 4JI0O 4DR1O 3B1VA 1TK3A 3UT5B 4M37A 4ERNA 2P67A 1A72A 4P3KA 1LWNA 1DBWA 1ZI9A 1NX9A 3IT3A 2ORWA 2W71A 1KOJA 4NSNA 3DQZA 4US2R 4RGQA 4TKMA 3W3ZB 2X4DA 3A1CA 1YTFD 3I8SA 2JDIA 2P68A 2Q3CA 4ZRMA 3L4EA 1NBIA 1J9ZA 4X5OA 4XIJA 3K5NA 3GFGA 2ZF8A 4Q9IA 5DASA 4X20A 1JMYA 1GCUA 2WG0A 4R1OA 3D0QA 1L8AA 4MNTA 2RDCA 1Y7PA 3CKYA 2K5UA 3DWGA 4X60A 1OHHD 3O4HA 4JX9A 5AW4A 5KYYA 5EIOA 2ZSHA 3QFHA 2ZJ3A 1J2UA 2D4AA 4S2EA 5JQGB 5DTMA 3AF6A 5A62A 1ZD9A 2XIJA 4L7QA 4NU5A 1CQZA 3Q7PA 4IYRA 3NWOA 2AH5A 2DPGA 2J5QA 1JB1A 1SC3A 2JJ8A 3B2EA 1R3IC 1X7OA 4YY3B 4BFXA 3SS9X 2PTMA 2A67A 1QP0A 2XAQA 1NI3A 4FWTA 2NUTB 1JFSA 3MQ2A 4W5NA 1A77A 2I2BA 3AM3A 4FSDA 4XD7D 2H63A 4XEUA 5BPHA 5KEIA 1JPJA 1E9BA 3ZLBA 1OGYA 3SPIA 1N5DA 4QL3A 1PR5A 4TSFD 4OF4A 3INYA 4EYQA 1VMIA 3WAJA 3TL6A 3OD5A 1BA3A 5JATA 1J0XO 1FXKB 3WIUA 2JH8A 4TWIA 1UBNA 2ZRHA 3AI2A 3NOVA 5KYUB 3WGLA 2BH9A 1T6XA 3AB3A 5D6NA 4D3XA 4HTFA 1Y9JA 4FS3A 3CB4A 4TKZA 4Q4CA 2PJUA 1MTZA 1SU7A 1GDHA 2LDXA 2PYDA 3MTDA 5FNVF 3TINA 4RFLA 5J40A 3TXYA 3CC4F 4FLVA 3ZHOA 2VF7A 3FHTA 3BGVA 3PRYA 2YI9A 1NQWA 2CXTA 2DTXA 1E4OA 2SNIE 1BS1A 5KNDH 2QXYA 4KVGA 4X9QA 3ONFA 4WZAB 1MAHA 3GYGA 5FWAA 2WJ4A 4U2DA 3SLKA 1B8NA 3DLHA 1P5ZB 4MQFB 1MAVA 4G84A 5HM8A 3LSTA 4TV8B 1J90A 3BEDA 5IUNC 2QVZX 4WNAB 3IAM6 1H3EA 4QTYA 3UN1A 3I3OA 5THQA 2XCOA 1YB7A 1ATIA 3HP4A 3PGVA 1DHTA 2ISCA 3AWDA 1OLXA 3LUDA 1W4LA 4DA7A 4F3NA 3NDIA 1FNCA 4HXFB 1QDEA 5HG0A 5LWQA 1J2YA 4D3FA 1H5QA 1FC0A 3Q8KA 1DFGA 4EB0A 5DHUA 3L7QA 3IKVA 3O8QB 1VA5A 5JNRA 1PUIA 1TK9A 4QYMA 4JVOA 1MA3A 1UADA 3CHXA 2ZJBA 4GNKA 3VHXA 1Y76B 1XIVA 3LVBA 3PPYA 1WMEA 3L9XA 4HSGA 4LSGA 4A27A 3AEQA 5KYYB 4KPYA 4BNDB 1SZXA 1G8YA 2ZCVA 3OQMA 1NSFA 2FEAA 5FL3A 2JJYA 5CM9C 2Z3ZA 2QJWA 4E1VA 2JA1A 5KYKA 2ZIXB 1CE8B 1N5IA 4QBKA 1NPYA 1X7WA 2LWIA 4ZIBA 2ZVJA 2PH3A 4XIYA 3ZU2A 4OI4A 2R3SA 4UCQA 1B74A 2RGGA 2BM8A 1E9SA 1WUJS 1RAFA 2F43G 2CLEB 1P9WA 4TTPA 3T9CA 1WDKA 2JFFA 4E09A 1YK1A 3HKBA 3EYAA 1NVBA 1XZCA 2OXTA 4N7RA 1CBUA 2PSSA 2Q5IA 4N3NA 4JDUA 4DO2A 1PJSA 3BSWA 1E4YA 3T4XA 3ZS8A 3CRZA 3REOA 1MXFA 3INNA 3MWJA 5C8VA 3O8OB 5K6RA 3KJEA 1LPSA 1S0UA 2LBTA 3A3KA 1XAHA 2W8BC 1PJ4A 1NVAA 3H5RA 3MWFA 3QLVA 3H18A 4P92A 5G2OA 3TOZA 2OHHA 2GN8A 4UEKA 1D7AA 1YZLA 1TTPB 1JHAA 1MNQA 4XR4A 1COWD 3A1DA 3KR2A 3EQ2A 4Z8YA 3ZQUA 5BYAA 2NZUG 1ATZA 3L0BA 3QX7A 4MVMA 1Z4PX 3D3QA 2JGNA 3OZEA 4OSOA 5FCDA 1OCZC 5TC4A 2BONA 4RK5A 4RKEA 4UHEA 1V7PC 1QRDA 1FMTA 2NU8B 4BMPB 1FNDA 4ZBMA 1WXGA 3GDFA 1T3GA 4WKBA 3D43A 3E3AA 5IXJA 1I7SB 2PWBA 3FDZB 1PJAA 1WPRA 4H6PA 1JDUA 2RHWA 1V1MA 1VHQA 3T1NA 3PQDA 1SULA 3QQ5A 2GYWA 4LVNA 5AWFC 3AR6A 3MT0A 1FXWA 3ZTTA 1JGTA 3KP1A 5FEMA 3FD9A 4ARVA 3P9KA 1T0KB 2NSYA 3NHAA 1SWWA 3K5OA 4LF4O 1FS0G 2F1RA 2IELA 3JW8A 4LQ4A 4N0PA 2IWHA 4ESOA 1GAEO 1YDEA 1E1YA 1BD3A 1C3VA 1T4CA 1VPDA 3Q98A 2OQIA 3C3KA 3W1VA 1OT5A 5BPFA 2Y9PB 2NOAA 4IOMA 2QRGA 4H3KB 3LG2A 2Z3WA 1KAOA 4M1OA 2CFTA 4ZP1A 3IHKA 3KYIB 5FLXM 1FVXA 2ERYA 3IC9A 4LG1A 3V1TC 2QBYB 1CV2A 2HRCA 1XQVA 1IPAA 2C2XA 3DVAA 2CLFB 1UKZA 4BQNA 2GRJA 3ZY4A 5J58A 4ZQBA 4PSUA 3ZGZA 3H1KH 4EZIA 3INTA 4QO8A 4E6PA 1U7TA 1UAGA 1PS9A 1IBLO 4NBKA 3BIOA 3LPLA 3K72B 4JT4A 1Y4SA 1OTXA 2WJZB 3IBFA 4OLFA 3HV0A 3LRPA 1LNQA 1NFRA 2AZTA 2W0MA 3RC9A 1VPEA 2RAPA 1U3DA 4OHVA 5ICFA 3AG4B 1I3MA 3BZBA 1JJ7A 3Q7RA 3VSAA 3ELWA 3MPOA 1JEQA 1E2BA 1A98A 3AHFA 1K7XB 4WFFA 1NXQA 2KBFA 3EEBA 4E51A 1ADJA 2WYWA 4CMIB 1PFYA 2NSDA 4PTLA 5DGDA 1AQYA 3ROKA 2JJ1A 2QLTA 2A5LA 3HM9A 4KFCA 2H8CA 1ZBDA 1ZSVA 3NTQA 3ITEA 1KAEA 1CUDA 2WM2A 3EIFA 2JDID 4IOLA 1XBIA 5D87A 4QDJA 5LQCA 2HK6A 4CLXA 4R0VA 4HZ3A 5AKXA 4TV9A 2GBGA 1FPMA 1M2NA 3IR6A 4GI2A 1H2SB 3CPSA 3QVKA 3VKWA 4TWRA 4E4TA 4EECA 4LHWA 1XZQA 3VJKA 4DV5O 1WNSA 1VKHA 2HO4A 4U2CA 1BCSA 2UUPA 4DIDA 1UK8A 2ORYA 4BE7B 5DM70 2ZXUA 1NVPD 4CUZA 4W4TA 2BGNA 4JNCA 3C9SA 2VDVE 2AX4A 3H5WA 2CUGA 3MAJA 2HPVA 2R6GA 1GMGA 1GQYA 1L7AA 1M34E 2CVFA 2E5FA 3HK2A 2B0JA 4D6TH 2GUZA 2ANBA 1B6SA 3NWEA 3MDSA 1JH8A 1EN6A 2FN9A 1GJRA 1MRZA 3AR9A 3QFTA 4K2AA 1VE5A 3WK5A 3CA8A 4XXHA 5DBGA 1E79D 3L6RA 1CS4C 4MV6A 3L7JA 1QP4A 3ER8A 1PDOA 3N8GA 3IEUA 4ACAA 4QARA 2RJOA 5ITZB 4XM2A 3VR5H 1EVIA 2KM1A 2PL5A 2DOSA 5MN4A 4DCCA 4JL8A 4ASUD 4EG1A 3ZY6A 1US8A 1U7HA 1DK1A 1J9EA 2BZGA 2PEZA 2WWTA 4AN4A 4KOEC 3GLFB 4UZEA 1VXRA 3TQIA 4BU0A 1MRSA 1WXDA 1YL5A 1OXVA 3O7MA 1YHQF 3MMNA 4MWOA 4EGSA 3I61A 2AFIA 3KSUA 3FB6C 4HUQB 4YWHA 2Y2VA 2TMKA 3OP4A 1VBMA 4GZ5A 4CHGA 4A8JC 3FTEA 1VC2A 2OV8A 3H1LH 1RU3A 3K8ZA 3OEED 4J0QA 2R68A 2PAFA 4YI5A 4A5UB 1UOPA 1N25A 1XDBA 4NNPA 4AUEA 2PE5A 1OKKD 4JBIA 1JT9A 1SKUA 1CYEA 2VOJA 1T8PA 5ULLA 3V3KA 1F5SA 3PC8A 4TQUS 2OCKA 4HAZA 3ZDRA 1ZN9A 2OAGA 2OCHA 3SQXA 4TT3A 3ND8A 2V97A 4OLJA 2XVMA 1Z7YA 2Z8XA 3IPRA 4B44A 2J7KA 4MS4A 4CEHB 4LHZA 1WHTA 2AMVA 1AJEA 1CQPA 1Q83A 2I2XB 3N86A 5U1PA 8AT1A 2JLYA 2GILA 1ZLZA 3NANA 3FPGA 4AZSA 1GVHA 2LV8A 4NU8X 4J4HA 3GTZA 1GVNB 1PNMA 3FRHA 4L78A 3ZTYA 4D8XA 3K5HA 4OJMX 3RVOA 4HLQB 4EFKA 2ZI9A 5AJHA 4K9PA 5FUMA 4BXOB 1EDOA 5DTRA 3AF2A 4DUGA 4DUPA 2GDSA 2FQXA 3ROPA 1OZ0A 2LBPA 2HCBA 2P6NA 2Q27A 4L74A 3UAVA 2PZBA 3H97A 2SECE 3IQDB 3NV7A 4QUEA 1W85B 3GZTB 3R5TA 1JR9A 3R44A 5E7JA 4AJIA 4B2IA 4E32A 1C3EA 1VL5A 2JEUA 4EX6A 3OLVA 4NYIR 3H2IA 3MYRA 1VJTA 1Z45A 2UVPA 3D7SA 5CT4A 1ZMOA 1FNKA 1N34O 3I6YA 4OU5A 4BT4A 2R6HA 4V02A 3UAWA 2X9VA 1YE3A 2OE2A 3C9RA 1UEXC 1ORRA 3KX2A 4TMXA 3UYKA 3DD1A 2G63A 1FF9A 4J3FA 4RY0A 3U60B 1J56A 2C2YA 1D4FA 4B9EA 3HFSA 1Q82W 5TQVA 1RQLA 1YR2A 1WD7A 2EX1A 1HNXO 2OC9A 4JOSA 1U94A 4URFA 2HTFA 1JHPA 4CLRB 2CLIB 2JHCA 2VPTA 4EEXA 3X2QC 5AKZA 3SYCA 1CY4A 3I9KA 1CEYA 2XYHA 2NP7A 1E1DA 2BM0A 1K4DC 5IRCD 4ISBA 1WSDA 1QTQA 1JU3A 5E3HA 5LP6A 1E8MA 2DFKB 2YHSA 3ZHZA 1ORWA 1YZFA 1GQRA 4ZTZB 1V55C 3E15A 4QQFA 2ZPTX 2PZAA 2QBYA 1RPAA 2J87A 2R8RA 3WJQA 3ZXIA 2QSZA 4EYEA 3KD2A 4A4DA 2ADOA 1K98A 1UFKA 4XGKA 4B2LA 3JSNA 4OTZA 2EGGA 1USUA 2FSGA 4EF6A 4UMEA 1ZXXA 3KQUA 5DYTA 4WBNA 2Q67A 4UVHA 1NTOA 1JIIA 1QS0A 3IAYA 3KYCB 2C4WA 3TQFA 5J4LA 1T6YA 1BWQA 3DZFA 3ESBA 1F3OA 1PG0A 1Q6HA 1ZD8A 4YHHO 2EHDA 4WA8A 2VRBA 2HZ7A 3S29A 3STTA 4DJEC 2MT9A 2XW6A 1GEEA 4HB3A 4JJEA 3K14A 4YRCA 4BFYA 5IT9M 1S7GA 2QGFA 1PNKA 3VO9A 4BJ1A 1V9CA 1PLLA 2H7VA 4QNMA 4AO8A 1U8YA 4F2HA 3L0OA 3NHFA 2W4IA 2WD7A 2PUWA 4HFJA 1A9RA 5AKIA 4A0QA 3HB0A 2JJ1D 1ZH2A 2XNJA 3RC3A 3P2JA 4EABA 2ZM5A 2CK3A 1O97D 4MO2A 4O4JF 2Y0PA 2HPHA 1FW6A 1UAAA 1UJ6A 4LVCA 3ZBTA 1E9AA 4QPNA 5CH5A 3FJ1A 3WBBA 1FPQA 3L93A 1QQBA 1IB0A 3ZHQA 3ZO8A 2PDAA 2LW1A 3TAXA 1YR6A 5DNDA 1A5AB 4ZQFA 1C3XA 2P27A 3RTEA 4C0JA 5IF3A 2GN2A 2EKQA 4IXTA 2OXRA 4FB5A 4E31A 3K04A 1LD3A 4WDRA 5JYBA 2VTDA 4QDOA 1RKQA 3MUFA 1FFYA 3SPJA 4RVCA 3HPLC 1XVTA 3QY0A 5DE3A 1XUQA 2CK3D 5EUQB 3J81k 2WT8A 4FOLA 3HJWC 5A3VA 4DIUA 2QJTA 3CZCA 1QFZA 2O2DA 5DNEA 3FBAA 3Q8MA 4FYWA 1NJSA 3KLMX 2NN4A 5H9CA 2F43B 2FKAA 3GJRA 3CX6A 4IL5A 5DHAA 3TLKA 2IOYA 1JJAA 3EUFA 4PFKA 3ZV5A 4V1CI 1SXPA 4CC6A 3JD3A 1NBMA 5CH3A 3ZXXA 5E6RB 1LW6E 4NBLA 2DWEC 1SQQH 4R50A 1AN0A 1KERA 1S9DA 1QORA 4JC4A 3ZWPA 2A7QA 2BEUB 1KO4A 2XNDA 1JWLA 1QRUA 4MDEA 2B69A 3KSRA 1DUIA 5C53B 5DO9A 1UBLS 5JZMA 2ZGVA 3NEJA 3KNZA 2XYGA 4IIFA 2W4MA 3MFQA 3TN7A 4JMLA 4NRDA 4ZCMA 3IQHX 3FDJA 4DJFC 2ZPUA 1UC4B 1Y1LA 2QRHA 4NPCA 2XZOA 4BTEA 1W6UA 4YY3O 1R0BA 5B66Z 3FOBA 4LGCA 5C8YF 2IS2A 3W06A 4NTYA 3D81A 5IAEA 5B3JA 2O19A 4HNVA 4B3MO 3TLYA 4AMBA 2JHGA 1XSEA 1VRWA 3PWZA 3TZQA 3V1MA 2JJQA 3GMIA 3MJEA 2WI8A 4GMKA 1BDMA 1Z0DA 2EL9A 3W8DA 3CCRV 4HPXB 4DV4O 1E98A 2JD0A 3ZRSA 3DKVA 2NSJA 3JQEA 1AP5A 2YEVB 2H7CA 4W7IA 4DV3B 3CRRA 1QVAA 4CKCB 3UHFA 3B6JA 4H7JA 5LJIA 4FBLA 1HMYA 4KFSA 5C46F 2FTKA 2X6BA 4CL3A 3G1UA 1L7VC 4EHJA 2J7PA 4Q3CA 4UCTA 4JEMA 3KEMA 3UATA 1DQNA 4Y2VA 3QWHA 3EIHA 4FJ2A 4RF4A 2RAFA 4HLUA 4QUAA 1MA1A 1NULA 2YIBA 1NSYA 4NG5A 4E0BA 2FUKA 1FDTA 3B7PA 2W42A 5J9PC 4S2UA 4D46A 3KBBA 4ODIA 2ZTUA 5CDUA 2OD9A 1Y74B 3H5LA 3HJAA 3CC2F 1EB8A 4FCWA 2XKKA 2YMQA 3UOGA 3NP9A 1H6CA 1RI3A 1LLDA 3LS2A 5K0SA 3NRBA 3LD9A 4PGGA 1MB2A 3NC1C 1DXOA 3N2GB 1HZJA 1VSTA 2Z01A 1JLSA 1JFFA 2IHZA 2IJGX 1I4TD 1KPHA 1XEWY 2Z5FA 3M1YA 4LOJA 4LY0A 1U0BB 2H2HA 3OP1A 4W9NA 2BKLA 3K6SA 4JYAB 1KIFA 3ND6A 3AVVA 3QG5A 2PO5A 3HHEA 4QATA 4R9NA 5GGYA 2FHPA 1IM8A 2QR2A 2JG3A 2ZBEA 3W2EA 3WMFA 5EJ8A 2V74B 2VG8A 5FA6A 2SHKA 3N2EA 4PI2A 1E1QD 3R9KA 4YO7A 3TX6A 2JIPA 3QKUA 4A0HA 3N39C 5J59A 1F4MA 1ADCA 2HCJB 5KNBH 2AKEA 1X6VA 4UVAA 1JECA 1XZEA 1UJ4A 4DANA 3ENVA 2ZVQX 2RI0A 3BB1A 1JQAA 1VE3A 1RQ7A 2DSNA 1A96A 3FHJA 1JSCA 1XHOA 2XA9A 5BN5B 2AG5A 2Z2XA 1YOBA 1ZMXA 3EC7A 5CA0F 1LX7A 4B5CA 1AKRA 4BO1A 2EQAA 1D9XA 1PV0A 3LDCA 2V6IA 4DV1B 4NATA 4ZOAA 5AVOA 3FNFA 3TD2A 1VQ1A 3D3KA 4Q37A 4NJMB 4H16A 4BYGA 5CXUA 3LWOC 1PK7A 3PB3A 2JARA 1N6OA 3CPJB 4QSMA 5F1OA 3ER9A 5JEEA 1OH8A 2OCAA 5B4TA 3WHLA 2IW5A 1PV2A 4D0NA 3S0YA 3EGXB 3JYPA 4IW3B 3F8SA 1IMJA 1WDWB 3K1AB 3Q5DA 4FN5A 4FTWA 3AXSA 4E08A 4ENQA 1H2KA 2TMDA 3UMVA 1DC4A 2WMNB 3A6DA 3WIEA 4O2AA 4AX4A 2QZ9A 4RK6A 5EC8A 1AMUA 3ZYCA 3KD3A 5LMZA 1RP1A 2ADMA 3FTQA 4RORA 4GX5A 5J2UA 1CY8A 1XA0A 4NJEB 1WR8A 3F90A 1KYIA 5F2NA 2WINI 2VP4A 2RGNC 1UL1X 4LEIA 4LY9A 1S72V 2ZOVA 1OZGA 1TYDE 2GDZA 1NVTA 3KLPX 5ARDA 5LWHA 5JZSA 1GU7A 1BKSB 2QV7A 2ZRDA 1IN4A 4KQMA 3HBLA 2QPOA 2Q6AA 2AQ8A 2JKVA 3GGJA 1MLDA 1E9RA 1VPTA 3D6MA 4TZZA 3JRWA 1DIHA 1T8RA 3MSCA 5CJPA 5CNJA 4A73A 1TGOA 2G5CA 3HPQA 4YECA 5IAGA 1YC2A 1OHHA 3IAXA 4MWBA 5LBIA 4CDMA 5DHTA 2GCIA 1GT91 2IYXA 4DTIA 4FLUA 1PXWA 3UBTA 3EODA 4ATNA 1YMQA 1M2EA 2WYHA 1RWBA 1AI5A 3BRCA 1YRAA 4JI4B 2GXUA 1NNSA 3PKJA 5EIHA 1J2TA 1RYZA 4WFJA 5CTAA 1N8KA 2VDKB 3B12A 2OXIA 2QTCA 4RHAA 3UHAA 1GPKA 2Y6VA 4RWEA 4PSCA 4RY2A 3OZRA 5FYDA 3VU1A 2FH5B 3WDMA 3WY9A 5HNKA 3KZKA 3VO8A 3ZD7A 1FXUA 1P84F 1YMVA 1JTEA 1Z07A 2FSPA 2LR0A 1U4NA 2XB4A 3IIJA 1LSOA 1OH5A 2VBFA 4IDPA 3MHHC 1QV6A 4LXTA 2E4ZA 3VPDA 2P9JA 5J2UB 3A1UA 3H9QA 4J1NA 2H2FA 3UUGA 2G5TA 3WZMA 1OTYA 3LQRA 4POAA 2JVKA 3W7WA 3PENA 4XDGA 1Q7GA 1Y89A 1ISSA 1DJLA 2JCBA 4MJ7A 4X90A 4FSHA 2FSVA 4YQEA 3SIXA 1U3UA 3MG9A 4KDFA 1WETA 3EXG2 1OCCC 4N6OA 3RGBA 3N8KA 3VR2D 1FDVA 1NATA 1HG1A 2AKAB 4AY6A 1YOVB 3KLNA 3KB2A 1S8FA 2QLLA 3D31A 4MULA 1B04A 1W40A 1NLMA 4MB6A 5CFLA 2Y93A 3ZU6A 2WUGA 1UC9A 1VHAA 3LW8A 5EWLB 4IIVA 4GX0A 3LRTA 1EJ2A 4NZMA 4YUVA 2Q0XA 4OXSA 3B77A 1TIKA 1JAZA 1EWQA 4KUEA 2R1UA 1YB1A 5HDQA 4R6ZA 1L4MA 3LQYA 4TV9F 1Y6RA 3D8UA 4QICA 4CM9D 1I7DA 4ZU6X 4ANFA 1LC3A 2MSNA 2OGWA 4WRRA 4DE5A 5KKCA 1UKAA 3ADKA 1NWCA 4WJZA 1LK0A 4W5RA 2G3YA 1X86B 1YASA 2JGJA 3SHOA 2JF0A 3PYLA 2CW4A 1C9NA 2W6ID 2XRMA 4J4BA 3HI6A 3KWLA 1P7YA 4KXWA 5EMNA 2KQXA 5HTKA 3RUEA 2WIFA 4BX3A 2HU8A 2YQ4A 4JDPA 2P9HA 2ORED 3EC2A 3HGMA 3NMUF 4GRIA 1QHGA 3USZA 4QXMA 5CPFA 1TKBA 1SXIA 1QHTA 1J09A 1RLJA 4R6XA 3GLIB 3VTKA 1EX1A 2R2AA 2G9RA 3CRAA 2QYSA 3ZQ4A 1QHSA 1XBTA 2H5JA 2GF0A 1LC0A 4OYHA 4QPDA 1CRLA 1MXHA 1GRNA 1QB7A 3DZ8A 3BK7A 4TTRA 1DOHA 5KOHA 2YMMA 4ZAWA 3OE7G 2WKRA 2WF9A 3HB7A 4FONA 4LECA 4Y2UA 1H85A 3P0EA 4OP3A 5CU7A 1ZC4A 1OWOA 1R88A 3DMRA 5KKAA 1PHRA 1AO3A 2ZIVB 3RRNA 2C7OA 1H1DA 4J9VA 4KG7A 3E9CA 1E1CA 3MJFA 4XI9A 3AZPA 4RTRA 1ZS9A 2WSMA 1DJNA 5BY1A 5GJCA 3Q2OA 4PPFA 3E1YA 1VKZA 2Q5FA 4ACBA 2ENUA 2VDOB 1L8LA 3AWIA 4C7MA 4D3YA 1VQ7V 3FX7A 4QAQA 3QKTA 3MRSA 4C7OA 3IP8A 2X58A 5L3SB 3NPMA 2OO3A 3VR1A 4QX6A 2ZE5A 1WY5A 4DG5A 4ZHSA 1AHIA 1E5LA 4PHFA 3CRQA 4KR0A 1BH6A 1PJLA 1BH2A 3IAAA 4OX9O 1K5GA 4H15A 4MQMA 1BTOA 7MDHA 5I01A 2UVDA 4TTTS 5A05A 4ZKEA 2P75A 2IUUA 5LLTA 3PPIA 4COKA 4FE7A 4YIOA 3QVOA 5HBGA 3ABZA 4YJ2A 1EDDA 4FGWA 2SCUA 1JQ3A 4ON9A 1KVQA 4ONEA 2GZ1A 3DFFA 3L7CA 2PD4A 2Q2NA 4R2JA 4X41A 4EDFA 4KE9A 3T61A 4EW1A 4TYWA 1ESCA 2HFKA 1QKKA 1OLXB 1IRIA 3QJ5A 4FYKA 4DSNA 4YC7A 1JN1A 3PPVA 3CCUV 1V3QE 1IBMB 3OF5A 1SXJD 4OK6A 4OSPA 5FWXA 5BN4A 2WLJA 3OMXA 4Z3OA 3M8AA 2FZLA 2J4DA 3O94A 3TZBA 3NM5A 2AFIB 2Y2UA 2FPGA 4L28A 4B5KA 1KS9A 3ZRXA 1C7JA 2C8LA 4IVRA 4KRGA 4AMGA 4YAJA 4YO8A 4OATA 1IIBA 4MSWC 2QN6A 5ELMA 3VR6D 4AT1A 4FWBA 1NV8A 3TXQA 2ASVA 2EZTA 2YC4C 4CI9A 4MAFA 2H4XA 1BE6A 3UWOA 4KR2A 1QOPB 2CHUA 4JAVA 2EKLA 4GKAA 5H68A 4H3VA 2JGFA 4QGAA 4BT7A 3A8TA 1N1MA 1RZVA 2ATKC 2F3SA 3ZRWA 1FLNA 2PWZA 3GIDA 3MB8A 1T34A 2FHSA 2P62A 4TVKA 3LO8A 4YP5A 5AKGA 1U43A 4WFGA 1GGHA 3GPBA 3KJZA 3K2BA 4M9CA 3LUBA 3QFFA 5H82A 4CW7A 2XZLA 2X2EA 4H17A 1XCBA 1RRFA 1RWNA 2Z2ZA 4QBTA 1MO6A 1IN8A 1ZCZA 4BASA 5HRAA 3K0GA 1U90A 2QMYA 4LFCO 2MYTA 1AVMA 1WXHA 1XDCA 3NOXA 3VH2A 2X0RA 5EE1A 1OCCB 3WGIA 5I7FA 3O8RA 3AL2A 4MUBA 4DVJA 5AKEA 4AJKA 2H6EA 4L75A 1HFWA 1Z3CA 2WV9A 1BHSA 3BZWA 4Q1BA 4FMTA 5H8WA 1F2DA 1W4AA 3L41A 4Y3UA 2R5NA 2ZZMA 4MV9A 2DUNA 3FYIB 1N33O 1YQUA 2VZ8A 4XQEA 3VX4A 1E6CA 1PS8A 2IYUA 4BE4A 1WMBA 5JSZB 2ILVA 4I8IA 2IH5A 1HNXB 2P1RA 4QWMA 3DXXA 1GL7A 2WTMA 2WF5A 4G85A 4NMXB 2X8AA 3ZW7A 4YPOA 3G6KA 1QH0A 1K4KA 3G80A 1D2NA 4N39A 3B13B 3EASA 1CR0A 3DLPX 4BEWA 2VNJA 3TYXA 3MPUA 3D3EA 3FCOA 3CCRF 4F2DA 1DTEA 2GMWA 2QX7A 1D1TA 1EVKA 1NJ5A 1AROP 1Q1ZA 2MJLA 3JQ9A 1KI2A 3UCXA 4FN4A 3T3OA 3PWTA 5L95A 1U2DA 1XGKA 3WK8A 3ZMVA 1R0SA 2O14A 2IEYA 4WTOA 4GLJA 4JBYA 1ZIYA 1RM1B 2V9CA 2CH7B 3HVIA 5DT9A 5F3RA 4RHEA 4MQEA 1LTKA 2Q3MA 4HF7A 1DFIA 1OWMA 2ATIA 3UJHA 1EM6A 3OPYA 4NICA 2CWJA 3JTEA 2FSVC 3LWVC 4RS3A 3UGTA 3ZW9A 5JAHA 3ON5A 1OBCA 3R8CA 3FUUA 1G8FA 2QL7A 3QEMA 4KQWA 5HQJA 3EA4A 3QV1A 4PCAA 4CWAA 4PZYA 3H4TA 2FP4B 4I9NA 5BUSA 3X2FA 2V1DA 4EBBA 1FMCA 3M6MD 3MT7A 2HL6A 3ZJ4A 2FGYA 3PNMA 4F56A 4XWOA 3NGXA 3RS3A 4P3NA 4BKPA 2D2CB 3F9RA 4JUAA 2FW0A 3ABIA 3OCWA 1YZVA 4LQDA 1I4OA 1XQXA 2VZEA 1YI0A 3DOUA 2DBYA 3QSGA 3H8JA 4HDRA 2OA0A 5I8PA 4YP9A 2YOFA 1IHDA 2ATVA 1ONPA 5HQTA 4CL8A 3ZGNA 1IQ0A 2IYQA 2QL5A 1MZPA 3D54D 3WTCA 4DR5B 4MRMA 1N2HA 2DAPA 2BGLA 5CYFA 1P0FA 1BNCA 3JY6A 4HEJA 1T0IA 1O0CA 3KZNA 4N8EA 9LDBA 2B1GA 1FEZA 1ZO8A 3RG8A 1FSFA 3CRCA 4I7EA 1V5GA 1LEHA 1CIJA 3KWJA 1IULA 3TEMA 2IEZA 2FZCA 2XODA 3LQQA 4GP9A 1UQTA 3VYTB 1VQOF 1WP7A 5IP5A 5JXIA 2C3PA 1S5JA 2VZ0A 3EGCA 4FFLA 1WIWA 2E49A 4O25A 4QOGA 3AEZA 2YWJA 2Y66A 4HQKA 3LX4A 4NPHA 2WA3A 4A5SA 4GX2A 4IFEA 4F93B 1CS0A 3U3KA 4ENSA 2PUEA 4EGCB 2E5LO 3DWEX 4HDAA 2QLNA 4KB5A 1Y6QA 4LH7A 1EM1A 1Y1KE 1ZM4A 1F20A 5IXSA 4KMRA 1IXYA 1H2WA 1IURA 1PSZA 3N3BC 1AKUA 3BRSA 2WSSA 1ESEA 3R5FA 2P7IA 3RAEC 4JZKA 2V6FA 1EE2A 4BNYA 1KVRA 1LJ8A 4IFTA 1Y4UA 3D2BA 3FVTA 5CTJA 5DJ5A 5AJZA 1L9KA 1YACA 5KHGA 1Y9ZA 3BBLA 4GF5A 4KQFA 3APOA 3WJRA 4RF5A 4MP6A 3IVAA 4Q82A 4ASUG 4L8LA 1Q16A 1VCOA 4MVWA 4CJXA 2L82A 1SS3A 2RK3A 3ZXSA 1J95A 1CZUA 2CSUA 1G8SA 2SCUB 4QTUB 4K8RB 3L7NA 1UT5A 4FMCF 1UXIA 1W5EA 1R27A 3BCHA 4N4AA 5CGZA 4WNAA 3QU4A 1KYZA 1OU0A 2EP7A 2QP9X 3PS9A 1OV9A 1AKQA 3QU7A 2WIGA 3ABKB 1AUPA 2OUKA 2XB6A 1F12A 2ZI4A 3QJYA 2PZEA 4MQFA 5BWBA 3F3MA 4RH0A 4MGKR 1QFYA 1GAWA 2E4YA 2B8NA 2JS5A 3GLIE 1W0JG 4LF9B 1XD2B 2A4MA 4F3RA 1MJ5A 3ZHRA 1A8QA 2BCGY 3TJMA 3DE5X 4H0LB 2ZSJA 3VKHA 4J03A 1T5SA 5B1AC 1NW6A 2CXUA 1VIBA 3CT6A 3PG5A 3CCLF 1S96A 3H3FA 3H6GA 3MWDA 4XDZA 2R1ZA 3RTAA 4B3SO 1T9GS 6AT1A 4PA7A 1TEHA 1ZVKA 1RM5A 1C9EA 2XQKA 4GYWA 1ECLA 1FK8A 4P82A 2PMWB 2O8EB 3L84A 4DIEA 4PPYA 5JJBA 1PUJA 1DIRA 2ZB8A 3DMGA 3Q7SA 4GKBA 4O4LA 4ZTBA 5I7OA 1N2GA 4EKWA 3HDJA 2COEA 3TPFA 5JZ9A 2C2OA 1U0TA 3ASUA 3V1YA 3CUWA 4FJCC 2ZULA 5CFRA 1CEEA 3IUBA 2I6TA 1YCIA 1I3OA 3LP6A 4R3WA 1IV2A 4OPMA 4RQBA 4DDVA 3CZ9A 5AG2A 3OBBA 4M86A 3FFMA 1WEHA 4Q15A 2EJ7A 4DMRA 1K08A 2REBA 1BEEA 1LXCA 3NKLA 1HWYA 1PWZA 3SR0A 1QJCA 2HCFA 2F1OA 3CEMA 3E4DA 3QXJA 4RK4A 2YY7A 2JIOA 1XO1A 3B3GA 2VWQA 3ZW8A 1BCRA 1N2IA 1O9BA 5JZOA 1DIAA 1QV7A 3CVXA 1PT5A 3KZMA 4UUNA 3C1UA 4ZN6A 3T34A 4KIGA 4XVRA 3DXYA 3S2FA 2AR7A 2DX7A 3A4YA 3ZY5A 4AZWA 1K5SA 3NK6A 4PYOA 4B73A 1GTL1 5AVSA 1A8HA 3C3XA 3GJTA 4WBNB 1EI9A 3MGBA 2NTEA 4E2FA 1JFTA 4TL8A 3J7AC 1SOUA 2G40A 1B3BA 1C4KA 5SY9A 5K0BA 4JASB 4UBKA 1P4SA 2WSLA 1U2EA 1U99A 1DARA 2CFOA 2XMZA 1FDOA 1NOIA 2ZDHA 1F5NA 2I0FA 5D5QA 1MVOA 3KU4A 1ZVJA 1UH5A 4OO3A 2YVLA 1W44A 2JJ2A 4Y6RA 1WCIB 2ONJA 1UFRA 2FX5A 4L85A 4CF4A 2WIDA 2YR0A 5H0IA 4MGZR 1MZVA 2WF8A 3CVJA 3EFOB 3CE2A 1DEKA 4LE1A 3A7EA 4P08A 4QXOA 4RVSA 5BN3A 1NW9B 1G41A 4Q16A 5EP3A 1UIRA 4WN9A 4Z6KA 2PGOA 2VDUE 2PKYX 3E05A 3V4ZA 4GBJA 4K3VA 3T7CA 1E0KA 1AKYA 1HRDA 3W7BA 4DUYB 2ZIAA 3SM9A 2HFJA 1UBFA 2B8TA 3DZGA 3SN6A 4QOEA 4BTLA 1KTIA 2QG9A 4OY3A 1NA5A 4U9HS 2P2GA 1RRGA 5FULA 5KSPA 2A9HA 1KO8A 1S5LZ 1KYTA 3FVWA 3IMGA 4CG2A 4YWJA 3FTFA 2ZUBA 1XMOO 1VQ4V 2R6FA 2I3GA 1SQXH 2XNDD 1CR4A 1PP4A 3NM4A 3UT5A 1RPOA 1N2CE 2RJ3A 4K8OA 5CNIA 2X0DA 3SNKA 3ZI7A 2QTLA 4MW8A 4BUCA 3VYSC 1IBRA 3E7WA 5LBUA 2OQVA 3U26A 3OX4A 3QVNA 1MTOA 1P8AA 1ZFNA 2AJLI 1YCDA 2XVYA 3LT1A 4MW7A 4PE5B 1Y8RA 4RZ2A 3D4LA 2B4QA 5ED0A 2FEXA 4HBNA 2W2KB 1ETHA 1Q43A 4BBJA 5IASA 1H9CA 4JA0A 3WQSB 4ZOLA 2QOEA