5ITZB

Crystal structure of the sac domain of cpap in a complex with tubulin and darpin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
430
structure length
420
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNAKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Centriolar CPAP/SAS-4 Imparts Slow Processive Microtubule Growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 172
structure length 420
sequence length 430
ec nomenclature
pdb deposition date 2016-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5itzB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5itzB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5itzB01
1FFXB 3RB8A 4I55B 2R6R1 4IHJA 5LA6A 4YJ3A 3RYFA 5JQGB 5LXTB 5KX5B 3UT5B 5BMVB 3HKEB 2R751 3JAKA 1JFFB 4FFBA 5GONA 4DRXA 4LNUB 5CA1B 5IJ9B 4DXDA 3VOAA 3WGNA 3RYCA 3RYIA 3ZBQA 4O2AB 4HNAB 4O4LA 5J2TB 3E22B 3JALA 5JCOA 5CB4A 3R4VA 4F6RB 5EYPB 5LOVA 3RYHB 1RLUA 1TUBB 4X1YA 4U3JA 4EB6A 5IJ0A 1W5FA 2XKAA 3VO9A 4M8IA 3JASA 1RQ7A 3WGMA 2VAPA 4IHJB 5LA6B 4YJ3B 3RYFB 4TUYB 4ZHQA 3JAKB 4EI8A 3JARA 2RHHA 4XCQA 3JAWA 5GONB 4DRXB 3JATA 5LP6C 4WBNA 4ZI7A 4TV8B 5KMGB 3RYCB 3RYIB 1Z5WA 4I50A 4O4LB 3VO8A 3WGJA 5LP6A 3JALB 4IIJB 5CB4B 5C8YB 5ITZB 2GVIA 5J2UB 5JVDA 2XKBA 5CA0A 1OFUA 2Q1YA 3N2GA 2BTQB 2BTOA 4X1YB 4U3JB 5IJ0B 4I4TA 4X20A 4X1IA 4O4IA 4TV9A 3HKDB 4O4JA 1FSZA 1FFXA 3ZIDA 3CB2A 5JH7A 3N2KA 4U39A 4ZHQB 4B45A 3ZBPA 3HKBA 2VAWA 5JQGA 1W5AA 3JAWB 3VPAA 4O2BA 3JATB 1Z5VA 3HKEA 3UT5A 4ZI7B 5BMVA 1JFFA 5EZYA 5IYZA 4YJ2A 4FFBB 4I50B 2RHJA 4KWEA 4LNUA 5IJ9A 1SA0A 4O4HA 1W59A 2VXYA 5LP6B 3WGKA 4EI9A 2RHLA 4ZOLA 3E22A 5CA0B 4B46A 3N2GB 5LOVB 4I4TB 4X20B 1TVKA 1TUBA 4O4IB 3HKCA 4EI7A 4EB6B 5FNVA 4O4JB 4X1KA 3JASB 5LYJA 5JH7B 3N2KB 5MN4A 5M7EA 3HKBB 5MN6A 1RQ2A 3VOBA 5MN5A 2Q1XA 3V3TA 4TUYA 4O2BB 4I55A 3JARB 5EIBC 5EZYB 4YJ2B 5IYZB 5LXTA 2VAMA 5KMGA 5KX5A 4WBNB 1SA0B 4O4HB 4TV8A 5JCOC 5CA1A 4ZOLB 4E6EA 1W5BA 4IIJA 4O2AA 2RHOA 5C8YA 4HNAA 5ITZA 5JVDB 5J2UA 5J2TA 1TVKB 4F6RA 2BTQA 5EIBD 5EYPA 3HKCB 1W581 3RYHA 5FNVB 4X1IB 4X1KB 4TV9B 3C8LA 5LYJB 3M89A 1W5EA 3M8KA 3HKDA 3WGLA
chains in the Genus database with same CATH superfamily
3ZHSA 1SKYE 5D87A 1JJBA 1UF9A 2H7XA 3RM3A 3UXYA 5FLKA 4LNUB 1QYIA 2ONKA 5JEDA 3U7RA 1XPUA 3QHAA 2KTVA 4DV6O 4XWWA 4MIOA 1KI8A 3DWEX 1XJ0A 5LQDA 4GICA 4KRFA 4JP8A 4FZ1A 2YEVA 2ID8A 2EHJA 1G8AA 3D8UA 2I4IA 4N47A 4BLSA 3AEXA 1Y3BE 5JANA 4F4DA 4B5CA 4B3HA 1HE3A 2A92A 3OF3A 3E1YA 3FCCA 2X15A 3ONDA 3OU2A 1NOIA 4QHTA 4MJ7A 4ATNA 5J9FA 4K1LA 4CIWA 3CCUV 5HF5A 1JEYB 4PN3A 1JMVA 1NUHA 1D2EA 4O4IB 1K0FA 3DEIA 2WUEA 4JQSA 2GDJA 1YFZA 4Z1MG 2EWCA 1VKHA 3KPUA 4NG5A 1CEZA 1SJ9A 1XUQA 4XWYA 5HKKD 3E9QA 1GRRA 3VZDA 4GDMA 3AHIA 3ZU6A 3U44A 4GLLA 2QAGB 3HN2A 4A2WA 1V7ZA 5IVKA 1L4HA 3KSUA 2A94A 1FE8A 3VDMA 4KLNA 3ZTWA 1HT1E 1IRIA 1BQ4A 4G88A 1A9SA 4BQPA 4HYOA 5DWDA 3DOJA 1YCFA 1TCBA 1NU1H 2CUZA 5HJ7A 2TECE 4F7WA 1QOQB 2WKQA 1Y6JA 4PXSA 3HAXD 1P2UA 1CR1A 3GLGA 3ROKA 4Q18A 4RHEA 5LJIA 4LFCB 2H94A 3VZCA 4NK5A 5JYEA 1O0CA 1J7HA 4G41A 2H54A 1UKZA 1W76A 1JDPA 2OT3B 3CPQA 3HO6A 2FV8A 1WKCA 2DFPA 3OPNA 4KBYA 1TRHA 3RYHA 2P77A 3L7YA 2LUOA 4D92A 3OCZA 4JEUA 1OFTA 1H2FA 4G1BA 5DB4A 1Z56C 2G70A 3EA0A 4E2FA 1F8GA 5AVQA 1TAUA 1JAXA 3G8BA 1H0SA 1I10A 5AHKA 1RXIA 3SZLA 3JQEA 1A4RA 1Z12A 2YQZA 3W9SA 4AQYB 3RVYA 1SKAA 1T2EA 5IDWA 3HA7A 3IEWA 4LSZA 4B7KA 4XUEA 3UVEA 2P9FA 3CLHA 3D01A 4DNOA 4JJ4A 2YYYA 2PA0A 1ACMA 1NI8A 3MA0A 4EW3A 2Z9CA 4FYJA 3P4XA 3UQZA 3IA7A 3FGNA 1V2GA 2JGDA 2PZKA 3DMTA 1VQ6V 4YAIA 5AW3A 1XZQA 3QYAA 5IM4A 4AMYA 4S2EA 1COWG 1CUZA 1ZSNA 1EZZA 2HJHA 1K3TA 3JTEA 2QNIA 3VHLB 4QBIA 3BGWA 1PSDA 4N3BA 3F97A 1OLOA 4FMBB 3U3JA 3TDNA 4YRJA 2Q5IA 4Y6OA 2Z2XA 4QNRA 1OCOC 4Y7DA 5GTDA 3N28A 1QPZA 1PK7A 4U02A 1ZNQO 1V35A 2FZLA 4KAFA 2UDPA 3VYRB 1MOFA 2YOFA 4XDLA 3CB2A 2R85A 3C39A 1PDWA 2QNBA 1PWXA 4RX1A 4I2VA 2GUWA 5KYXB 3P52A 4FLFA 2IF2A 3HXKA 3Q2OA 4EI7A 1H3FA 2EG5A 1IDSA 5LL6P 2I4TA 3ED5A 4NCBA 2XYQA 4A5OA 2JFYA 3KOYA 3VZQA 1OHHD 5IHPA 3AWIA 1VG1A 1JLHA 2VSNA 3U81A 1ZICA 2FN9A 3R0JA 1TA0A 2QJFA 2LRHA 5CDUA 3ZHTA 1VCIA 1U0LA 1S96A 3CSDA 3TQHA 2SICE 3VUFA 5E0OA 3E0XA 4EVSA 3EXHA 4N6NA 5EHNA 4S05A 2GK6A 2YHIA 3ZTTA 3AVPA 3ETEA 4QDJA 1E3WB 2RKWA 2PUWA 3QPDA 3LUAA 1W4RA 4H7FA 4N0QA 4HWSA 2UUAO 1PIWA 4KUHA 4TXLA 3VOTA 4CQMD 3IUQA 3UMBA 4ED9A 1AP6A 4NZMA 1XMIA 4RD3A 1D9ZA 1NNUA 1VE3A 1MAWA 3DMGA 5LMUB 2JDIG 1RMYA 4WXRA 1SVLA 3E27A 1K7SN 4ER7A 1VL1A 2YYZA 1ORWA 3F6PA 3LUGA 2XRFA 4FSXA 5EMHA 2QUZA 4J0DA 1ZWLA 4ZOLB 4NXMO 1A4XA 1XROA 3I9NA 1VQOF 5P8WA 1RQLA 2ILVA 2ONJA 1QH1B 5LXTB 4TM8A 4F3TA 1M6NA 1O95A 1L4BA 2VKQA 4CQLB 4DMRA 1ILWA 2M6SA 4TXMA 1M2HA 1SU6A 4F1JA 3E3MA 2CD9A 3COVA 2CTRA 1PZMA 5H83A 3HV2A 3EUWA 2FMXA 1W55A 4NYIR 3KYBA 3V4FA 1GGMA 2ISSD 1NYQA 3X1KA 2BTOA 3COYA 3WMXA 2YXPX 1R0RE 4RKRA 1M2GA 2BR5A 1XOIA 2W7TA 1H93A 2WQ6A 3AEKA 4LF8B 1TGYA 2EL9A 4AY2A 2ALEA 1Y8CA 3U7QA 1FYFA 3LUHA 3IGAC 3Q9LA 4DA7A 3G4SV 5DCWA 3N86A 2QWQB 3LYBA 4TTJA 1U9IA 5GJWC 2PD6A 2QD4A 4PWYA 1FNCA 3O38A 1KAGA 3U9LA 1OWNA 4LBEC 1N9GB 5EGSA 2JJYA 2NTJA 5TVGA 5FJIA 1NW3A 4MQ5A 4DMKA 2QMZA 1Q6IA 4IVQA 4ZMSA 2QM4A 4KLZA 1MP0A 3QU9A 2JLXA 3E9EA 3QUWA 2X8WA 4GI7A 1ISJA 1N4CA 3REOA 1NBIA 1YZVA 1JN0A 2HRZA 2F3QA 3CV3A 2BF7A 5ILQA 1UR5A 4P0QB 1N1MA 4LY9A 5JY6A 4IEEA 5LNK6 2EILC 1G3UA 3NRBA 1AXGA 1U5BB 2FPIB 3G8YA 4JDPA 2VP9A 1P18A 3QZUA 2XNDA 4LNAA 3MGGA 1D0SA 2VI5A 4KPYA 2B92A 3HVJA 4PX3A 1N8NA 1VBNA 4CGZA 5H9WA 2AF3C 4UM7A 3PXDA 1SBZA 3AR4A 1NQXA 5CAEA 3JQ9A 3HBMA 2DPXA 1IMJA 4MUKA 1VA4A 2Q9LA 1G1XB 1AXEA 5BWMA 4I5EA 5C8YA 4PDMA 3FSGD 1HM5A 1A98A 3KOXA 5C37A 1BG6A 5BN5B 2Z8ZA 2HHCA 1XT6A 4P54A 2REXB 3PV0A 4LYDA 5I7WA 2W6IG 4Z3DA 1JXOA 4II2A 4HJRA 3IT0A 1WRBA 2FRXA 4PC1A 4OJMX 4KQXA 4D74A 3OX3A 3SPGA 4O2AF 4GUNA 4HTAA 3RRNA 4NBLA 4QL3A 3D6TB 3NOOA 5K6RA 4N0DA 4G9BA 1X8KA 3IUBA 3IXMA 1OZ0A 3OMWA 4HWRA 1RABA 1ABFA 3TLZA 4ISBA 4G4GA 1CP2A 3H1BA 2NNUA 2VUUA 3H9VA 4RQFA 2VYND 1F4MA 3GLGE 1O08A 4XJSA 1RJEA 1R0ZA 1W48A 2M6KA 3KB8A 3LC0A 1AROP 3GNQA 3TIIA 3NVIB 3ZY2A 4O02B 4HZUB 1YL7A 1JPVA 4HWGA 4J7AA 3VC2A 4MVMA 4DM7A 5LC1A 4UOQA 5EXDA 3IBFA 5IEBA 4GEGA 4X1KB 3SXUA 2LNDA 1EJ2A 2A5YB 5HY1A 3VNSA 5F3WB 4QGSA 4QUKA 1OWPA 3DE2X 5BSWA 4BVLA 3I52A 3RYCA 1FUUA 3WWPA 2J3LA 3C70A 1U7ZA 1XK6A 5AK3A 3CPWU 2OBLA 3GJZA 1XI2A 4ZCRA 5TJHA 4RK4A 3QNEA 2O7NA 2XXAB 2Q6AA 3AOEA 2C2WA 2V59A 2WFLB 2H29A 5K05A 3GNSA 2P1ZA 2IDZA 3QVWA 3MTGA 4J7JA 1MV5A 4ZOQI 2CYBA 1QLWA 5KUKA 1QVZA 4PPQA 5F1KA 2I2DA 4ZQGA 5IE9A 4PJ0Z 1IUKA 3C7TA 2Q28A 2QX9A 4A03A 3IKJA 1PP9H 1F23A 1PFGA 4F8EA 1NLFA 4FOLA 4LJ5A 4W7IA 3S2FA 3INNA 4FE3A 4EUSA 3ZKWA 4NU5A 4EYSA 4DHWA 4I1YA 5K8LA 3UAOA 1AKMA 4UHCA 2M2IA 3BTSA 5A4IS 2XQGA 4UHFA 5DCUA 5G1NA 1FXKC 2HQSA 4B73A 4C5BA 4KFMA 1N5LA 4KQ1A 4L4RA 3MCUA 1TYBE 1E2QA 2UUCB 1MJGM 3CY6A 5EZYF 1L0LH 3E82A 3H2BA 4JJGA 1EAYA 4B09A 4ESHA 3PP8A 2JAXA 3GDOA 3KQSA 1JG2A 3UKJA 2CFRA 3ZD8A 3L84A 5IN5A 3DMPA 1CRPA 4R2HA 4UUOA 4DV6B 4M87A 3PQ6A 5CT9A 1N0IA 1VDMA 2VP5A 3NMUF 3JQCA 1SCNE 4DCUA 1YJAA 2X23A 4LNUA 4FEYA 2W2VA 3IV9A 2GBPA 4UD6A 4ZRDA 1FK8A 4C05A 3OMAB 4YMTA 3TQQA 2H8KA 1K73H 3DV2A 3UG6A 1MA1A 4CQNA 3P20A 3LDEA 4Q1DA 4RELA 1CNMA 1GPDG 1EDOA 3WV4A 4ZO8A 4PHTA 3ZV7A 2Z4TA 4HEQA 5TR9A 3CWCA 4MIEA 3S4YA 1Z5PA 2QKAA 2ZWVA 1PLKA 3CUTA 3S70A 1LBEA 2QB5A 2V6IA 3IKFA 1VFPA 1V3QE 3IMPA 3GVPA 4L57A 3GJXC 4FWIB 1L5SA 1P4SA 4TSKA 2P2ZA 1SK8A 4X64B 1E7QA 3L74H 1TZMA 3LA8A 2YY7A 1JAHA 5KA5A 5GQSA 3X2EA 2ZJ7A 5JS7A 2OXTA 3NNDA 4X54A 2P67A 5FX2A 3A25A 4RMJA 5JWHA 2CDNA 2GLTA 1P6XA 4DIDA 2HRBA 4CN9A 4LXUA 4EZBA 1O94A 2UZ3A 3INYA 1VQ8V 1B73A 4I1OA 1MX1A 1VQVA 5J5VA 1NSTA 2P30A 4QYIB 4CEJA 1WDTA 1EX6A 3I12A 3MRSA 2RI6A 2JKZA 2C04A 4XVRA 3HWRA 1TJ3A 4CQMB 5IJAA 1U3UA 3RC7A 3TPFA 3LHKA 4ND2A 1Q95A 1Q0HA 4TWBA 1VQ9F 2QI9F 2JIZA 3WQRA 1E2PA 5T7BA 3O4RA 1V39A 3O3OB 1H9CA 3P4UA 2WA3A 1L5HB 1Q7YW 4FEGA 3JYLA 4DQKA 1ZITA 5F3RA 3W3ZB 2HCFA 2VHEA 1Q5PA 4Z1MA 4D7SA 1L5ZA 1SELA 1IHXA 3D02A 3HJRA 5D2CA 4NK4A 1QOZA 2OCKA 1ICIA 2JLWA 3P3NA 1SBTA 2DPLA 2BFBB 1WZ2A 4LRYA 2PL9A 5I3CA 3FCEA 3UQYS 5CXQA 4XIFA 2KSDA 2VFAA 5TIIA 2P65A 1M2WA 2O2XA 4GECA 5ALGA 5J9PC 1J9ZA 4I9FA 4AAYA 1SHUX 3DC2A 5B55A 3GH1A 1U2DA 2BGNA 1JQLB 4Q21A 4KJZA 2O2YA 3A1WA 1EZ1A 3NC1C 1E2LA 3BSFA 3FETA 5F51A 4OAQA 1GM8A 3QXSA 4PCAA 4IDBA 1AQLA 3EHEA 3WR5A 2ZUSA 4JVSB 1EAMA 3O1HB 3WQSB 1G6OA 1TQHA 4DIEA 3OQMA 3H2HA 2WJIA 2OWOA 2JEYA 2IRWA 1Y3DE 3RYTC 4KWIA 2AT1A 1RRMA 4CG3A 5TF4A 1M34B 1PJAA 1QTRA 3N59A 3FWKA 3URKA 1XPJA 5KUMA 1EFRG 4KPEC 3FBTA 3MJHA 4PWTA 4ZT2A 3ZK8A 3WDLA 1R0KA 3RBXA 3HBJA 2X5XA 3ZQJA 1LTQA 4Q7JB 3HV0A 1YVWA 2H4ZA 1RLOA 4IIUA 4CVNA 1CQPA 4QHSA 4ZWNA 3CJHA 3FD5A 3LGSA 3HN6A 4RJKA 4W1PA 4M38A 1I3NA 3GLTA 2G80A 3CUSA 4O08A 4BKRA 1RIFA 1RJGA 1RI3A 4YUAA 1YI0A 3ANMA 5AKXA 4Q20A 2C5BA 3FWNA 4OL0A 3SZUA 2JFXA 4I50F 2OZBA 3MSCA 2WIFA 3VM6A 3S99A 1QCZA 1SIUA 3BG5A 3TZEA 2YJ3A 3ZDEA 4NEHB 1XZMA 4PFKA 1PBNA 2NUBA 1Z2OX 2WIKA 2XCUA 4Y2RA 4OD0A 1D2HA 5KU7A 1TIPA 2GZAA 3O03A 2W4IA 4PA6A 1U2GA 3FF4A 4QTXA 1EWYA 2VOEA 1CY1A 1L8QA 4YO7A 4BFCA 1PR4A 4R9SA 2MSNA 4F3CA 5EWJB 2OBMA 1DKUA 2Z1TA 2O20A 4NV3A 3GP8A 3ETNA 1R37A 3ROEA 1P91A 3C3AA 2HCTA 2PNJA 2ACWA 5ED4A 4KUGA 4PYKA 3NCHA 4BATA 2YYEA 3K2EA 4CFYA 3PC3A 3DW1X 4IEIA 3L72H 1RYDA 3ZOPA 1W19A 2AN9A 4R8VA 3AJ9A 4TMZA 2QM8A 1JHXA 1WX1A 5BW4A 5CPFA 1JHOA 1SPXA 3OR6C 5T8KA 1U0SY 1EWQA 3V8RA 1CWUA 4OQMA 1C9KA 2UXNA 2WLKA 2ZS7A 1I36A 1AZLA 3IA2A 3NHAA 4LGCA 2BSKA 4MW0A 3F7NA 3EZ2A 5CBKA 1T9DA 1WMDA 1ZX1A 4L76A 3HWWA 2QUIA 3K9NA 3NOVA 3Q8XB 4C0QC 2QVXX 2ZYIA 2FW1A 1XA4A 1S3FA 2G8NA 2GN4A 3LX4A 5AJWA 2OFWA 3PYMA 4HB4A 1H1LB 3TVDA 1TJPB 4GOND 1XALA 4BAYA 4Z6KA 4N9QA 1ZEMA 1RKVA 4WXHA 1I13A 3D1VA 5LYJA 4U2KA 3T3NA 4PC3A 5JXIA 1BX1A 1NSFA 3T7CA 1SXJC 2FSVC 3H04A 1A77A 2XE7A 4G0XA 2VF8A 4DYLA 1SCUA 3GGOA 1S7CA 1EQAA 4Y9TA 1NP3A 1OC4A 1YWGO 4P5DA 3GX1A 3F5MA 3H97A 3HDQA 2FPGA 4EB3A 3SU8A 3R40A 2JDIA 5IT9A 2D0PB 5CJ2A 5EMJA 1E18A 5GINC 1U8ZA 2WG2A 5JD5A 1IRXA 2QZ9A 3O7WA 2FUG6 3PDCA 3VC1A 2H2WA 3BAFA 2IF0A 2ZVJA 1FUEA 1TB4A 3KZNA 3Q3GE 3HSKA 2C5SA 4HLUC 4YO8A 3QVSA 2W93A 3SSAA 4AECA 5JMOA 2I3BA 2QN6A 3B7PA 5KNDA 4RGQA 1AP5A 4LJLA 1OFGA 3FZNA 3QEKA 2ZUTA 1EA7A 1GYQA 1GSAA 4MTOA 1QFZA 1TUEA 4RENA 2AJDA 4EYKA 3HUTA 1HUQA 4P3YA 2O2GA 2Q2WA 3AV0B 1WHSB 1N6KA 2NW6A 5DM2A 2AMYA 1VQKF 1O95D 1IZ9A 3USZA 2IUUA 2AMVA 4BP1A 1WXWA 3HNPA 3DLBA 3UWPA 2QKCA 4F4LA 1GQSA 2WZCA 2QWRB 2H6LA 5FBRB 4M98A 1E2NA 3I92A 5FKJA 5KO2A 3KVRA 2VDVE 3FFAA 3IEIA 1QIMA 4KC0A 1M8PA 5JCJA 4M1WA 1D0VA 3A4LA 1M57B 2D0OB 5HCNA 1CX9B 3A9WA 2AC4A 4L5BA 4ABMA 1MABG 2IYXA 1SC4A 1RZUA 3ZBPA 3HSSA 5FWYA 2RSLA 1TAGA 2AHRA 3HCWA 1G4AE 2D1YA 5LFAA 5BP7A 2Q50A 1IXZA 1KEKA 3BKWA 4ZZ1A 3L82B 3A1VA 2GTSA 3W6PA 5TXGA 2QZ4A 2OHHA 4BV8A 1V2HE 3KALA 3KWFA 3ADKA 2A06H 1VQNV 1DINA 2GF0A 3AFMA 1N0UA 5K09A 2FUG1 4N3CA 1KVQA 1FFEA 2W71A 3PQCA 2Z3VA 4E07A 1YK1A 3LVFO 2WZQA 4WF9V 3VQWA 5C32A 4L8LA 4OKSA 3KSBC 1IBSA 4DYDA 4DCNA 2XNDD 3OTGA 2QTAA 4Q34A 3SXJA 1Q84A 3LSSA 1M0SA 2PKQO 4PF1A 3U9SA 3OCCA 2PEYA 3INRA 4DLLA 5EIEA 2IXAA 2YEVB 1QQAA 3BDAA 2E3JA 2DQSA 1IUPA 5AICA 4KU4A 4IILA 2FMTA 1DTEA 4RD0A 2WJZB 2W6IA 1MO5A 3PS9A 5EK0A 2ZZNA 4K6MA 5A1JA 2ZKOA 4FE7A 2DQZA 3CYOA 2C83A 4FMCF 3BGSA 1RQ2A 3AUSA 5IWCA 3V6MA 5FPSA 2XXAA 4BVKA 1PI3A 3H9JA 1JVSA 3AI1A 4JLPA 1AD2A 1CJVC 2Z1FA 5ICEA 1U0EA 4J29A 3L73H 2Z5FA 1M1UA 3AF4A 5BNWA 5HMMA 3KV3O 1ZONA 5H82A 2VZLA 3QJYA 3K3WA 5J63A 3B8MA 1CY0A 3IVMA 4H3KB 1NNSA 1V9CA 4BCDA 4N21A 4ON9A 2HKOA 5E79Z 1RYNA 3LY9A 2P5UA 3U44B 4OI4A 1JDSA 4DJDC 2Q3LA 4CH5A 4M0DA 3NYRA 4YQZA 5ANRB 3EEYA 3M2PA 2H00A 2DX7A 4REQA 3V2GA 4P7GA 4YGYA 4E5KA 1SUFA 2ANBA 5FL7A 4ARCA 1MO6A 4DRYA 4TVOA 4JUAA 2HHAA 2XNCA 2P4SA 3RJZA 5A4DA 3RJ9A 3IALA 1HDOA 3ZE2B 1TO6A 1MMMA 3PI7A 5KQPA 3PIRA 3U4CA 3GLGB 1DMRA 3BRSA 3S8YA 3AEQA 1HFJA 4P4NA 2OCLA 2D7DA 4B0OA 4MMZB 1P2DA 5DK4A 1RHJA 2DYKA 2XQKA 4JX8A 3FYCA 4PAGA 4RTRA 1RZRA 4KVZA 1T9CA 1FS5A 5BN4A 2ALJA 3PFCA 3P2KA 3OZBA 1Z0IA 4MYTA 3RE3A 4J0HA 4JF3A 4MP6A 5I47A 4X90A 5ALJA 5JROA 3RYHB 2C4HA 3PCRB 6ABPA 1Y1LA 1DBPA 5AHXA 4YPFA 4AILC 1W0JG 4H7DA 2OILA 4EG7A 1W2HA 2KLBA 4WE3A 3A2LA 3FOBA 2HQ1A 4CM9A 3PA6A 2WWHA 3KXPA 3DV0A 1V47A 4MWSA 1QC5A 5HRCA 1SQFA 3IR6A 3I7TA 1FDVA 5LZ7A 4J9VA 1TM7E 4LDQA 4NTYA 2QDOA 3O82A 3D8SA 4LMBA 5B1DA 2N05A 2ITDC 1OIWA 4UCUA 3SR4A 4MYRA 4M2LA 1W4CA 1YRYE 3KKEA 2RGWA 2VUIB 4TWJA 1YS9A 4AQYO 3AXSA 5THKA 1BHJA 3DDZX 1GNTA 4GSYA 3WL3A 3RKSA 1SC3A 3H99A 2VHTA 4YH1A 1WXHA 5D3ZA 1Z6QA 2JGDB 4DR5O 2FMHA 4XRRA 5EZ5A 1GVNB 4ZVNA 4CKZA 4XEUA 1XZAA 2BM9A 2C95A 4K9OA 3WK7A 3C97A 2UXBB 3UJPA 5TMEA 4QYIA 4FSHA 4XLTA 3VO9A 3ZJYA 4QUHA 4H31A 1KHTA 4DMLA 4CETA 1P7YA 3WG7B 1ZBDA 4RYDA 3D6FA 2B94A 2WTBA 5LLSA 4DLSA 3SYOA 4ZTBA 1IM8A 1N8KA 5CLFA 1D4ZA 2Q1WA 1N36B 3ZW7A 5CBFA 5A9GA 1C3EA 2J46A 3OIYA 1FJGO 1SA0A 3N8NA 2UYNA 2PUTA 2LW1A 3C8UA 1F8FA 1VJ0A 1DV1A 5A7FA 4U2EA 4Z51A 3CUUA 4BAGA 3JTMA 2OXRA 3ZWWA 4U3FH 4BCCA 4EHBA 1YHQV 2JLBA 2Q2VA 3ZDBA 4ZHWA 3DEHA 2LP4Y 2FEKA 4Q9JA 1ZD1A 2C0CA 1SVUA 2XX3A 1JF8A 4V0LA 1VCNA 3CC7V 4HEA1 1FUKA 2BFWA 4DWOA 3UK1A 1N2JA 4PBSA 2FSUA 4DW8A 4GBMA 6CHYA 3T4UA 4F4JA 3RRMA 1RAFA 4X8LA 5IANA 3GK3A 1X38A 1BO6A 2WNHA 1WTAA 3UAYA 3EXHB 2XHEA 5BSRA 1O94D 2PGNA 2RARA 2YHIB 2YBDA 3LL4A 4TS3A 3WYDA 2VP0A 3I6YA 3ENNA 4JB2A 2VNSA 2ZTUA 2C98A 5A0VA 3UKDA 1SUEA 1Y1KE 1UBGA 3LPDA 3RFUA 2YRFA 4IJ6A 1NV9A 2XT0A 3QFSA 4TTQA 2QL7A 4MWOA 4A6XA 2HLHA 3B1ZA 1M34A 2QGZA 4S1PA 1Q91A 5AI8A 2ZIAA 4J11A 1BDHA 1H65A 2B6HA 1M76A 2JIZD 2HLPA 1HRDA 4JV5O 3EY9A 2I62A 3TDMA 5MGBA 3UNXA 2AG1A 3HFJA 1YJQA 1Z6GA 2OCGA 4ZVLA 3ZKAA 5EJ9A 4Z4IA 1KRHA 3CLRD 1HMYA 1Z83A 5LMUO 3Q8WA 1FOEB 3TK1A 2HU5A 1GPWB 4ETNA 4Z1MD 2Q41A 2H8EA 2HHJA 4Q12A 3DVSX 5CHEA 1G6Q1 2HPAA 3CS5A 4W7HA 1NXXA 2YOHA 2IHYA 2AKAB 1X1BA 4KIUA 4O59O 3IJPA 1A5SB 4RV4A 4LY6A 1F14A 3I3FA 5KHLB 2C4TA 2BGJA 2OQRA 4MYSA 1LSSA 5JJCA 4HYQA 4P84A 2O57A 4BBAA 3FRHA 4DF3A 4GF5A 4LZJA 1HG0A 2SKEA 2XMCA 1NXTA 1NP7A 1RCTE 1XXLA 3AEKB 4TWZA 3SLRA 4EKEA 1EFRA 4BMOB 5IH3A 3U7QB 2C9DA 5DGDA 4NKGB 1F4LA 1UBRS 2ZT7A 4LA4A 5C8VA 1Y76A 4IXTA 4FS8A 1XLUA 4FZ0A 4DCPA 1M5IA 3T3MB 2WTAA 3BCCH 4PQFA 4LJYA 3VSCA 1E5QA 2VT3A 1VRCA 3KDPA 1KU9A 1IOVA 3S0YA 5LP1A 1IM2A 5T4FA 3RAEC 3IHWA 1N3YA 1XHZA 4UAUA 4KFCA 1NW8A 2FQWA 1NN5A 3MTEA 5JSHA 3UJ6A 1W44A 2VC2B 4HNHA 1Y33E 2W2KA 3LWZA 1IEWA 1KO1A 1CNFA 3WHIA 2O1WA 4HGOA 3D6JA 4CG1A 2IV2X 3IQZA 3DCYA 2FF7A 4Y18A 2GLZA 3CCBA 5HXAA 4UNPA 1IN6A 1D0IA 1T0AA 2YW9A 5EMNA 3RS3A 1CR0A 3AW8A 1HKHA 2ZB8A 4K9SA 3PYXA 2KM1A 3MXTA 5B1HA 2XVYA 2PMEA 4ZAYA 2QR3A 5CAEB 3LWRC 1UBTS 2GARA 2R751 5K45A 2CHGA 1A27A 1QHGA 3F7OA 2Y66A 5A2QA 3BRWA 5DNCA 3P0RA 2CT8A 3QKUA 4IXMA 1HA3A 2W2NA 2XMDA 2WYHA 2QQGA 5AIBA 2EBFX 3H4TA 4QHYA 5KQLA 1EM1A 1ULBA 5AI0A 3TYXA 4QOFA 1YZNA 4TYQA 1XL6A 5K3SA 2O0HA 4F9TA 2Q0AA 1O3YA 4D6YA 1KJJA 1V6CA 3FYIB 2F8MA 2X0NA 3TVTA 3X1ZA 3Q5GA 4DK1A 4LDPA 2N3ZA 3H7AA 1QP8A 1C50A 1R1DA 1GR0A 3HYCA 3OPQA 4L4UA 2NADA 3AY6A 4CLEA 3EFBA 2BMFA 5JFOA 1ULHA 1DQSA 5AVMA 5B5SA 3NC4A 1GPJA 5ARBA 2LD4A 4CDRA 2ZSAA 4W1RA 4H15A 4MS4A 2PKRA 1Q82H 4D57A 2Z95A 3BQNB 4IUYA 4YFVA 3IMEA 2ZI5A 2DPHA 2I2BA 3LMEA 1SKMA 3WK4A 1GL9B 4NTXA 2EU8A 1BS1A 4GSLA 2WF5A 1XHXA 1A7KA 3B1FA 2F1MA 4A27A 4IIGA 2EW2A 4BVAA 2P7IA 3SXUB 3TEMA 4J9YB 4R9RA 3ADOA 1C7FA 4ZCTA 1Y5MA 2X9VA 1DCTA 5KVSA 3RYCB 2FGJA 1DDIA 2WLSA 3AO0B 4J94A 5DTEA 2IOYA 4DMMA 1N3IA 3CRRA 1CN7A 4JOCA 3KS9A 4P31A 1EZ4A 3V8PA 5AXAA 2HRYA 1XHEA 2VXOA 5KTMA 1X86B 4HQLA 3UPTA 3I2IA 4O0MA 3BS4A 2MTBA 1IHYA 2G04A 1XTBA 1VLHA 3R5JA 1I51A 2X1MA 3AM1A 2H1OA 1A2OA 2IEGA 3Q6NA 1ZGJA 5JZMA 1EUDB 2AOWA 1VHDA 3V55A 2IA5A 2JDID 2Q4DA 5DNEA 3BXEA 2I3DA 1XWWA 4OQ4A 3BYQA 3KJJA 3TXQA 2GMWA 4HATA 3IDSA 4L8YA 3P27A 1TFRA 1I3MA 1OBVA 4U9IS 3TRKA 1Y48E 4XQCA 1POXA 1R88A 1XL4A 1Z8FA 3ZXIA 4LDRA 4TYWA 1E9DA 5BY2A 2J9YB 1FXKA 4EY5A 5KNDD 1N8RH 3KB6A 1OAOC 2ZDHA 5HG0A 3G0IA 1G8HA 2A9OA 4PYOA 1Y66A 1YOBA 1VPVA 4TVKA 5B6JA 5IRCD 1XBIA 2RIRA 5CEEA 2UUCO 1J70A 3ZJTA 2Q5FA 3M5DA 4GO1A 4BVEA 2XTNA 1A76A 2ZRFA 4QARA 2DUMA 4RD2A 4RL6A 3WDSA 1LQ2A 4UVCA 3AVOA 3QO5A 3RASA 2HA6A 3HRHA 1BOOA 2XAUA 2HDHA 4N03A 1MABA 5A04A 1WSBA 2PSHA 2MK3A 1XNJA 5K4AA 1QHHB 1GNSA 2V4MA 4UUPA 1CR4A 1GJRA 5JCJD 1QPGA 4O1MA 3M7IA 2FUEA 2JIZG 1ZAKA 2BZ0A 4YDRA 1U81A 2VBGA 4OG2A 1AHNA 2PMCA 4CV0A 5CPBA 1XU4A 1U2ZA 3ETGA 4H13B 1JL3A 2QP3A 4K03A 3JPYA 5I6DA 3ABQB 1Q86H 1ODTC 1I0ZA 1W36D 2E5LB 3DT8A 2Q3MA 3HB3B 2X2PA 2AI1A 1P19A 1BE3H 1RRGA 1FMJA 2GAAA 1DCMA 4X64O 4F45A 2P6UA 1GZUA 2W0SA 1RSZA 5SYMA 1KEZA 4D5EA 2F8TA 1JQ3A 1M34E 4ZOEA 3HDTA 4ZIBA 4IO0A 5KAPA 2C03A 1F2DA 1AC5A 5ICMA 2AZMA 1F3LA 4CEJB 4MWDA 4JY7A 2GCEA 2FRDA 1K2VN 5YASA 2WTMA 1L4KA 1FVOA 3K9FC 2FU5C 1ODJA 4XVQA 2QDXA 1LX7A 3F5SA 2E75B 3JZIA 1D1TA 1MNGA 4WKPA 3RG8A 1YSCA 2ZI3A 1ZH4A 4MW9A 1Z0SA 2XKAA 5G4LA 5KSOA 5IX8A 2O5EA 1WW3A 4ERNA 2WM2A 5DVZA 5LJLA 2QYSA 2ZIMA 3EY4A 1VA5A 3NUZA 4JR0A 5I9MA 1MAUA 1C0PA 2WJ3A 3D31A 2WWXA 4KPFC 4HH4A 2Q6IA 3S2YA 3BJRA 3STLC 3K32A 2W6ID 1CG6A 3TPCA 4JL6A 4W5HA 4BUZA 4UW9A 2L35A 1UDBA 2BEKA 4N1AA 3D3IA 3ZMSA 1SUSA 3TLXA 1U5CA 2YIMA 3PUWA 5E9AA 4P93A 3OU6A 5EHQA 3BH0A 1JHDA 1YZFA 3SC4A 2YC4C 1T9GS 1XGKA 2D0IA 4BNWA 3V9AA 2GXSA 5KTTA 2M1XA 3QOWA 1ODSA 1Q2UA 1U0GA 1Y7TA 4DABA 2O6HA 1N8TA 1TYEB 2WZDA 1K4YA 2ZROA 3E83A 3IUPA 4TM7A 4BRWA 1UBSB 4L5AA 2FN8A 3L7CA 1QBGA 4DR5B 4PQYA 5FL7D 1QQBA 4ZI7A 1Z22A 1IZ0A 4P9OA 4K6HA 5BW6B 3FJ1A 3RRXA 4BMDA 4RPCA 1HDXA 1W42A 1I1HA 4UBMA 4K9LA 2K4MA 3OIWA 5HSGA 5ITWA 4UZFA 4B85A 4M9RA 6GPBA 3UGJA 5AD1A 5TQVA 4BNDA 3PG5A 3PDUA 1Z5NA 1K6MA 4QGGA 1HURA 1YI2F 5CA0F 1RZRD 4TSFG 2OAQ1 4OMDA 2UZ4A 3IBGA 1W0JA 2I03A 1QORA 1VJRA 1FJGB 2C77A 2CXSA 3WJPA 5J2TA 1OI4A 2WTNA 4C04A 4AG5A 4XD2A 2VXBA 3CJHB 3TEJA 3MT9A 2D2FA 2Y6UA 2KHZA 3GFOA 5A5GA 2GBCA 2C4WA 2P3LA 1Y80A 1E9AA 1L7MA 5GZ6A 4FFKA 4CM9D 3JVVA 3EDMA 1XSEA 3AJ8A 2EGGA 2DQ0A 3ZD9A 4NNJA 5AJTA 1MNQA 3K7EA 4OXYA 4BEBA 4ZJPA 3BHPA 5JOQA 5ICCA 4FQ8A 1VSTA 2C5FA 5C4MA 4OIMA 1JQ0A 1LV8A 3L7AA 1OAKA 4B31A 3ZWVA 4QWMA 3MHPA 2VP2A 1SHTX 2AZXA 1HX7A 3MDOA 2F1OA 4OA5A 4ZQCB 2GTPA 3MUNA 3BJIC 1P77A 4P38A 4DIKA 4UAVA 2XAJA 1A96A 5E1BA 1YA8A 2A7XA 1YS6A 3D8NA 3CPHA 3B52X 1B16A 1PW7A 3AC0A 3U49A 2W70A 4D46A 1HT2E 3I2JA 5FBVB 3CLKA 5B36A 1I4DD 3JQFA 3WYGA 1ZTEA 4EB8A 2CSUA 2QXTA 3JAKA 1JIQA 3GJRA 4KZPA 4YLGA 1NG1A 1T4MA 3L9WA 4ZT6A 3UTCA 2PS0A 1HFKA 4JV5B 2P6YA 2DQ4A 2XH8A 4RMNA 4GZ5A 2B1JA 3G71F 2JD1A 2YVUA 3NBQA 4QQKA 5H3CA 4P5EA 3IILA 4BWFB 1TYDE 4BECA 5DLPA 3MAAC 3PGJA 1EESA 4OY3A 5EI5A 5AI5A 4RVUA 2XMZA 1U8XX 3SQWA 4P32A 5A71A 4AFNA 1P0QA 2BSKB 2ADFA 2XRMA 4XFKA 4QNNA 2ZUVA 5D00A 2P2SA 1RT9A 3F5TA 1VIYA 3NORA 1F1JA 1NASA 3DH0A 2ZI7A 4K87A 1NJIW 4IUBS 1AGPA 1ATIA 1L5KA 2Q5LA 2HWWA 1AKTA 3DZBA 5LYJB 1E2IA 4BX0A 5G4UC 3ZDRA 3EC2A 1SXJA 2XZDA 1L3CA 2PHNA 1C7QA 1SCUB 2WU0A 4LJRA 4WESA 3D7KA 4OQDA 3DNFA 5KYVA 4Q3OA 4U2CA 1CP3A 2FPGB 4YV2A 2EYUA 1V3UA 2V54A 3V1NA 1AB3A 1Q5OA 2RAUA 3T95A 2OESA 3KU4A 4FDVA 4QPDA 5EE9A 3ZHYA 1UZMA 4KLCA 1YTLA 3SN6A 2I22A 4RAIA 3S06A 4JA0A 3C8MA 3QXJA 5L6MB 4WA8A 4UUAA 5JE8A 2ZSUA 4O8ZA 1YZGA 5H02A 2GTHA 1E9VA 1TU3A 1WXGA 4M0PA 4NBTA 3OQNA 2X0JA 4HLUA 1J8MF 2L2QA 4I7EA 4PEVA 1G19A 4PLTA 4X3CA 5E1OA 5C7YA 3KRTA 1TUEB 4JJFA 3TAHA 4BNXA 1EUQA 2J45A 4D6PA 4HNUA 3WXMA 4BRZA 5JVDF 4BJ5A 3OX1A 1UJCA 2G7MC 3FOWA 3IL2A 3FTQA 3HB0A 4K81B 1XAJA 3V4OA 5CFZA 3FNIA 3E1KA 3KUDA 3CWQA 4PQEA 2NQTA 4ERHA 4B62A 3U48A 4XB1A 3W7SA 3SJQC 4OHBA 4GXNA 2OZKA 3VQYA 4EJMA 1S2NA 5L4NA 5A9TA 4OI1A 1MPTA 2RONA 2PTMA 2ATVA 1JPJA 5ALTA 2YXZA 2JCVA 4EH1A 4IY1A 5ESRA 4MI3A 4H0NA 1EFRD 3K0DA 5DN9A 4RZIA 3WYCA 4F4IA 3WHKA 1R1BA 2GRAA 4BO4A 1B76A 3CEMA 2I6FA 1XMSA 5FWYB 5ALPA 1TMGE 4YMGA 1YIOA 1ZNWA 1V37A 4C4OA 4G5XA 1B2LA 1W36B 5D5HA 4XB6B 2CDYA 4KGXA 3UJ3X 1DK1A 2DQKA 4TOIA 3CD6V 1RWMA 1WPBA 4BMSA 3ZNOA 1P39A 5BSHA 1M1ZA 3L0SA 3KPWA 4L7VA 3A1DA 3N4YA 5B4VA 4MKFA 3UCSC 2DBZA 2BBTA 2UVQA 1EVQA 4PWZA 5I4CA 4YROA 4NP6A 3AW9A 3HP4A 2FMUA 3FPJA 2Q1TA 1J49A 1G21B 4PZCA 4ZHQA 1WDKA 4S35A 3WBJA 5F3DA 3RS4A 1MB2A 1X7XA 3BZBA 2HUPA 3WGOA 3TW4A 1L7EA 1DWOA 3TBHA 1N5RA 3OQVA 2PD3A 4ARVA 4BVSA 1KJ8A 3ZHZA 3X1WA 4XA8A 4XI9A 2Q99A 3F6CA 5FL7G 4QYSA 2ESRA 2O7QA 5JBQA 3DVLA 5B64A 3OWXA 3ILHA 4QE9A 4EI2A 4M8KA 3PWSA 2H2IA 4EHIA 3BRWD 4B3TO 3K1TA 3K53A 3R7WA 3B9QA 1F48A 4WY2A 5LNK1 5HBRA 2P69A 5CD9A 4BQNA 3UWKA 5AKLA 4OH1A 2GN0A 2VJKA 1PEDA 2F6RA 4YMWA 5JCPA 5JQGF 3D0RA 4P3PA 1H2ZA 1P1RA 2C8JA 1H22A 2IP2A 4I4LA 1R5NA 3MD9A 2QLNA 4NFLA 4QEKA 3WSWA 2X6TA 3KPJA 2ZF8A 1Y8ZA 5LPNA 1GTL1 2FGKA 2OGTA 4B3DA 5KB3A 3ZN2A 1U7HA 1EUDA 2YN4A 5E8RA 1RPRA 2FW8A 3KU1A 4LGMA 4MUYA 2NQ8A 5DPMA 4J9ZB 2XWSA 4L08A 1O97C 2PMWB 2F1IA 5FADA 3LXUX 2G8LA 5TX7A 1DG9A 2POCA 4REQB 4J75A 2IX9A 5DGHA 2C3UA 2J3DA 3TKYA 5JZ9A 3I04M 5CDSA 1RP7A 2XUGA 1LI7A 4BASA 1TW3A 4A5SA 1T8PA 1EMDA 1WP8A 1WUJS 1TVMA 4EGFA 5EYPA 3O9MA 4PIMA 3U26A 3QHDA 3ZDCA 1P7ZA 3ZY4A 3AEQB 5CXSA 4M54A 3WYEA 3ILVA 1E3TA 2I7XA 3PC2A 3TIGA 3PL5A 1RM5A 2AWNA 1S0UA 1YC5A 1FXHA 2V9CA 4CMEA 3QO8A 2CXXA 2NNLD 5BN4B 1TE2A 3T3HA 3R9WA 3D4OA 2BN4A 3WZLA 2XCRB 4B4OA 4Q3CA 1X1SA 4I4TA 2H18A 5I5GA 1NPYA 4YI3A 4W5JA 1GTG1 3C3CA 1Y1RA 1M75A 3RTBA 4HNVA 1FS6A 1QHHA 4FFNA 4OO3A 4XEHA 3CEIA 4AS3A 4ZYLA 1GPMA 3DV0B 3O94A 3RA6A 3STWA 1SQVH 3HVHA 1QC5B 1CNEA 1YKGA 1TUGA 4B6GA 3R3XA 2A3NA 2CKDA 3OWOA 1YV9A 5DT2A 4NH0A 1HT3A 3QLUC 5GJVC 2VBCA 1A8HA 2RHRA 4UHBA 2AOVA 3OPYB 4KO1S 3WGTA 1LV7A 1ZK0A 3GROA 1UFQA 4OSPA 3GHZA 1HF3A 1STOA 1RHRA 5SZIA 2FKXA 2IODA 1MORA 3NHUA 3ZU2A 2XWQA 2C1EA 4DB4A 1U2RA 2P1RA 2HB6A 2R65A 1VIVA 1XD8A 2J59A 3OZVA 2ASVA 2W8BA 1TTQB 1R6KA 1RHUA 2J5QA 4YRBA 1AO3A 1WQ3A 1U4NA 1Q0ZA 2GCOA 1NKVA 4RHXA 5DV9A 2M32A 3Q41A 2C5LA 1PWHA 4RK0A 4ZD6A 2DAPA 4OLJA 1W2BU 5KTRA 1E6MA 1UMDB 2ODBA 4BIUA 3B85A 1P5JA 3CONA 4NECA 2CE2X 3BT7A 2UXBO 5DTJA 2P5SA 2PD4A 3W06A 2ZWAA 3RVMA 2CFIA 4XH9B 5EXSA 3RUHA 3ITNA 3WGGA 1OCOB 3GWOA 4RACA 3PSAA 3DDUA 3OHSX 4KL8S 1MSDA 1SA0B 4KSCA 1IV3A 2UYNB 1V71A 4XJTA 4NS4A 4WXEA 4RIFA 3G6WA 2ZJOA 3MLAA 4YHBA 1SIBE 4MLPA 1WW8A 2VUTA 1CZHA 1O6GA 3LDGA 3P94A 1FMCA 2CLEB 1N36O 2Y8EA 2BMEA 2B78A 3MUFA 4C4PA 1FQKA 3VXKA 1I0HA 1R18A 4GYJA 4C4XA 2W4QA 1F0PA 4ZBMA 3DFFA 1UQUA 5IT9N 3AY0A 3UMSA 2OXIA 2RMKA 3VGPA 2ZQ5A 3C8DA 2BBSA 3ODPA 3CHYA 4NAHA 2HJ9A 3I4FA 5KDOA 3CCUF 1T4CA 5AK5A 5GV7A 5HZKA 4Q9AA 2XCOA 3ZGLA 2O8DA 1JGTA 1YQNA 5LD2C 1VLMA 4EYGA 1TKAA 4YP6A 4DQVA 2JAWA 3N8KA 3W8RA 4C7KA 1IUOA 1X6VA 4EGJA 5FUBA 3VZRA 3I61A 4NSNA 1YOVA 5H70A 3S0WA 4C87A 4DZZA 4F6CA 1MW9X 1UINA 3RS0A 5EP2A 2Z8XA 3I0NA 2Y0BA 1W5SA 3AJAA 4M9QA 2VSQA 2XB2A 3I9V6 3S6JA 2AEJA 4L8GA 4ZOCA 1N2CB 3A28A 3LSUA 3DQZA 1RYMA 1E5TA 4I46A 2BISA 3SQLA 1IQPA 3GL9A 1ZHFA 1WCWA 1Y6QA 5AJXA 1OC2A 4DVGA 1ZJJA 2IPLA 4ZAWA 1H2WA 2JFFA 1CT9A 1O5IA 2PX5A 5ELXA 2YC0A 2DUWA 3OCUA 2WMDA 4X91A 3MF4A 2JFZA 1QUEA 4N8SA 2PZGA 1KORA 3CM0A 1LZKA 1ZM2A 4H7KA 4XVCA 5KHGA 3CMCO 4TROA 3CMAV 3NVAA 4DZRA 3ZN1A 1QO9A 3RAFC 2C1ZA 2W37A 1PJ2A 1KJWA 3GC6A 3I2GA 1GGVA 4HKTA 3ZGOA 2GOYA 1C14A 3TTSA 4OQXA 3FPSA 4U2DA 4LOIA 3MJRA 2F1RA 4KUEA 5C8XA 3IELA 3RGBA 3MB8A 5JNUA 3AKYA 2Q21A 5FWDA 1Y76B 4WUVA 4D8XA 5LQCA 3ZNQA 1GU7A 3BWMA 2KI5A 2ZT6A 2R4UA 1L5YA 3UK2A 4TSFA 1ZK2A 2DYSC 5SY6A 3CSXA 4IDAA 1ADJA 1NXSA 1T8UA 1IXMA 2C7OA 4KFTA 1XQ8A 1U8AA 1IG0A 1X52A 1DU4A 1Y8AA 3OR7C 1VQ6F 2BFNA 1O6ZA 3AB3A 2F9MA 4K2HA 3VR1A 1QYDA 5IAGA 1W0JD 4KMRA 5T3YA 3PB3A 3TSOA 2FHSA 4BO6A 4XIJA 2W2KB 2NU7A 3BFKA 3R7SA 5A9RA 3A3KA 1MC1A 3H1KH 4UCXA 1Z6YA 4EGAA 4IICA 1VKRA 3NAQA 2QD3A 2HTEA 4YP1A 3ZJZA 1VQMV 1U11A 4UUJC 2P6MA 3T4ZA 1PWYE 3B5JA 3ZV4A 2EILB 1G8PA 3TD6A 1QTQA 4HI0E 2BHSA 1AHPA 2BGTA 1U6JA 4L4SA 1L7BA 2IQ5A 3MWDA 3UPDA 4JZYA 1NULA 4PNPA 5DK6A 4JLKA 2FGYA 1Z36A 4MI6A 3X1MA 2JKVA 3GQBA 3S3WA 1WB5A 4AJOA 5B1SA 4UCQA 3LNMB 4D3SA 3T5GA 5CK4A 1D8TA 3IOBA 2GN8A 3NKVA 4J3FA 3C3PA 2FG5A 4NHEA 3KCXA 3TSWA 1ZY2A 2O0JA 1X3SA 4R9NA 4QDKA 1EZVH 4FQ7A 2VJYA 4FKMA 1WP4A 3L0IB 1E2DA 4M1YA 3VRHA 2H1LA 1RE0A 1MX9A 1RVV1 3I5MA 1A95A 4I9UA 5TE9A 4D9EA 3ZVNA 1L5MA 2OYSA 2V6FA 2A33A 5KIAA 3NHSA 4MS4B 1AO0A 4Q15A 4YCJA 3AUUA 4UHKA 2VJDA 4R2KA 2EX4A 1WUIS 1Z0DA 3RUCA 1XD2A 2OCDA 5KWSA 5KVVA 2UZIR 4MVCA 1LH0A 2PUHA 5GOZA 1WU8A 4GGPA 4C01A 3TECE 3CCQV 2BJVA 4IKPA 4ZCQA 2ZE7A 1O8BA 4BVHA 4EFNA 3H2KA 2IYWA 1VQ5V 5E1MA 1AK9A 1OYVA 4OHOA 5KNCH 3EWAA 3ZS9A 2VQ6A 3B7WA 4D1YA 1T6NA 1EWVA 2RC6A 1XXHA 2F9LA 4GVLA 2Y1LA 4FJ2A 2HJWA 2WAOA 4A5UB 2JGAA 4IH1A 4KX3A 3CA8A 1ZD9A 2X7RB 3JRWA 1SXJD 2YV3A 4MJLA 5KVQA 2CSLA 3RE1A 3SM3A 1DJMA 3K96A 4HYTA 1EI9A 3ROZA 4IUDS 2ISCA 2W6NA 5KDLA 4BNMA 1KI7A 5EJ4A 3CXCF 4AT1A 1ENPA 3FSEA 4FINA 1KQSF 4HMPA 4PPYA 5HBGA 4A1OA 2FJ0A 2AI3A 1TK9A 2XE4A 2NT3A 3IUEA 4WKNA 2EKZA 4X20A 4KP7A 3G4SF 3P3PA 4FONA 4QFDA 3TZLA 1F60A 5JPCA 3K1ZA 1FXKB 3PEWA 2HMYB 5G0WA 5DNDA 3TL2A 4DBLE 4EB6B 2E48A 1IN7A 1OAOA 5DTQA 2VH5R 3EXG1 4S3MA 1G21A 1CBUA 2GN9A 2FZVA 5AM3A 2GPTA 3SEZA 2AMTA 1PUJA 1VF6C 2X0KA 4LX0A 4QICA 2J3IA 3PE4A 3DE4X 3R3JA 2G4LA 1XMVA 3M84A 1RC0A 2J8ZA 3IAEA 4G1VA 2O06A 3MTBA 4ND1A 2OE2A 4TWKA 3HEAA 4FOTA 5DP2A 4KH0A 1YULA 3UIEA 1GFZA 3AHGA 2G5PA 4YK7A 4BVQA 4BIOA 3KAKA 4B3TB 2QUAA 1MABB 1EBUA 4XR4A 5AKZA 1HQDA 5JTUA 2P40A 4NVRA 3CBGA 3NS7A 3TTTA 2IPXA 4IL5A 1E1QA 1N0NA 1EM6A 1CUDA 4EO4A 3GIWA 2YXYA 2F8SA 3C4QA 4J07A 1SF9A 2X1VA 1I4OA 4ENPA 4ESOA 3CG4A 5DWVA 1Q21A 3GG9A 2JGEA 3LZCA 3SZGA 1L8OA 2V3CC 1UKCA 1M2EA 4J0FA 4LRWA 3PFKA 1K68A 4FFDA 2DJVA 4GLOA 1FTQA 3K2BA 3W8FA 2E5LO 4KXXA 5HEKA 1A0OA 2AOTB 1Z4NA 3SYTA 3X43A 3GDWA 3V8QA 4XPZA 4D4GA 5BV8A 5LZ5A 2QX4A 3CKKA 4JCOA 2YC2C 1Z7GA 2H92A 4KKXB 3Q4HA 1R0CA 3N2EA 1AU9A 3OT1A 4XDJA 3B3QA 2JL1A 4QDOA 4JPRA 4LKRA 4GXRA 1BKYA 4YQEA 3GHYA 3I5DA 3BCHA 1U7PA 1QK3A 1U02A 4KBGA 5B5EZ 2H0AA 2RCNA 4L15A 4KIGA 3B2EA 3ZQUA 3E8FA 2UXDB 5IU6A 1GU1A 1IHOA 1J1IA 2BHRA 3OVMA 3TOZA 2NTYC 4C3UA 1LQUA 3HKDB 3HWUA 4ARUA 4PV1B 2I3AA 3AOGA 3HKBA 2WHXA 2ZOSA 2QJTA 3BH7A 3THWA 4KBFA 2DPMA 2LKCA 3AZPA 2PX4A 1IJEA 2P6OA 1ND6A 3HU2A 4JUBA 3FMOB 4L6CA 1D5WA 4GYYA 1THMA 4M4SA 1XMJA 4ZGGA 3NBMA 1PP4A 1ISRA 5A02A 3E7FA 5DLDA 1F7YA 2WABA 3HKEB 1BZKA 4D79A 3NRCA 2A86A 3E5MA 1QR2A 5SY4A 3U17A 4NLLA 1JEOA 3WK5A 1ORQC 1ISHA 1ENVA 2C2XA 3E7DA 1P31A 5COAA 3S8EA 4MYUA 4Z8YA 3FDFA 2EV9A 3OPYA 4ZYZA 2RKBA 5E8JA 3T1HO 1UZAA 2HIAA 1MX3A 3JR7A 1H4QA 4ZI7B 4F8YA 2BE7A 4KQ6A 3GJ5A 3JWEA 4NMXB 2A5GA 3MN1A 1RHMA 4IMPA 1XRSB 3GOQA 3L7QA 3L75H 1YI1A 5G4KA 3CUKA 1TPZA 5K9ZA 4BNDB 1TKBA 4EHLA 4FIPC 1FP4A 4Z3OA 2HMWA 3WGQA 4MLZA 1I7NA 4YJHA 1DKRA 3ZW8A 3FF1A 1CJKC 5BPFA 1WCXA 2ECOA 5KLVH 3FYDA 1JMKC 1Y1TA 1SZJG 1UMDA 3T5DA 4ZVTA 5A2QN 3IS3A 7AT1A 5J2TB 4EY6A 2H1CA 4G23A 3V8VA 4YS6A 5B3JC 4RL4A 1YL6A 3CINA 2OD9A 3KZXA 5HVNA 4W8GA 5K0NA 3R0ZA 2PUSA 3IFXA 4F5ZA 2IS2A 1KC1A 2P62A 1MKYA 1BMDA 1VLLA 5L3SA 3TWOA 5ALYA 1K4KA 4WCFC 1VH8A 3C9SA 2WB4A 3DO8A 2O07A 5EIOA 1Y9ZA 1M3SA 4RQAA 2ZPAA 4YRPA 3L92A 1ZVKA 3NUGA 4P30A 4HTFA 2C4VA 2EW8A 4PGFA 4PLGA 2C29D 3AVVA 1CR6A 1JI0A 1V1JA 3IVGA 1YZYA 1UFYA 2GK7A 1Z6TA 4KODA 1FLNA 2CN1A 3C4JA 1M6WA 4BVFA 1FRZA 2VQEO 5JTTA 2Z2ZA 4JFAA 1YB2A 3AEZA 1QRAA 3BEHA 2R44A 3GGPA 1KQPA 1K4DC 3A3PA 4WK6A 2W6JG 3EBLA 4X1YA 4JJKA 4KO4S 5IK2A 4TSRA 2BUBA 5IWAB 4REMA 3JAKB 3Q8HA 2IEDA 1BCSA 2AD5A 3FDXA 4KYUA 1VQ8F 3ZWXA 3B20A 3TZCA 4LNHA 2XB8A 2I7CA 3HI6A 1E59A 3DHWC 2GJ4A 3WSVA 4F97A 4MVJF 5K0LA 1K5GA 3C14C 3BL8A 4BWVA 1ORHA 2GYYA 1CZLA 3PIIA 5E6RA 4GKJB 3LI2A 1DIOB 2HS4A 1N2CA 4IHJF 3DEAA 1NF8A 5EJEA 3WGUA 3EF3A 4O1HA 2FQQA 3CH7A 3SYRA 3QXCA 4RFLA 4C6RA 4CF7A 3CKMA 1NLUA 3PXXA 5DNAA 1ECBA 4OXKA 4Q3EA 2ZIGA 4V0SA 2EXXA 3MK31 4U7WA 2X3YA 1SB9A 2OGZA 1NQ5A 1CUAA 2GM5A 4OLHA 4OX9B 5IJWA 2NMUA 3ZYZA 2F67A 3FAVB 3F6SA 1TXGA 1IX9A 1MENA 4ZMBA 6Q21A 1SXJB 2NZWA 1ZGCA 4WESB 1QH9A 1XIVA 5DIZA 2B8NA 1XVUA 4Q05A 3A6PC 4ZVRA 3H6HA 4JTAB 5JG7A 2H2AA 2PGLA 4HVTA 2XUHA 1CVRA 3OM8A 4YJ3F 4POAA 2F48A 2A7WA 1A2BA 1Z4JA 2PZMA 5FF9A 7YASA 4QA9A 4OMCA 3L7LA 2QJ1A 1C80A 1G21E 5F7ZA 4ALMA 2HVYD 3B48A 2PGGA 2BKAA 4RJTA 1RRVA 3SHWA 4BNIA 3HLYA 3OD1A 4G5SA 2R8PA 1DKPA 3IEXA 4IEFB 2G1PA 4AKTA 3NIBA 3R2JA 3HFGA 1JSXA 1BRTA 2HY7A 3EIOA 1R9NA 2FETA 5REQA 5TMBA 3WXMB 2XUQA 2QMQA 3ELYA 4KXUA 1IY8A 1ZNYA 3D7NA 1CXZB 1BTOA 1JXAA 4DHEA 3S2IA 3PJFA 5IVDA 3M3DA 1PTKA 4TWIA 4MXDA 5DCVA 1E9EA 1HLPA 3ZMVA 5IT0A 4V0RA 1QIKA 1X2BA 1TT5A 4DQDA 4E70A 2GK3A 1T6ZA 3EA4A 2Q27A 1SC6A 2IQQA 4U8HA 1GKFA 1SUBA 4O4LF 5A2QM 3OJEA 3NMUC 4FGUA 2GM4A 5J5CA 5KEIA 1Z25A 1X87A 1SFRA 3LCRA 1JKIA 4POOA 4LXQA 1RBQA 4EHKA 2DKNA 3TMKA 2DRIA 4QZVA 4TSFD 4IGGA 2ZI4A 4OB6A 1Z5ZA 3KOMA 4TKZA 3ON5A 5LB2A 3K9BA 1IHPA 4TTRA 3FDIA 3TGLA 2EHDA 2EIMC 3SGLA 2I78A 1G0OA 3SE7A 3DB1A 4Q00A 2OIEA 4HGQA 3B2EE 2IJHA 4RUEA 4WKGA 5BSEA 4O25A 1Y4MA 4ZHQB 1ZCAA 2XCQA 4JYZA 3C41J 2BOCC 2VCEA 2YS6A 3AFIA 5B37A 1X7XB 4BP9A 4DDTA 5DHQA 2I3ZA 3QPWA 3K0EA 1NVBA 1UQRA 3SSMA 4KXQA 1QYRA 1G4HA 2XUZA 2C3MA 4V0KA 4GYWA 1CFJA 3RU9A 1BHAA 4DR3B 3FNFA 2EZ9A 3NOXA 2Y4OA 2LFRA 4G97A 5LGTA 4PLCA 5FJJA 4CF4A 3X1XA 4AZ3A 5K0FA 3MCAA 1E1DA 4Q4LA 1SUIA 3BWYA 2G7ZA 4AIIA 4WX2B 4ZAFA 3R7WB 5HA5A 2CCGA 1D2MA 4BBPA 4II3A 3SG0A 1WNTA 3L5KA 4GL4A 4HT3B 2B2CA 2QI9C 2HA0A 5KYWA 2D7CA 4PG4A 2QW8A 3L93A 2UYYA 2V8OA 2OV6A 5AJYA 2NU9A 1FSGA 3HQ4O 4WFEA 4LY3A 4YRFA 4A0QA 1FFAA 5DYIA 3BK7A 4A15A 4B1FA 2BZ1A 4QULA 4NZZA 5KWIA 3K09C 1UAYA 3G1UA 3C3DA 3TD2A 2H16A 2E18A 1DAOA 3LNCA 4NBWA 1E6KA 2Z2JA 2Z6AA 2QRHA 4EQZA 4HS9A 4HMQA 1JA0A 1FMLA 2GFHA 5EMKA 1CP9A 1RXWA 4GP6A 2O52A 1WUTA 4AO6A 5B2EA 4HPJB 5EXPA 2WA2A 3NI2A 2R5FA 2VBIA 4EGSA 4YJKA 1FW6A 3PQFA 3IFSA 4XOIA 2AW9A 3SQDA 1MAAA 1W88B 2QN1A 3KJGA 3VKFA 1QG6A 1EN4A 5EYPB 3K03A 2OAGA 4J16C 3NTOA 4EB6A 3B6NA 3EVCA 5BXZA 3E2PA 5DHPA 2P4KA 3OQOA 3SPHA 1Q44A 5I7EA 2ZDGA 5AVJA 3HPQA 4MQMA 1PNVA 3I83A 3GMSA 5EHZA 2HAEA 3THYA 3KWLA 3HRIA 1BU8A 3ASVA 1A9RA 4ZP1A 3WJRA 3G2MA 1ZISA 4I4TB 3VR2A 4F21A 1IB0A 1XNRO 3JASB 3JYOA 1SQSA 4FMDB 4M1KA 4GLFA 2WOOA 2A0WA 5CG1A 2ZJ1A 4D02A 1YH3A 3R0QA 2H1HA 2P41A 4J9UE 1E7KA 3NXSA 4WLFA 3RB8A 1LDGA 1VMGA 3SY8A 1Q3HA 2HA7A 1AN9A 1QJCA 1VKJA 5B57C 1CS4C 3RIHA 1G8SA 4IIHA 1RQNA 1UDXA 4X7PA 3WL5A 5IJ0A 1JDBC 4N6GA 4N40A 3VR3A 1DRJA 2VWGA 4ENUA 3L0PA 3I9FA 4TYPA 3S2ZA 3KB2A 3HGMA 3CYFA 2JS3A 1JW9B 2SKCA 3LT1A 1IHUA 4M8NE 4WWHA 4R71A 5EP1A 2AOTA 4FOSA 3PJRA 5BV2P 4D0LB 3CPJB 3I1FA 3KTAA 4C89A 2FK8A 5B3AA 2W8BB 4IJQA 1AKQA 5DH9A 2GCOB 3H5OA 1YB6A 3ZE7A 2G09A 3PEUA 3ON1A 1P33A 3TR6A 3SE0A 3E5NA 1N2CE 4IZ6A 1SKBA 1VQNF 1PN3A 1OA0A 3OY7A 2PFGA 2P4UA 1K7CA 2VBFA 4LMPA 6ADHA 1SEPA 4BFYA 3K5OA 2ZR0A 3H3JA 3HKDA 1FFXB 2R70A 3EIEA 4DCCA 3MNFA 2OKGA 1S1MA 3U7FB 1BWQA 3NIGB 4KQ2A 4KV7A 2NSLA 1S02A 4Q9LA 1QGZA 4YCAA 4P82A 1E1QD 1AJEA 4MHSA 2L0XA 3ZCSA 3H1PA 2AHZA 1HT0A 2PF4E 4LV6A 4LYGA 2X8LA 2D1QA 2YI8A 1HZJA 3CRZA 1RNLA 3LK6A 1DL5A 2I99A 4NQRA 1YQTA 3NETA 5DOZA 1M33A 2RMKB 1XZHA 2DOKA 1XEWX 3HKEA 2BFOA 3AZOA 1Z17A 4ZAZA 4DPMA 1Q7RA 1T4CB 4U7HA 1OIVA 3VOUA 2C2GA 5THQA 2O8DB 3IVAA 4ZK2A 2VDMB 1XQ1A 3VYVA 2ZBGA 3T1HB 3EH1A 4MGZR 4JR2A 1ADFA 4QTZA 4ER0A 4H4CA 2FJPA 3TLCA 1U2PA 4LK2A 4E5DA 2ODMA 1I4EB 4UJ3A 1G66A 2JAOA 1DFGA 2R4QA 3QTTA 1XYYA 2JGJA 2ZJFA 3QEOA 5DKFA 1HZZC 4J0QA 3KSAC 5COBA 1YOVB 1WDWB 2ISQA 5KBYA 2IU6A 2K9PA 5HXZA 3P32A 4AYWA 3E1SA 2XOKG 3KEGA 3K12A 4XASA 4FZRA 1ONNA 1SXIA 5TQJA 1V8BA 2BGWA 1X19A 2IDKA 4IINA 4DA8A 5CUQA 1RC8A 2B25A 2O0MA 3K79A 4ML3A 3AJDA 4JC8A 2GM9A 4I8XA 2G6TA 1NW5A 3D7LA 3UXMA 3ASUA 4WD3A 2YN2A 1GRNA 1Y7IA 4PGHA 3NEAA 1DAIA 1NBAA 3OO0A 3CH5A 1IZ3A 1IWPB 4HQNA 2IYNA 2REQA 3HDYA 3P4EA 3SYQA 1BGVA 2F3TA 5JJBA 2VEDA 4DC9A 3LHDA 3T7SA 5DHRA 4P36A 3QKRA 1Y6ZA 4H59A 3LP8A 4ZRMA 2WKPA 1XBLA 2QWNB 2GHTA 2J3MA 3FJOA 1QG0A 5ALIA 1UQTA 3RO7A 4FHFA 2PRZA 2ZTHA 1NWCA 2BHNA 2WAAA 1X15A 2VG8A 1ISMA 3ABIA 3R7AA 3PR2B 4NUTA 2FY8A 2VQEB 5J4KA 3GVHA 2AE1A 1YA6A 3MBMA 4D8YA 5B1OA 4Z9BA 3RIYA 4C82A 1UWLA 3ORQA 3NM5A 5IZCC 5LHGA 1IMOA 3RS2A 2FWNA 3TH5A 5DM70 2DY0A 4IIJF 1BDMA 2VJBA 2I3GA 1M2VB 3ELWA 2RGRA 3UAWA 2RKOA 5AUNB 3KOUA 4PCVA 2IYQA 1RYBA 1BDIA 2YY6A 5GOTA 2DFLA 1F5NA 5FPHA 1OH6A 1IXBA 4P8RA 5MN4A 1YRQA 1NHWA 3EHDA 3WA6A 3C2QA 2GCPA 4BV3A 3HU1A 4HAWA 4UC0A 4M0KA 2B4KA 1GZHB 2NU7B 3FDJA 4MJXA 1UBEA 3OC0A 2G1JA 3KQNA 1JP7A 1NQVA 3KCYA 1NM5C 2BC9A 2FW7A 1PNQA 1E3LA 2YL2A 1BHO1 3CIOA 1OH8A 4N82A 2YY5A 1OX4B 2P78A 2A3RA 3H75A 3TXAA 1J1UA 2YS7A 2JFUA 3PHIA 3RVNA 3MWDB 2Q6KA 3HCNA 3S81A 3GQBB 2OVFA 2RH4A 3IKMB 1DI0A 2POQX 4E7OA 3GUVA 4KXFB 2WJAA 3AGQA 1QVGF 4QRHA 1YHQF 5HYVA 2RE8A 1EIWA 1NBOA 4CR7A 3S7ZA 4A0FA 2W6JA 4B7EA 3FAVA 1DIRA 2ABWA 4ZHYB 2BJWA 3KETA 1COZA 2OC9A 3N8GA 2YWRA 5DM0A 3CC7F 4DLWA 3OIUA 1Y4DE 3BHJA 2FSVA 3C4VA 4IVNA 2XIJA 2YFQA 2OSBA 3CR3C 4OEHA 5DLQC 4FPXA 4E1BA 3ELCA 2G63A 3NUQA 3MJDA 4P4UA 3K9HA 1QYXA 3IC5A 5IK2D 2AA3A 4KMMA 3ZX4A 2EJWA 1JLMA 3CJRA 4MQBA 3GLUA 2GGSA 2JIMA 3TRFA 1KYYA 1U3WA 4B6RA 3WNBA 4OYYA 2Q45A 1PJCA 2XCLA 4E12A 3G6EV 1YB7A 5B1AC 4L6AA 1M7GA 5CJJA 4Q5IA 3IIIA 4FYIA 4JK3A 1KB9F 3N2ZB 4X0EA 4KQFA 4AN0A 5J58A 4ZCPA 2CTWA 1OJHA 1NY6A 4WECA 1JLLA 3LVRE 1XD2B 1GNQA 4U7NA 4PZLA 3GOHA 4DDKA 4TL6A 1QQCA 4RETA 3NWBA 2P6RA 1T34A 3SJCC 3ESCA 5K8UA 1UPGA 3ESQA 3D8TA 2V97A 2FG7C 1IXYA 3IKLA 3OBWA 2BRUC 3ESYA 1CXZA 4YRRA 2NUPA 4NU0A 3K8QA 3HN7A 3KKLA 5F7JA 4F2PA 1XXHB 2Y1DA 1XX6A 3JD2A 3IUYA 1TCCA 3L6RA 3LVQE 2JNBA 2QS9A 1M8GA 4PAMA 4HXYA 1J24A 2DC1A 2QW1A 3KKQA 1NFQA 4MZXA 5EC1C 3F9CA 4KWCA 1ZCFA 1K6IA 3JQBC 4BNLA 2JI7A 1QGAA 2W0XA 4K0RA 4DA6A 1NA5A 3V8MA 2ZI6A 2RHTA 2WLHA 3PF8A 2PMPA 3DCJA 2ZM5A 1NI3A 1SUDA 3BE5A 3EHBB 1CYDA 3F6MA 1DQRA 4R01A 3ZHXA 1FYDA 2VF7A 1E1QG 1KZYC 2H85A 3AM4A 1YKFA 2J0UB 1T91A 3AWDA 5ENVA 4X20B 1OAAA 5DM1A 4C7MA 4AKHA 4UFPA 1GG9A 1L8XA 3FYEB 3GAZA 3VO1A 4E30A 4U6QA 2X13A 3A26A 4A92A 3W7WA 1NL3A 3M8KA 4QGAA 1EGQA 3RSLA 3X2QC 1AI7A 2HQRA 1D4FA 2O8BB 1CDEA 4I7ZB 4JZGA 3H5RA 5BMVF 3ZV6A 1ZRNA 4B3IA 4CG0A 3HEMA 2D2CB 4OCZA 4PQGA 2IIPA 2DQYA 2B4QA 3AESB 3PFHA 3P1JA 5LQRA 2PUGA 4QXQA 1YJNV 1XZKA 2IK8A 1TIKA 2F1HA 2BHLA 1YDGA 2B1RA 5JJ5A 4CC6A 2GX6A 4LN1A 5H59A 4HH3C 3UWMA 3FW1A 3TD5A 2P9CA 1AGNA 3COPA 4KQMA 5EIWA 1SZCA 2BEVB 4CUKA 5EWMA 1DEKA 1H2HA 1PD1A 4LYAA 2XGJA 2A1UB 3KQOA 4ZYTA 1NF2A 2Z9DA 3VR0A 2LDBA 1I2DA 2IH5A 1ECFA 4BZZA 4UBNA 4HLQB 4K9PA 4C76A 3ABRB 1JVBA 2F4NA 2JHFA 1UAGA 4G5HA 1DC7A 2PL1A 2P1DA 1F20A 3PRHA 4DXAA 5B4UA 2FEAA 4CF3A 3DAOA 4IJ5A 3EE6A 1R16A 3AUKA 1OY1A 2JGUA 3ABMC 3AONB 3PEYA 2XJ4A 5IBPA 1T3GA 4GAEA 2CLOB 2M6YA 5KWJA 5CYPA 3BL5A 2BEUB 1C7EA 1E4OA 4Z0PA 3JYCA 3Q4HB 3OT1B 5AKJA 5K7SA 3M6AA 4XWKA 1UT6A 5JPIA 1KDPA 1T2NA 3RODA 3IX7A 1E9BA 3DP9A 2XRZA 2WKWA 5CD1A 2HMTA 2XNHA 3QI7A 5AVKA 1W88A 1AUVA 4S1NA 1CY8A 3E23A 4C6SA 1Z8DA 5F98A 2NGRA 1ZUWA 4Y1GA 3PVSA 1KECA 3HKBB 3ABUA 4IRUB 1YE3A 1ESZA 5KNBH 2UXDO 4ID3A 3Q40A 1JQ5A 2A67A 3O4VA 3THWB 2GCNA 4GSKA 2QG6A 5E9QA 1IN8A 1G64A 1P6UA 1XNRB 3P0FA 3OH8A 4KAJA 3OICA 4Q01A 1QF6A 3F5FA 5ERGB 1UM8A 5DECA 3G59A 4HSEA 3KR1A 1WY5A 1WKVA 2VSFA 2YVKA 3JASA 5HJ5A 3AUFA 4ZALA 4B47A 3FVQA 3BPSA 2CFCA 4P2BA 3SLGA 4XCVA 1URFA 2GXQA 1J23A 2JRIA 2ODTX 2PEZA 2XF2A 1NF3A 4YB8A 2BGKA 4N5MA 2FEWB 4HAUA 1VC2A 4HQKA 4PINA 8GPBA 3W0LB 3K9SA 2OBXA 2ZPTX 3QM1A 3P7MA 1V6SA 1WZIA 2NXJA 2WV7A 3V2HA 1ZMXA 1F6DA 4BGUA 4NQZA 3M4SA 2ZWPA 4LHYA 1QF9A 3GLKA 4FP9A 4KKVA 1HOXA 2D7JA 4PBRA 3CO5A 3UAZA 1W34A 1AJPA 5TF0A 3HSYA 1HE8B 3EVZA 1G7TA 5G4KB 3D1JA 3VV3A 4B3FX 1FP4B 2WIDA 3OZCA 4OLAA 2GKGA 3BRCA 1Z63A 1GTVA 2B4YA 1SU4A 2ZT9B 4YJHB 1NAHA 2I66A 2WYVA 2PTHA 3ER9A 4LCJA 5SZKB 4EI8A 3WRVA 1HQYE 1RXYA 3BXXA 3VKGA 2C9CA 2R7AA 5EJ8A 1UZLA 3IR9A 4PTLA 2ZM6O 2XI4A 1K7FB 1SVSA 4K3UA 3U4AA 4KTTE 1FFXA 5B3JA 3VR2D 2Z8YA 2R8XA 1B14A 3LT5A 4KYTA 4R4JA 5L3SB 4PA4A 3LAWA 1CUCA 5A4JA 2QX6A 4LKOA 1R1MA 4E22A 2ZSDA 4C21A 2HFJA 4MKRA 3BICA 2VYVA 1B74A 2O2EA 2IKQA 3NJRA 1RBMA 1T9ZA 2VT7A 4UEWA 1CJBA 3A1CA 1E2BA 3QIVA 3IT2A 2PGAA 4HL6A 3ETHA 4HTFB 3H17A 1SXJE 1RWXA 3I62A 3VR3D 1OJ7A 2ENUA 2G9QA 1T4GA 2VP3A 4QIWF 3LVBA 1EXMA 1FLDA 4F72A 3OF2A 1Q6UA 5DM60 5BYKA 1ACLA 1Q0UA 4CH4A 4FD2A 3T3DA 3FTFA 5E4FA 4NR0A 3BN3A 5CB8A 4UNSA 5GINE 2EARA 2P11A 2Y4NA 3OU7A 1HFWA 5FI5A 2CVOA 2HRRA 3PQ4A 5AHRA 2B4AA 1W4BA 4X1YB 4WJKB 3K6JA 1Z4IA 4OP1A 5EJIA 1JQAA 4BQRA 3FX2A 1BCSB 3HCDA 1ZHHA 1FQWA 2EL7A 1DCKA 4X6XA 4BKOA 3ZBTA 3FD8A 1MQ8B 3ZWOA 2ONYA 5IWAO 4IGFA 1FUYB 4U8GA 2ZR8A 2QJRA 4UDYX 4ZQFA 3BHIA 4K3AA 4GXTA 4IJWA 1XE3A 3CF4G 2ARKA 1V9SA 5E6RB 4RVFA 4O2AA 4OHFA 3MW8A 1JDJA 4BU1A 5A4AA 4XE5A 2MQEA 1IC6A 2IOFK 5ALRA 2B3TA 1WMEA 3ZS8C 3ESRA 5KOJA 4WFHA 4HOYA 5EPUA 1DTWA 4GKJO 3NGXA 1PFQA 1L4FA 2PX6A 3RIEA 6REQA 2QTPA 2FSPA 1DQYA 1I0LA 3HVKA 1WAZA 4Z9AA 2JIOA 5A5FA 3TDKA 2CB9A 2RHHA 2WSIA 4ADSG 5ESWA 1QANA 3ND5A 3ZVKA 4OP2A 3DONA 3VU1A 4JIMA 1OU0A 3FLAA 2X7XA 4LCUC 3CXCU 1ESMA 1ZLZA 4S24A 3BE6A 1KQSU 3O47A 3HCBA 4AZSA 3SQOA 5JZBA 4E7PA 4OX9O 2OK8A 2XOKA 3IRVA 4ISCA 1PS9A 5IAKA 3KHKA 3EODA 1YU6A 5JSUA 3NM6B 1EE1A 3I01A 1QAOA 1GXSA 4UTVA 3BOSA 4K3VA 3MC1A 3DE0X 3MTQA 2G4VA 2YWFA 4IFIA 3QSYA 2ZRIA 1OGIA 2NUTA 821PA 1FEZA 5GM2A 1BN7A 1GGJA 3KXDA 1M2VA 3E05A 1V54C 2IJJA 3ZQ6A 5DYYA 1QZ3A 4RWUA 4U3JA 2HV8A 1J95A 5CX1B 3K58A 4F96A 2HADA 3JATA 1RLMA 2G88A 3PJEA 1BJRE 5KHHA 4BO2A 3QYJA 2C7QA 1FDWA 5REQB 3JWGA 3H8VA 3PC7A 1YFJA 1SKVA 3I9V1 5DNWA 5E95A 1AQYA 5F52A 5C7IO 1EQ2A 4FFVA 4W5RA 1OX4A 5C34B 3NTRA 5M7EA 1TT5B 4PG6A 5HTKA 1U0OC 3TLYA 2QD5A 2I7VA 1Z88A 3O31A 1A8QA 3RHTA 4BJ1A 1KQGA 4FUTA 5HY0A 2YHBA 4AZVA 3N74A 2ZBFA 3UMYA 4NDNE 2L6LA 1EFDN 1RCFA 4PPFA 3O3CA 1R6DA 3PE6A 2FWAA 2VPQA 5PGMA 1RP1A 1H42A 3MEQA 3ZHRA 2OCHA 3PFGA 5L9AA 3BD9A 4OL9A 4KTVE 2FJUA 5LU9A 4C7VA 2YWCA 3VBEA 3Q12A 2WYOA 1UPAA 4MDHA 3GJ0A 4DJJA 3DBOB 4AN1A 3HJNA 4QSHA 5DYWA 1Y8RB 3ZWNA 4ZRNA 3LZ6A 5AIAA 4IOMA 4G4YA 5IT9M 2AK3A 1X1CA 4QNHB 1J0XO 1CJUC 1U1FA 5LR6A 2V74B 4ZVUA 4H44B 1RWQA 2ZRDA 5I01A 4UB8Z 1K97A 2RC5A 4DLRA 4C3VA 4HGPA 3PN1A 1Y3FE 1ENZA 3F5WC 4X3PA 4PO3X 3TNLA 3AZQA 2OMEA 2QVYX 3DWFA 1YRLA 3R3SA 2OHOA 1T1IA 1EJBA 1OXBB 4I55F 1VHAA 4PZ9A 4K6KA 3ZRXA 5I9LA 1CQXA 1VG9B 1HDCA 3AT1A 2ECQA 3C24A 2VPIA 1X8XA 4KQKA 4AZ3B 3VDQA 1CQIA 3MCAB 2Q9AA 1TYZA 3SFVA 1PDVA 4DR3O 1R12A 3K9CA 1R8JA 4JMPA 2JH8A 2BDTA 3GEGA 3NCTA 4BB5A 4BRUA 5DOVA 1GAJA 2JLQA 2QUBA 3ZIDA 2W6JD 2YZ2A 3SYNA 4EG4A 4F4CA 5BXQC 5JAQA 1PJQA 1K88A 5KYWB 3PLRA 2IPNA 2YYSA 1T1GA 1OW3B 4EG8A 3PUKA 2K7ZA 3LF1A 2NU9B 4IDEA 4J0KA 5ETJA 4OIFA 4BLOA 4F9GA 3ZWQA 1JBQA 2VF4X 2VZEA 3HY6A 3E03A 4IIDA 3IV7A 1QBKC 1Q12A 3RGGA 1ORIA 5B4TA 3K09A 3SX4A 4JKYA 3LG2A 3L7IA 4E51A 3PFNA 3D4LA 1NTOA 1VE9A 4WZBA 3ELDA 4JJAA 3RABA 4LX8A 2JANA 4P3OA 4C2AA 4JB3A 1R00A 2J0UA 1SZXA 4L0CA 2AG5A 4Z7JA 3E2EA 5CNKA 4UM8B 4NAVA 1GZ0A 4Z0HO 4HDCA 1PV1A 3G7SA 4OQYA 2YNMC 1FXSA 1SNYA 3DKVA 4Z5XA 1EP9A 1FPOA 3PDIB 4J16A 1UJMA 2CB0A 2XAAA 3D8CA 2Y0PA 1I1NA 4K2AA 2V0GA 2JLVA 2O8BA 5IKEA 2Z58A 2XJ9A 2XGMA 2J6IA 1CEYA 3WTBA 2YINC 4H1WA 4LJKA 3AESA 2G36A 3THYB 3T7KA 1CIVA 4UBJA 3P96A 2PRSA 3JQQA 2H4YA 2OPHA 2J1LA 4LBYA 5ULLA 1LI4A 4IG4A 3U56A 3C1UA 4TQFA 1F51A 2BEVA 1JA1A 4H1TA 4NMMA 5LQKA 1DPFA 5F2OA 4BMNA 2A1UA 3OLYA 1P5RA 4PZEA 3CC2V 5AVRA 1QHXA 3PDJA 4FLEA 2XR1A 1J00A 2PSEA 4GZ3A 1XTPA 1LC3A 2YQ5A 3M5CA 5BT9A 3KZ1E 4PCLA 3I05A 4R2MA 5T57A 1XU7A 5DBOA 1H05A 5IJ0B 3IP5A 4AULA 3I30X 4RTSA 4BVBA 5CBPA 1W5AA 1U9CA 3FPAA 5HY2A 3HU5A 4IDOA 2JI4A 3FCSB 2O7VA 3CD6F 1W29A 4NDZA 5E4JA 3VDXA 2ZXWC 2QZJA 3KEMA 3KTAB 3PLAC 1GRCA 3DC5A 3QE0A 1LBQA 2H63A 2ZRLA 1Y1SA 4CE6A 3ZDQA 2BEUA 4E2WA 3WJ2A 3FMVA 4PN7A 4XGQA 3HCCA 4QSMA 5EVJA 5GY7A 1AKNA 2IYRA 4PRZA 1C8KA 3GR6A 3I76A 4TPKA 3S44A 1TM4E 1L5FA 2G08A 3G0GA 3OZUA 1LB1B 4QPNA 1ZCJA 3QENA 4X60A 1GG8A 1PS0A 4LE2A 3TNYA 5TS3A 4ENSA 3V4ZA 1C3VA 1T5OA 1RTTA 4JQCA 3UMGA 4PVDA 2BTEA 3AFNA 3RUPA 2G5GX 2LKDA 4TLLB 2C3OA 3OQJA 3C5VA 2H57A 2QZSA 1XTVA 4KQIA 2VK8A 2DWCA 4MGHA 2C9BA 3OX4A 3N1UA 3UANA 5E38A 1U63A 1VJDA 3A7EA 3O90A 5DI9A 2ILMA 2CFSA 1HWYA 1RD4A 1MFPA 4FWBA 3U2QA 2FWJA 4KQ9A 3HNRA 3B53X 3IEVA 4KQHA 3IO5A 2HSEA 3GRKA 1TGVA 1BDBA 4YRNA 4JZKA 1Q3TA 1E4EA 1U7DA 1ECJA 4YMSA 2O5VA 2C82A 3JXEA 1H2AS 1SQBH 3FVTA 4YTEA 5BRAA 3FPLA 2C8LA 5LD2B 2OOSA 1JXMA 2RAPA 3GPBA 4I1PA 3W5IA 4KE9A 1JHYA 3SSNA 4AK9A 5MFPA 4Q4JA 1QNLA 5KPJA 4UXJA 2D1FA 2ZIEA 1GX1A 1G8JA 1YBFA 1DAHA 1H2MA 2VZ0A 1X25A 3ANNA 1SURA 4DCGA 1N2XA 1U94A 3WQQA 4KXNA 3KC2A 4H27A 4YACA 1GTMA 1MOPA 2AUNA 4UEOA 2HQBA 2V7QG 3U5ZB 2EGHA 3LV8A 1SVOA 1KSHA 4PLVA 3L41A 1ZFNA 4AO7A 4DUGA 4UOEA 2ZM6B 3IBCA 3PAFA 1R6VA 5FI3A 2DU8A 3GEHA 4WIAA 3OTIA 4G8CA 3MGAA 3EGWA 4G1FA 4O2BF 4HF7A 1FQOA 2DMRA 5EJ2A 3DL4A 4INAA 2ZR7A 4BFZA 4G4SP 4E13A 3FOCA 2REQB 3KVYA 3QBEA 2ZI9A 2FKNA 2ET6A 4BXOB 1VJTA 1GUAA 2XYPA 1JTVA 3V1KA 5AJUA 4I5DA 3FPHA 3T35A 2DXIA 1M6YA 3QKRB 3DZFA 3L71H 3Q0TA 2JLYA 3TB6A 2G9RA 2LTAA 2AZ0A 3JAMA 4Z0TA 1CC1S 4LSGA 1MOQA 4Y1FA 3FAKA 3I72A 4MUHA 3EVKA 4MYHA 1IFXA 2G1UA 2OIGA 1KEEA 4AKGA 3G79A 2ZVPX 1KPGA 3H8SA 3D0OA 4GH5A 3V97A 3FPCA 3KVOA 3WLRA 1BVHA 2CXQA 2QD2A 4FR2A 1I5EA 1ZOPA 1AILA 3BD7A 3G8DA 1T0HB 1PEKE 4CU2A 1VB5A