5ITZB

Crystal structure of the sac domain of cpap in a complex with tubulin and darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNAKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Centriolar CPAP/SAS-4 Imparts Slow Processive Microtubule Growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 172
structure length 420
sequence length 430
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5itzB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5itzB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5itzB01
4EB6A 3RYFA 5CA1B 1SA0B 4IIJB 3VPAA 5GONA 2VAMA 5EZYA 5MN6A 4O4IA 1RQ7A 3JARA 3E22A 2VAPA 4O2AA 5FNVA 5J2UB 5MN5A 3JAKB 5LA6A 4IIJA 5CB4B 5CA1A 5GONB 4O4LA 3HKDA 5C8YB 1FSZA 3ZBPA 4B45A 4X1IA 3N2KB 5LA6B 5EIBC 3RB8A 4X1KA 4E6EA 4IHJA 2RHJA 5JVDA 2BTQA 5CA0A 3N2GB 4I55B 1Z5WA 5EYPB 1FFXA 5KX5A 5BMVA 4DRXA 1W5AA 3VOBA 2XKAA 4TUYB 5KMGB 2Q1XA 4ZI7A 3RYIA 2VXYA 5JH7A 3HKDB 4KWEA 1SA0A 2Q1YA 3WGKA 3ZBQA 5IYZA 5J2TB 5KMGA 5MN4A 4I55A 5EYPA 3RYHB 3HKBA 4O2BA 3UT5A 3RYCA 4IHJB 5JCOA 4O4IB 4DRXB 3JAWB 3JASA 3V3TA 3E22B 5IJ0B 3JALA 5LP6A 3VO9A 4M8IA 2RHHA 5IYZB 5CB4A 4WBNA 4U39A 3WGMA 4O4JB 3JAKA 4B46A 3CB2A 5IJ0A 5LP6B 3JASB 5J2UA 1W5BA 1JFFA 4X1YB 1W581 4X1KB 5IJ9B 2R6R1 3N2KA 3N2GA 1W5EA 5LYJB 3M8KA 3RYCB 5EZYB 4X1IB 1RLUA 3JATA 4ZOLA 2VAWA 4ZI7B 1TUBB 3HKEB 5LXTB 4O4JA 5JH7B 4I50B 4I4TA 2R751 3RYIB 3M89A 3RYFB 4O4HB 5LP6C 2BTOA 4O2AB 5EIBD 4F6RA 4EI7A 4FFBA 3R4VA 4TV9A 4X20B 3UT5B 3HKEA 4DXDA 4O4LB 4YJ2A 5ITZB 3JATB 4I4TB 4ZOLB 5LOVB 5C8YA 1W59A 5LXTA 3JALB 4YJ3A 4HNAB 2XKBA 3HKCB 4F6RB 4TUYA 2BTQB 5CA0B 1W5FA 4EI8A 1JFFB 5BMVB 3WGNA 4X1YA 1OFUA 1TVKB 5ITZA 4HNAA 5LOVA 4TV8A 1Z5VA 5LYJA 1TUBA 4ZHQA 3VO8A 4LNUA 4XCQA 4EI9A 5M7EA 5FNVB 3ZIDA 2GVIA 3HKBB 4O2BB 3WGJA 5JQGB 4O4HA 2RHOA 3JAWA 5J2TA 4U3JA 4YJ2B 4LNUB 4WBNB 1RQ2A 1TVKA 3WGLA 4TV8B 4TV9B 4X20A 4ZHQB 5JCOC 4FFBB 3VOAA 1FFXB 2RHLA 4EB6B 5JVDB 4U3JB 5KX5B 5JQGA 3HKCA 5IJ9A 3JARB 3C8LA 4I50A 4YJ3B 3RYHA
chains in the Genus database with same CATH superfamily
2CVPA 3MILA 5CTJA 4WN9B 3X0DA 1X1DA 3DMDA 5I7WA 4UMFA 2QZ9A 2A59A 4M4SA 3D4LA 2YEVA 2C5HA 3D3EA 3K05A 2WWVD 4HJRA 4O4IA 3CRCA 2XNKA 2JA2A 3VYTC 2C07A 2C2WA 2REXB 5EHNA 4EQZA 1X94A 2H3OA 1WQ4A 3JAKB 2C4UA 3CXUA 2IXTA 3QEKA 4YDSA 5DNCA 5DYTA 4Z4GA 1H4QA 1FPOA 3CCMV 1D9XA 1FPQA 1KIMA 1U9IC 1Y8AA 1VQKF 1YKSA 3SBEA 3D9QX 3TUJC 3PJRA 3GVHA 4LFCO 3QFTA 3QWFA 3RBXA 3H13A 5CDUA 4JV5O 1ZM9A 4C1NA 1OTYA 4X3PA 4O4LF 1GQRA 1IUNA 3FW1A 1G8MA 3RTGA 3MD9A 4RULA 1DI0A 2G77B 3OECA 3R8XA 5L7YA 4U7NA 4ZI7A 1H0SA 3NETA 4NNJA 4Q5IA 1RQPA 1T8RA 3ECAA 4TVBA 2ZZMA 2P6RA 4AKTA 3CLUC 4ND3A 1J42A 3CX4A 1TA4A 1LPOA 2QU7A 4MR7A 1GGHA 2I54A 4LFCB 4Y6PA 1ZCAA 5EIHA 8AT1A 1GGKA 4H6XA 4KB5A 2C9YA 2JFUA 5FUBA 4MUKA 3AF1A 2OC4A 4XM0A 2PQMA 5E2BA 1IHUA 4CQMA 4W5NA 4DXHA 1FNCA 1NKVA 2DBRA 1BDBA 1NDHA 2OE2A 2XECA 4KO3S 1RWNA 2MTBA 4TT3D 2WU0A 1TFRA 1IHXA 1WDTA 3L8CA 3MTIA 1RFYA 3AK1A 3JU3A 5HIAA 1SIOA 2VJMB 3CLUD 2P4SA 4UZSA 2HLHA 3WYBA 1YV9A 4L4SA 4ZU1X 5DHQA 4DJTA 2VVTA 1JN0A 2AH5A 2YN4A 1IXMA 3JATA 5J4HA 1IXKA 1AJPA 1EFRA 3SX4A 3QLTA 1KMCA 1HDEA 3GPCA 1KECA 3EQZA 4J43A 2P7HA 1T2VA 3KQOA 1A1VA 3FCAA 4NU5A 3R8FA 2MSWA 3TKAA 1IM2A 1HDGO 1G6OA 2XMGA 2WFMA 5BSVA 1P2UA 1NVPD 2KQXA 2OY0A 1VI2A 3DUFB 4L75A 1HT1E 4YLGA 1GTZA 2GDJA 3KVOA 3MAJA 2A94A 3ZY3A 1FDWA 5E6UA 3LY9A 2QD3A 5ITZB 2AWOA 1NW5A 1GM5A 3PTAA 4EG3A 1JD1A 1Z37A 2BD0A 1C30A 1M2EA 4KOAA 4PYMA 1KI6A 3VR3A 2Z8YA 1OGYA 5G1PA 4LWSA 4C4RA 4UVEA 3K70C 2YR0A 3KJGA 5A9TA 3TMYA 2GVZC 3KEQA 2QXYA 5DNVA 1YCFA 3T9DA 3PE6A 2GPBA 2XAHA 2BM1A 2DHQA 3LYHA 3ASUA 3CLHA 3Q3JB 1U2ZA 1IJFA 1P80A 2PX3A 4XX0B 1PG0A 2ZJ4A 5C80A 2YIDA 2KG7A 1LBTA 3DOIA 3UOGA 3HI6A 4OYYA 3DVRX 4PNHA 4PLPA 5FTMA 3UJ9A 4B6JA 5CCXA 1W6UA 1AKYA 1CR4A 3HY6A 2QDOA 1SQVH 2GN0A 2N42A 3K70D 1IULA 3OO1A 3GLGA 3PJFA 5SZHB 4PHTA 3B2EA 2PRKA 3PPWA 5A4MS 6ADHA 4PELA 2OCXA 4F93B 2GHTA 2L69A 4RK4A 3NEAA 3SQLA 1X8JA 3K9WA 4GMXA 4MLZA 2Z57A 3OJWA 1TYBE 4TLMB 4YEDA 2XYPA 2HA2A 3G82C 1XZJA 2ZYTX 1K8QA 2GAFA 5CDFE 5JJBA 4QYIA 3RYHA 3TMAA 1ZCFA 2FPIB 1PWEA 1EXWA 1RAIA 2HK9A 4FUQA 4MKXA 1XOUA 4IYHA 4LSZA 5D3KA 1EFPB 1OWOA 2RSLA 4ROTA 2A78A 3DMTC 1E3WA 2MK3A 2IIQA 2OLJA 3BE5A 3MSXA 4JJKA 4LXTA 4TWIA 1MZVA 3TZCA 3DVAA 5DRYA 3ZCSA 2NU8A 3IYLW 3N5CA 1JR4A 1G2QA 1OXMA 2YX1A 4KBFA 3CS5A 2OKCA 1CP3A 1BRMA 3M1AA 4C20A 3RSQA 2AJLI 2DPGA 2OAEA 1DBPA 4KXFB 2OD9A 1M9NA 2J3KA 3VR0A 3B7PA 2QN9A 4EB8A 3O4FA 3C8HA 4Z4HA 5KB3A 2A5LA 3AVYA 5L3QB 5IDVA 3FTCA 3EWIA 4FIZA 4KQFA 5IM5A 1YR7A 2VT7A 1JOYA 3B6NA 2R66A 3ZXYA 1PLLA 1U6KA 5DCUA 1J21A 2Z6UA 2HDHA 4J03A 4JI7O 2C92A 4CR7A 5AJYA 2HP0B 4TKVA 3RV3A 3IC5A 3D4OA 4YJ2A 2F9LA 1NSTA 1RZ3A 2HQSC 2W93A 5JPCA 1X7HA 4D44A 2IOFK 2EP8A 4U3FH 4EY5A 5IVPA 4TM8A 1NOKA 2ETVA 1I3KA 4A10A 3J81A 5I3ZA 4XUGB 2IWHA 5KWJA 5M04A 3PRJA 3VNUA 1G5FA 4EHJA 4CMCA 4ZQCB 1I6MA 2C4VA 4BW0B 3BMCB 3GEEA 3UO2A 1QVVA 5ILGA 4YT4A 3GARA 1OJ7A 1ZKDA 4DLAA 4IJKA 4YT2A 2IU3A 3QTTA 1LTHR 1J5EO 3IJ4A 4ENQA 3I92A 1NVWQ 1TEVA 4DC9A 4KREA 3WBJA 3PL1A 1DWUA 4GPIB 2MHCA 4I3GA 4ZC1A 1LLCA 4ML3A 3LYBA 1QZTA 2IYFA 1VLVA 2B9ZA 1HFWA 1DBSA 2QTZA 2KW5A 2VJLA 2G8NA 3COYA 1G5IA 3CZMA 3GNLA 3M5CA 3QM1A 5FPQA 4R8KA 3CRRA 3TXYA 4HVLA 1KYIA 1JJ7A 3DH0A 4I08A 3RABA 4FLMA 3AI2A 1RHMA 4ETWA 2DQYA 1USGA 1SUAA 2GF9A 2VYCA 1ABFA 3HHPA 1YI1A 4P3YA 4NPCA 4TQAA 1QH0A 4E94A 1Z4LA 3VU9A 4WE3A 1EG2A 1ZZEA 2PM8A 2ZSFA 1MORA 2B0JA 4R7ZA 2AKYA 4Y2JA 1R0SA 1U4SA 2EW8A 3IB6A 3VAAA 1YIJV 3V8QA 3E1SA 1FZTA 2HU5A 3IVXA 4LI3X 3CNQS 2WG1A 4Y30A 2BFEB 3L82B 3VHLB 2E5FA 5EXEA 2Z01A 3CPWF 5C1IA 1GGEA 3JWGA 4A5SA 4J16C 3AU8A 2C2XA 1PYOA 1EFCA 2YJ5A 1Z63A 4IWNA 4F72A 3GA0A 1FX1A 1U1IA 1MP0A 2X6BA 2Q29A 3L7KA 5DI3B 2DB3A 2A9JA 1O4WA 3LV8A 4M49A 4Y2HA 5DYIA 4P3KA 1W36B 2HJ9A 1MABB 1SU6A 1JY8A 1QOPB 1WL8A 2DPYA 2R8OA 2VEDA 3E3OA 3FI9A 4RZXA 5FUYA 521PA 4G6ZA 1TEZA 3DEJA 2GBLA 5JE8A 5KYNA 3FVWA 4Y18A 4YUWA 3OW2F 2GH1A 3CEIA 3D8BA 2XEXA 5GOTA 5EQJB 3VKVA 2FZ5A 2O7QA 2NAFA 3ICPA 3R76A 5HFLA 2X86A 2ZXWB 3FUXA 4C8EA 4AMZA 4HRVA 3DFMA 4BQRA 3PVCA 4R2XA 4YY3O 4HLQB 1JLMA 1K0FA 2NMVA 3L41A 1LLDA 4IRUB 3CX5F 4C6TA 2GTPA 1U6IA 3A4TA 3MFYA 3OU7A 4G37A 5DCVA 4UEKA 3ME5A 3ML1A 4M38A 5FOUA 5TS3A 5CDHA 3WLEA 4ZI7F 3BRWA 1AE1A 2N75A 1BKSB 1ZMOA 2J45A 2ODEA 5BN5B 3KKNA 2A4KA 4MR8B 1NN0A 4Q34A 1Y5IA 2Q3MA 3ITEA 4IGIA 3RI3A 4JQSA 3CMAF 5IX8A 3I62A 2GV9A 1OI7A 3ZXXA 1VSBA 3NNDA 3T1QA 1GEEA 4ZIRB 1GKIA 2LP7A 3CNLA 2Q2VA 3FPFA 3RG8A 4P0TA 3RBAA 3JS5A 5JSQA 3PQ4A 1YR8A 1OWLA 4A8JC 4RV5A 2VDLB 3RUDA 4RORA 3B6EA 4BXOA 5ALKA 1HKUA 1S89A 1XCMA 2FCRA 3P9CA 4AY5A 1XU9A 5IYZA 2R72A 1R0LA 2Z1DA 1S3JA 4DPLA 7YASA 4UKDA 4QNMA 3TRJA 3O21A 3LFUA 1YJWV 4YRCA 3BXHA 3LH5A 2Y69C 2XTNA 5F5LA 1CUHA 4NR0A 1SVWA 5ALYA 1C2TA 1VQ8F 1PW5A 4PC2A 2NT3A 3DHEA 1ND6A 5TQ0B 3VVLA 5BSKA 1E3JA 2A8YA 1R6NA 2W83A 4M7OA 2DH5A 1Y3CE 1UBCA 2CFCA 2VJBA 1T1GA 1TQ4A 2WV7A 4WFQA 4ZFNA 1QRSA 2XGGA 2B82A 2YXPX 1F2UB 1QGAA 1YJ8A 2VQFO 2HF8A 2HVKC 4AY2A 3HN7A 3U1TA 3K9FC 4V38A 4MKRA 3WNBA 3L70H 3OGIB 1XFAA 4Z2WA 3IQEA 3BRCA 4JVNA 1Y8QB 3H8VA 3TSZA 2VUIB 1D2EA 4KUEA 2Z1UA 5HZMA 2BTOA 9ABPA 1E4OA 1FUEA 2YWXA 2GBPA 4YP6A 2YNMC 1ONNA 6CHYA 3ZHXA 2HIMA 3AP1A 1Y6XA 4OQEA 3RVPA 1U02A 3RA6A 1UXJA 3W1EA 2C5LA 2V6JA 3HYTA 4P7FA 1NXPA 4M0EA 5A5FA 1CIVA 4JHLA 1EGAA 5TXGA 1BYIA 3ZK9A 3CKMA 4MVZA 5L3FA 1E1CB 1NQOA 1X39A 1VCOA 3GU3A 3QELB 4RFSB 2D4HA 4L5IA 1KE2A 1T24A 2JLVA 4Z0NA 3WGNA 3L9DA 4DR4O 4JASA 2OZEA 4LBWA 4BWFB 1TMGE 4I2VA 4S0XA 5GJBA 3HDQA 1YK0A 4IKEA 3ZN1A 1XK6A 3DPIA 3MJCA 4S1NA 5TPZA 4IJVA 1HA3A 3VZDA 4B17A 4CKXA 3SDLA 3TK1A 5LHGA 3DP9A 3K4HA 5DLQC 1W85A 4FEGA 4UTNA 5B1HA 1VFNA 5JROA 4B4UA 1GTRA 4WIAA 3UUGA 3AQIA 1AXGA 3DFIA 3PFBA 1AUVA 4QU8A 5CA1F 3RVLA 2EVWX 1B8UA 4AYXA 1UXKA 1UPUA 1GZDA 1QTNA 1XKQA 3D6MA 3HCAA 3OZCA 4KKXB 2DQ0A 4E2LA 1WHSA 4HAYA 4ZMBA 2ZRIA 1XU7A 4RHXA 3FYDA 3L4SO 5J4YA 5KDOA 4LCEA 4E5YA 5E6SB 4NIMA 5B55A 5LMNB 3THXB 5JVDB 3C3EA 1UZUA 4UM5A 1W42A 4UREA 4C0BA 4J9VA 2YC0A 1Q7CA 3B20A 3M6AA 4J7XA 4JYPA 5BWNA 3GWZA 2ROQA 3MWEB 2QP4A 3QVOA 1Q11A 3QJ5A 1C50A 4R7TA 2IS2A 2EDAA 1UOQA 3QGMA 3PHGA 1MXHA 3BXEA 3L6UA 3TRIA 2FNAA 1FDTA 1ZH8A 2KYRA 3ILXA 4JEMA 3ZZMA 4KPFC 5CB8A 4M0LA 2CHGA 3L4KA 4Q7QA 4BRWA 1XCBA 4QPDA 5KWSA 5IK2D 3DR3A 1G1MA 4KI0A 1V54B 4W9NC 5K8TA 1I5RA 1E2KA 1L8OA 1T5DX 3IMEA 4UM9D 4HATA 1LRLA 1BXKA 3OPQA 3D3WB 4IFEA 4J49A 4BFCA 4MVJP 4MB0A 1N2BA 2FPUA 2WC1A 4ND8A 3WWDA 1XQXA 3ZP7A 2XVXA 2YOHA 2G1UA 4DRXA 1O0BA 1C8LA 3L4JA 3QEBZ 1GPNA 2DAPA 2Y4UA 3JPYA 4W99A 4X91A 3TEJA 3SQXA 2FEAA 1QRDA 3QG1A 1EVYA 2AW5A 2VHCA 1ZD3A 3HPQA 3WAGA 4ISCA 1J0AA 1XRRA 3JTMA 3VUEA 1T8UA 3PUKA 3JVUA 4YRQA 1NVMB 3ZE7A 4O2BA 5IJZA 1M6WA 3DD1A 4AZWA 3I5UA 4PAWA 5G0VA 4Z9FA 2MINA 1VE3A 3RQIA 3L7AA 4RD3A 4X00A 1YRBA 5GTDA 1N9ZA 1MX1A 5I5EA 3OEHD 3WLQA 2B2XA 3SR4A 5FUWA 2QTWB 3LT1A 1CVIA 4W4LA 3FNIA 1AC5A 1L3IA 1AV7A 2V5UA 3I2FA 1GGVA 1Y8CA 1C2YA 1RPJA 3GEMA 5KCZA 5IKEA 1X4TA 1QCYA 4NS1A 2VYFA 1MVOA 2PY6A 3MQ4A 5CX1B 4U6SA 4UULA 3KVVA 2B8EA 5A3RA 5EGNA 2J46A 3HJBA 5LLDA 3FOAA 1BS9A 1KDTA 4MCJA 5KWVA 2QUAA 1POXA 3LUJA 4OHVA 1BCCH 3VYUC 4KXUA 4K0KO 3EW7A 2WJZB 4Q7LA 3ZQ6A 4WN9A 1JDTA 3ZHUA 1QVGU 1JJBA 1NNUA 3W4IA 4RDXA 3F5TA 1BSMA 1NRIA 4I4LA 4H37A 4KH0A 4RTOA 1WA8B 2FZEA 2E4VA 2GEVA 3C97A 3P9ZA 5FL7A 1J99A 3NMUC 2QMQA 3L6EA 4QREA 1ANKA 4Y2RA 2CB0A 2FVXA 2YZ7A 4NECA 3GRYA 1QGDA 3GRVA 5IF9A 2KQUA 1GG9A 1LC3A 2IW1A 1W47A 4F6RB 4BO8A 1SEPA 2BTQB 4PD4F 3CC8A 3T3MB 1PWXA 1QFZA 1QV9A 3BCHA 1OCCB 2H16A 1GA4A 2LCAA 1YHYA 4XVRA 5JJIA 1ID8A 1CR0A 1BX0A 1D0VA 4HC4A 1JT2A 2OBFA 2ODPA 3QBDA 3GRUA 5F2EA 1E5TA 3GQVA 4QTXA 4JSRA 4PZEA 3CC4F 3D0KA 5K4GA 3LT0A 4NE2A 2YY6A 3AF2A 1W0KA 4NAVA 1H3EA 2H9AA 2ORED 2P6NA 4GPEA 4JYMA 5TQ2B 3B1YA 3A0RA 3A9VA 4G24A 4ZT6A 4DE5A 3QE9Y 2NPIA 3EUAA 1FMJA 2NQTA 2QZSA 1COWD 1AA9A 2BTEA 3GBSA 3IO5A 2AFRA 2X0EA 4YK7A 2CXPA 4QYSA 1USUA 3GAFA 5CT6A 5DEIA 2AZXA 2EKDA 4FMBB 3IEMA 2WSSG 4L0DA 4MICA 2X76A 3C8ZA 3OKCA 4L08A 4V0RA 4XGQA 2I29A 4L5AA 4P4TA 4EHFA 2UUCO 4HZ3A 1YMVA 2UYNA 1VQ4V 5ARDA 1TEHA 3JPWA 3V80A 3KQTA 3E8SA 4YUAA 2ZYIA 4JGGA 1M8KA 3SR3A 1GPBA 2XNDA 4DY4A 2VKQA 3FFXA 4QHSA 1S9HA 2CKMA 4WK0B 3EMKA 3K5OA 1ZXXA 3K08A 1H2SB 2ID4A 3P52A 3J80A 5FPSA 4IDAA 4FB5A 4BNYA 3NB0A 3QU9A 1YDMA 1N5DA 2IKSA 3M34A 1OCRB 2W6PA 1ML4A 3C4VA 3HMKA 2NZVG 4YJGA 1NOIA 3NGXA 4K6KA 3RAPR 4DB4A 4UZFA 2HXSA 4EAQA 3EVBA 4FGZA 1E1QG 3MMXA 2VYVD 4OFZA 1YJXA 3WLRA 1WF6A 3MHPA 2GAJA 3R5HA 1N77A 4RDIA 1ECGA 3MAAC 4LFAO 1NQXA 2C5EA 3QEMA 5DP1A 2DFNA 3VKWA 4Q1CA 3OIFA 1MTOA 2PL9A 3CGWA 3V9AA 2CXXA 3L1JA 3JVIA 1OTXA 3G6EF 5FRDA 3WJRA 1I51A 1YBHA 3I6QA 1IZ0A 3FZQA 1EZJA 3H18A 3ZD8A 3H99A 1TO1E 2R1TB 4G9EA 2VDOB 3IE0A 4JN6B 2QTTA 2WKWA 4LMAA 3W9YA 4RJKA 2PXCA 1OCEA 1Q7YW 5GZ6A 1HYGA 2B4KA 3ZRWB 1M54A 4P98A 2R4TA 2XGMA 3W6PA 4FC7A 4ZGWA 2GEBA 4BVSA 2CNBA 1VQ1A 4IEEA 3DLAA 5AKIA 4DQXA 3OG9A 5KTRA 4BAYA 1DKRA 2XUDA 1X42A 2B61A 3CKKA 3M5DA 4G28B 3GLFB 4FLYA 4L16A 3HDJA 2GAAA 3RRXA 4GMGA 3ADBA 4KWHA 2CUTA 2JIPA 1TUBB 1WUTA 1Q1GA 2PLWA 5EJIA 5LJIA 1Q1ZA 4FHCA 4G1EB 4GP9A 4IIFA 5IM4F 3ZC3A 3IDFA 1EUCB 5ILQA 5HYVA 4CLEA 1S8FA 2V4UA 1W25A 3MYYA 1G21E 4DOMA 3X1DA 3GG2A 1G41A 1NF9A 2ARKA 1BHBA 4KV7A 2PT6A 2PZAA 2YINC 3IAM1 3OZVA 1X70A 3SYPA 3P0JA 1KE1A 2HRYA 4KAFA 1MHTA 2Y77A 4BB0A 1TECE 3VNQA 4D80A 5KAIZ 3C7CB 2I6UA 2YY5A 1DMRA 2XE6A 3CUWA 3V4RA 3FTDA 5E9AA 3L71H 1KSFX 1MT3A 1S5JA 1OFHA 2GPAA 3A6FA 4MP3A 2GSWA 3EC2A 2WV9A 4RH1A 1GRVA 4O2LA 2AUMA 2CXHA 1E0KA 4OMUA 2ZJZA 1ICIA 4M9RA 4UHFA 3H75A 3W9UA 1VLJA 2FX2A 2LDBA 1XPJA 3O03A 3WVNA 5CEFA 1P7YA 1Z2NX 2DUMA 3IUYA 3BGDA 4GVPA 1Z2PX 4YP9A 3KIZA 1RYHA 3EC7A 4JLKA 1BVRA 4MYTA 3RTDA 4CBVA 6PFKA 2OD7A 4NBVA 3A2MA 1T2FA 2LKDA 1VF6C 3PSAA 5C3MA 2A2ZA 3HCEA 2EINC 4U2FA 4ED9A 2PQ6A 5EC2C 3KKEA 3PGJA 4TKVB 5EXTA 5E8RA 2F93B 2XT9A 1LRKA 1CETA 2AG8A 2ZJOA 1XIVA 3F7TA 3L6CA 1I5XA 5A7HA 1S3FA 3U4AA 3ZZTA 1UQUA 4EAAA 4O3MA 2VP9A 3COWA 3D0QA 3HK2A 4B79A 5FBWB 3ABIA 4ZAYA 3MOIA 2QW1A 4L72A 4AJ4A 4WZAA 2LIPA 3BRQA 1YDFA 1PNVA 5KOHB 2AXNA 4N5MA 5KDLA 3STHA 1RTTA 1J25A 4WN3A 3N87A 1BQEA 4YN3A 3A26A 1IY1A 3TIXB 2GZSA 4KIJA 2ZRMA 2Z2JA 3A1TA 3LCUA 3TRFA 1TKBA 4UCTA 4PCLA 4OQNA 4U7PB 5FXMA 4TN5A 3KJEA 1PDVA 1X1CA 1XHXA 2IPAB 2MR6A 2Z1TA 1R88A 3THOA 3KEOA 4I7EA 2CVLA 4MP6A 5HIIA 1ID1A 3SY8A 2XMRA 3Q88A 3RWMB 3ZTTA 1MJGA 1OBHA 2Z0MA 1EFUA 4DYVA 2QQGA 2YHUA 2OMKA 2F4NA 2HQ1A 3NTQA 4IGFA 4Q1AA 2BGIA 3B3FA 4JBYA 1X8LA 1Y5MA 2XQKA 4O5AA 2NUTA 3G2JA 2DYRB 3CLTC 2P78A 1IX9A 1EQUA 2BF7A 3TD5A 2H54A 4WCEV 2GCIA 4RSGA 4ALKA 4HMQA 2IHJA 2PWZA 5C5DA 4FOPA 3U26A 1NR5A 2JIOA 2EIKC 3IPXA 1JGTA 1QH1B 5ITWA 2C0CA 2CMDA 2H8CA 3C5CA 2PS1A 3QOXA 4HQLA 4TRMA 3FUVA 4IXMA 5T8KA 3SNKA 1PJ3A 2PKXA 3B6KA 4UASA 1VHLA 5JYEA 2KWIA 2R65A 3DONA 3PUWA 4UNSA 3WJAA 1XXLA 3K8ZA 3PXGA 4G9GA 3WQHA 1NVGA 3CLTD 3LX5A 1RP3B 4XSGA 4NG5A 4F7WA 1JIKA 1U0SY 1J56A 1CQIA 1TFUA 3GC6A 3OQIA 1PX0A 4KQGA 4NFLA 3ZCUA 2FYTA 5LQRA 1DPGA 4YMTA 1SHZA 4FBGA 4HUJA 2XUAA 3AO0B 2XRFA 4OKNA 2V03A 2QD5A 4ZZIA 4R9SA 5LL6P 4ENPA 2J9ZB 3FBTA 1QAMA 3KSDO 5K01A 2A7XA 4MKIA 2CDCA 1SC9A 2ENUA 5D01A 5FPYA 2PZGA 3U44B 1JU3A 2ZFUA 4OM7A 1A5TA 1IOVA 4FLXA 2WUFA 4RPJA 4JQCA 1R6VA 5HXZA 2E4YA 3VI3B 3WLFA 1IIBA 3LC2O 2WWTA 3HBNA 1DT5A 3LQYA 1XHZA 3B1VA 4EHHA 2MMCA 4HUQB 4PHCA 1FSSA 1HSOA 1XL0A 3CRQA 1DJOA 3QEOA 3TSCA 3M89A 1LBHA 1E8DA 3SZOA 4PC7A 3TR5A 3H1FA 1H22A 3RK4A 3EFOA 1N5LA 1ZD4A 4UEQA 3PRYA 4GI7A 2H4WA 5HF9A 5I7AA 3U7RA 1ZUQA 3FYHA 3T3OA 221PA 3V1UA 5LBIA 3UMVA 2XKKA 1WPQA 1EUDA 5H9WA 3ON5A 1RXIA 4B33A 5FWNA 5B1DA 3HWRA 2EULA 1CLUA 3SLRA 1RBYA 3ICXA 4UFPA 1DBQA 1AR4A 1E5DA 2VDKB 1Y67A 3N7UA 5EWLA 3H7AA 4CQMD 5L3SB 4BNKA 1SHLA 3ZV6A 4TKLA 4ZRDA 7ADHA 1G6HA 1XXHB 2B1QA 3ZS8A 4E31A 1A4RA 1G6Q1 2POQX 5HJ7A 4PICA 3GD5A 3H9EO 3Q7PA 3O8RA 1M90W 1EK1A 2Z5UA 3LOPA 3B3QA 3M5WA 3IUEA 3IIMA 1Q3TA 3PZBA 3OC0A 4INOA 3IXLA 1Q2UA 3TKYA 2FQWA 1A0OA 3I6MA 4R3UC 3OBWA 2J9YB 1E20A 3GJ7A 4KBYA 2P0AA 5KYGA 1Y8RB 2H7YA 1G5QA 2AEJA 2VPXA 2ZDGA 4OPHA 3L7YA 1NI8A 3ZHSA 3JQBC 4PEVA 2QSUA 3A3OA 4TQUS 2TMKA 2P40A 4YUZA 1FJHA 4C4OA 4HTFB 2AXEA 5EXXA 4WBNF 3ZGXA 2XE4A 1NW9B 1Z3CA 5JBIA 3D0RA 5D6OA 1CXZA 3OFNA 1X7ZB 3MUEA 4MV7A 4B4WA 1BCSA 1EH5A 2Q99A 1MB2A 4F11A 1RAFA 1GM9A 1E1RD 1QZUA 1G8GA 1Q3HA 1VSTA 2F1JA 4CH3A 2W2NA 5H9CA 2BMJA 2NYAA 3IURA 3H86A 3LQ1A 4L8FA 5EHQA 3RV4A 4LRQA 3V33A 5HQJA 4BB5A 2DBVO 3JARA 1SOUA 3OBYA 3IIKA 4M60A 3T3GA 4OJKA 2EQBA 1TMKA 5AVUA 5JJEB 1YI2V 1CBUA 4NHEA 4PS0A 1VB5A 4DIKA 1LTQA 2B6NA 3IPAA 1E7RA 1CYEA 2UVPB 3AF6A 2AIFA 2KPOA 3SZRA 2OXTA 3MJEA 3C1TA 3PFCA 3ZMTA 1Q22A 1RYFA 2VTEA 2CMFA 5TQJA 1XQYA 4H3HB 3GLHA 2D59A 4OREX 3PHHA 2DVMA 1SKYB 2B25A 3T4EA 1KSHA 1V9PA 1OILA 1P5FA 1W93A 1L8QA 3MJVA 3BYZA 4LGVA 4MRRA 5BUCA 4XJVA 4PVCA 3AX6A 1ZJ4A 1AS3A 4D79A 2NXCA 5KHOC 4KGVA 1KRHA 4KMRA 4R0MA 3IHLA 3C5HA 2HMUA 1IOWA 3J7AU 4QPPA 4UCVA 4HZUA 2VHYA 5K8IA 1KHHA 3U7IA 2O54A 1KI6B 5AVQA 4CFYA 3HGTA 3EXFA 1GRQA 4QU0A 3BREA 3SFTA 4LZZA 4BHTA 2DYKA 4CMAA 4E14A 3GP8A 3K92A 3ZVLA 1UKAA 3H4TA 1YTFD 4B3TB 1Y42X 2C9OA 2RIPA 3ZE0B 1VL5A 2HC9A 2HPHA 2F9MA 2WM2A 4BVQA 1L4FA 4FIDA 4CS3A 1ZITA 1AS0A 1HTBA 1CUIA 2VBIA 2V4ZA 3E2PA 3JQ8A 3MIIA 4AQYO 4ZQBA 1C9MA 4PFQA 5B1AC 3M33A 2ZR3A 1MF7A 3MELA 2NSDA 2ZWMA 4KYVA 4YAIA 3CCEF 4DYDA 5HKOA 2WALA 4NTYA 2CEAA 2RARA 1GXSB 1JV2B 2VQEO 3R3YA 2K7ZA 4R05A 1Y3AA 2PWBA 5CXSA 1SZQA 2VJKA 3LIPA 3UW3A 1NBEA 1TMOA 2AOVA 3N2ZB 1ELOA 4CCSA 5HM6A 5IZCA 3MWEA 1YZ3A 1YI0A 1Y7PA 4CPDA 1VE6A 1RBZA 1XLTC 4TX1A 4U7JA 2BUCA 4UPDA 3ANTA 5DYYA 4DHEA 1B41A 1JIQA 2QE7A 4RW0A 2FUNB 3BC1A 2ZSIA 3KOWA 4HGNA 3ES9A 3UKJA 3BA1A 2IUYA 1HQKA 3FCUB 1T3LA 3FMIA 3BFJA 4MS4B 5TQVA 4XE5A 3R7SA 4YJ3A 1Y6ZA 1XJWA 1W4LA 4ZOAA 5JRDS 4KUGA 4TZTA 1US6A 4CEHA 3EFBA 3TSOA 5KTKA 5CA0B 2ATEA 3DBHA 3O38A 2HK6A 4LF4O 1ZA2A 5C8VA 3VXKA 2DUNA 4YYEA 5CNIA 2Q73A 4DIDA 2D4AA 3JR7A 3VNAA 3N6VA 4RQUA 4JAAA 3E18A 4E1AA 3ZIAG 3GDGA 4KXXA 4QXOA 3DTUB 3SPIA 2GZLA 1G3RA 1I1HA 2V7QD 1TVMA 4WX2B 4XM1A 5FI3A 5H70A 2PUAA 1U8AA 2Y1FA 1AV6A 2JCYA 3M99B 4O63O 1RKBA 1K3UB 3BTSA 5AIBA 2J59A 1OW3B 2YWHA 1SULA 5HFAA 5JDIA 4CT0A 2IITA 1PZNA 2QRJA 3W8NA 3EDOA 4IQ0A 4KNWA 3ZLUA 9ATCA 1KXJA 1QJCA 1R4AA 1BCRB 1L7EA 3B7GA 4XDZA 1T1IA 4O2RA 3ZY5A 1QIDA 4I3FA 3PDWA 4WT7A 4YV1A 2VS0A 1NIJA 4J11A 1HETA 1JG4A 2CC2A 3NPAA 4FINA 4OP1A 4X88A 4IXWA 3PWTA 3O1LA 2V7PA 4UXHA 5SY9A 4E1VA 4XVCA 5JQGA 4RHUA 4FLWA 1TJ3A 3JCMM 2VAVA 2XUQA 3MGAA 4AHCA 2I9PA 2Y27A 4R5MA 5C8DA 1JHYA 2R7KA 3O84A 4IFIA 3E89A 2X5JO 4FYPA 4FEAA 4KWTA 4L6AA 1AUOA 5EQTA 2B9VA 1KFBB 4B85A 2I67A 5IH7A 1KIAA 3DEKA 3TB4A 2NT4A 3DBIA 3W4JA 4X94A 2FWMX 1P2DA 2Q5IA 2BFAA 4N40A 5U4QA 1I4OA 4IJ6A 1B6TA 1XZNA 4Q1VA 1XNQO 5GPBA 4AJ2A 4MDHA 1FDSA 1H1DA 1ODFA 1JALA 1UMBB 1YOVA 1N2JA 1DBIA 3PX2A 3V2IA 3STWA 1UM8A 4R2KA 2C7VA 1MEOA 3CLVA 3ZZ1A 5JAOA 4G25A 4DCCA 1P7ZA 3GHZA 4IHJA 1XBTA 5DTQA 1M57B 4K6OA 1WVIA 4U2EA 3ZJZA 2JNWA 3EJWA 3QV2A 2PGGA 1ENZA 3B09A 1LLUA 5HTOA 3E61A 2DX7A 3O47A 4L5CA 3TJMA 2BI8A 2NP6A 3MOSA 3VPDA 1DK1A 3HCWA 1DLJA 1SXJA 4J0KA 4P4GA 2QDXA 2EHJA 2X5NA 3HKBA 4LF7O 2I6TA 3HSSA 3Q3VA 5EG5A 4RIIA 4EYKA 5TMDA 2C2MA 1OYWA 3D2LA 2VPZA 4KQEA 3ZVNA 4OX9Y 3ANNA 4UXJA 2I71A 4JXXA 4JQOA 3UMBA 1GU0A 1GPDG 1YTUA 3FOEC 3CH4B 2NU7A 4JJ6A 3ZZUA 1QMGA 1EVZA 1M1YB 1P1HA 1VGVA 3SJUA 2X8WA 5GADl 1AQLA 5M29A 3EDQA 3VKFA 3QO5A 4FIPC 4TL7A 2C7RA 1U0HC 1EP9A 4BMYA 3OE7D 1H23A 1A7UA 1B8NA 1Q7RA 5LGNA 1J5PA 1E1QD 3PNKA 1RLJA 5KVVA 1SC3A 2PBFA 5TPWA 1NU1H 2PWAA 3UVEA 3KE8A 5JD5A 3X2QB 3O9VA 3I2IA 2HJGA 1CEEA 1Z17A 2RK4A 3UHPA 2HWYA 4B35A 5HY0A 2J5QA 5LZ5A 4DSNA 3HA3A 3VTKA 2X0LA 4BQQA 1PJLA 3LY8A 8MHTA 4X6LA 2V1UA 4YMIA 3RRZA 5DM60 3RFUA 1KP3A 3CE9A 4G0MA 5FTJA 3BIWA 3OPYI 4XI9A 4CG2A 1N34O 2YVKA 5DYNA 4GHWA 5B3SB 3DKKA 4KYIB 1J0CA 3RU2A 1D2CA 1RJDA 1U9ZA 3HVJA 4PA9A 4LJSA 4EARA 3UAYA 2IJJA 2GZ3A 4YIOA 1GDTA 4LK2A 2IY8A 4IF4A 4JC4A 3OZIA 4TV9F 1UDBA 5G0UA 3WMWA 4BV3A 5G2OA 2DTXA 2WF8A 2OB1A 3EWNA 4EBFA 1TJPB 5AVYA 2I99A 1KFEB 2W9XA 3P0HA 4JI4O 1SVNA 1CZOA 3IBCA 3GHYA 3B40A 1H2FA 4Q37A 5FBRB 2AW9A 2XA2A 2ZSBA 4DCMA 5AUOB 1JR3A 4HRAA 1GARA 2WRZA 3VV2A 1JMYA 3H97A 4JJ4A 1F23A 4INZA 4PYRA 1GUZA 1DGQA 1IBSA 3E82A 1L3CA 1SC4A 4JSTA 4AZ0B 3P20A 2AKEA 4HQOA 4P2GA 3ZGLA 5C2JB 4RVDA 1M10A 1JDSA 3A70A 3HSKA 3WQBA 2GZ1A 4G89A 4MVJE 1FP2A 2JAQA 3OCZA 4F6EA 3Q15C 4PPNA 5CJJA 1M2VB 5ESDA 3U3XA 3PDJA 4D6XA 5IASA 1IZ7A 1G9XA 3U7QA 4A5UB 3ZS8C 5B6PA 5BPFA 2WLKA 1GA6A 1JX6A 2IKQA 4EG0A 4JYBA 4EEQA 2ERCA 3NHLA 3F6EX 4RABA 4K35A 4J07A 5JARA 4G4IA 2GRJA 1BG6A 3EF0A 3AIOA 1BS2A 4YP7A 1VJRA 2IA5A 2L2QA 3U40A 4UCQA 4X3MA 1UEJA 3LPCA 1WB4A 2ILTA 4WZBA 3LW7A 3B8MA 1CULC 4N3GA 2GXAA 4K81B 2JFXA 3A1DA 4DV1O 2HEIA 1X1AA 3E03A 4CKEB 5BRAA 1LH0A 1NZFA 3CZCA 1U3UA 2O1XA 3N7TA 3ZBHA 4KZKA 1HNNA 2FPGB 3OLXA 4UBJA 2NYUA 4BVLA 2FRDC 5FBKA 4B3MO 2EIMC 1N6OA 1YBVA 4X65O 2I4TA 3FUUA 1KYQA 3RVNA 1ATZA 4ODIA 3DTYA 1SOMA 4ZEVA 3RVOA 2G9ZA 4R40B 1O54A 3G0DA 3M1YA 2GK6A 3GRFA 3OAAG 1RABA 2OIGA 4BY9D 3PXXA 3KPVA 4U9HS 4YJFA 2R11A 5SZKB 1PFVA 3ZV5A 4BKPA 4E5DA 4GGMX 4GIBA 3H1JH 1DWOA 1QTRA 2PLNA 1M6NA 3UXMA 2ZJ5A 3EH1A 1WSBA 2YXDA 3CH7A 5DN6A 3NBKA 1LPPA 3FHOA 3GVCA 4D43A 4OGFA 3TZHA 3ZCRA 1O94D 3TJRA 1L7PA 3ZIAD 4CMGA 5LGTA 3DZIA 5JMWA 1EFKA 1TA0A 3EE6A 4TVOA 1OX5A 4BEVA 1N8RW 2YFYA 1NW8A 5F2OA 1Y3DE 3EIUA 5KYYB 2CNKA 1XEFA 4GRDA 3JASB 3TH5A 5LSAA 1K7CA 3LCJA 2E2WA 4HF7A 5FOXA 3G8YA 2EBHX 2WWWA 3SF8A 3V8MA 1SBHA 3LBHA 4FX2A 1SG0A 4E5PA 3HJFA 1QCZA 1SUCA 3AKDA 1QQTA 4D1YA 1YVRA 4IO1A 2A3QA 2OFOA 4QWMA 4PBSA 4NENA 3PX7A 3KEMA 2YUIA 1EE2A 4XXHA 4ZIBA 1D4FA 4RGVA 3AJAA 4D42A 5LP6C 1PS8A 2CYCA 1I01A 1JQAA 2FMXA 2HBQA 2A0YA 4WA8A 2VDVE 2GEDA 3IE2A 3ZY2A 1JXAA 2EATA 3BN3A 4XWWA 3PPYA 1J0BA 1OXXK 4X20B 4D6TH 1ODJA 5DLDA 5GJVC 4LF9O 3B70A 5KREA 4K7JA 2WUWE 4KO2S 5F3RA 2QR4A 1WS6A 2WMYA 4F3RA 3UJ7A 3DP7A 3OPMA 3UFBA 2WUEA 1HMYA 1W1UA 2ZTSA 5PGMA 1N2IA 3RUEA 1H8HG 1E3EA 1NT2A 1TAHA 2G9VA 3AHGA 1JQ3A 1CUWA 2WZCA 4CIVA 1JLHA 4OGLA 1HFJA 3AEUA 1DLIA 3HB4X 4GM0A 4GYYA 2JH3A 1XVAA 2FR8C 4KMSA 4BQFA 2R6ZA 1WF3A 1TDJA 3RJTA 3EPRA 4C3VA 2EFHB 1FTNA 3UBTA 1E3SA 1SVLA 1PK7A 2C3YA 1WEHA 3LOQA 4M9ZA 2HR1A 2IH4A 4FNAA 5BSFA 4KXLA 3LVBA 4G0QA 2SCUA 4NCAA 1O5OA 1R8SA 1TC1A 5LA6F 2O8DA 1XI2A 4N8EA 1RTKA 4BJ1A 5KUMA 3KSBC 4W1QA 2FXIA 3ISVA 5L3ZA 3IAEA 3F7YC 4WXYB 4Y7CA 3BMNB 4C7KA 5FO1A 5B1NA 3U7EB 3MK31 3WWCA 3F46A 2ZI4A 4R1LA 3DV9A 1V4BA 1WDMA 4ES6A 4I5SA 5CHYA 4YAOA 5JASA 3D6UA 1EA7A 4DNXA 2QLJA 3ZVMA 5DTMA 3AMVA 4DJDC 3KX2A 4OSPA 2ZSEA 2OCHA 1OU0A 2GJAA 4QBHA 1NG9A 1H0HA 4UUJC 3EDMA 3U39A 1GFZA 3RUCA 1FXHA 1G4YB 4KTVE 2ETNA 1QKKA 2QMZA 3EIXA 3PI7A 4J6EA 1V16A 4ZKEA 3TIGA 5GONA 1BH6A 3GLRA 4IDHA 3GJRA 3FYIB 1SELA 1TRHA 1V71A 1RQ7A 2IYLD 4RIGA 1V5GA 1DG1G 2ACWA 3VR6A 4IXTA 3KPWA 1ZHHA 2ZVQX 4E2FA 2LBXA 1RHKA 4I9UA 4JC0A 4KR9A 3R5XA 4Z7QB 3E5MA 2CZGA 3G5MA 3Q1KA 3RAJA 1T0HB 4MLPA 4N6GA 3CCVV 2BKUA 4R1OA 3O2JA 4BE7B 2D00A 5EJ6A 4BIIA 3OM9A 2Z30A 1PR6A 1DAMA 1AXRA 5JVDA 2PZBA 3IEUA 4CLDA 4G67A 3DL7A 5IY5B 1N7GA 3GH3A 3IVGA 5EFOA 3K0FA 3EQ6A 1DPFA 4B3SO 1SN7A 1P1JA 4H3VA 1XXHA 5DB4A 3ETQA 1B42A 1VM6A 2YDXA 3MUOA 3VHXA 4DLTA 1GYQA 3MRVA 2EW2A 2K2QB 2NZJA 3GL9A 2AB0A 1Z5OA 4LX8A 5F64A 5AFSA 1ORTA 4DK1A 3QMWA 3EZ6A 4NOKA 4Z4QA 1LK0A 1JR6A 1MEEA 4V0KA 4DM4A 5JSFA 4M8NE 1RZRA 5F23A 4TZ0A 3GTZA 1M2NA 4WJZA 1XZLA 4HGZA 5JJKA 4ER7A 3A2LA 1XMSA 3EXAA 4Y1RA 4QGPA 1D4OA 4PCUA 3ZXUB 2AOTA 5J2UA 2FPWA 4PPGA 2CTQA 2VNKA 2G67A 1DV1A 3BK7A 2B3DA 4PVDA 1US8B 4TMYA 4RMGA 4AS1A 2HDWA 2V96A 2NTJA 2PSFA 5EZYB 1G8YA 1JVNA 2I87A 4EKYA 2ALJA 2RAUA 3AEIA 5LXTB 1LB1B 2ZIWB 3DR5A 4Q4HB 1BEZA 3TYXA 1YVPA 3K0AB 1SJ9A 4IM7A 4S35A 1HORA 1ZN2A 2GUGA 2G9NA 5JAHA 5HNKA 1GFIA 2IYSA 2ZITA 4I9WA 1E79G 3E9ZA 5AKZA 2X8LA 5K2MA 2UYKA 3B85A 1P1IA 1WCIB 3K5NA 2FUG1 2Z9DA 2ZAMA 3DE1X 4J3JA 4BMXA 2DHEA 1YR2A 4FDLA 5G53C 3LDEA 2Q69A 1FBNA 1FTSA 2MYPA 1TUEB 3KQYA 1ZUHA 1MUUA 2QHXA 2XA9A 4OYLA 5B3JC 2G6BA 1V7PC 2AR0A 4ZCRA 2WMDA 1NBME 2CVZA 4NICA 4DJFC 1Y74A 3GFOA 4Y6SA 5C5CA 4MTLA 1PV0A 1R9MA 3ESCA 3KLPX 3V4FA 2YJ3A 3EZ2A 5G4VC 2AKAB 1M83A 1ZH4A 2DFKB 4BUCA 2QI2A 2BKXA 3RSSA 1JH8A 2G1PA 2F4VO 1QSGA 1AB3A 1MSWD 2NPOA 3AUYA 4MI6A 3OQBA 1W96A 4IWXA 2ZRNA 3GFRA 2B8TA 3K04A 3ESJA 4KFMA 3P19A 3PDIA 1JF8A 1VLHA 4N7RA 3TTWA 5KTMA 1E98A 3PR3A 2DPMA 1SQ6A 1FC0A 3VISA 3T3NA 1V5IA 2HXYA 3MWGA 3STTA 2O5VA 1DJNA 2GERA 3DBRB 3V1TC 3WXMA 3UMRA 3S8EA 4DPKA 1FDIA 2G0AA 4OAOA 1B0ZA 3DDUA 3B6IA 3KTFA 4L2IB 1O97C 4F1JA 2HRZA 3GUYA 4BLTA 2D6FA 4A2WA 4YRMA 3VQYA 2V55B 3BMOA 4N9QA 4PPQA 2NOAA 5A5DA 1AUPA 1OJLA 3N75A 5H59A 2PGXA 1SXPA 4GDMA 1BVUA 1II0A 5IZ4A 3NAGA 1DKPA 5T6BA 2J07A 1KI7A 1ZSPA 3PF8A 4FFPA 1K68A 4ZQGA 3WAKA 3YASA 5E4YA 2B37A 3A9CA 5ELXA 3NT5A 4GBED 3ZE2B 3I83A 5CFQA 3TRKA 5B58C 5ICCA 5TGDA 3BDIA 1N0JA 3KOYA 4X6XA 1KK0A 4EX6A 1O97D 4UFZA 2J33A 4YRDA 4A6DA 1KS2A 4PJ0Z 1VRVA 2C04A 1IY8A 2ZVYA 2FDXA 3D4BA 4Y1EA 5FO0A 4E0BA 1CUAA 2JJQA 2VRBA 2A7WA 5F5XA 2IUUA 3ER8A 1HT2E 3OZRA 5H80A 3WJ1A 5I7FA 2IHYA 2PAAA 2Z4SA 5EE5B 4JU8A 1VYTA 2I2CA 4BDSA 4DC0A 1ZX1A 2QNRA 2QY9A 4R2JA 2WKRA 5AG2A 2H06A 1MH1A 1N1DA 3DB1A 4OQZA 4JJ7A 4C2TA 4X1KA 1L8LA 2HU7A 4QPNA 1Q5OA 3SFVA 1QQ6A 1LDBA 4GRIA 4JGBA 5KMGB 1F51A 4MVJH 2CFOA 4QIHA 1JMVA 3DGFC 4MVUA 5EJFA 4PA6A 1GN4A 3QVNA 4OMDA 1J2UA 5JQWA 5EC8A 1E3DA 4IIGA 4Z49A 2BTUA 3ZCPA 4KXYA 3RG2A 3ROMA 2HNKA 3ZIAA 2GD6A 3EVAA 4PO3X 4EGCB 1IY2A 3OQNA 1PDOA 4WCFC 1Q50A 3KAJA 4Z1OA 2Y05A 1EYZA 3SVLA 4U39A 2RG7A 3E4CA 3S27A 3JAKA 1XN1A 5AXBA 2ABWA 5BUZA 3VQWA 3CE2A 1G0OA 5G40A 2LCQA 5IULC 4D8UA 2OV2A 1U7DA 1IJBA 3AXTA 3BTOA 2EFEB 3V9PA 3GMTA 1K1EA 2VP2A 3GUZA 4DGSA 4UHDA 1PG2A 3U11A 1VQMF 1VQ7F 4P34A 8ABPA 5KOYA 2IHVA 2WWGA 4XWAA 1QU3A 4I1IA 3K20A 4Y2UA 2FPKA 4Y6RA 2ERXA 1T10A 4PY2A 3VM6A 3SSOA 4RTPA 3Q4GA 2WYWA 2HGZA 4F1KA 4YBZA 1QDLB 2A9OA 3D7NA 1AR5A 3NVMB 1O96B 4G5HA 1W35A 2XDAA 4CH5A 2AT1A 3N39C 4OBXA 4C01A 4C4TA 5LD2C 1U9YA 4CKZA 2FW8A 3R4VA 3B1KA 5GY7A 4G97A 2WEKA 1KD1W 3HKEA 2VK8A 2BI7A 3GNSA 1CUEA 1XD2A 3K1TA 3PHCA 1AZLA 4X44A 5CT5A 2WT4A 3E5HA 1SR8A 4X3LA 3AONB 4H9GA 2GM4A 3VOTA 1Z4OA 4ZRNA 8OHMA 1ZFNA 3HO1A 2I1LA 2HS4A 2V5VA 3F0EA 3TD3A 3QSYA 4ASUA 2QM3A 3R7FA 1NUPA 4CM3A 3GFSA 3JQ9C 4LBEC 4KX5A 4ZHQA 5LYJA 1QAQA 3HEMA 2X8JB 3LQQA 3KU1A 1CP9A 2H07A 3TLEA 4RELA 2O05A 4P5EA 2PU7A 3K5WA 1IJEA 3CW2A 3AVVA 2KHZA 5EAZA 1I3NA 2ZYAA 4TRJA 1SCQA 1RYZA 2P6YA 4GGOA 1XCGB 2OK7A 4LY6A 3MJFA 4PC1A 4CF3A 2M6YA 1B8VA 1JR3D 5CMLA 1NDUA 1XYYA 3CJTA 1UC8A 4M54A 3FGPA 1RQ2A 2LO1A 1C4OA 1Y4ZA 3MCQA 2BY4A 3GGGA 4CV3A 3CY6A 3B1JA 4E2YA 3G2QA 2RHGB 1KBQA 2AHOA 4FFBB 2IXBA 3DE6X 1SB8A 4H1UA 1RWQA 2FMKA 3GNQA 5EXSA 2ODBA 8LDHA 4CLHA 4ZVUA 5I4KA 2G04A 3SIVA 2DWEC 4NBUA 5JYDA 1IZZA 3ZX5A 5KNBH 1IWOA 5BXZA 4MVOA 5KA5A 1NS1A 2OZKA 3LPNA 5GAJA 3TRHA 3TXAA 4CG0A 3TG8A 1WDLA 4RKRA 4QG3A 4LGMA 5U9CA 2R1VA 3C14C 3N2IA 2AN5A 4RF3A 5COAA 3VDQA 2PGIA 2JRLA 5HE8A 3F67A 4CYMA 2ECQA 3UEOA 3SQNA 2Y76A 2OP0A 4OJNA 4W5HA 3T5DA 1QO9A 2EGUA 1ZM3A 5AKEA 5C1DA 1K9VF 4DADA 5B7GA 2IPLA 4U7TB 2GO1A 1VKJA 2IHKA 3KBOA 3LRTA 4PAMA 3A2NA 5H0IA 5A4IS 1YITV 1FJXA 3W79A 3ETNA 4JQZA 4W5OA 1IPAA 2FWAA 3VPCA 4P2BA 1FYXA 2AOXA 5FNVF 3ZHTA 2ZE8A 2FP4A 2FPIA 3IGAC 2OVBA 1XZGA 1ONBA 3FLAA 4JUIA 5KMGA 1N0NA 2EQ5A 2HB6A 1EXNA 3ADPA 1NI4A 1URFA 3BCCH 1Q1BA 3JQBA 3OLCX 5B1SA 4CMJA 5DBIA 3S55A 1SXGA 5CG2A 4F9FA 3NORA 4MKFA 4JF3A 1YB7A 4RLQA 2C9MA 2ZDIC 3CCMF 2HWWA 4HQ6A 4R31A 2HMTA 2VN8A 4G56A 3KKLA 3QUWA 3GT0A 3SYKA 3WDLA 4DABA 4AG6A 2JATA 4KRXA 3UKMA 1QU2A 4E7OA 5DM6V 3I0ZA 3BXFA 4OSOA 3MD0A 1ZJ6A 1GKFA 1COMA 3E7PA 4E33A 1M0EA 1VQ6V 2VUHB 2WAYA 2IXAA 1YRWA 3R3UA 3SPXA 1XRPA 5SICE 3FDIA 3PC6A 3C3WA 2LFSA 4WV3A 2A3RA 4MEJA 3UPDA 3C3JA 1ARZA 1AK1A 2XJ4A 1DHRA 4C1BA 1L4GA 4WKPA 4JLWA 2WLIB 2CW4A 3QXHA 1KP9A 5DP2A 5TEWA 1ZYUA 3TQTA 5EJ9A 2R8YA 4PHGA 1QLJA 1JBQA 1F48A 2CDBA 1ZUNA 3D59A 4MVJG 2Z3WA 5C18A 2F1MA 1Q0QA 3CGGA 4CDNA 3GO4A 4UUNA 1NW3A 2OQRA 5BR8O 1H85A 3H05A 1E6LA 3KCNA 5D8DA 4XCVA 4RD0A 2XB4A 3F7OA 4TUYA 2LCIA 2O57A 2PO7A 4JLSA 5KSPA 3RVKA 4JLAA 4YMUA 5KSZA 4FFMA 3TNLA 2QWQB 2J4FA 2G9UA 3K9QO 3HBJA 1GADO 2FPGA 3PGVA 3HDGA 5IJXA 1XJ0A 1KTIA 3L46A 5HS4A 3VH1A 1EQ2A 2EJRA 3CR8A 3N9IA 1Q5PA 3WGOA 4WW0A 1SCUA 3BCRA 2ZYDA 4DYLA 5BN4B 3T8YA 1DBWA 2V7UA 4ZALA 1VECA 5HDBB 3EX7C 1JIXA 2BC9A 3BRSA 2O0HA 5KAMA 5K8LA 5DN6G 1DIGA 1EU1A 4HWTA 3DFFA 3BKXA 1BJRE 2XYGA 3UUEA 2ZUTA 3AETA 4MYDA 4MH0R 2C9DA 4EYQA 5AKJA 4C05A 4JR0A 5INTA 4NZPA 4TYNA 2QN7A 2HVYD 2XI4A 4NJMA 4RHEA 2HR3A 3FPKA 1TAUA 3G8DA 2HDNB 1RI3A 2ZI9A 2VNAA 4HDAA 4XSVA 1MJFA 1PZEA 1K4KA 1MTZA 2RGEA 3NUGA 4KQCA 3Q9NA 4HOYA 1LPNA 5CBGA 3HWWA 5KYXA 4GEGA 2QLTA 3CRW1 5EZ6B 5H81A 2IFTA 1ZL8A 2AI3A 2EJUA 4G86A 4NCHA 3ZV4A 4Q9NA 3R0IA 3TIVA 1WMFA 1EFRG 3PFGA 5PNTA 3ITNA 3QLUC 1F4PA 3RS8A 3UHOA 4LC1A 1AN9A 1GNLA 3DVLA 1R12A 3NU1A 5FTWA 2R1VB 1GUBA 1NLFA 1XA3A 2INGX 4BO5A 5EN4A 2BZ1A 1PGJA 2C5GA 1OBOA 1VKZA 1IXBA 2ZBRA 1A9XB 3QPWA 2WLHA 4R01A 3WICA 4EYSA 1A8IA 4DJEC 3OQHA 1FLAA 1GH6A 1QO0D 1RPAA 2ZS7A 4KUHA 4MW5A 2ENWA 3KT6A 1R16A 4UHJA 2K2WA 5D2CA 1FNKA 5DFAA 3QJYA 3ABUA 2BDTA 5NLLA 3NRCA 3IX7A 3LCMA 4PLFA 5KTTA 3FOCA 3WHIA 4RTJA 1K7EB 2QZ4A 13PKA 3BOSA 1W0KG 5C46F 4J4HA 1R3KC 4DAEA 4DCSA 2W2LD 4HB2A 1LBEA 2FC3A 3Q8HA 5IT9N 4HWKA 2OFXA 3LWPC 3KT0A 4D8XA 3LWVC 4LHZA 1ZI9A 2FW9A 1NZJA 3A05A 1VG0B 1B73A 2PTGA 1QQAA 2CXNA 1AJQA 2G7MC 1YVDA 3FOWA 4WVLA 2X58A 4RJTA 5BN5A 4YJDA 1JPVA 2W8BC 1QLEB 3EGWA 3MWDA 4B4VA 2C83A 3OZSA 2P6OA 4M1WA 1AKQA 2PF4E 1YQEA 2CHQA 3OE1A 2AW3A 2DQ4A 3GFTA 3Q5DA 4HAIA 2PJZA 4X1IB 1WAMA 3PFFA 2DM6A 3F5QA 2KM1A 3ZE8A 2V7QG 3UK2A 1Y89A 3I6YA 2ZYWX 4H6WA 4H6PA 4Y2YA 3ZDEA 5J2UF 1V47A 2C4NA 3ORHA 1NNSA 3R6DA 2VQFB 4QXQA 3UJ8A 4E03A 3NFRA 4DV2O 3PP8A 2NXEA 3F90A 4TV8F 5IRCD 3LZ6A 4D7SA 4QJFB 5ALOA 3ASYA 2AG6A 2XAGA 2JGMA 1H1TA 4L22A 4P08A 3RROA 1ZVVA 1KQPA 4MA0A 3L07A 3DV0A 2W5UA 3T1NA 3K0DA 4D3DA 2NVWA 3F6RA 3IDZA 1DO8A 1Y76B 2OV6A 3MCZA 4ASUD 2CL5A 2VLIA 2CMGA 3PQEA 5WRFA 1HZJA 5JPDA 1X3LA 1JH9A 4HDNB 2QUBA 2QTBA 5IP5A 2CTPA 1T6ZA 3MGCA 1FFEA 1VA5A 3A58B 2ATKC 4H7KA 4HYQA 3U49A 4DQ0A 3PC4A 5I48A 1IMJA 1YACA 1YI2F 3SZLA 4FFLA 3PPIA 3L7QA 4L28A 1MVLA 4MR9B 4UM7A 4ZMSA 3BULA 1J0XO 2VWQA 2RIRA 4GPZA 4E07A 4X85A 4DXWA 4QT4A 1P0FA 4X93A 4OIFA 1RYBA 3WYAA 2IYPA 3SHVA 1IBCA 1LXCA 3TVDA 1ZJWA 4ZI2A 3KOOA 4LOIA 1XKXA 2RC6A 3RC3A 1LQTA 1F2TB 3G0IA 2R6HA 4V0LA 1THTA 3PQCA 5CK4A 1BXGA 5BURA 4YP5A 2QJWA 3KKMA 3THWB 3MERA 1TU0A 1J97A 1V43A 1YIAA 4B83A 2LIVA 2HYIC 3LA8A 5AHRA 1ZCBA 1LF5A 3NJRA 3VDXA 1M8FA 2CBXA 1D1QA 5HBGA 2AHZA 2B7CA 1IXSB 2HU2A 4Q4AB 1ORRA 2JDID 4OK6A 1TCCA 4Q47A 3KKOA 4GDFA 1K3TA 2VJOA 1KI4A 4IZHA 4QFDA 5E38A 1F20A 1PN3A 1RWBA 2QP9X 3A6LA 3G7UA 4X66O 2XVZA 1A2OA 2R3SA 4EW3A 4NMXB 1FFYA 2FG7C 3FZGA 1L7OA 4X62B 1ZMTA 5J4LA 2CXUA 4EW6A 4AYWA 2JFWA 4JWTA 4A8TA 4JJ8A 1GRNA 4LTDA 5M3BA 1LJ8A 2I2FA 1Y98A 3CMMA 4D9IA 2QRLA 1QFMA 1XCPA 2VRCD 2IPXA 2QT1A 2QRPA 1QV7A 4PU0A 2DY0A 2HRDA 3GWKC 4L8JA 3OIYA 3P94A 4PTZA 4URHA 4QTTB 4PN7A 5LA6A 1V5EA 1V5WA 5K0SA 4JKIA 3TTVA 1L4MA 3FFTA 5K1PA 1CT9A 1NVEA 1KQSU 4Q4JB 3I9V1 2HHAA 2ZJBA 4HMOA 2EBWA 3I0MA 4NAHA 1KMIZ 1IEWA 3HB1A 3JQAD 4JA2A 2BR3A 1ONSA 2AK2A 2QD1A 4CC5A 1C41A 4RKWA 2WILA 4UPVA 4Q6BA 3AM4A 5E6SA 1JHVA 4OAPA 3UW1A 4FP9A 4DR2B 3E81A 2Q4BA 2N04A 3OOHA 1OH6A 2ADPA 2JGAA 4H35A 2W4QA 1VE7A 2HA5A 4JP8A 1T36B 2OZLA 4EHLA 3ZWOA 1YBFA 3EXG1 3UG7A 2PUVA 1C29B 2VAXA 2FK8A 3LRPA 3RS3A 2HX1A 1BKYA 4JZGA 1MMFB 2BUBA 4OYRA 5JCOA 5CFRA 3SYOA 1DMSA 4BO2A 1XZKA 1S9DA 1YHZA 2I80A 2J3DA 3AK2A 4CS4A 2P9HA 3FY4A 4I50F 4YRGA 5DW3A 2REOA 1TIKA 4F3TA 4US1R 4KPUB 4PYNA 1YOVB 1Z5UA 5BSRA 3QENA 1AN0A 2DWQA 1SC6A 2OCPA 2QLLA 2VF2A 3KSUA 4X92A 4KO8A 2JS5A 2GJSA 5TGZA 3GUVA 1F9EA 3TZKA 5KUTA 3VMFB 1M34A 2YW9A 2RJZA 4N0EA 5IYBO 2AS0A 3DUWA 4RJJA 1FU8A 4Q4DA 3B2EE 1COWA 2NSLA 3STZC 4WNYA 1RWOA 2WZDA 2MSKA 4D9FA 4HTAA 1QUFA 3MWDB 4KKVA 3HFSA 1NJ5A 4LJAA 3KSMA 4OEHA 1R18A 2B4RO 2XNCA 3C6QA 2C8VA 1A8HA 4AZ0A 3VZBA 4DUGA 4IGEA 2VR1A 3IDOA 3P0EA 4Y1GA 2J9FA 3OEEG 1TIBA 2WSYB 4JQYA 2OUIA 2VH1A 3RAGA 4MMXB 2ZYRA 3GQBB 5EMKA 4EG5A 5HF8A 3IL2A 2A9HA 4REQA 3WADA 2H59A 5AKKA 2WJ4A 1FRFS 1ENPA 2FQ1A 2FHSA 2OM2A 3EQ7A 1J49A 1M1YA 1Q0ZA 2GCOB 2R5FA 3M49A 2O6HA 4RZSA 2M1XA 3D7SA 5A03A 3PWZA 5LYYA 1G8AA 1KU6A 1KI2A 1ZJYA 4EW2A 4J0GA 1KJ8A 1ZRSA 4G4ZA 5BV0A 1FF9A 3MJRA 4QHTA 5LU8A 3FAVA 1YJCA 3JSXA 5FA5A 4B74A 1BJTA 2CWWA 3VJRA 3O65A 1O9HA 2EILC 4AMGA 3E4DA 2O2YA 2OZPA 1B0AA 1WSAA 4RGBA 4LYFA 1N34B 3JVHA 1P3Y1 4P7KA 1CB7A 1LVHA 2IGTA 4MV8A 1NTZH 2Y4TA 2OXIA 1YJ5A 3PEVA 2PXAA 1VMEA 2AJ8A 2P30A 3ABSB 3T5AA 4M7PA 4HAZA 2I6DA 3EAFA 3U4MA 5CXQA 5B2FA 1V5FA 2IHZA 1KEUA 1DLBA 5EBMC 3SSNA 1GFSA 1VKOA 3UJ3X 2HSZA 5AJWA 1N2EA 1XEXB 3HN2A 1JS1X 4JROA 1SBIA 4B2IA 1C7ZA 4FGKA 1E1DA 4BCCA 1T0PA 3GLTA 3FOBA 4F3CA 3EXHB 2OQIA 1Z5NA 5B1BB 3KG2A 2RGNC 4Q93A 1F3OA 1QQ7A 4FM0A 3HJTA 3TTTA 3DQPA 1CZHA 3HUDA 5FLYA 2HS0A 4DBLC 2FZCA 2RH9B 3GFVA 4QNRA 1WZIA 1YQTA 4Z99A 3RC1A 4J4BA 4OQDA 4QARA 4TMTA 2MWMA 4PGGA 5FEMA 2A3NA 4DR6O 3TX6A 4ABYA 4YCNA 1JE0A 2RHBA 3QBJA 1M72A 5DTJA 2FJ0A 2J3IA 3QVGA 4KFCA 5F1PA 3DSQA 1HSZA 2PHNA 4B45A 1PL6A 2ZUUA 3B52X 1KJIA 1TT5A 3CRVA 1UH5A 3EOAI 3O2SB 4KXNA 4XLLA 3T7DA 1IQ0A 2VKTA 2Y4OA 1E1LA 4UHKA 4ZZ1A 3WK5A 2F1IA 2MINB 4KP4A 4ALJA 1R1MA 2VDQB 1C1HA 5T3YA 4ZHSA 5BN3B 3IE1A 4LYEA 1P0QA 5B7QA 3ESRA 2SNIE 3D1JA 4B6GA 3I37X 2AFHE 5JYCA 3LDGA 4MW1A 1GQ2A 1YF2A 5T6MA 2WYVA 1RM4A 2DJ5A 3AZOA 3WGZA 4Z4CA 1D1SA 2CJWA 4R83A 3R3WA 2PMBA 4ZCLA 4X24A 1OH5A 1EK5A 1IH8A 1V6SA 5IC6A 4G2KA 1IUOA 2ST1A 3BTUA 3NHWA 4HXYA 1WNFA 2SKCA 1F4VA 2ZBUA 4EEZA 5TLSA 4DV4O 4QAJA 3S81A 1EJ0A 4WZAE 4OXIA 3SC2A 2DKNA 4YAUA 4YQZA 1HP8A 1QH8A 2B34A 3HDTA 2DFVA 3NIDB 4L0QA 4YRJA 4UTZA 1UODA 4GXNA 4DLRA 4HNVA 1P4AA 5I7RA 4LEIA 2XOKA 2BYTA 1U3PA 4MP8A 1R50A 2Q4EA 5D86A 1H3FA 1BQZA 1LDGA 3S2EA 4YMGA 3VMFA 2Q0OC 2CE2X 5FWXA 3ABRB 1KI8A 1RM5A 1LF0A 5KJEA 1SESA 2UXXA 3J80M 1VG1A 3A1UA 3Q7EA 5CPBA 1HPLA 4FGWA 4GSLA 4WLUA 1YBMA 5CLIA 3DC5A 3H4VA 1IV2A 5E6RA 4S12A 3T99A 4M21A 2JNBA 4MGEA 3LGAA 3NHFA 1P6UA 2GDSA 1G5PA 1YKFA 2JZCA 1AURA 1ENOA 2JL1A 1VA4A 3BERA 4JH0A 3RS0A 3BD7A 3DEYX 3TW4A 4KLCA 3DAHA 1Z15A 1EGVB 1X2EA 3QEJA 5F33A 2XBLA 2YS7A 3R0PA 5F2VO 4GP6A 4PAQA 3K2QA 3K9HA 2D5CA 1M1NB 4DR3O 4RQOA 1EDEA 3JZIA 1W2WB 1E6KA 4NZZA 4PONA 5B36A 2QRKA 3D7RA 1OQAA 3AK3A 2P9JA 3DBVO 5FFMA 2AZ4A 4ZDWA 1EUZA 1HT0A 2ZXEA 3IUQA 5B2EA 2BHSA 3QVSA 1T1JA 1PZFA 3ORYA 4JX9A 4AJIA 2GVDC 2DHRA 4Z9YA 1K7YA 5B3SC 1GN8A 1VBKA 2YXZA 5HRUA 2ZJ7A 5KNDH 4OXYA 2DMXA 1G20E 2CLEB 1U96A 3LDHA 3U81A 3MFQA 5HIMA 3WGJA 2G38A 4A03A 2PTHA 1FMTA 5JXIA 4P7JA 4N48A 2QTSA 5L3EA 4CR8A 3E9DA 1LLFA 4D6PA 4M9QA 4OGWA 2DR0A 1Z6GA 2QTAA 2YHAA 2Y71A 3LUFA 4BT3A 1U1DA 4UCFA 3T5CA 3ZD9A 2VHUA 2X7HA 1I4WA 4KVZA 1Q0SA 3SHTA 5JNWA 1NZ6A 3WZ2A 1IRIA 2OENG 3DE4X 1JEJA 3TRDA 4YMVA 3QJGA 4RLFA 1OYOA 2GPTA 4KK3A 3TSYA 4GD3Q 4MS1A 3RYFA 2IXEA 4ON9A 3HLTA 3HM9A 1L0BA 4JUDX 4TWAA 3KZVA 3G0OA 4JLPA 3ICEA 4B7UA 2FN3A 1RW4A 4OQ4A 3SC3A 3W2GA 3R5SA 4CZ2A 1U0FA 1XRQA 3UB2A 1U90A 1RU3A 1XREA 2HF2A 3AJ8A 2O8FA 4RMNA 4PA7A 1CJSA 1K9MW 1SCIA 1TQ8A 2ZXFA 5H02A 1NJSA 3HYNA 1OREA 3KZCA 3T7TA 5KHGA 1TM4E 3DFZA 4PSDA 1AMNA 3QEMB 5FPTA 3UMSA 2QN2A 4UFOA 2GTSA 4DEVA 4CQJA 3T12A 3G2MA 1QX4A 3IP1A 3LIIA 2Q7OE 4EO4A 3W4KA 5I7OA 2G88A 4I55B 2EJTA 3A27A 5FUQA 4PDRA 1TPYA 1Q1AA 2GUWA 3IQXA 2FOLA 2VCEA 1L9KA 1GFWA 1CJMA 2NNLD 1X1EA 4WUTA 5H1YA 3WJ7A 3K12A 1YDGA 2P9YA 3KYDA 1P7CA 4BQNA 3G5UA 1AT1A 3L8YA 2LNDA 3IJ5A 3IV9A 5HGXA 2IBZH 3UT5A 1Q14A 1SHUX 4MQ5A 4WEOA 4DMRA 4F6CA 2QIOA 2JFVA 5JTUA 1UZMA 4ZJPA 1MKYA 3O9OA 3B3AA 2LGWA 3UWPA 5LQKA 1F4NA 3QVXA 1G38A 3ZDZB 1PM9A 1XGKA 3AWIA 1K6XA 2OMEA 4G01B 2WG0A 2NMUA 4EQ6B 3CH6A 1D5AA 4I1VA 4L07A 2YZGA 5C1PA 1I94O 3CB4A 5J58A 4TSFA 1TL7C 2X9GA 5EUQB 1Q19A 3D1LA 2VJQA 3FMVA 3OJFA 3P71T 3IT1A 4C0AC 3W7VA 5AK0A 3QUQA 1X86B 1N3YA 2BR5A 1QH8B 3C3DA 3DOFA 1OHHD 3JQEA 5ERYA 3CP1A 1RE0A 3GJ0A 5K6AA 1WLEA 4MJ7A 5GVSA 3K3WA 4JR1A 3ID6C 1W88A 2WHPB 3L05A 4DWOA 2O0JA 1EG7A 2GZHA 4XD7D 3W6NA 2ESRA 1RR6A 2BBWA 1WSWA 1PR5A 2YQ4A 1N6HA 3TCKA 4B75A 1X0XA 4B32A 2WHEA 2O14A 4OCZA 2H8PC 1R9NA 3SR2C 1E0DA 1V1RA 1YB2A 3R3HA 4AC9A 4RTSA 1CRZA 3M6IA 3JQQA 1TTQB 1Z6AA 1HO3A 4PGAA 4FMPA 3BXOA 4X0EA 5CBHA 3ZDYB 4EDFA 2DCMA 3V1KA 1EINA 4LDQA 4ZDKA 2YRFA 5I7HA 1X77A 4XCXA 3CCSV 2ISCA 2B2CA 4FJCC 1VBMA 3BHJA 2VGNA 3LHIA 1E4VA 2IYTA 3P9IA 2PNJA 3WL5A 1EK2A 1OJHA 1Z9BA 1BWQA 2M32A 1Q3EA 2MSLA 3OTGA 1T8PA 4CLOB 1L6IA 2WWXA 4CODB 4S04A 4RADA 4UHHA 1TZBA 2X7JA 1H6CA 2FPMA 1RXSA 2FPXA 3QKSA 3AEXA 2IE8A 4N4AA 1Z28A 4JMPA 3TDMA 4BMZA 5I9MA 2ZJ3A 4EGAA 2IL1A 3TIFA 5J43A 3OCCA 3FKSG 3HJNA 1QHEA 4TTSA 4DIOA 3I04M 1D2HA 1MPXA 4UU0A 2ZT6A 4QE9A 4C7VA 3GB7C 1UBFA 4CIDA 1JYEA 4LCUC 4PC6A 3H5TA 4HFNA 1RXWA 3NP7A 5FULA 4FS8A 2Z5VA 4WCFA 4M98A 1YSCA 4W7IA 4TYWA 4CEIB 1UWVA 4F2HA 3DVAB 4IPTA 5IDXA 1ZVQA 4QDTA 1NMUB 2NVUA 3O8OB 3HNOA 3WC4A 3AGKA 5B5EZ 2OAQ1 2R5WA 2MYUA 2AD5A 3R4CA 1QQCA 4X41A 5F76A 3CW9A 2G70A 2KGWA 1K9MH 1OAAA 3IAFA 2VF4X 1GQOA 1QAOA 3IKMB 3VUFA 2P6PA 4I9HA 3JD0A 3RM3A 4MS1B 5HJ2A 1OV9A 1KO8A 4BO4A 4PZUA 4P1ZA 5ERXA 4IFBA 4RTNA 2GWHA 1IM5A 3EH2A 4N5LA 1CWUA 1JDJA 2OCDA 3AJDA 3L5OA 4H1VA 4MZXA 3M4NA 3ZDDA 3O3NB 3ZHOA 1HYBA 4D0RA 2BN4A 4H77A 1RJFA 3DV0B 4DV0B 1M1XB 1Z6PA 2VJYA 3BXZA 3EXIA 3OT1B 3QKUA 3UA3A 4WFGA 2PZLA 2QLFA 1VIBA 4MPJA 3FOFC 3FTFA 1YGYA 1BE0A 3D7LA 1BMFG 3Q0IA 4QAQA 5JECA 2O19A 1N25A 4IOJA 2PLAA 2H6EA 1GJRA 1F0PA 1LPBB 1WMEA 1X13A 1FFWA 3RU3A 4R84A 4MGZR 3ELWA 3C3TA 2P9ZA 3MYRA 3ORQA 3OOSA 5A71A 4JBWA 3C4JA 4NPAA 1RLIA 4DMKA 2DWOA 3JZAA 3NBYC 3TFWA 4GMKA 2ZBPA 1PJZA 1XHFA 5KC9A 1C14A 4GG1A 2C2YA 4BX2A 4NULA 4CW7A 4HUQA 3PNYA 3FYCA 4WERA 3H83A 1E9SA 1X7XA 1WXEA 2JJ1G 4M7WA 1DAOA 4G41A 4TM7A 3ELDA 3FTPA 3NCTA 3IFXA 4GBMA 3GCZA 5REQB 3ZW9A 4CQLA 1SCKA 3IULA 1R8YA 4PGHA 1G60A 3MOGA 1X25A 2VPPA 4X1KB 4IUBS 2HV8A 1V54C 1FJ2A 3EVGA 1LQUA 2UUCB 1VG8A 3PUIA 4M53A 4OB7A 4PSCA 3LWOC 1XWWA 3BZBA 2WA3A 2AN3A 3R3VA 3ZOZA 3KOMA 1LI5A 2PX2A 4LXHA 1Q83A 4UCOA 1X7OA 2BJHA 1E7SA 3SBXA 3F74A 2RCYA 1XRSB 2OWEA 2R8RA 1W8IA 3KKYA 1EX1A 1FMCA 2QVZX 2YMQA 2ACKA 3H9BA 3QW2A 1B23P 5EIBD 3U3DA 4JKYA 4GXRA 4A91A 3D3QA 4CE6A 5IBCA 1KEZA 4NYIQ 4Z9XA 3RF6A 1R73A 2EFYA 2FP3A 2HCTA 3ZTYA 2PO5A 4I4TB 4EMTA 4LOAA 3HE3A 3DAPA 1N3BA 3I28A 4JK3A 3UK1A 1YJNF 2NU9A 1SKYE 2VPTA 2XKBA 2YYYA 3EA4A 3LDFA 3M6MD 5ESWA 3ZMVA 5FV4A 1PTKA 2H1WA 2I3GA 3JSNA 3DOUA 4AUNA 3TQRA 3T0IA 2R1ZA 4W82A 3U7GA 2H7XA 4Y6OA 2AHYA 2QTVB 1YASA 1U7XA 4PN3A 2V9YA 1CQJB 1A2BA 3CCUF 3KSRA 4MIKA 3WBBA 1I7DA 4FLEA 2Q0HA 2VI5A 1CS0B 1R0WA 4Q6GA 1VI5A 1EMDA 5DXFA 5KJ6A 2DE0X 1O8BA 2ZUWA 3R41A 4MUXA 4MINA 2V65A 5F7JA 1S2DA 1UM9B 4QASA 1QE3A 4GAEA 4G5OA 3UG6A 2VRCA 3IUPA 4FFRA 4DLVA 5HWSA 4TVSA 3OTFA 1M75A 1MAHA 5JFGA 1OAKA 1JDNA 1A69A 4C4AA 1A1SA 1W29A 3L0IB 4PW0A 5B3AA 4YMHA 2HADA 3SICE 4GWLA 2QIPA 2WMNB 3L6DA 3R6WA 1J8QA 4JJEA 1N0IA 3HKCA 1DX9A 3UXYA 3ZNOA 5IZCC 5K7SA 4Q3BA 3CZ5A 3ECCA 4CM5A 4U5QA 2V0CA 4BX9A 6ABPA 4RY8A 2VBGA 2IBTA 2JCXA 2LCFA 3BBLA 1LS6A 5DHTA 4LCJA 1JBKA 1SA0B 6NULA 4JYYA 5LUBA 4DDWA 1ZW6A 1N8TA 4MR8A 3UV3A 2EAUA 2XZPA 1ESCA 4HAVA 3WYGA 4XM2A 2JLUA 1NLYA 2FWNA 3CA8A 4FHZA 4R69A 2CBGA 3RIGA 2AOUB 1VQMV 1VQ7V 4M8KA 3CM0A 5IW8A 5ESRA 4HXEB 4HEA6 4RZHA 4QOFA 2QDKA 5E9WA 1Y4MA 1NUUA 4F5ZA 4D7AA 3PCRB 5F3DA 1JPNA 1KQ3A 3RYTC 4D92A 4AN1A 2ZF8A 2VP4A 3ZHBA 2NGRA 3JWIA 4R98A 4PM4A 1XNHA 1ESNA 3OHMA 1D3AA 3X44A 3UCFA 4C6SA 1TYCA 4GKAA 3I56F 1K75A 1TD1A 2Q2OA 4MTGA 2OCGA 1I2AA 2C20A 2GF0A 2YFKA 3CNEA 4UOEA 5JC8A 3T0FA 4PG4A 2WAOA 2HZ7A 4HNSA 1V55B 4TLDA 5AW2A 2WNHA 2QWXA 1A8QA 3KHNA 5H8WA 2EKQA 4FNMA 1LVUA 2NZ2A 2B4QA 2HRQA 2QJFA 4KFRA 1USKA 4LRYA 3W77A 3R66A 4OQLA 3KVRA 4BWYA 4KE6A 1OIVA 1AR1B 1HTWA 4JI1B 4X9XA 4GKJO 2FN8A 4XFKA 4ZZ0A 2JG3A 4EFEA 3AYZB 3W6UA 1E89A 3B9BA 1YB1A 3UA4A 5K0EA 1TTHA 5IM4A 1T15A 2CF6A 3BFKA 1QP4A 1WVMA 1ES9A 3RREA 1R0YA 2Z3ZA 1RAAA 3NFYA 1QGOA 2ZTUA 4NYJR 3EZGA 3PA8A 3FNBA 1BFKA 3HVUA 3BWCA 2R7AA 4JBLA 1KGSA 2BEVA 4MDEA 4IL5A 2FP4B 3HU1A 3B38A 4YRZA 6REQB 3NVKE 3AETB 1V25A 3K9LA 1SBTA 3NAQA 1DWQA 3NTOA 1L4LA 1T9DA 1CE8A 5ALIA 1EWYA 2E55A 1EXDA 4DZRA 1ADFA 3OQPA 4DARA 4A23A 4KFSA 5K3DA 4PINA 4BRZA 3D3NA 1VF5B 2H65A 1XAIA 1WCV1 2ID7A 4AF6A 3EA0A 3IRUA 2YVUA 4CNQA 1K66A 3MGGA 4WJKB 3S2GA 5SYMA 3UCXA 4QRDA 5A2QM 1E6EA 3OIDA 2ZYUX 1RFGE 2WSIA 1ZLZA 1OF1A 2I1WA 1OZGA 3A04A 3CH5A 5FKJA 3QZUA 2XWBF 2ES4A 2PDAA 4Q3CA 1SIWA 4C30A 1K3FA 4PSUA 1WHSB 2QTVA 4P92A 1LSOA 3D7KA 4JBHA 1RHRA 1TQ2A 2FUEA 3CVUA 2OHFA 3QE3A 1N3LA 3MCAB 5JQGB 3G89A 3I2GA 1H05A 2IV2X 2AJTA 1CS0A 2CH7A 2RHDA 3DB2A 2A6PA 3DEAA 4IINA 4QFBA 4XASA 1N2XA 3C3PA 5B2ZA 2L35A 1E6CA 2FE4A 3H19A 4B48A 6GPBA 1Y1QA 2QYOA 2VRNA 4HDMA 1KZHA 4L8GA 4LYJA 4DGQA 1PYGA 3MBIA 5J59A 4KSBA 1QANA 1WP4A 1EJ6A 3WLJA 3VFDA 1RWKA 3HUEA 1K4DC 4EA8A 1T25A 4W5TA 2MSCB 1DXYA 4FWBA 2PJDA 5KYVA 1F1JA 4FLVA 5JTTA 2GKOA 3CUTA 3B5EA 4WOPA 4GZMA 4I50A 5K3FA 5C7LO 1PL8A 4LXUA 5ICSA 3UANA 3PDHA 3O9MA 3OP1A 4MAFA 2KB0A 2IV3A 1AKUA 3IP8A 3L8ZA 2ODTX 4M7RA 4B8ZA 1E79A 5KHHA 4IDQA 2H5IA 2NTYC 1WW8A 2E5LO 2Q5LA 3HCCA 1KYOF 2FR0A 3LFTA 4P35A 2N47A 4NONA 1MXFA 4JPRA 2ACEA 4JT9A 3GEGA 1JLLA 1RRVA 2FHPA 2VO1A 1F5SA 4CT4B 1Q7BA 3I12A 4QECA 4RL6A 3RSOA 4QJ4A 3U31A 2Y99A 1K5GA 1NM5C 4AI6A 3Q1LA 4H31A 2F1RA 5E4TA 1PZXA 2ORWA 1EB9A 1PNRA 2LW7A 4X1IA 3ED1A 4FWTA 3U7JA 1MA3A 5DJ5A 1E2BA 2E5LB 1JECA 2GLTA 5FIUA 1S4QA 3DE3X 3LRXA 2RGGA 2IX3A 2PLFA 2EQAA 2Q28A 4LW8A 1PJQA 3A6EA 1GN6A 3B1ZA 4NYMQ 4Q12A 3RS9A 4FE7A 1YT5A 4BU0A 4DRZA 2ONJA 3FOZA 1AJEA 3TLXA 4OOFA 5EUMA 3GR6A 1KVSA 2Z2KA 4UOZA 5C53B 3PC8C 1YC5A 3U10A 1NXSA 2YHSA 1Y4UA 3DZKA 2Z3VA 2HNBA 3P3NA 2DLDA 3E8XA 3N07A 4RMIA 2Q5QA 3MS2A 4RWEA 2FN4A 5ISMA 4GOXA 3KQQA 1WIWA 1W9MA 4OI2A 3FD8A 4ZPXA 4C7OA 4KQHA 1R8JA 2OBNA 4JT2A 3SZGA 3W04A 3K0GA 2BEWB 1CZKA 2HZBA 4TWJA 1ZCJA 5AM1A 4AT1A 1MC4A 4UUQA 1IY9A 4OJTA 2VT3A 1HRKA 1RE1A 4YI5A 5FADA 4UXNA 2J32A 1J20A 1P2FA 3FNHA 2VH5R 1OPXA 2A0KA 2GBIA 3X2SA 4Y2TA 3UN1A 4JV5B 4FT4A 4YNBA 5IDWA 1RVV1 4BMPB 4J0FA 1UR5A 4IIYA 1HDIA 4BGIA 1QK5A 1BHSA 3FF1A 1BXGB 2VWPA 1PFGA 3GRZA 2VC2B 4MVXA 4X95A 1UINA 1UOOA 3RYFB 1AB6A 1KKCA 1MR3F 3ANMA 3ZLTA 4MV9A 4F6RA 4KACA 4L74A 3AINA 3NHAA 6REQA 1CQWA 3G0GA 4F3KA 4F3NA 1JHQA 1DVRA 2IYXA 1YZGA 4MV6A 3LF1A 3W8RA 1RSZA 4HEJA 4DWVA 2HD4A 2QTHA 5D51S 2QPTA 1M7HA 4LH7A 4ZO8A 3V00A 4EHKA 2O8NA 3FKJA 3WKCA 1W55A 2CE7A 2R62A 2JBAA 2DFTA 3CW8X 4JVSB 4W5JA 3IKJA 1Z34A 1BC5A 3NQ41 1Z75A 3SCZA 2AOWA 3ZBUA 1K8AW 2I6XA 4HLUA 1JUDA 3I04A 4L8LA 3VGPA 2C4KA 4NNOA 1H2YA 3TFQA 3ZNPA 3TIIA 4C7BA 1AKWA 1CNEA 3VOSA 3W1WA 3AEKA 1N36B 5I4CA 2AF3C 2FGYA 1JHRA 4WFJA 2H4ZA 4CI0B 4EPTA 2GR9A 3O7MA 4ER6A 1F3LA 1H5UA 3JYPA 3R9IA 5TB5A 1QOQB 1SQXH 3CMEV 3IR6A 3EG5A 2D0DA 3KJQA 7MDHA 1VL1A 4BP8A 1CJKC