5ITZB

Crystal structure of the sac domain of cpap in a complex with tubulin and darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNAKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Centriolar CPAP/SAS-4 Imparts Slow Processive Microtubule Growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 172
structure length 420
sequence length 430
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5itzB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5itzB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5itzB01
2RHLA 3M8KA 5JCOA 5CA1B 5EIBD 2Q1XA 3RYIB 4ZI7B 4I55B 3WGKA 1W5BA 5EYPB 3RYFA 4O4HA 5IJ0B 4E6EA 3HKBA 5MN5A 3WGNA 5C8YB 2VAMA 5CB4A 1W5AA 3JAKA 3HKCB 4IIJB 3JARB 4EB6B 5IYZA 4I55A 5LA6A 5EYPA 3RYFB 4O4HB 5IJ0A 4U3JB 4DRXB 5IJ9A 5C8YA 4ZHQA 4O2BB 3R4VA 3UT5B 3JASA 3N2GB 4TV8B 5LP6B 3WGMA 2XKBA 3HKEB 3N2KA 4O4JB 5GONB 3RYIA 5KMGB 3WGLA 4EI9A 4ZOLB 3HKDA 3CB2A 5IJ9B 4HNAA 4IHJB 5JH7B 5JQGA 4TV9A 1FFXB 2VAWA 3JARA 1FSZA 3JAKB 3RYHB 4EB6A 5IYZB 1Z5WA 5EIBC 4YJ2A 4B46A 3VO9A 5LA6B 4EI8A 1Z5VA 4U3JA 4DRXA 4X1KB 3V3TA 1TVKB 5CA0B 2VAPA 5KX5B 4ZI7A 1JFFA 3N2GA 4TV8A 5ITZB 4I50A 2GVIA 5J2UA 1RQ2A 2R751 3VO8A 4IIJA 1TVKA 1TUBB 4EI7A 5BMVB 3ZIDA 3JALB 4O2AB 4X1IA 5JH7A 4YJ2B 5JQGB 3RYHA 3JATB 5MN4A 3VOAA 1W581 3JAWA 4LNUA 5J2TA 4O4JA 2RHJA 4O2AA 4I50B 5MN6A 5ITZA 3E22A 4KWEA 5KX5A 3HKCA 3VOBA 5LXTA 1RLUA 3WGJA 5BMVA 3RYCA 5FNVA 4I4TB 3VPAA 3HKBB 3C8LA 4U39A 4X1YB 2BTQA 5J2TB 3HKDB 4LNUB 4ZOLA 4O4LB 5LOVB 4O4IB 4FFBA 4M8IA 4HNAB 4IHJA 2RHHA 3E22B 1FFXA 2VXYA 3UT5A 2RHOA 4X20A 2BTQB 4X1YA 3N2KB 4F6RA 3M89A 3ZBQA 4WBNB 2Q1YA 3JALA 4FFBB 4X1IB 4O4LA 5LOVA 4XCQA 5JVDA 5FNVB 3RYCB 5LYJB 1SA0B 1W5FA 5CB4B 5EZYA 4X20B 2XKAA 1OFUA 4I4TA 5J2UB 4DXDA 4TUYA 4ZHQB 5CA1A 5EZYB 5LXTB 1W5EA 1SA0A 1W59A 4X1KA 3RB8A 5LP6C 1JFFB 4WBNA 4TUYB 3JATA 4F6RB 2BTOA 4YJ3A 5CA0A 2R6R1 3ZBPA 5M7EA 1RQ7A 5JCOC 3JAWB 4TV9B 5LYJA 4B45A 1TUBA 5JVDB 4O4IA 3JASB 5LP6A 5GONA 4O2BA 5KMGA 4YJ3B 3HKEA
chains in the Genus database with same CATH superfamily
4TM7A 4B3MO 2ZDIC 2R8YA 2DHRA 4TRMA 3HXMA 4PBTA 2H06A 4FD2A 1CZRA 5IK2A 1QHIA 3HY6A 1QKIA 4W6ZA 2WM3A 2YDEA 5C0OE 5F5LA 4O4HA 3O74A 4LR3A 1PGPA 2AZMA 2XWSA 3DL7A 2GHQA 1XNHA 3FOCA 3TMYA 3U7JA 1UKZA 3VC2A 3K16A 2OTJF 3OZXA 2VSFA 4ID9A 1XNRB 3L71H 3DJYA 5AKXA 5A0FA 2I3BA 1M2VB 3O8OA 3TKYA 1DAOA 1AP5A 1OXXK 4KFTA 3SLGA 4G4GA 4NYKA 5C31A 3UQYS 4YAKA 1X1RA 4KR2A 1U1IA 3UK6A 1DEXA 4QYWA 3HKEB 1BE6A 3HBAA 4IO1A 3HL4A 4MR8A 1XDUA 3ESJA 3B6MA 2IHKA 3SPIA 1YKSA 1NIPA 2PGJA 2VDKB 3PA6A 1MRNA 5DTIA 4YRSA 3GMDA 4OGFA 3UGKA 2D1YA 5CPFA 4ADSG 2HQSC 1V43A 4WUTA 4ES6A 1KVSA 4F84A 4K0KO 5HSGA 4P36A 2XDQB 2IRWA 3NPAA 1EXWA 2NVOA 2QN6A 4MGHA 2IS6A 2ZU6A 3CLUC 3HM2A 4Q1BA 1KIAA 1Y48E 1ZGBA 1JXQA 4EG8A 2O7RA 2NR5A 5BR4A 5SY9A 4GPZA 2W6NA 4FOSA 4N65A 2IIQA 4G2KA 5JAIA 3IEWA 3PX7A 3MRVA 2PQMA 3BXHA 3F7MA 2WKRA 1VQ5V 1PXWA 1TGOA 1Q6YA 3GDOA 4A8PA 5BY2A 1RJFA 3ZP7A 1V7ZA 1P4RA 2D4AA 3WG7B 3UUEA 4CL2A 1KI8A 4KXFB 3A6EA 1YZHA 2F7SA 4OYRA 3Q7EA 4DADA 4B4KA 5AM2A 4W63A 4UMFA 1YIAA 4PSCA 3ND5A 1MNGA 1HT2E 4ZIRB 3AP2A 5F2VO 2WSIA 4D9IA 1YH3A 1Q6UA 4DB4A 1SD2A 2LWIA 3I53A 2ATKC 2OD7A 3O3MB 4UUBA 3C6ZA 2IUYA 3GQBA 1KORA 1PO7A 3KJKA 3WFVA 3L0BA 4LQLA 2FZ5A 2CK3G 2H11A 4KWTA 1P9NA 1YFKA 4G0QA 4WI1A 4GO1A 5C2JB 3SZLA 1M8PA 3RUFA 3RU3A 4B3DA 2JARA 3VI4B 2BFDA 2OYQA 4FHCA 3EH2A 2XGGA 1MG5A 521PA 5CB4F 4UQLA 4HXYA 2WW8A 3O31A 4ZV9A 3TOVA 4WOKA 4LZJA 1UDXA 1VGRA 1WXDA 2FG6C 2ZSHA 3BKXA 4PLYA 4EW2A 5LNK1 1IBKO 1EESA 2QDOA 2BR4A 2MR5A 4DGQA 5AVZA 5FA6A 3O82A 4P86A 2V59A 3WB2A 4DR1O 1N7IA 3IVGA 1YE8A 4J6EA 4TKVB 4DLPA 4AG5A 2HHHO 2GJSA 2GNOA 4BNXA 2H65A 3GIDA 5KNLA 5KYTA 2F1RA 1HGXA 1MB2A 1MJHA 3D6AA 4IPTA 2M6KA 1XXHB 1Y42X 2AHOA 4UTXA 1MA1A 1JHRA 3BERA 5EE5B 5E95A 2BSQA 1YVWA 1LRKA 1DARA 3BMCA 4MPDA 4RYDA 4MYHA 3UAYA 4AIIA 2C7BA 1XTIA 3B6EA 4DQLA 2VHQA 5FYQA 3LW8A 4GMFA 1B00A 4KU4A 2DKFA 1K63A 4P3XA 3MUEA 4FYPA 4KQ2A 4NQ3A 2AC4A 1VQLV 5DM6V 2GAOA 1O9GA 3CX4A 4GLFA 3L9DA 5HFLA 4G24A 4LXGA 2VTDA 5AICA 4ISCA 3RIEA 5J4LA 1DMRA 5M29A 2HCRA 4OXYA 4FB5A 3KR0A 1Y9JA 3KZKA 3PNSA 4JB8A 3U1VA 3SDBA 1E1QG 1QIFA 4AZ3B 3NT5A 3WL5A 3EPJA 1LB1B 1OA1A 2V7TA 5A0TA 1GL7A 2LXNA 4B6RA 1CD5A 5JFOA 1U7PA 1IXZA 1GQFA 2RI1A 4A0FA 1XZHA 2BEKA 1MC4A 4Y6PA 4BJ6A 5JZSA 2P9EA 4U2KA 2WMYA 1SBZA 5E6RA 2FMXA 3G9ZA 2QV7A 2QUJA 3E8XA 2C2BA 5ES3A 5FTWA 3OO1A 5KCMA 3A9CA 1LPBB 4YJDA 3T1NA 1FP4B 4MS3A 5KHKA 1GAJA 2NPFA 3E03A 3AW8A 3GROA 3UUWA 1OCOB 1MABA 2JFYA 1GKUB 4RPIA 1AZWA 4ND8B 1E3DA 1JI0A 2R7MA 2KBFA 4XD2A 3EQ7A 3FD9A 2VP2A 4YA6A 1QHHB 4KG7A 1PDVA 2QLMA 2AMTA 3ENKA 3KB1A 1R3DA 1II8B 2OPHA 1ONIA 3G6WA 3I9FA 3Q9NA 3MF4A 5GJWC 1NXWA 3D0OA 2B20A 3DWGA 1D1TA 1Z5OA 3IPLA 5EJAA 5CCEA 5IH7A 2W0XA 2NU8A 4RSGA 4O3FA 2EC5A 4ARUA 2IYUA 1KVTA 3GRUA 3WIVA 4RDCA 2VJAA 1THMA 2WSSG 4N7MA 5E1OA 4E7OA 2R751 3RS2A 1NXPA 4D3DA 3U13A 1CNMA 4ZICA 1V16B 3G0OA 4AS2A 3A2MA 2FZWA 3DCNA 2LPMA 3G6KA 3OHMA 1CV2A 4P33A 3V42A 4IFIA 4ZT3A 5EHXA 1I8TA 2YUTA 3HO8A 1JSCA 1M72A 4TRNA 3SWWA 3UM7A 3OA0A 4OAQA 3KJNA 2QMUA 2Z1UA 1JDNA 1LI4A 1FMJA 2A3NA 1VSQA 3II6X 4KVGA 1YZBA 1HYQA 2RHRA 3SXUB 1JXOA 1A96A 4LRXA 1P0IA 2GH1A 4H1TA 3GWOA 3LVRE 3THXA 1KO5A 3WAGA 2WK1A 3BMNB 1BMDA 3PUYA 4ESEA 1GGEA 2UZIR 1OC4A 1CF2O 1D2AA 2Y4UA 3KTDA 1GYQA 1PV4A 2LFSA 1YHNA 3L77A 4IGKA 4M9XA 1NXVA 3WNCA 1GM7A 2JLWA 1S8NA 5JI2E 1GXSA 4GX0A 1SUCA 2IH5A 4D98A 2C1ZA 2RHHA 3CSDA 2QRZA 1H1LB 2J3IA 2YYZA 4LZAA 1DC3A 2ECKA 3KDSE 4PLHA 3SFVA 4RVDA 3OJ0A 2CF6A 5LUBA 1Z4MA 4ZYZA 5JZ9A 2B34A 5EPUA 3RR2A 2PL9A 2RG7A 4ZHSA 5KNCD 3IDZA 2DPXA 4WXHA 1W49A 2QT9A 3OCJA 5B1EA 3U0ZA 1KMHB 4DA0A 4QIWF 5REQA 4EVQA 4GL4A 3L7NA 3V4DA 4AIRA 3KHTA 2JCXA 1W93A 3FNRA 5JASA 4OQ4A 4YREA 1PTKA 1B06A 2F66C 3CMAF 1SHKA 3NBXX 4TWZA 1QD9A 5BOVA 3BRSA 5BW4A 1PR1A 1MO3A 5AW8A 1MOFA 1ZN9A 4ZAZA 3SJAC 2FSVC 3CCBA 4HUTA 1GGHA 1USGA 4MKFA 1SN7A 3NX4A 4XEUA 3DMNA 2EX4A 3D01A 3L8CA 5K1ZA 1HR0O 4OVKA 4YV0A 3EVDA 3C7TA 2C0PA 2G04A 3LT1A 2V7QD 2DHDA 2ODAA 3OOSA 4YJFB 3B40A 2JVDA 4O2BA 2NU7B 3AB8A 4FP9A 4FFSA 5EPEA 4Z2YA 3Q8LA 2HK9A 3V8NA 1CWUA 2QN1A 3HDTA 4HYYA 3E23A 2QU7A 1FUYB 3H9GA 3LV8A 4IOKA 3S6JA 3LFHA 4E5PA 2Z8ZA 1WVIA 3HR4A 3PVSA 2DGDA 3FBGA 1Q44A 4CF3A 3BB4A 2IH2A 1Q7RA 3PV0A 1YV9A 2AHRA 2ZEJA 5AW1A 1H6BA 4PLVA 5SICE 5K7SA 1BMFA 1V26A 4P81A 2NSDA 6YASA 3LWRC 4NOKA 5H7XA 2QM3A 5DNDA 3UJDA 1I7FA 2QE6A 3V9AA 2C7PA 3DP9A 3LWDA 2UXBO 2CVPA 1PS8A 3CZ9A 4FZVA 4GI1A 1H47A 4K40A 5EL0A 4BVAA 4RTKA 1F8XA 3FHJA 4GKKB 3J80M 1XGKA 1YUBA 2CNOA 1ESNA 1JE0A 3EGEA 4M1TA 2JAXA 2W8BC 3E05A 1GGMA 2XVAA 3R76A 4AXBA 3Q4HA 4MVJG 4CJXA 5BW5A 2XOKD 4O4JF 5L95A 4BCCA 1DLBA 2ZBPA 1DINA 3BMQA 3FNEA 4LMRA 4ZCTA 1J5EO 2PU5A 2F00A 3E2PA 1OB5A 3AEYA 1DXQA 3F7OA 3PKIA 1T1RA 1KO1A 1DC5A 3RH0A 5HKAA 3ISJA 4D9CA 3N59A 2ORVA 4MV9A 1IPHA 1OV9A 2QW8A 4TTTS 3GZ4A 2J59A 1MQ9A 3N0XA 4L28A 4Y1EA 1EXDA 2L42A 4U1RA 4GPEA 5BNWA 4DREA 1N1EA 1UPGA 2RNBA 5EC2C 1AY0A 1JDJA 2CBXA 2IDKA 1GG8A 4L6CA 5ILQA 4Z2WA 4CQLA 4DUGA 2YIJA 2J7PD 2Q4RA 3V48A 2XUAA 3SYKA 1PHRA 1MGOA 3KBOA 2F9MA 3DE5X 4LNUA 1JB1A 1Q8RA 3CWCA 4TTAA 4G0VA 3LDCA 1Z22A 4QEDA 3RSFA 4B7KA 2IXTA 3S03A 4L8GA 4UMDA 3S99A 5KOYA 4UTRA 2BCCH 1RI5A 1QHFA 4QASA 5BSEA 2OFPA 4WHMA 3TI7A 3ANMA 1J9GA 2YWFA 3BX1A 3LK7A 2W0MA 2G28A 4UREA 5EUBA 5JFTA 3GLIB 2D74A 2QWOB 2WMDA 3PFWO 1GVNB 2ILVA 4IXWA 1ODFA 3ZBHA 4P54A 5HG0A 4TL9A 3SR0A 3AF5A 2IU0A 4MW5A 2QJOA 1VQ7F 1UBJS 3IBSA 2PUCA 3TM4A 1OI4A 4YS6A 1NV9A 3VJMA 2Q5IA 5EA2A 1PL6A 1IG0A 1QC5A 1JIXA 2D00A 3W1EA 5EJ9A 5T7BA 4KQ1A 5EIXA 4QUBA 1FK8A 3ZY3A 1KU0A 1P45A 2YHSA 4OEHA 2JA2A 4EECA 1YR8A 3CF4G 2W43A 1NWHA 3U11A 5LYJB 3VTIC 1J9EA 1R9JA 2Q4EA 2X3FA 1IBRA 4IIUA 3T1QA 4ZEOA 3GLQA 1OROA 4PPFA 1E7MA 1ZNWA 1YI8A 1B3QA 2DWPA 2IXEA 4NFHA 4LF8O 4PSAA 1DOZA 1CK2A 1YWGO 2NMUA 1HQDA 3K32A 4RD2A 1L1QA 2WYIA 3A2KA 3QNEA 2PX8A 3OMLA 5DMHA 4XXHA 1AS2A 3GFRA 4PGMA 4JEUA 2QWNB 1KAGA 1WU7A 2ZK7A 1UBHS 1UPTA 3NH6A 5BT9A 5IMSA 1JR9A 3WLNA 3M3DA 5JYBA 3HAXD 4JUDX 1RFYA 1FSFA 2V9ZA 4OBBA 5AHOA 3TPZA 3O5AA 1YSCA 4Z7OB 3WWYA 3U3ZA 3EG9A 1KZ6A 3WSTA 1QQ7A 1WJZA 3OT7A 1KSHA 1Q7EA 1B7GO 1Z29A 2ID7A 2XEDA 2XV1A 1XREA 2ZI9A 3QOYA 4HUQB 4J1QA 4UUNA 3ENNA 2HN9A 1UFYA 3A37A 2ZRJA 2GCEA 1GRCA 3L93A 4JCOA 4Q1DA 1JY8A 1I5RA 2R2AA 3LZCA 4QDTA 4M0DA 4CM4B 4EFNA 1VQNF 2Q62A 1QR2A 5I8PA 5KOHA 4DSNA 1V6CA 3BRCA 1Y7LA 1YRBA 5AI9A 1EZVH 3OJXA 3GXOA 1LWOA 5HIJA 3HG7A 3ED5A 2C7RA 4ITVA 4TYQA 4FJ1A 4YRAA 5TDHA 4OQXA 1EX1A 2ODMA 1AX9A 2Q3DA 2CE7A 3C15C 3WYDA 4E94A 4RUKA 1OZ0A 2WF9A 3UMRA 5KWJA 3CJQA 5ALGA 1EUQA 4HB4A 1GN4A 1FU7A 2G5PA 1GTSA 2F62A 4ALJA 5T4HA 1Q21A 2H3HA 5LA6F 2ZYDA 4U7HA 1R5JA 5IYBO 4JV5O 1I94O 1U1DA 2EJVA 3JZFA 3KJHA 1J09A 5IBRA 4KPEC 4O25A 1LPMA 2DG2A 1Z0ZA 4LA4A 2VDPB 2GPYA 4JYAB 1LFDB 3LFTA 2XLBA 1T5LA 2JAHA 3ELYA 4RJJA 3VH4A 4EHHA 3ZOZA 1GAEO 2G72A 1XMOO 2KQXA 1BX1A 5LZ5A 3FWHA 4QVGA 1UEIA 2ZJ3A 3PEVA 1W6UA 4PG4A 5H3CA 3H1IH 1ZI6A 3EEIA 1K4KA 1I1NA 1G5TA 2PWAA 4ARAA 4LNHA 1ZA1A 2CTWA 1XR3A 3D8TA 1T9GR 2LGQA 3OQHA 4OP2A 2P0EA 3ADDA 5FI5A 4RTMA 4O2AB 2CB9A 3D6JA 4Y9SA 3U3RA 4PM4A 2CVFA 3L5KA 3UWOA 3JATB 4MLCA 1MOSA 2ERCA 5J2TA 2PZLA 4HVTA 3R3XA 4OJNA 3V2HA 3SICE 4UNNA 4PXSA 1JALA 2VDWB 1IYZA 5FTNA 2G5GX 1AR4A 1K7XB 4QGBA 1V3UA 2IPLA 3S2SA 1XCJA 2ZW9A 3QMMA 4BTVA 4DHEA 2YEVA 4UXNA 1PQYA 2APJA 2G09A 2PZKA 4TVKA 4E33A 1DBPA 1TO2E 2GHRA 1U1EA 1YQTA 1GY8A 2QEXF 2G1JA 1WVMA 4DR6B 3OBWA 1GUDA 2EEPA 4DUZB 1JJ7A 1X59A 2QP4A 1YCIA 2A88A 1DTEA 2IOQA 2LBXA 4JGSA 2E1PA 1P75A 2IYYA 2PTGA 3VPBA 3GLUA 3JU3A 3DT9A 2AYXA 3D54A 2ODBA 4LWZA 3LOUA 1VKHA 3TZBA 3CNNA 5G4UC 3MT7A 2OR3A 5A4KA 5AXCA 3K9LA 2CN1A 3SX0A 3LE8A 4KX5A 1FZQA 5AW0A 4WNAA 2FNAA 2IY8A 1VPTA 3KOOA 1YZKA 3CXHF 2QW1A 3AONB 3DEZA 4KLRA 2XAGA 2O8FB 2DCUA 2DWCA 1BC5A 3OEYA 2DH6A 1ESEA 1W1WA 4IOJA 2VGMA 3ZHZA 1EN6A 3C90A 3AUJB 4OHUA 1Z62A 1OYOA 3WISA 5F2EA 1OKKA 3DVLA 4PN7A 2G1AA 3WIOA 1FY2A 4CXMA 1C9DB 5FWXA 3VC3A 5JNSA 4CG3A 5IABA 4DBZA 1VP9A 2X9LA 3RU2A 1KIFA 1YR6A 3E89A 5LXTB 1R5BA 3GB7C 1PD0A 1RW4A 5EWLB 3E27A 3VZSA 3MFQA 1XKTA 1WO8A 4B3SB 3R5JA 3G49A 1W46A 4ZVOA 1HZZA 4BE7B 1L1FA 2HFEC 4S24A 2ZD9A 2PYJA 1K9SA 2Q07A 3GJSA 4KUEA 4XVRA 1KB9F 5F78A 1CY7A 2QG9A 3K4QA 4BFYA 4DXWA 1KBHA 2PWBA 4YMGA 2PUHA 3AKZA 5D00A 2YIAA 1IEXA 1Z7EA 2CZGA 4B5CA 4L3VA 3ZK8A 2Z6VA 2PUAA 5TEVA 1X9GA 3Q8MA 1CT9A 3MC1A 4OXRA 4G4VA 4TT3A 5FULA 3V46A 4AB1A 4MW9A 5EBMC 1RRKA 5KHGA 1E1CB 1Z0FA 1ZKMA 3GVXA 2LBTA 1O54A 5E7MA 3WL4A 4YN3A 5LQJA 1C9YA 3AK3A 3H16A 3OLZA 3OU2A 3TSOA 4D4IA 4GP6A 5FTMA 5LQCA 1DT9A 4OXSA 1L7DA 1VK3A 2E7ZA 1X1AA 2AG1A 2IITA 5FF9A 4GAEA 3K20A 2R70A 4BVFA 1EM6A 1EYZA 1JG2A 4CCWA 1E7YA 2XKBA 4CI9A 2R7NA 1VHTA 2OFOA 1UPCA 4DK1A 3QA9A 5DV9A 3TSAA 1TTTA 3ZDDA 4EGFA 2NM0A 2VPYA 3MJVA 2P4SA 3KE8A 1SXHA 1F2TA 4AUKA 1KJNA 4DMRA 5BN3A 5JMPA 3T3OA 4KMMA 3CB2A 2CJFA 4M21A 2PU7A 5BYKA 1PVOA 3IQEA 1MC1A 4CT4B 721PA 3ZXSA 4CKYA 2W0SA 3OX1A 2IGTA 4PG8A 2N48A 3UG7A 4H4CA 4HNUA 1GNPA 3ETDA 2P2DA 5D3QA 1ORVA 4FMTA 4PD4F 4DRXA 3L9XA 5BVGB 3BVOA 3GA0A 1Z0KA 4J0EA 2XY4A 4TV8A 3X2EA 4BTEA 4TS3A 3A6ZA 2VJQA 4DC0A 2D3TA 3KD2A 3GVMA 4UVAA 1VE5A 2QL9A 4BEJA 3CKYA 1KEEB 1VRVA 1Z4NA 3E9QA 4Q9AA 2MHCA 1JFVA 1I2ZA 1ZCBA 4Y2JA 1EQAA 1OXSC 1QXSA 2VPPA 2EIMB 3FYHA 2ID9A 1VPDA 2B82A 1KDOA 3WKAA 3FYDA 3HEAA 3DKPA 3B8MA 4KOEC 2QD5A 1E3MA 4LCJA 2VK8A 3R7AA 2EFGA 3OP4A 2RGUA 5T3YA 5AJXA 1IN4A 2FVYA 1JX9A 2JHPA 2SECE 3HJFA 4C0BA 2OP1A 4W1RA 5IKMA 1SVNA 1RC0A 3ORFA 3E9YA 3ZC3A 4ER0A 1TEVA 1UH5A 3GPCA 3H5VA 4MW1A 4QUEA 1XI1A 1V5IA 3ZMZA 3LKZA 3UJNA 2II6A 4L4UA 1FZTA 3WHKA 2PFSA 4OGKA 2AIRA 3CINA 3UKJA 4NB5A 1BD4A 3DTTA 4DW8A 3MQWA 3A6JA 3SP1A 2F23A 1MEOA 5KBYA 1L8DA 3EPHA 2YVKA 4N03A 2QWXA 3K70D 2A5DA 2WLKA 4AVYA 3ZVNA 4PI0A 3C48A 3T7DA 4UHCA 3KL4A 1U9CA 1N5LA 1L5LA 5SZHB 2JB9A 3FNGA 3NGLA 2Q1YA 3A3KA 4HVAA 1XAIA 4JKYA 5EMLA 1YVEI 2C2XA 3U40A 2AZ2A 4YUAA 4R2JA 1PV0A 1E7RA 1Y9EA 1A8SA 2HQOA 2ZSAA 3S02A 4GP9A 4N6OA 3Q7SA 2XA9A 4HBGA 4HWOA 1E5VA 3VX4A 3D59A 1ENZA 4WFQA 4ZDKA 3WTBA 3CG6A 2XTJA 3MGGA 1Z35A 4HQNA 1JSXA 5COQA 5B1AB 3LWZA 3LWVC 3RABA 2C8LA 1I01A 3DTYA 1XEWY 4W5HA 4KZKA 4NHEA 3TR0A 1QP4A 3HK2A 1NYLA 4MYRA 2XB4A 4F6LA 3DKVA 3SC2A 2WJ4A 1WKBA 1R0KA 2RHMA 3V2GA 2QTWB 1ECGA 1TA9A 4J16A 3PDHA 4FLYA 2RBGA 4LRTB 1NR5A 5CFLA 1VJTA 3S1AA 2CLKB 3OLXA 4RWUA 5KLVH 3C87A 4W5WA 5GTIZ 3K14A 2IW5A 3K70C 2ASVA 4B4DA 3ICPA 2GBCA 4NONA 1G5QA 4C6TA 2UZ3A 4IMPA 1P1FA 3IP5A 5CB0A 3HEMA 3P9XA 4F38A 1RWQA 4IKPA 1RLTA 3OCUA 3T38A 1FXKA 1WKCA 2PMFA 3DTVD 3LQYA 4QJBA 3F46A 4XASA 5IJZA 3HNRA 2RN9A 3K03A 4EFBA 2PKEA 3M4YA 1TC1A 2EERA 5CT9A 4U7FA 3J7AC 2YWJA 1Z07A 3HSSA 2NSLA 5HKOA 2C4KA 5LBTA 4P22A 4ED9A 3SPHA 4FJ0A 3Q4HB 2KB1A 5B8FA 2X1LA 3DAHA 1FX0B 5L3CA 1ZM4A 2EJTA 2GPAA 2JGUA 5JXGA 5GONB 5L45A 1FIUA 3GMTA 3C7CB 3QLUA 4HPJB 4AXXA 1GM8A 5KX5F 4RAIA 1SEVA 5GM1A 4QYIA 3USZA 1UK9A 2NAPA 1U9ZA 1WP8A 2MMCA 3A1CA 3EODA 4LS3A 1R27A 1ZPDA 3O8CA 1YBMA 2IJJA 3R66A 2EW8A 2PH1A 5EO3A 1B0PA 3P7MA 3AM4A 1SY7A 1C7RA 2R8RA 4OMFG 4WXEA 1E3IA 3QTCA 3NHJA 4YMLA 3QOWA 5F21A 4BVHA 1TKCA 2VH1A 1Q0HA 3GW8A 4OBWA 4H0FA 4IWYA 4DRYA 1A5SB 1UMKA 3AFOA 2AUTA 2F9FA 1KAQA 2ZI3A 1NSYA 1XQWA 1BXKA 2V1XA 3KV3O 5ALOA 3SOZA 4UV9A 3DDNA 2PUFA 3ZGNA 1UAYA 3DMGA 4KYUA 1XELA 1HDRA 2RBEA 1JSLA 3GBPA 1JIIA 2ZAMA 3LUJA 3QVKA 3IP9A 3SBXA 1X1QA 3W7BA 4P8RA 2IXDA 5C1IA 1L4YA 1YFZA 5JNWA 3C74A 3NAMA 4QICA 1AP6A 3X3HA 3CX8A 1KEZA 4CBCA 4LF9O 2ZJ7A 3K0AB 3JCUZ 3MCAB 4KE9A 4Q47A 3SYTA 4BXOA 1A9QA 1IAQA 3KT8A 1WABA 3OPXA 3GZTB 3GFQA 1FS6A 3HA3A 2HFJA 2WHRA 3EXG1 3PITA 4FFRA 1UMCB 3RYCA 1PYOA 3CC4V 4QOSA 4H1WA 3WSVA 1C50A 3T94A 2WALA 1AQJA 2H0RA 1Y5RA 3N6RA 4RJIA 1GKIA 4NCHA 5UKDA 4JI2B 3CE2A 2A9PA 1SS3A 5K3AA 1ADYA 3LUGA 5K2OA 1TUEB 1ONSA 3DOFA 2RGXA 3ESRA 1XRNA 2PO7A 5CXSA 1PTJC 2OUKA 4CR8A 1FFXA 2RHOA 5ILGA 2DWDC 2Y9PB 1BGVA 5MGBA 3QEAZ 2RGDA 2PNJA 2R96A 3V7UA 4UULA 1G4AE 2P5TB 5AK5A 3ZNPA 1U9IC 2NXJA 3UXHA 1T26A 4JK3A 1ILWA 2C59A 2AGVA 1P5RA 1U81A 4I19A 3L6OO 1TK9A 3HB3B 3F2IA 4BFUA 3UA3A 4KRFA 1OJ7A 3REOA 3RA5A 1L8OA 1NT2A 2QN2A 2VF7A 2V6MA 2REOA 2IM9A 3BF7A 4RF4A 3TXQA 2MQEA 1E58A 3LFOA 2D1FA 1NU8A 2ZT7A 1CETA 2ST1A 3CUVA 3Q6NA 4OB8A 2QX8A 3RBVA 2R1TA 1OD6A 4FTWA 2HO5A 4HYEA 4EG4A 3KLMX 1CK4A 2C7GA 2GHYA 4D45A 1HW7A 2L6LA 1NRXA 5LP6A 3FYSA 1JCHA 2J3JA 3AZPA 4JI8O 4OGQB 2PUVA 1ODEA 5IKXA 1H22A 2PS3A 3D8RA 1Z17A 4BY9D 3QPVA 4X65O 2MINB 2PA0A 1BCRA 3A4NA 4KFUA 3PENA 3AG5A 2VP9A 2AN3A 4K6CA 3INNA 2HYIC 3G0HA 3PPIA 3G9UA 1EE2A 3CRW1 1MHPA 4JI1B 1CUXA 1SUDA 2GVDC 2BSXA 2WVAA 2ZJBA 4LWOA 2A8YA 3VR5A 4MSUA 4CKEB 4IV0A 4J9VA 1ZG3A 1M1XB 2I78A 2RGCA 4L8FA 1GJRA 4XRRA 3E0XA 2VN8A 3FPLA 4B6OA 4IDPA 5EEGA 2UZ1B 4R7CA 2JIZA 2X8BA 4CNBA 3KC2A 4B6PA 5FOQA 2Q5EA 2MW2B 1E9DA 1T5DX 3NK6A 3I56V 4IHJB 1J9ZA 1M0WA 2HZ7A 2BKAA 4HSGA 3VSDA 5C4IA 4EL0A 2WMNB 4BPBA 5K1PA 3R7WA 3V1MA 2ZG6A 2PEYA 1F7YA 4B46A 1T0AA 1JKJA 1NBMA 2VSQA 2VH2A 4M99A 1LI5A 5DN6D 5JNRA 3VGJA 5MFZA 3EEOA 3JZIA 1ZRMA 8ABPA 2P1ZA 3SJCA 5KJ1A 1FFEA 3FAZA 5BSGA 3L7QA 1KMHA 4NBWA 2OV8A 4JASB 1CHDA 1TYZA 2PHZA 3WLEA 3W7WA 5I4BA 4GPD1 5REQB 2VDRB 3CN9A 2J0QA 3RWBA 1E8NA 1O95D 1WF6A 2WU8A 1YI2F 3GVHA 1DNPA 4MTLA 3FWZA 5AK6A 2QSYA 3PRKE 3GLKA 4QUGA 2WHXA 2YIVX 4IYIA 2KLHA 1TJ4A 3CCUV 3PLRA 4LGCA 2BGKA 3ZWPA 3VDNB 3KKKA 1UDCA 2ZAIA 4GM0A 1KUQA 4I0WB 1E79G 2VWQA 5CM8B 1EFVB 3WLHA 4BLQA 3OZAA 2IPAB 1M1KH 1Y8CA 4J3FA 4TKLA 1ZXLA 1VBFA 4ZJZA 4YJKA 3D0RA 2ZRNA 4X8LA 3BGDA 5U4QA 2WNIA 4GKAA 3RF7A 4HAYA 3OQIB 2CXNA 4G1FA 4L75A 1N0JA 1A1VA 4BZPA 3KUCA 3DFZA 4W7IA 2QKYA 2XODA 5EZYF 1V1MA 2HQBA 5LZ2A 1NTZH 3V8VA 4DWJA 2QKAA 3K5MA 1AF7A 2FSFA 2EGGA 3GYGA 3PL5A 4KIWA 4NDZA 1J8FA 4UUJC 4QDZA 2QUBA 2H8EA 1J4AA 5E4YA 2ZUFA 5AKKA 4EABA 1X9IA 4WCDA 4M3NA 4D4MA 1AKMA 1WU8A 4G09A 1UOEA 4GOXA 3VYRB 4ARBA 3DBLA 1COWG 4IKOA 1EP3B 2OEPA 3WBBA 3CC7V 2MSLA 2XBLA 2H29A 3QY9A 4LF9B 1P4HA 4ZDWA 3VHRA 1G2OA 5AKIA 3FA2A 3IP1A 1V2HE 4WF9V 2GN6A 2RH4A 2XI4A 3KZMA 3A2FA 2NTYC 1JPNA 4H1UA 5EWLA 4ARZB 4EA6A 3JQGA 5CX1A 5FPSA 3UAGA 1Q86W 3EZ2A 4L6IA 3RK4A 3W8EA 3DMFA 1PSDA 1FXWA 5GOZA 5L4NA 2OYRA 2C97A 2IQIA 4DR2O 1EJ6A 1JQJC 5E3JA 4DV2O 4PAGA 1TECE 4D7SA 1NQAO 2HJWA 3DTUB 2Q5HA 3LI2A 3JYQA 4ZP1A 3QPDA 4A0HA 2DHEA 2EWCA 1RQ7A 2IYQA 5A04A 3C1UA 3LT5A 4Y2QA 4BMZA 3AQIA 1UEXC 2GEKA 3TW0A 4E2WA 1O94D 3HV0A 4F3RA 5H9VA 4I3FA 821PA 4BO8A 3JASB 4YLGA 4KNYA 3H2GA 3LXXA 4L5CA 3LWPC 3T6KA 1H4TA 5K8CA 4RTJA 3JQEA 2V7QG 1BJKA 4I50F 3ZD6A 3T3GA 1ENPA 2P9GA 3GJ3A 3RTAA 4HLNA 1UC8A 4MTOA 3A8TA 3LUFA 3WYBA 2HREA 1ZUNB 3M5PA 5LXTF 4X91A 3ELWA 1Z0IA 5FPRA 4DG9A 4HFJA 1NTKH 2OV2A 3OT5A 5EG5A 5LA6A 4D2IA 3NH9A 3DJFA 3RYFB 3RFVA 5BQPA 4ARIA 4DSUA 1O6CA 1JG6A 1R00A 4DNXA 4YUYA 4OB6A 1VH8A 5F3DA 2I6GA 5SZKB 5K0LA 4L2IB 4F3YA 1V8OA 2OTMA 5DT2A 4FJCC 4PLTA 1N2CA 1P81A 5JE8A 3WGZA 1YS9A 1DGQA 2VZLA 5THKA 1A95A 3MB8A 3W8NA 4MH0R 2R6AA 4GYWA 4MKIA 2HA3A 1JHDA 2ZPTX 3MIIA 1KKCA 2H4WA 4NU5A 2JJ2G 5I9MA 3K9BA 4AJOA 4CF5A 1BXZA 4DA9A 1NVWQ 1P2FA 4BAYA 1TVKB 4FLXA 2XRMA 1IDN1 5JJ5A 1PZEA 4ZOLF 3OZEA 2NP7A 1MO6A 3L82B 4DRZA 1QJ4A 1RWMA 1IN7A 3MD9A 3FETA 3ICCA 1H23A 1ORDA 1Z25A 2E4XA 2BZ0A 3FF4A 3PVZA 1NPTO 2ZUTA 1OCRB 5CBKA 4LH6A 3CYFA 4WZAA 2BTEA 2E4ZA 1E2UA 4MCIA 2WI8A 4C0JA 4UCTA 2H0AA 3J7AR 4QUJA 2PV0A 3BY6A 1DJNA 1M73E 3THOA 5HRCA 1F9AA 2VDVE 2ZBEA 3MJ4A 4EUKA 3BAZA 2SNIE 5FL3A 4RF2A 1VCHA 4YIKA 3UPUA 5C7OO 2JBAB 1WCIA 4II2A 4NMLA 3GARA 1SMKA 2DFKB 4Q7LA 5HZKA 4LZWA 2GK4A 4C0LA 1IXRC 1VMGA 1CS0A 2NQ2C 3BCRA 3KKYA 5KNDA 2O9JA 1CUUA 3JTMA 3DKRA 4ZT2A 2QSZA 1OCRC 3HPQA 1YZVA 4NYJR 4LF5O 1GZHB 2RG1A 5BN5B 3RJTA 3C14C 1RKBA 5JO9A 3ZQ6A 1PFUA 3W2TA 3ZZNA 1FS5A 2FZEA 4UBJA 1AI7A 2GGSA 2VJBA 3QJ5A 4EKEA 3HCWA 1HYGA 3WO1A 5DW3A 1HQCA 1Q14A 2Q69A 2IZ1A 3FRJA 1M6VA 5I8WA 4LYAA 4ZRDA 1KJ8A 3P0RA 2ZXEA 2AI2A 1TFRA 5FFMA 4BQSA 2B1GA 1T4DA 1JHOA 3AI7A 4NVPA 1G2IA 3QBVA 5JSHA 2V55B 2W2MA 3VR5D 3NWPA 1EA7A 3CXUA 3CLHA 3FFQA 3M2PA 2X42A 4LTNA 1A5ZA 2YXYA 1U0TA 2N47A 2HBZA 2WWTA 4DV5B 2VJOA 3DB1A 4G1VA 2IBZH 2LGWA 2XAAA 4R1NA 1Y80A 2VNIA 3V1TC 4DAOA 1PDOA 4WASA 4TRJA 3KKPA 3KT0A 2XE4A 2D6FA 1AGRA 3KPUA 1H94A 1P3Y1 2QQEA 1N3YA 3UOWA 1Z3CA 4AJIA 3UBMA 4LF4O 2ZYWX 4JLWA 4ZVMA 2XCLA 3WK6A 5D01A 3DKKA 4ND2A 2ZQ5A 3RRYA 4UNPA 3HDQA 4MIYA 5JVDB 3S7ZA 3RU9A 1A4UA 3WI7A 4NJOA 5AQEA 1L0NH 1NUHA 1SQ5A 4K26A 3LMKA 5CDYA 4PHFA 1G6UA 1HEUA 4LJ5A 3T7CA 3PEWA 5LYYA 1ZK1A 3QWIA 3VAYA 2RGGA 5GWXA 1VEWA 2XF8A 4DGSA 3MNFA 4CEJA 3O9MA 2ZUDA 3SHOA 3DXRA 1C9JA 3K73O 3O65A 2CB0A 5BR8O 1JNXX 1U02A 3NKVA 4D9KA 1RKVA 3DSQA 1NN0A 5CG2A 4DLTA 2X7JA 1U4SA 1KHHA 1QRTA 3WWZA 5JQWA 1K88A 3NANA 4ZYWA 4U7PB 2CYBA 2DKOA 5ALDA 3LLSA 1V9PA 4NOMA 5HWSA 4WRRA 1KI9A 2V96A 2HU8A 2XE6A 3HRKA 4OK6A 2IEGA 1JDBB 1TJ3A 1P4AA 4Q7MB 4C0AC 5A9SA 2CAZC 3G79A 3H4MA 3C6XA 3REQB 1Q15A 5A6SA 2JL1A 1R0RE 2R48A 2SICE 2Q6IA 5EKSA 5C35A 1OIWA 5KO2A 2JLAA 4LZZA 3FTFA 1YIJF 4Q9IA 2R00C 2X86A 3RVRA 5DCVA 1ZD4A 3KKNA 3E81A 1THZA 2C03A 3U0BA 1N2ZA 4Q9DA 1N2JA 1US6A 3HR8A 4Y2VA 5TPWA 4KR7A 2B4QA 1U3UA 2ZROA 2QB5A 4H33A 2HYDA 5AW5A 5H9WA 5HIIA 3UT0A 5JHHB 1BW9B 3AHGA 3K2QA 4IIGA 4DF3A 4F9TA 3SQWA 2PLFA 4C05A 2ZYIA 3I6IA 1KKLA 2ONZA 1C14A 3E3OA 2R1UA 4GNRA 3UZUA 4IOMA 4EQ6B 2PMPA 1SCJA 3EAFA 4XFDA 4KPUB 1QYRA 3GQBB 4UCQA 4TOIA 4JVOA 4S0ZA 2O1XA 2GTSA 3P0EA 3HWX1 4GPBA 3AHIA 2HA5A 1GCGA 2ODEA 3DO6A 1QGUB 2HMUA 4C4RA 1YHQF 2EL9A 4PC7A 2V0CA 4JBHA 4G97A 4Q9NA 4R9UC 1LLCA 3PBKA 4MUJA 4PAMA 5CJJA 3DBRB 3WQHA 1LBSA 7AT1A 1HYEA 4EHLA 4PDRA 2ORED 4GVXA 4H3KB 4B4WA 4OXKA 4E03A 5BXZA 4A0RA 3L0ZA 3PXCX 4KNVA 3QX7A 1CUAA 1NJGA 5DHPA 1BXRB 2VUHB 2O2GA 3P0HA 4KBFA 4WFJA 1ZR2A 3IEXA 4G4SP 5CLQA 5G3ZA 1ZNZA 2IHYA 2QUZA 4I99A 2BMDA 4WA8A 5HMMA 4GD3Q 1I7PA 5FPKA 4JJ8A 2ACWA 3QVLA 3GPDG 3LC0A 2HX0A 3OIGA 4HLDA 1CJBA 5KAMA 4Q05A 2PRKA 1F2DA 2V6JA 3EUFA 3GJRA 3IAM1 1UWKA 1Z5NA 2BHRA 3G89A 2PSDA 4FLFA 3G4SV 2B33A 1MORA 1DF4A 1XZGA 1K7CA 1OBVA 3GQVA 1PR0A 2REQB 1YO6A 1KSGA 5I7SA 3U7RA 2YASA 5J1TB 1JEJA 1ZK2A 2CUZA 2GJAA 3IUEA 5BW6B 1V48A 5DZSA 1PFGA 1TJNA 3T4DA 1XZ8A 3ITKA 3N07A 3UWDA 1YVDA 3BF8A 3L8EA 4IQ4A 4X5OA 1W9MA 1SCDA 4KWHA 2OP0A 3HR0A 1NU6A 1XALA 4GI2A 5CIQA 3ZY5A 1FRFS 2IXFA 2JEUA 3GIWA 4MDEA 1U8FO 4YNBA 3IC5A 4ZU3A 1CB0A 1CUZA 3R1IA 1JA8A 4H7IA 3SEZA 3ZLVA 2DXIA 3KQQA 1KI6B 4BECA 2D2EA 3L0SA 2C88A 3GJXC 2MYNA 3HUEA 5F64A 1O6GA 1T35A 2J09A 4RK7A 3GJ6A 3IT2A 1GZ3A 1HBJA 3H0EA 2GN9A 3BSWA 1JIQA 4PSVA 3JPWA 1CRPA 2Y27A 3MUOA 3TQOA 1WRBA 3W06A 2J30A 2OO5C 3H6KA 1M2KA 3RRMA 3TNDA 3VO9A 3UENA 3CKMA 3FN4A 2XMSA 1KYVA 1T3SA 4OKNA 1TM5E 4HJRA 2AWNA 2HP0A 1OTHA 1A77A 1KEWA 2XWJI 1WPXA 4IFBA 2B83A 2RI0A 3L79A 3VVCA 3G2IA 5IASA 1AMOA 3W2HA 1P84F 5H59A 4MQFB 4RANA 3AJAA 4WKBA 4I55B 4DEVA 5IVPA 4WA7A 1Q1NA 1XQ9A 3UW3A 1UBOS 5A5FA 3I4CA 4POOA 3PC3A 3SY8A 3WLTA 1XAHA 2DH5A 2JC3A 5C4GB 4I55A 4QWWA 2Z5VA 4CH3A 2F43G 1BJTA 2GRAA 3ED1A 3FLEA 4LMAA 3BCHA 4U7TB 1NJIW 1XMVA 2BKLA 2YIDA 1CZKA 3JQ9C 3CJRA 4U2GA 4UVIA 1HYHA 3IDQA 121PA 2J3MA 4M83A 5GIPC 4QUAA 3S2GA 2DHCA 3BGSA 4GI3A 1CVRA 4DY6A 2RDMA 5ERXA 3AEUB 4PA4A 3CUTA 5DO9A 5F5NA 2ZJ8A 3EZXA 1P0FA 3D8BA 1K86A 4IXTA 3PCTA 4LOKA 4MKZA 2HS4A 4TMFA 1GGNA 3RRBA 3PXUA 5KHJA 1KI7A 4ZXPA 4ICGA 5EVJA 4AYXA 4HEA6 4KQWA 1WQ4A 4IHJF 3WK4A 2ZBUA 1EZ1A 1Q7TA 3G6EF 5AG2A 1KQPA 1US8B 4H7JA 5DCLA 2O8BA 3K1YA 3PZRA 4BDTA 1Q0TA 4EG6A 5KUMA 1E3JA 2GEJA 1U3FA 1FMCA 3SYMA 3AHHA 1RQXA 3H86A 3PC4A 4CKWB 1RNLA 2BEWB 3M7MX 1QANA 2X58A 1ZXXA 2DWEC 1T9BA 3NUZA 4XVHA 4YLEA 3CLSD 4CEIB 1V5GA 3NRCA 2WTNA 5J58A 1TT5B 2ZR8A 4BGVA 2GN8A 1PGQA 3VA7A 4I5IA 4J4BA 2ZPUA 2RKBA 1MV5A 1WCV1 3L8HA 1WLSA 2H4FA 3Q11A 1M1UA 3PUKA 1RJDA 2VDJA 3I1JA 2A4KA 2NU9B 3HFSA 2YXEA 5B1OA 1AGXA 3G0BA 2EZUA 1PBNA 2ZT6A 3H5OA 4JTCB 3MTDA 4JEIA 4DM3A 5JS6A 1JDPA 1S01A 5K3FA 2XB2A 5ERGB 3UFXB 3TEJA 1AVTA 1NDQA 1U9YA 2DMRA 3FYUC 3I2KA 1P7CA 4H6PA 3RVJA 3WZLA 3SYQA 5EIFA 4EG5A 1L1EA 5CD9A 3VNUA 3GFGA 3MM4A 5DNWA 1YONA 4JEHA 2QM8A 3QKSA 4YQZA 3TOZA 5H3LA 1M2HA 4LNUB 2OBYA 3F71A 4KI0A 5T57A 1KSFX 3LK6A 4PHTA 4FIDA 2XOXA 3OIFA 1BX3A 1K6XA 1YQDA 3KJQA 5HBGA 3NZEA 4HNGA 4HWKA 2PKWA 4GU5A 2ZT9B 1Z2OX 1O5TA 2G0AA 4I5GA 3SC6A 1L7VC 5DIZA 1WNTA 4ZZ1A 2FW0A 2YVUA 3LNTA 4MUHA 3FM9A 3HI6A 3S8YA 2OK8A 2FEPA 2P2CA 3CMMA 1KK3A 3KOYA 3ZJYA 4B76A 3MINA 1M8KA 1WUHS 3USCS 1CNFA 3P9RA 4DA6A 2QRLA 3RC9A 4TUYA 4U0KA 1CJVC 1J42A 3M5CA 1Q74A 1D6MA 3VKHA 4C1NA 5DASA 1VLLA 4UCSA 2G25A 1W3EX 3QPWA 2H2IA 3L75H 5LOVF 4O5AA 3ZCXA 3M2TA 4MV6A 5DBFA 1D4AA 1DP4A 2Y76A 3UUGA 1Z6XA 4ZIBA 1BCSA 3IBFA 3LF1A 4FNAA 1CP9A 4R8RA 1E3QA 3CY6A 4PS0A 4GHWA 4I4TF 3GELA 3VHXB 3X1XA 2JGKA 1N0NA 3NBZC 5LYJA 1AJNA 1JEAA 3MDOA 3B6IA 3G2OA 5C5EA 1U2PA 4K03A 4O4IA 1GZ0A 1Q6ZA 5F2NA 1D8TA 4L9SA 5DNCA 2UV8A 4MS4A 1JJIA 1XV5A 4R51A 4XQ9A 2QAGC 2BMFA 2PGNA 2OWEA 3PD7A 4QAJA 1FJHA 4DO2A 2YC0A 4C4OA 1BE8A 4PVDA 3T1HO 2IYXA 4EEQA 1UJ2A 1CVLA 3DOIA 1T5HX 4FFKA 1WDWB 4MW3A 4KAAA 1ACMA 1XNGA 3RE1A 3VR6A 4MI1A 5JSQA 1S2IA 2PRZA 4NMHA 3S0YA 1VBMA 2AQKA 4BASA 4JC8A 4D0RA 3DS8A 4PPNA 2JNBA 4RK4A 3NXKA 3GRAA 2A79B 5C1OA 4WDQA 1EQUA 4BQEA 2IH1C 3BZUA 5FCDA 2GN4A 5IN5A 5D85A 3I37X 2WLMA 2DBRA 2YJZA 2AW5A 3D6UA 4LOHA 1BD3A 1O95A 3CCLF 1RPAA 3BRWD 3JWJA 3RKUA 2JF0A 2V45A 5JH7B 4C7UA 3LUCA 1FFXB 5G1OA 2MCFA 4AZ0B 4W5QA 3KZOA 2C4HA 1QLEC 2IE8A 4DMFA 3A0HZ 4K9MA 4PDLA 2FR0A 3CCMF 1U3CA 2WWXA 4XH9B 2ONJA 5C1BA 2J48A 1AXGA 3H13A 4KE8A 1ZMTA 1VYUA 5KX5B 2B5VA 4GQBA 4RORA 2NO4A 3GAFA 3OEHA 4CLRA 2ZCJA 1YZGA 1D07A 4EGSA 2IYNA 4HYTA 1D9ZA 3HCCA 2HVKC 4C7OA 1ZRSA 5H2FZ 1Z2NX 4XIYA 2BFEB 3KIPA 4BKOA 1LQUA 1F5NA 1XZLA 1XZPA 2BE9A 3ZRWA 4KSBA 4AF8A 3CCSV 1I4DD 4XDJA 1U3DA 5EMHA 1KYYA 2P3LA 5HCIA 3OWXA 2H3OA 3OTFA 2AR9A 3W04A 2O48X 4X92A 1UK7A 3LCJA 1CEEA 4NCXA 4OOEA 4DLAA 1KYWA 1N5MA 1A4XA 4ESOA 4WLFA 3I56F 2Q1TA 4FIPC 1IZ0A 3IEVA 4AS3A 3HTNA 2FEOA 3BHIA 2XT9A 1RYHA 1X38A 2QI9C 2QK4A 2CNWA 2WF7A 3P0JA 2QPOA 2AJLI 4B7XA 4BV8A 4MQLA 2WZQA 1NNI1 1EB8A 2GESA 1B8OA 3PRHA 4DEYA 2MINA 3KB2A 4BV3A 2EIMC 4DUGD 2HO4A 2GSMB 2QX7A 3NALA 4O63O 5FUQA 5IVHA 1BMTA 1W9HA 2OHJA 3IT3A 1IU9A 5AO9A 4O6VA 4C7BA 2F43A 5EIAA 4W5OA 2P8JA 3IV7A 4HRVA 3W7SA 1QHHA 1LV7A 3ZHYA 1D2DA 5K05A 5BWOA 4YRDA 3H2IA 1RC1A 4X45A 4E32A 2YHAA 2RKWA 3JQAA 3N8NA 1ZL8B 1UANA 1E5XA 3E82A 1BROA 1A9YA 1S3SA 2QUHA 1Z8HA 4ZKEA 3R5KA 1ISRA 3K05A 2Q27A 4WKPA 2VUTA 4ZVKA 4FXOA 1MW9X 1CC1S 4FYKA 1CJUC 4I1RA 3GGSA 4PWZA 1Y7PA 2XKKA 1RQPA 1XQVA 5JYEA 3NBFA 1R4AA 2OHGA 3I05A 1LTHR 4R3UC 4R5HA 1SOVA 3V4FA 3ZWCA 1T9AA 5ALIA 4E5KA 2PH3A 3ZTTA 4U8GA 3RHZA 1CQJB 5IAEA 3I7TA 3FSRA 3U09A 3AIIA 3GA7A 4DR1B 1ODJA 3HCDA 4RPCA 1OH5A 1XMJA 2DFNA 4QECA 5ERYA 4WEQA 2JLVA 2LUOA 2F95B 4NU6A 4PCAA 3SYAA 5AI8A 4EYSA 2G77B 1WB6A 2IKSA 4PZYA 1FP6A 3QUCA 3FOFC 1Y1PA 4JC0A 3ABSB 3UB4A 5KSYA 2I91A 2GWRA 2LCAA 4R6ZA 2QEQA 3GNSA 1QHXA 3C85A 4BMXA 3CWZA 3RNLA 3RIGA 4RDHA 1LFAA 3RTBA 2OM2A 3JAMA 4YWHA 4EPTA 3C3SA 4RFSA 5GIPE 1ECJA 3HVIA 4YIOA 3PB3A 3U60B 4TYYA 2CDCA 3K7EA 1JT2A 5AMXA 2JCVA 3CX7A 3I9OA 3M1AA 1PW7A 4G63A 4YJ2F 4EB6B 2JJQA 4HJXA 2Z1TA 3R7WB 1JGTA 2M98A 2MT9A 1JKJB 2DC1A 4JP1A 2YBEA 3QVSA 1ZIYA 3FFAA 4IV5A 3LX5A 2WQ6A 1DO8A 3QFRA 1Q19A 3F5DA 4G5FA 5ALRA 1OLXB 3O26A 5CVUA 2OZEA 1K5GA 4US1R 2QDXA 4BFSA 5HQ3A 2X6BA 5AVWA 3BHMA 3GAZA 1FNMA 3CHYA 4AJ2A 4QUKA 4EDFA 1LRJA 2ZUCA 3WYNA 4H3SA 4CM8A 1FFBA 1SKBA 1VG9B 2EFEB 2H1FA 1DBRA 3K9QO 4PXAA 1DJOA 3T52A 1SXJC 4U2DA 3W79A 1B6QA 1ZIDA 1N1MA 4FQ5A 3RVZA 1IPFA 2CHUA 4R1UA 5DWQA 1H2MA 3RC7A 3TQRA 4A23A 3JQGB 2VZ0A 1A9XA 1CUFA 3RAJA 3MWEB 3MT0A 1OY1A 1F4VA 5TIIA 1FYDA 2B98A 4HTFB 4QJ5A 3ENWA 3IXLA 5FBVB 1SKAA 5I7FA 2LKDA 1DKOA 2LDBA 5D7NA 2ZWAA 3L4SO 2H1SA 3UT6A 3TIFA 2HXSA 2E6UX 3JVUA 3ET5A 3RG8A 2IOFA 4CR7A 4BZXA 3U0OA 1QH0A 1K73H 1EFRA 1J8YF 2C2WA 4E5NA 4GMKA 1KZ7B 4X8HA 3TLAA 1HZZC 1UCFA 5BNZA 4Z1VA 1IJEA 4PPYA 5CG1A 3AERA 3R6LA 1WEHA 3E2IA 3SIUA 1EUZA 1Z3IX 4X00A 3T1CA 5ENDA 2GEUA 2ADQB 2A2ZA 2VATA 4JKIA 3FKJA 3F8TA 5C53B 4OP3A 4Z9AA 3BFVA 2YMPA 1XVIA 3AJDA 4CMIB 3U7QA 1D0IA 2P3QA 3H1JH 1QGYA 3JVHA 1IVYA 2WU0A 3PCRB 4FYMA 3MHPA 4PCLA 1VGQA 2J46A 3K0FB 1EI9A 2EZ8A 1CE8A 2OESA 3KNZA 3EFHA 1O97D 2FWRA 2EFHB 2B3TA 4JIMA 3MWYW 1Z38A 3PU6A 4GVPA 4KKXB 5IDVA 3WL7A 1Z6QA 2QZJA 2PE5A 4ZO4A 3G2MA 4N0PA 1VIVA 4YASA 1E2FA 2Y05A 3NGMA 4H6XA 5B66Z 4B4OA 1CE8B 2ANBA 2ZVQX 4QBFA 5HZMA 1ODKA 1OPRA 5HVNA 3ZDBA 2XB9A 2IBSA 2VHXA 1NKTA 2J6BA 2Q3JA 4U5XA 1DKLA 2P3OA 2GO1A 3PS9A 4Q24A 3GLSA 4WGFA 4DQ0A 1CY8A 4OGGA 4L0MA 1LNQA 4GYCB 2OY0A 3D4BA 5B1NA 3GDHA 4NOJA 3TBHA 3WKCA 4J7ZA 5CCXA 3AF6A 4KQEA 1Z18A 4K9LA 2PUJA 2BSAA 4XJVA 2C5SA 1KO4A 4Y7DA 2J9RA 2VF4X 4KPFC 4MKHA 5IAOA 3VNRA 3MK31 2K4MA 3BWVA 1IN8A 1XI2A 3TETA 2GM3A 3B48A 1Z06A 1U1FA 3CUEF 3IVRA 4UV8A 1Q2XA 1T1IA 5JJNB 1JH8A 1PVDA 3NJ8A 3PUIA 5CT8A 3UMFA 4YMWA 3IHTA 4PZAA 1UZAA 3GGCA 2I33A 2AIZP 4IJVA 2FB5A 3S70A 9LDBA 5CA0B 3IP8A 2IH4A 5JJIA 1WEKA 2HG5C 2CW4A 2WAMA 3H99A 4KUGA 5B37A 1DBSA 2VWHA 3H87A 1RADA 3ILXA 4G5RA 2IJKA 4H37A 1FRQA 2FTKE 3L6CA 4KIGA 4PN3A 5EYPB 4DDHA 3KL2A 3P0FA 4Z4CA 5LM3A 2REXB 1G4YB 3MAGA 1OXUA 1Q1ZA 3KQNA 3ZE2B 3JAKA 2O23A 3Q0EA 1FNKA 4LRSB 1NNEA 2WNHA 1PV2A 1DC4A 3T4ZA 4H7DA 2NZ8A 2WU3A 4B3CA 3AEUA 1ZP6A 4XRGA 5CFMA 1K8RA 4C81A 1REQA 1B0ZA 1ZW1A 4GZLA 4BVEA 3ACCA 4XLLA 3ZHVA 4JLAA 1L7EA 4P3OA 1ORWA 1Y3DE 5AP9A 4C88A 5HWEA 1A9ZA 1LPOA 1YJWF 3ADOA 5KTKA 1SEPA 3CV3A 2WTUA 2ZVJA 3FOWA 3GRRA 4N18A 2NSHA 3CRRA 4GUAA 3LDGA 2YYAA 1VFPA 3KS9A 1M2JA 3K1JA 3W5HA 3NDRA 5EXXA 4KX3A 4C5CA 2Q7XA 2UUAB 1J06A 4I9HA 1SCUB 1RP7A 1VG8A 3NP7A 3B1WA 1KS9A 4JAAA 1E3TA 2YRXA 3D5EA 3GD5A 5DFAA 4V0OA 3TYXA 4BQOA 4ZAFA 1BO6A 3ZE7A 4ZZIA 1ZAUA 2GYYA 2EX3A 3DAGA 3JSXA 2YV2A 4K05A 1L7RA 1Z39A 2IHTA 1ZUD1 2VQEO 2PKQP 2QWPB 4MQ6A 4QBKA 3VISA 3RUPA 4MQ5A 2XSZA 4U7WA 2VJPA 4RPKA 3ETCA 4QU0A 4IDCA 4QKQA 5EJEA 3TZEA 1PK9A 1RHMA 1YJ9F 5ALPA 3DLPX 2CVHA 2DF8A 4INAA 4QPJC 1KO7A 2COUA 2VCHA 1P2DA 1KYOF 3BMQB 4HP8A 3I55V 2OTLF 4R3WA 3ABQB 4I1UA 4L08A 3DVSX 3ZCSA 4CTNA 1R3UA 2VTKA 5BN5A 2ZUSA 1W5SA 2DR0A 3EORA 4UTVA 5JSKA 5CP8A 2BMVA 1RI1A 1JR4A 1Q50A 1YHZA 4RM2A 4URWR 3G67A 5JI3E 2I3DA 4EA8A 3NHSA 4KQCA 4RTPA 2PKCA 2YYYA 1ISFA 1BDBA 3KEQA 4R0VA 4ROSA 2YOGA 4I5FA 4ZWNA 1YQWA 1G291 3PEFA 5EE0A 3MILA 4WESA 3JVIA 3A0RA 1E9SA 4CQMA 5AXAA 1DADA 1NJ1A 3VYTC 3TOCA 3NTLA 1G3IA 1U9IA 3OZSA 5BP7A 5FX2A 2AMLA 2N04A 4QQKA 2A6PA 2Z4SA 3ML1A 2ATVA 4OGWA 3O4VA 1FJ2A 1OU0A 5DIFA 5KSPA 2UXCO 4MO2A 2YDYA 3NTRA 5AKLA 4YMVA 3ZKWA 5CD1A 5JDIA 1LDBA 2AXNA 4L87A 3H4TA 1J8MF 4X1IB 2IYEA 1O77A 5BSWA 3VI6A 5HFNA 3DXXA 1M6HA 1IZ7A 3GLIA 2NLOA 2OK7A 3H1LH 5A9GA 2QRNA 4LV5B 3T3IA 3U81A 3RIXA 3N0TA 4P98A 4DR4B 1E6CA 2ECPA 3A6GA 3AVYA 4GX5A 1K08A 1GTMA 3FWPA 3B6ZA 2BW0A 4AJPA 2O0KA 2PSHA 4X8MA 3AC0A 2VHZA 3GG2A 4U2EA 3TKLA 4LQDA 3H19A 3KYCA 1IV1A 4CTJA 5IYCO 5HGXA 2IX3A 1RXCA 3DW3X 3IALA 2JK5C 3UYKA 2FPOA 2BTOA 4WW0A 3GEHA 3F7TA 1ICIA 4GLBA 1ADBA 4ZIRA 1BFKA 1Y33E 4YXWA 1VQKV 3BILA 3GLHE 4QO8A 4H13B 3IILA 4IIDA 3B3JA 2IEAA 4K2HA 2H2FA 3HCBA 2PKQO 5KHLB 3H5AA 5F1YA 1SURA 5DBIA 2DYYA 1PT6A 1PW5A 1JHZA 4BBAA 4Q4DA 1QQCA 2X14A 5BSKA 3FNBA 1Z7GA 1V37A 3HRHA 1SXGA 1TTQB 3D7RA 4XGNA 1G98A 2A0XA 5G41A 1G64A 2AEEA 2Y4OA 3H9BA 3M1XA 4P9PA 1P8JA 4CIAA 2C94A 3BWYA 2I7DA 1RCFA 4IGAA 4DV1B 3F2VA 2XZPA 3NIFB 1BE1A 3FBAA 1UMCA 3WFJA 2BH2A 1DQRA 2WD9A 2HZBA 5FRDA 1UT8A 3P9YA 4DILA 4HL6A 1C3VA 2ZYTX 4N5HX 1LU9A 3SJCC 2WSLA 3DZFA 2Y3IA 3EF0A 4W7SA 3VO1A 1A8UA 3ZLUA 5B64A 4HK4A 3JD1A 3X2SA 3DNPA 2R1ZA 3CF4A 4NBTA 3A1WA 2XWQA 2GXSA 3GDFA 4YI5A 5H16A 5GAPK 2W6JA 2FH5B 2AIFA 2K5UA 1XMQO 2EV9A 3NAZA 2ZB7A 4MDYA 1SBYA 2H1HA 4RZXA 3ROFA 3P2OA 4CQNA 3E58A 2YHBA 4J4TA 4OQQA 1VI6A 1IRIA 1V7CA 4KO3S 4BBJA 2Y6VA 2F4VB 2OFWA 2ORIA 3R0VA 3DUFA 5IFKA 1ZO8A 3EXFA 3K9HA 4JI7O 2BMEA 2VHEA 4XM0A 3DOJA 4HGRA 4I4IA 3U7IA 5HK9A 1TK2A 1QTIA 5I4KA 4AN0A 2Q6OA 1MT3A 1UDWA 1CF4A 4UU8A 1U3GA 5E4FA 4Z9BA 4CUZA 2VKTA 1AN9A 1I6MA 2BFCA 1MB9A 2MJLA 2PX4A 1P6QA 1IQRA 4V38A 2A9HA 4ENRA 4PX9A 2FP3A 3CO5A 2OYSA 5AJWA 3SX4A 2CBGA 4QX6A 1U3LA 2PS9A 3ABLB 2ZJ6A 1S2NA 4OLBA 2VDMB 1JH9A 5ECGC 2A67A 2JIOA 1R0YA 2O8BB 5K0SA 2QSJA 4BNNA 4UOQA 5LGTA 3O03A 1QO0D 1Z56C 2QKSA 4TZTA 4YR7A 4I7ZB 2KS6A 5EESA 3V8PA 2ZI7A 4PHCA 3IDSA 1I08A 5B5EZ 1WDMA 3Q3EA 4EUFA 4JXZA 3HB0A 1U40A 1U8CB 2I2FA 1EFVA 3UJ7A 2VK2A 1UKEA 1RWVA 3UMGA 5G02A 1AR1B 4F4IA 1PL7A 1JU9A 1BN6A 1SJ9A 3JAMN 1W29A 4GG1A 3IP7A 5AVMA 2N46A 2X7HA 4NZZA 5TE9A 1DMSA 3RS9A 3W8RA 2HK6A 5JECA 3Q5DA 4M7WA 1T10A 2AXEA 2VF5X 1ZWZA 1N2GA 2RH8A 3E9DA 4R5MA 2PF4E 4B2YA 4CLOA 1XTKA 3FVVA 1PD3A 1B93A 1CHNA 2VQDA 1ABEA 3HYTA 1KOGA 5TY0A 1WW2A 1IN1A 3JQ7A 2A3QA 1H1LA 1NI8A 1K7DA 4DE5A 3DHYA 2HTFA 4XJXA 2ODQA 1T2EA 2ZRAA 3UB2A 1N2EA 1UZMA 1GOTA 1ZJYA 4K6MA 4WXPA 3RJ9A 3ST7A 3WLRA 2XCRB 3U56A 2OAEA 3EDMA 3KT6A 1SXPA 3FUXA 5EXSA 4UPVA 1M67A 1QP8A 3IAM6 1E77A 3AUUA 2E76B 4BYMA 5A9RA 2IIBA 1FJXA 1E96A 1NWCA 3JZMA 4LFBB 1HOTA 2FW8A 1G8JA 4LHWA 3ZZ0A 3EF1A 3UJPA 1K98A 5LLTA 2HLNA 3H1BA 3ZUGA 3E83A 1QS0A 1K68A 1KVUA 1PK7A 3KAKA 3G1UA 3SXUA 3KSDO 3Q8HA 1HORA 3H65A 3LIPA 1EGQA 2VNKA 2OBMA 3J81N 1QGDA 4XQGA 3JV7A 4REOA 1K9MH 1S0VA 2C9DA 2HK8A 3D3EA 2O2YA 3OAAD 4E30A 5KSZA 3ZEAA 1JEOA 3QXCA 3W7VA 1W47A 1H2GA 1UWVA 2QNBA 3DFFA 3MB5A 4HHEA 4U5QA 2X6AA 2ZVDA 1XLTC 3C5VA 3A3YA 1ZNYA 3KDPA 1MRZA 2WIJA 4Q6WA 1R5NA 2WDZA 1BHSA 3EDOA 4HDOB 4OA8A 2Z83A 1XZEA 1R50A 3IJ4A 1YI2V 4MYCA 3BIJA 1X6VA 1G63A 4JJKA 4PG5A 3ZZUA 3GO4A 2JPDA 2P11A 2VYND 4TSKA 4X9XA 1SC9A 4D9JA 4ZOLB 3NYIA 2YCLA 3HZZA 2B1JA 4O29A 3GUVA 3RAPR 4P3NA 3MAQA 2QJRA 1GTOA 3IKVA 3IKJA 4I4LA 4YRTA 3WK5A 1IB0A 4BLRA 1G5PA 4EFLA 3EMDA 2JD2A 1XZBA 4KXLA 4HN4B 3GLFA 1XIVA 1WM1A 2R66A 1NW4A 1FDIA 1Z5VA 4DR7B 2HHHB 1ZDMA 5BNTA 1YGPA 3FNFA 5EWJA 4UMEA 3MINB 1R1BA 3N3AC 4QU9A 2XE8A 3N5KA 4PHGA 3KSAC 1XNQB 3RE3A 4FDAA 2X2EA 1Q57A 3N7TA 4R2KA 2O5RA 1ZM3A 4F5DA 1KOFA 1JWAB 4NE7A 2WPDD 1OWPA 3BMXA 1I5OA 4QXQA 5TF0A 1GM5A 2QTAA 1PM9A 4N47A 4EP1A 2O8DB 1GKKA 1W581 1YI1A 5IH3A 2JH9A 1EK5A 3A7DA 1UR5A 4P4UA 1E2QA 4TL6A 2YBDA 1M1YE 2D7CA 1X77A 3VYWA 3F6EX 1JJFA 2D2VA 2LQTA 3X1MA 5D3KA 4X62O 3OZRA 3ETNA 4WL0A 2FDCA 2Q6LA 3TXXA 4LDAA 4G0OA 4MV4A 3CLRD 1QHEA 2H31A 1JAZA 2O3SA 3OOWA 3I0ZA 4FHGA 4GIBA 1F0NA 2WWVD 4MW2A 2V6IA 3U7QB 3CMCO 4JI0O 1QF7A 3CLSC 2PY5A 3FB4A 3QLVA 4QULA 4B9EA 3DM9B 4GFDA 1P44A 2Z2JA 3CT4A 3CT6A 3K79A 3KYDB 4KZPA 4UATA 4RCYA 4KP4A 4BNDA 3ET4A 2B37A 2PT9A 2QYTA 3L72H 4NG4A 3WA6A 4JP3A 1QQ6A 1XU7A 4PANA 1NMYA 4DR6O 4DK0A 1KI3A 3PC2A 4K1LA 3ZCVA 3IDFA 3FVTA 1LW7A 2D1RA 3DE1X 1PG2A 4ZVVA 4UCXA 1SCKA 1Q17A 3SYCA 1Y37A 2NPOA 1WWKA 3EEBA 2BFPA 5JO0A 1ODTC 3TZCA 2V7XA 4U6QA 1LSUA 4WSOA 3U4DA 5CCDA 4ZARA 4E88A 1QC5B 4WTOA 4UCUA 1S72V 2V4MA 3RUEA 1TADA 3EHDA 4DG8A 1Q7BA 1XILA 5CTJA 5AT1A 4JYCA 4JR1A 1JECA 4QFDA 4IX9A 2I03A 2LVBA 3VR1A 1SU6A 4UU1A 3IESA 1TA8A 2EG9A 2I7CA 4UAGA 1ECCA 4LYGA 1XQ1A 5ED4A 3WJQA 1MD9A 1N5IA 1TB4A 2XNDG 5CA0A 2QTPA 1ADFA 4KLAA 4KL1A 1W41A 2C0CA 1DLJA 1LZKA 1QU9A 1N6OA 1P17A 2VHJA 3A06A 5T67A 1JR6A 4FZ0A 3QBEA 3RVQA 4F3TA 1R2QA 2Z1EA 1HFKA 1U6JA 3PNVA 4G0XA 5FBLB 3QSGA 1CQXA 3NUGA 4MA5A 3MJSA 1VIBA 5U4XA 4OKIA 4XUCA 1V9LA 1HNWO 2RGRA 5IT9M 3AYXB 3ZRSA 3EVEA 3HA2A 4O8ZA 4BAUA 1YMUA 4OM7A 4I36A 1ZRHA 4YGYA 4B3RO 3B1ZA 3DR5A 3E61A 1WA8B 3O1IC 5CH8A 3W6NA 1CUSA 3DDZX 1KARA 3TJTA 2IYAA 3VYTB 1VMAA 3CZ5A 3WGMA 1RPJA 3EPPA 3N2KA 4NDNE 1CFZA 2F43B 3BICA 1SQPH 4LZLA 4AMGA 5IMBA 2ZSJA 1B1AA 2F9LA 1BWSA 3ZWKA 3ZGOA 2AZTA 5K8IA 2FRDA 1N6PA 2PZFA 4RV5A 2R62A 2IT1A 2MYTA 2AQIA 3PDIB 1COMA 1NI5A 4F04A 3ZMUA 1JV2B 4GM1A 4DCOA 5KAIZ 1W4BA 3VQVA 2ZTMA 1VBKA 1HTTA 4U3JA 1PJBA 1KPGA 2K7ZA 2OHWA 1AQ6A 3VQYA 1EHYA 2FK8A 3KU4A 1TM4E 4KFSA 2PJZA 3TW8A 5ITZB 2R5FA 3EDQA 1XD8A 3IBTA 5DWVA 2KE5A 5FL7D 2DN9A 1TW2A 1GL3A 2P6NA 3PX2A 3NR7A 1WHSA 2YIBA 3APQA 2AFIA 2FRVA 4AU1A 5M2QA 3VDXA 4GW3A 1B14A 2BDEA 2Y2VA 3G85A 1KEKA 4HLCA 4S2UA 4POAA 4E1VA 3M82A 2XJ4A 2XE7A 3FF1A 2D1SA 2O0HA 2ZSUA 3UKMA 5FLXN 2MIIA 3FPBA 3SI7A 3GTZA 1YDXA 1MT0A 4DCUA 2HSGA 2HMVA 3ZO8A 2DUJA 3L9WA 2BN4A 4X7RA 2WUFA 4JJZA 4QC2A 4PSKA 5CLIA 3BE5A 1KMNA 1JLMA 1WD7A 2YQZA 3B6JA 4BJ5A 1T8SA 2DR2A 3DXZA 1JSZA 3BA9A 1KFEB 4G01B 5EJGA 1PEAA 1BDHA 2J5KA 2IWRA 1PQ4A 1HMPA 4IX1A 3QRWA 4MUIA 3TO5A 5ALQA 2EHDA 3DNFA 2ATIA 3DXRB 3HKBB 3TL2A 1KK1A 4DY4A 4TWRA 1J8QA 2AFRA 1WOMA 5FOSA 1GN8A 2A92A 2I55A 3DVAB 3DC2A 3OEEA 4P7KA 2HIHA 4NAUA 4JLDA 4M9CA 1Q1EA 3FUVA 4ZEVA 4MI3A 1UBRS 3SPCA 4FZ1A 3KKZA 3EVNA 5K4HA 1GG5A 2W4MA 3F8WA 1DAKA 4ROTA 2XVMA 3UHJA 4LJKA 1Q8IA 4B3MB 5JSYA 4KJZA 1M9NA 1M66A 3E8HA 1XJ5A 3MUNA 1TMGE 2MTBA 4IJ6A 5JPIA 3TZLA 4A91A 1GTVA 3HXQA 2VWGA 1RBMA 1ACJA 1SIUA 3RYCB 4DCMA 1F51E 2SBTA 2Z9CA 3C6KA 3A1NA 2IUTA 4KK3A 4NG5A 4CFSA 4EY5A 3EYAA 5TR9A 1ULZA 1ULAA 4WFIA 3HN2A 2QVGA 1E1CA 4JI0B 4OHFA 1OBFO 2IE0A 4MTXA 1E2GA 3D4LA 3CBQA 2GAFA 4LE2A 4QFCA 4LVNA 3R5SA 2JFGA 5B57C 4C82A 1A9XB 4QOGA 5E1AC 1J95A 3DYVA 1VQ4F 1QRRA 3R8CA 1QB7A 3WQQA 2XITA 3BGOS 4RLFA 1YI0A 2E3CA 1C1DA 3RVOA 4CYMA 3DLIA 1L5KA 3IR7A 3W78A 3TTVA 2XAFA 5CAEA 3LG2A 2Q67A 1NI4A 2W00A 3WKBA 3AG4B 4FLUA 4QBIA 1S3FA 3VVBA 4BT2A 1DJPA 3GRVA 2V7BA 5B2ZA 5J5CA 3TTSA 3GJ0A 1YL6A 5E6SB 3L49A 4GPAA 4P6VF 4BT4A 4OHXA 5CXQA 2AZDA 4LP8A 5IRCD 2J3HA 2XCIA 3WIUA 4LSGA 5BSUA 3THWA 3Q3IA 5IBPA 4HFRA 2AKYA 1GO3F 1MVOA 2PX0A 2A14A 4WBNF 2QVLA 2JDIA 1PNRA 2AR0A 1L5ZA 4L7VA 3IEMA 2Q5ZA 2P5YA 1QG4A 3ZDFA 2XCSB 5C93A 2ODWA 1IXMA 3IE2A 3LWQC 1RRPA 3N2GB 1KGDA 1L4GA 3ETJA 4J2OA 1H2LA 1XCPA 4JYYA 4MR9B 2HDOA 4P5DA 3ZJ5A 2WSBA 1BVYF 3WFZA 2WUWE 4GOKA 3K12A 1LS1A 1LF0A 5L3QB 3WLIA 3G7NA 3RUDA 4CLEA 4RGYA 1FDWA 1IY9A 1OB2A 1NUPA 4A27A 2QYOA 1FRVA 3LJKA 1FP4A 4BQNA 1XLTA 1VQ9V 1GGJA 4FQ8A 3ETEA 4JJGA 1PGJA 2HA6A 3HGQA 1W0CA 3QYAA 1SULA 3A9TA 4RWZA 4YUVA 1MW8X 4GDFA 1KJZA 1Z88A 2P7HA 2HC9A 2QD2A 2X2OA 3EDCA 1DAEA 2ODPA 3FBWA 3RAEC 5I4IA 1VZ2A 3RNOA 3KG2A 4ACBA 2VGNA 3UAOA 5LR6A 4G8BA 1E1RA 5J2UA 5BR8B 4F12A 3RUCA 1BH2A 2O50A 1IV4A 4EHIA 3VPGA 1S72F 1E2LA 2D2FA 1H66A 3FTPA 2HSEA 1U2DC 2DFLA 1WJGA 1IWPB 4EPVA 1CUEA 4B7AA 2NTEA 8LDHA 1MOPA 3UEOA 1X7YA 1ZVQA 3HMKA 3MJRA 2EINB 3O73A 4MMZB 1IDOA 2P2LA 3D4IA 4NYIQ 1S96A 1KZHA 1G3RA 1MC5A 2JBWA 2AUMA 1Y76A 4A03A 4BUCA 5JRJA 2VYVA 3BRWA 4X65B 1NDHA 3H5WA 4K9OA 3SHQA 3L0YA 1NOIA 2VEOA 3PEUA 1D5AA 2UVQA 4MKXA 2C57A 3CO0S 3PC8C 2NUAA 5KVVA 2ERYA 1T8UA 2CH7A 2V8BA 3DEJA 3IBGA 3QPAA 1EWYA 2FZGA 2YZ7A 3CURA 3BK7A 3NHKA 4FCWA 4DT1A 3CTPA 2IXAA 3WQRA 1SG0A 3TIIA 4ER7A 1L4UA 3D81A 1R3KC 1UK6A 3QIAA 4CKWA 3AG6A 3AOEC 4KBYA 1LPAB 1EXMA 1OHHG 2VO1A 2G76A 1DELA 4J7UA 3MWDA 1LZLA 4MPRA 2GTPA 4QGGA 5F1KA 5BVHB 4Q01A 4BNTA 2VDUE 1G8SA 4JBNA 3EZ7A 5TMBA 1KZ9A 1DB3A 4EYKA 5DYTA 4INZA 4D1YA 1NVKA 4GE0A 1AZLA 5KZMB 1B3RA 4KW7A 4X84A 4D42A 1V1MB 4NTZA 4L0DA 4EY7A 1PX2A 2Y71A 5DOZA 1PBTA 2XYVA 3N86A 3A1DA 5E1MA 4EW6A 4EWLA 3U7FB 5IT9N 5FBWB 4BP3A 4D80A 1NYQA 3DL4A 5KYYA 1PR6A 2QTLA 4BT3A 1ZICA 3ABMB 2JGAA 4XM2A 4K9QA 5ALFA 3QEMB 3EOAI 4XUEA 5ICFA 1TZ2A 3L1VA 3MOIA 5KTSA 3FTCA 2MYPA 1YOVB 5HW0A 4Z9XA 3NYWA 5E3IA 5KOJA 1L5SA 1FPMA 5CLJA 1PL0A 1N1GA 3QXHA 3ZBPA 4DTIA 4HQ0A 5M7EA 2WA1A 4R81A 1KQFA 1XEFA 4EKNB 2B5UA 1BQ0A 3WB9A 2YJ3A 2XUHA 5AFSA 4G5OA 4LC0A 3R9WA 2PI4A 1EVEA 4OI0A 2O20A 4TROA 1N33O 3OQOA 1IHXA 1PUIA 5D8DA 2C8KA 4C89A 1BDIA 1SQQH 1DBVO 1XWWA 1PNOA 3EA0A 1RLIA 2ZBQA 3W2IA 3ZDRA 4B32A 3IJRA 3SCZA 4D5EA 5IHXA 3RS0A 2OCIA 1ZHFA 3B4SA 1KPHA 3QEKA 3L7BA 2EIJC 1L5YA 3H4IA 2BD0A 4S0XA 1G9SA 2NGRA 5IYZA 1O94C 1PWXA 2CDRA 1JQ0A 4GOMD 2VRWA 3Q7TA 3R0QA 1SQ0A 3T15A 1IEVA 3JASA 3DC5A 1Q2UA 2O2SA 4U9UA 4UNIA 4XSHA 1JXAA 2ZXWC 1ZXBA 5DBHX 4A3SA 2V9PA 1VQMF 1ML4A 4MPJA 4XOIA 5FLKA 3SKXA 4KLCA 3W7AA 2NUPA 3U3MA 1OA0A 1K66A 4L22A 2EJ7A 1DV1A 4LZOA 5JQGA 3A4TA 4DEXA 3LOPA 2C7OA 1U99A 4BVGA 1RWOA 5EEHA 2ZIUB 3AB7A 4BQQA 5LB4A 5JOQA 1SC3A 3L1UA 3VR0A 5ICGA 4DJAA 1T5SA 5D86A 3LSYA 3I9LA 3VNAA 3T5PA 2EDAA 4NXNB 1MVNA 1QAOA 2COKA 2FEXA 1NU1H 3AFIA 3FJ1A 5D87A 4ZI5A 2HRCA 3MTBA 4NOLA 3QU5A 3OM8A 1ZZGA 3LYUA 1RM4A 4DJEC 4EA7A 3VPXA 3BA8A 1NATA 2JFVA 2Q4DA 2ZJYA 1EVQA 3BORA 3DXYA 2G9RA 2HTEA 4PW0A 1T4BA 4RPGA 1K75A 4WACA 2H57A 4II7A 3MSCA 1V7PC 3TZHA 1MA0A 1T8PA 4R9NA 3GR6A 4TXLA 5A4FS 1NZJA 1EXNA 1CR6A 1PJLA 3BZBA 3S27A 1E9VA 3ACDA 3OCXA 5IVKA 3ZOPA 2GB4A 4KIJA 4Q4HB 4KKVA 4E2YA 1K0FA 2J32A 4O4JA 2Q1UA 5LMZA 2Q7DA 3QFFA 2UYYA 2TYSB 3P9KA 2HFKA 3U6BA 4TWIA 1XJCA 4CFYA 3E9ZA 3QVNA 1Z36A 5E6UA 2HKIA 5K8JB 3B3FA 1M2OB 2BFBB 1N5RA 3N6XA 3C45A 2CJXA 3K0GA 2OHHA 2VBGA 4WKGA 3V97A 1CBUA 4OHYA 2QG6A 1E2JA 4QOIA 3HCPA 1XRQA 1BGXT 2XAUA 4M60A 3RJZA 5G4KB 4G5YA 1NFRA 4UPEA 5IDQA 3DZGA 4RBNA 1P7ZA 1QG2A 1I24A 2ZIXA 2VZ9A 5DHAA 4C03A 4EHKA 3GLTA 1F23A 1VQ8F 1NE7A 1GQOA 5FBRB 4BVJA 1MJNA 1AKEA 3JVVA 1BA2A 1RDFA 1KQSF 2W6MA 3VDQA 2CTQA 4X3MA 3I12A 2WKPA 4LMBA 1N77A 3GJ7A 1J39A 4KN9S 1OLSA 5BRJA 4EYEA 3MTGA 2VUSA 3KQKA 4UHBA 3B52X 3FROA 4YCBA 1OFUA 5KQLA 3CEAA 5K99A 3CJHB 1Z4OA 3QE4A 4P35A 3RFUA 4E5MA 1PT9A 5JZBA 4M9RA 4EVRA 1IBSA 3K0AA 3LSSA 2CE4A 3E4DA 2FZLA 3OVMA 4V3CA 3B89A 2WIBA 4MUYA 4CM4A 3W3AD 4BO0A 3CJHA 4RHUA 1R8QA 5A3RA 1HG0A 2AG0A 1I0IA 4OLJA 3T12A 4D8WA 4DN6A 1ZL8A 1HDXA 1TTPB 1GUYA 4RADA 4WN3A 5H9CA 5BSFA 4HGNA 4M8NE 4AKTA 5JCOC 5FWNA 2DQSA 2HWXA 2KB0A 4Q1FA 3HB7A 2VHWA 1GT91 2CVQA 2IYRA 2PT7A 4NY1A 2XHEA 2A59A 2A9OA 3CUWA 3AKEA 4GBED 4CC6A 1G21B 2O7NA 3CISA 4LRUA 2GJ4A 3AG3C 4ZAYA 2ORWA 1NQTA 2R1TB 3H2ZA 3G5LA 1GRVA 5BV0A 3WGKA 3HBFA 2D1TA 2ZB2A 1TAHA 4G65A 4AMZA 4X3OA 4BP8A 3T9AA 3EGIA 1LC0A 5I47A 4WCEV 3DR3A 4PYJA 4HZGA 4JA2A 2WYHA 5I7VA 2ZTHA 5AW3A 5CVTA 5T4EA 1G38A 3ZDCA 1QJCA 5CYGA 4JGIA 4F56A 3F7VC 1NXOA 3SBOA 5EXPA 4RQEA 4W4TA 3H7IA 4YP1A 3FKQA 3JQRA 1UKBA 4ZJPA 5ENZA 2DETA 2PANA 3EDYA 3GUZA 2UU9B 1SAYA 2ZS9A 5CRIA 4BWYA 2G1KA 1ZOPA 3BJIC 3P2JA 4A6EA 2WPDA 4XVQA 4A7PA 2ENUA 3LUDA 3GFPA 4J7AA 4X71A 5K2MA 4CH6A 4EB6A 2ZOSA 3OSZA 4YJ2A 4GUDA 4X97A 5DI3A 5EJ7A 5ALXA 3CH7A 2HIGA 2H4HA 2BGIA 1PV1A 3V3TA 1BFUA 1WXIA 1JN1A 1SPXA 2W48A 1PFQA 3S2EA 3GK3A 4N7BA 3SIPA 1KDZA 2UYJA 4HB0A 5DTMA 4LYEA 3HJWC 1OT3A 3K31A 1SQSA 4MWEA 2XYQA 3BFJA 1OCEA 3CG0A 4RQOA 2EVWX 2FP4B 2VIIA 3PNLA 3ESCA 3PC8A 4E6PA 1EG7A 3CN7A 4E7PA 5B3KA 3CKKA 3S5UA 3N8KA 4YIHA 4RZHA 4K9DA 4Y6SA 3VOAA 1C30A 3MHTA 3DZKA 3CC7F 1D4OA 4KN5A 4OD0A 3BBLA 4D79A 2NOAA 1NONA 1P4GA 2B4RO 2XT0A 4KB5A 4UVBA 2O07A 5ALWA 4R40A 3RT1A 5TQ2A 6LDHA 1VMDA 2ZF8A 1F60A 1R73A 2G40A 4H7HA 4Z3KA 3THYA 2WLIA 3K2IA 2X9QA 1KYZA 3LHSA 1KTVA 4Q20A 2ACKA 4Q66C 2ZREA 3AEQB 4BMCA 2RD2A 4L4ZA 4GX1A 4CKEA 3SSOA 1Q7YW 2HV9A 1QVFF 3QUQA 1KC8H 1J2RA 2CXQA 2HU5A 4NC9A 3JWIA 4BO7A 4QE9A 3OZUA 2ADMA 4RLSA 3FH0A 3WNZA 1DL5A 4X6XA 1WMSA 4JUAA 4Q9JA 4DUZO 1IEQA 5LZ8A 3M6XA 4HDNA 1I6KA 1GR1A 4F71A 2HXYA 5HRUA 3SJQC 5CIWA 4GSKA 2D5IA 2ZXUA 1WZEA 2AYYA 3UG6A 3TFOA 3F8SA 4GT1A 4TLCA 3B7PA 3ZU4A 4TYWA 1LLQA 3ZBQA 1WZNA 1N3BA 5HQ3B 2WU4A 2E74B 2HLPA 2VA9A 2VOJA 1URPA 3SJUA 3QVWA 4IJKA 1C3OB 3SYRA 1QAQA 2UVPA 2QT0A 2HMAA 1SHLA 1XMQB 3V00A 3ZDQA 5GV8A 2GMWA 4KVZA