4NUTA

Crystal structure of the complex between snu13p and the pep domain of rsa1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
122
structure length
122
Chain Sequence
PNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords 13 kDa ribonucleoprotein-associated protein
publication title Proteomic and 3D structure analyses highlight the C/D box snoRNP assembly mechanism and its control
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 4nutA00
2KG4A 1T0KB 3MCAB 3J81M 3GYQA 3OBWA 2I6DA 3LWRC 3N4YA 4NUTA 3CCEF 2OZBA 3LWOC 1VQMF 5GANK 3CCJF 3OW2F 3RA5A 1VQNF 3CMEF 3NMUC 1N8RH 3LFOA 3NVKE 3HAXD 1H7MA 3CC2F 3JAMM 3FFMA 1K8AH 3VI6A 4C4WC 3G71F 2LBXA 5GIPC 3J80M 2QA4F 4BY9D 1VQ6F 3O85A 5G4UC 2ALEA 3AGKA 1NJIH 1JJ2F 1X7PA 1YJWF 3HJWC 1W42A 1YIJF 4LCKA 5GAPK 3E1YA 1X7OA 3CG6A 3CPQA 3CCUF 1KC8H 1KQSF 3NVIB 4TZZA 2QI2A 1GO1A 1K9MH 3I55F 2WALA 3V7QA 1Q86H 3CD6F 3PLAC 2VGMA 5EO3A 1M1KH 1S72F 3ON1A 5A2QM 2QEXF 5FLXM 1Q81H 3LWPC 1GZ0A 1Q7YH 1VQ7F 1VQ8F 3CC7F 4X3MA 3RA6A 3I56F 1RLGA 1M90H 4X3LA 3CCVF 3NK7A 1QVGF 1YI2F 5FJ4C 1X52A 1IPAA 1YJNF 2HVYD 1YJ9F 1VQPF 3SIVA 5GIOC 3CCLF 2AIFA 3J7AR 2KTVA 1W2BF 2CZWA 1K73H 1VQKF 2OTJF 1GO0A 1VQLF 2FC3A 1YHQF 3G6EF 3CCMF 3CC4F 3CPWF 3VMFB 3LWVC 3G4SF 3SIUA 5DCVA 1W41A 1KD1H 2VGNA 1W40A 2BO1A 3NK6A 2JNBA 1Q82H 1CN7A 2LBWA 2OTLF 3LWQC 2KTUA 1CK2A 1ZWZA 4BW0B 1XBIA 3WXMB 2OHWA 3CCRF 1NMUB 1PXWA 3IR9A 5GINC 3V7EA 3CXCF 1W3EX 1QVFF 3PAFA 1RA4A 1VQ5F 1SDSA 5G4VC 1E7KA 3CMAF 1VQ4F 3CCSF 1DT9A 3N4ZA 3OBYA 5EWRA 3E20B 3JCMM 1VQOF 3CCQF 1YITF 1VQ9F 5IT9M
chains in the Genus database with same CATH superfamily
3JATA 5EZYB 3TD5A 3S0WA 4O4LB 3LWRC 5KX5A 1Z5WA 2I6RA 4G88A 1JD1A 4ZHWA 3KE1A 3K2XA 2GZLA 4B5CA 4O4HA 2QTPA 5FNVB 5JVDB 3CMEF 3NMUC 3HAXD 5IJ9A 3GHZA 5CA0A 3JARA 3ELCA 3VI6A 4C4WC 3G71F 5GIPC 3J80M 2QA4F 1VQ6F 1J7HA 4BVRA 2VAMA 2GLZA 3KJKA 5BMVA 5HY2A 4ZI7A 3HJWC 2VXYA 4I4TB 1RQ2A 1W42A 4ZI7B 4BT6A 2L26A 5AVMA 2UYPA 5JCOC 3ZOPA 1H48A 3CPQA 3HKCB 5EYPB 4TZZA 4TUYB 2Z1TA 4I50A 3V7QA 3CD6F 3PLAC 1M1KH 2HP0A 1UI9A 1W581 3UT5B 2QEXF 3VYUC 1Q81H 5HXZA 4X1YB 5KMGB 5JH7B 1KNJA 4O2BA 2CHTA 1ODEA 3IMPA 4ZOLA 3RYCA 4X3LA 3CCVF 1RLUA 3NK7A 3WPXA 3MBMA 1W5FA 2Z1UA 1X52A 4B45A 4BT2A 3S0YA 2Z1FA 1YJNF 1YJ9F 3DDNA 3SIVA 3MDOA 3MCQA 2KTVA 4G4ZA 1VQKF 2CW4A 5ITZB 4XCQA 5LP6A 2VAPA 3G6EF 2ZF8A 4YJ3A 2CHSA 3G4SF 4WBNB 1W40A 2BO1A 4PWTA 2Z1EA 3VOBA 4DRXA 1Q82H 1CN7A 1TUBA 3LWQC 3D01A 5MN6A 2KTUA 1ZWZA 3CCRF 3V7EA 1PXWA 1VHAA 2Q1YA 3JAWA 4O2AB 4TV9B 1W3EX 1SDSA 1VQ5F 1JFFA 5JQGB 1VQ4F 1Q8RA 3JCMM 1VQOF 1VQ9F 2GVIA 1W59A 1W5EA 3S02A 4C8EA 5LYJA 2PHNA 3S06A 1NQ3A 1T0AA 3N4YA 3F0GA 5GONB 4U3JA 5HWEA 1IV2A 4BVTA 3CCJF 3RYIB 4I55B 3IKEA 3RA5A 4G4XA 3TD3A 3NVKE 4TV8B 4X1KA 1H7MA 2ZVYA 1PF5A 1SZQA 2RHOA 3WGKA 2DYYA 3ESJA 5C8YA 5J2TA 5IYZA 5JCOA 2EWCA 3RYFA 3V3TA 3I7TA 5J2TB 1IV3A 2K1SA 3KIZA 2RHJA 3O85A 1NJIH 1JJ2F 3IKFA 4FFBB 2OTMA 2F9ZC 3JATB 2R6R1 3B6NA 4O4JA 5KX5B 5GAPK 3E1YA 1QAHA 3CCUF 4BVQA 3JAKA 1KC8H 3WGJA 2W8BC 1Z5VA 2ZVZA 4O4HB 1K9MH 2WALA 4BT5A 3V4DA 1XHOA 3GTZA 5HXUA 5IJ9B 2VGMA 2CWJA 5CA0B 3JARB 2ZAUA 3R0PA 4X1IA 3LWPC 3F0EA 1SA0A 2CVLA 3N2KA 4X3MA 1W57A 4NWOB 1U3LA 3I56F 2AIZP 4EI9A 5CA1A 2CSLA 4EB6A 5BMVB 3L7QA 4E6EA 1QVGF 5CA1B 4C8GA 4X20A 1VQPF 2KGWA 3HKEA 3CCLF 3HKDA 2AIFA 2BTQB 3FD6A 3FPIA 2OTJF 2CZWA 1GO0A 4DXDA 3K0TA 1VQLF 2FC3A 3JVHA 3P0ZA 2HP3A 2UYNA 3CC4F 4B62A 4I50B 3S0HA 3VTIC 4ZHQA 3FBAA 3LWVC 5DCVA 3HKBA 3HWUA 4RQOA 2HP0B 3NK6A 2JNBA 3T80A 2LBWA 3HKBB 3DC2A 1VK3A 1H47A 3HTNA 1UFYA 3RYHA 1XBIA 3E22A 1NMUB 4O2BB 1OFUA 3QTYA 4O4IA 4ZOLB 3RYCB 4YJ2A 1RA4A 5G4VC 4ZHVA 3CCSF 1DT9A 3Q8HA 3C9UA 3N4ZA 3OBYA 2KG4A 3WJQA 3MCAB 3OBWA 3J81M 5LP6B 3WGMA 3WJPA 4NUTA 3CYQA 4YJ3B 3LWOC 2IG8A 1VQMF 5GANK 2P6YA 3QUWA 3MQWA 4DRXB 1TUBB 3JALA 5HP8A 3N2GA 2ZOVA 1VQNF 2ZODA 5EB1B 1N8RH 4NQ3A 1COMA 1VQVA 2YYEA 5MN5A 5EIBC 3FFMA 3JAWB 4HNAA 1ONIA 1JFFB 2LBXA 3VCZA 5G4UC 2ALEA 3AGKA 1X7PA 3C9SA 4IIJA 1QD9A 2IQQA 5LA6A 5LYJB 2BTUA 5HP7A 4ERHA 5LA6B 4U3JB 2VAWA 1DBFA 1VH8A 1W5BA 1XV2A 3CG6A 3M1XA 4C82A 5LXTA 2H8EA 3F0DA 1KQSF 4M8IA 2QI2A 1TVKA 2HS0A 1Q86H 4X1KB 4G4YA 3RE3A 3VIUA 3ON1A 5A2QM 5FLXM 4EI7A 4ZHYB 5C8YB 3LYBA 3BYQA 1Q7YH 1GZ0A 2Q1XA 1FNJA 5IYZB 4LNUA 3P4EA 1QU9A 5EIBD 4F6RA 3CC7F 3RYFB 1RLGA 5LOVA 1M90H 3D00A 3WPWA 5LP6C 3WGLA 1FFXA 4R40B 4O4JB 2B33A 5IJ0A 1FSZA 4KWEA 5GIOC 3F6MA 3IEQA 3J7AR 5EZYA 3JAKB 1GX1A 2NMUA 1YHQF 4O4LA 4IHJA 1OAPA 3CPWF 3VMFB 2RHLA 1RQ7A 2HS3A 1W41A 4IHJB 1KD1H 4BT3A 1IV1A 3K14A 1FNKA 4RHAA 3I3FA 3VO8A 4X1IB 1KNKA 2UYJA 5FNVA 5JVDA 1IV4A 2OTLF 1JN1A 1SA0B 3N2KB 4G4WA 1CK2A 4BW0B 5GINC 3CXCF 3P10A 4EB6B 2YXZA 1QVFF 3PAFA 3K12A 1E7KA 2RHHA 3C8LA 4X20B 3HKEB 5EWRA 4ZK7A 2HRUA 2Z01A 4BT4A 3HKDB 3CCQF 1YITF 2PMPA 5IT9M 4I4TA 1T0KB 3GYQA 2UYNB 2I6DA 5HY1A 2AMTA 1YQNA 3M4SA 3WGNA 4ZHQB 3VYTC 3CCEF 5B8FA 3HKCA 2OZBA 5EYPA 3C9TA 4TUYA 3TD4A 4C8IA 3OW2F 3S03A 3D54A 3LFOA 3ZP7A 3RYHB 3E22B 3CC2F 3UT5A 1JY8A 3JAMM 4O4IB 4X1YA 2N48A 1K8AH 4YJ2B 3C9RA 5KMGA 5JH7A 5CB4A 3ZP4A 3CYPB 4BY9D 3M84A 4BT7A 2HQSC 5CB4B 1YJWF 3QHDA 3F0FA 3VYSC 1YIJF 1R1MA 4G4VA 4LCKA 2UYKA 3WJRA 1X7OA 3EORA 3NVIB 5ITZA 2RB9A 3FD5A 3OONA 3VOAA 1X25A 1GO1A 3IEWA 3I55F 3JALB 3KHNA 3N2GB 3JASA 4WBNA 5EO3A 4EI8A 1S72F 4C81A 3JASB 1U3PA 1XRGA 1VQ7F 1VQ8F 1W5AA 4HNAB 3RA6A 2HRYA 3CB2A 5EAZA 4O2AA 3ERNA 5MN4A 4TV9A 1YI2F 1CLIA 4IIJB 5JQGA 5FJ4C 1IPAA 2MQEA 2HVYD 1K73H 1W2BF 5LXTB 5HY0A 2FGYA 2UZHA 3CCMF 1TVKB 5GONA 1W55A 1U40A 3SIUA 2LBTA 4U39A 5J2UA 2VGNA 3RYIA 4I55A 5J2UB 4LNUB 2LCAA 4TV8A 4F6RB 5HY4A 3WXMB 2OHWA 5LOVB 2H6LA 3IR9A 3ZO8A 1YGYA 3LDTA 4B46A 2HX0A 4BVSA 2H8CA 2IAFA 3U0OA 3CMAF 2BTOA 3LMEA 1FFXB 2DT4A 2R751 5EB0A 5IJ0B 3E20B 1U43A 2V9YA 4FFBA 3KJJA 2G9IA 2HS4A
chains in the Genus database with same CATH topology
2KG4A 1T0KB 3MCAB 3J81M 3GYQA 3OBWA 2I6DA 3LWRC 3N4YA 4NUTA 5HY1A 5HWEA 3CCEF 4BVTA 2OZBA 3LWOC 1VQMF 5GANK 3CCJF 3OW2F 3RA5A 1VQNF 3CMEF 3NMUC 1N8RH 3LFOA 3NVKE 3HAXD 4NQ3A 1H7MA 3CC2F 3JAMM 3FFMA 1K8AH 3VI6A 4C4WC 3G71F 3V3TA 2LBXA 5GIPC 3J80M 2QA4F 4BY9D 1VQ6F 3O85A 4BVRA 2ALEA 3AGKA 1NJIH 2GLZA 5HY2A 1X7PA 1JJ2F 5G4UC 1YJWF 3HJWC 2F9ZC 1W42A 1YIJF 4LCKA 5GAPK 3E1YA 1X7OA 3CG6A 3CPQA 3CCUF 4BVQA 1KC8H 1KQSF 3NVIB 4TZZA 2QI2A 1GO1A 1K9MH 3I55F 2WALA 3V7QA 1Q86H 3CD6F 3PLAC 5HXUA 2VGMA 5EO3A 1M1KH 4EI8A 1S72F 3ON1A 5A2QM 2QEXF 5FLXM 4EI7A 1Q81H 5HXZA 3LWPC 1GZ0A 1Q7YH 1VQ7F 1VQ8F 3CC7F 4X3MA 3RA6A 3I56F 1RLGA 1M90H 3D00A 4EI9A 4X3LA 3CCVF 3NK7A 1QVGF 1YI2F 5FJ4C 1X52A 1IPAA 1YJNF 2HVYD 1YJ9F 1VQPF 3SIVA 5GIOC 3CCLF 2AIFA 3J7AR 2KTVA 1W2BF 2CZWA 1K73H 5HY0A 2FGYA 1VQKF 1VQLF 2OTJF 1GO0A 2FC3A 4XCQA 1YHQF 3G6EF 3CCMF 3CC4F 3CPWF 3VMFB 3LWVC 3G4SF 3SIUA 5DCVA 1W41A 1KD1H 2VGNA 1W40A 2BO1A 3NK6A 2JNBA 1Q82H 1CN7A 2LBWA 2OTLF 3LWQC 2KTUA 1CK2A 5HY4A 1ZWZA 4BW0B 1XBIA 3WXMB 2OHWA 3CCRF 1NMUB 1PXWA 3IR9A 5GINC 3V7EA 3CXCF 1W3EX 4BVSA 1QVFF 3PAFA 1RA4A 1VQ5F 1SDSA 5G4VC 1E7KA 3CMAF 1VQ4F 3CCSF 1DT9A 3N4ZA 3OBYA 5EWRA 3E20B 3JCMM 1VQOF 3CCQF 1YITF 1VQ9F 5IT9M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG4 A;  1T0K B;  3MCA B;  3J81 M;  3GYQ A;  3OBW A;  2I6D A;  3LWR C;  3N4Y A;  4NUT A;  3CCE F;  2OZB A;  3LWO C;  1VQM F;  5GAN K;  3CCJ F;  3OW2 F;  3RA5 A;  1VQN F;  3CME F;  3NMU C;  1N8R H;  3LFO A;  3NVK E;  3HAX D;  1H7M A;  3CC2 F;  3JAM M;  3FFM A;  1K8A H;  3VI6 A;  4C4W C;  3G71 F;  2LBX A;  5GIP C;  3J80 M;  2QA4 F;  4BY9 D;  1VQ6 F;  3O85 A;  5G4U C;  2ALE A;  3AGK A;  1NJI H;  1JJ2 F;  1X7P A;  1YJW F;  3HJW C;  1W42 A;  1YIJ F;  4LCK A;  5GAP K;  3E1Y A;  1X7O A;  3CG6 A;  3CPQ A;  3CCU F;  1KC8 H;  1KQS F;  3NVI B;  4TZZ A;  2QI2 A;  1GO1 A;  1K9M H;  3I55 F;  2WAL A;  3V7Q A;  1Q86 H;  3CD6 F;  3PLA C;  2VGM A;  5EO3 A;  1M1K H;  1S72 F;  3ON1 A;  5A2Q M;  2QEX F;  5FLX M;  1Q81 H;  3LWP C;  1GZ0 A;  1Q7Y H;  1VQ7 F;  1VQ8 F;  3CC7 F;  4X3M A;  3RA6 A;  3I56 F;  1RLG A;  1M90 H;  4X3L A;  3CCV F;  3NK7 A;  1QVG F;  1YI2 F;  5FJ4 C;  1X52 A;  1IPA A;  1YJN F;  2HVY D;  1YJ9 F;  1VQP F;  3SIV A;  5GIO C;  3CCL F;  2AIF A;  3J7A R;  2KTV A;  1W2B F;  2CZW A;  1K73 H;  1VQK F;  2OTJ F;  1GO0 A;  1VQL F;  2FC3 A;  1YHQ F;  3G6E F;  3CCM F;  3CC4 F;  3CPW F;  3VMF B;  3LWV C;  3G4S F;  3SIU A;  5DCV A;  1W41 A;  1KD1 H;  2VGN A;  1W40 A;  2BO1 A;  3NK6 A;  2JNB A;  1Q82 H;  1CN7 A;  2LBW A;  2OTL F;  3LWQ C;  2KTU A;  1CK2 A;  1ZWZ A;  4BW0 B;  1XBI A;  3WXM B;  2OHW A;  3CCR F;  1NMU B;  1PXW A;  3IR9 A;  5GIN C;  3V7E A;  3CXC F;  1W3E X;  1QVF F;  3PAF A;  1RA4 A;  1VQ5 F;  1SDS A;  5G4V C;  1E7K A;  3CMA F;  1VQ4 F;  3CCS F;  1DT9 A;  3N4Z A;  3OBY A;  5EWR A;  3E20 B;  3JCM M;  1VQO F;  3CCQ F;  1YIT F;  1VQ9 F;  5IT9 M; 
#chains in the Genus database with same CATH topology
 3JAT A;  5EZY B;  3TD5 A;  3S0W A;  4O4L B;  3LWR C;  5KX5 A;  1Z5W A;  2I6R A;  4G88 A;  1JD1 A;  4ZHW A;  3KE1 A;  3K2X A;  2GZL A;  4B5C A;  4O4H A;  2QTP A;  5FNV B;  5JVD B;  3CME F;  3NMU C;  3HAX D;  5IJ9 A;  3GHZ A;  5CA0 A;  3JAR A;  3ELC A;  3VI6 A;  4C4W C;  3G71 F;  5GIP C;  3J80 M;  2QA4 F;  1VQ6 F;  1J7H A;  4BVR A;  2VAM A;  2GLZ A;  3KJK A;  5BMV A;  5HY2 A;  4ZI7 A;  3HJW C;  2VXY A;  4I4T B;  1RQ2 A;  1W42 A;  4ZI7 B;  4BT6 A;  2L26 A;  5AVM A;  2UYP A;  5JCO C;  3ZOP A;  1H48 A;  3CPQ A;  3HKC B;  5EYP B;  4TZZ A;  4TUY B;  2Z1T A;  4I50 A;  3V7Q A;  3CD6 F;  3PLA C;  1M1K H;  2HP0 A;  1UI9 A;  1W58 1;  3UT5 B;  2QEX F;  3VYU C;  1Q81 H;  5HXZ A;  4X1Y B;  5KMG B;  5JH7 B;  1KNJ A;  4O2B A;  2CHT A;  1ODE A;  3IMP A;  4ZOL A;  3RYC A;  4X3L A;  3CCV F;  1RLU A;  3NK7 A;  3WPX A;  3MBM A;  1W5F A;  2Z1U A;  1X52 A;  4B45 A;  4BT2 A;  3S0Y A;  2Z1F A;  1YJN F;  1YJ9 F;  3DDN A;  3SIV A;  3MDO A;  3MCQ A;  2KTV A;  4G4Z A;  1VQK F;  2CW4 A;  5ITZ B;  4XCQ A;  5LP6 A;  2VAP A;  3G6E F;  2ZF8 A;  4YJ3 A;  2CHS A;  3G4S F;  4WBN B;  1W40 A;  2BO1 A;  4PWT A;  2Z1E A;  3VOB A;  4DRX A;  1Q82 H;  1CN7 A;  1TUB A;  3LWQ C;  3D01 A;  5MN6 A;  2KTU A;  1ZWZ A;  3CCR F;  3V7E A;  1PXW A;  1VHA A;  2Q1Y A;  3JAW A;  4O2A B;  4TV9 B;  1W3E X;  1SDS A;  1VQ5 F;  1JFF A;  5JQG B;  1VQ4 F;  1Q8R A;  3JCM M;  1VQO F;  1VQ9 F;  2GVI A;  1W59 A;  1W5E A;  3S02 A;  4C8E A;  5LYJ A;  2PHN A;  3S06 A;  1NQ3 A;  1T0A A;  3N4Y A;  3F0G A;  5GON B;  4U3J A;  5HWE A;  1IV2 A;  4BVT A;  3CCJ F;  3RYI B;  4I55 B;  3IKE A;  3RA5 A;  4G4X A;  3TD3 A;  3NVK E;  4TV8 B;  4X1K A;  1H7M A;  2ZVY A;  1PF5 A;  1SZQ A;  2RHO A;  3WGK A;  2DYY A;  3ESJ A;  5C8Y A;  5J2T A;  5IYZ A;  5JCO A;  2EWC A;  3RYF A;  3V3T A;  3I7T A;  5J2T B;  1IV3 A;  2K1S A;  3KIZ A;  2RHJ A;  3O85 A;  1NJI H;  1JJ2 F;  3IKF A;  4FFB B;  2OTM A;  2F9Z C;  3JAT B;  2R6R 1;  3B6N A;  4O4J A;  5KX5 B;  5GAP K;  3E1Y A;  1QAH A;  3CCU F;  4BVQ A;  3JAK A;  1KC8 H;  3WGJ A;  2W8B C;  1Z5V A;  2ZVZ A;  4O4H B;  1K9M H;  2WAL A;  4BT5 A;  3V4D A;  1XHO A;  3GTZ A;  5HXU A;  5IJ9 B;  2VGM A;  2CWJ A;  5CA0 B;  3JAR B;  2ZAU A;  3R0P A;  4X1I A;  3LWP C;  3F0E A;  1SA0 A;  2CVL A;  3N2K A;  4X3M A;  1W57 A;  4NWO B;  1U3L A;  3I56 F;  2AIZ P;  4EI9 A;  5CA1 A;  2CSL A;  4EB6 A;  5BMV B;  3L7Q A;  4E6E A;  1QVG F;  5CA1 B;  4C8G A;  4X20 A;  1VQP F;  2KGW A;  3HKE A;  3CCL F;  3HKD A;  2AIF A;  2BTQ B;  3FD6 A;  3FPI A;  2OTJ F;  2CZW A;  1GO0 A;  4DXD A;  3K0T A;  1VQL F;  2FC3 A;  3JVH A;  3P0Z A;  2HP3 A;  2UYN A;  3CC4 F;  4B62 A;  4I50 B;  3S0H A;  3VTI C;  4ZHQ A;  3FBA A;  3LWV C;  5DCV A;  3HKB A;  3HWU A;  4RQO A;  2HP0 B;  3NK6 A;  2JNB A;  3T80 A;  2LBW A;  3HKB B;  3DC2 A;  1VK3 A;  1H47 A;  3HTN A;  1UFY A;  3RYH A;  1XBI A;  3E22 A;  1NMU B;  4O2B B;  1OFU A;  3QTY A;  4O4I A;  4ZOL B;  3RYC B;  4YJ2 A;  1RA4 A;  5G4V C;  4ZHV A;  3CCS F;  1DT9 A;  3Q8H A;  3C9U A;  3N4Z A;  3OBY A;  2KG4 A;  3WJQ A;  3MCA B;  3OBW A;  3J81 M;  5LP6 B;  3WGM A;  3WJP A;  4NUT A;  3CYQ A;  4YJ3 B;  3LWO C;  2IG8 A;  1VQM F;  5GAN K;  2P6Y A;  3QUW A;  3MQW A;  4DRX B;  1TUB B;  3JAL A;  5HP8 A;  3N2G A;  2ZOV A;  1VQN F;  2ZOD A;  5EB1 B;  1N8R H;  4NQ3 A;  1COM A;  1VQV A;  2YYE A;  5MN5 A;  5EIB C;  3FFM A;  3JAW B;  4HNA A;  1ONI A;  1JFF B;  2LBX A;  3VCZ A;  5G4U C;  2ALE A;  3AGK A;  1X7P A;  3C9S A;  4IIJ A;  1QD9 A;  2IQQ A;  5LA6 A;  5LYJ B;  2BTU A;  5HP7 A;  4ERH A;  5LA6 B;  4U3J B;  2VAW A;  1DBF A;  1VH8 A;  1W5B A;  1XV2 A;  3CG6 A;  3M1X A;  4C82 A;  5LXT A;  2H8E A;  3F0D A;  1KQS F;  4M8I A;  2QI2 A;  1TVK A;  2HS0 A;  1Q86 H;  4X1K B;  4G4Y A;  3RE3 A;  3VIU A;  3ON1 A;  5A2Q M;  5FLX M;  4EI7 A;  4ZHY B;  5C8Y B;  3LYB A;  3BYQ A;  1Q7Y H;  1GZ0 A;  2Q1X A;  1FNJ A;  5IYZ B;  4LNU A;  3P4E A;  1QU9 A;  5EIB D;  4F6R A;  3CC7 F;  3RYF B;  1RLG A;  5LOV A;  1M90 H;  3D00 A;  3WPW A;  5LP6 C;  3WGL A;  1FFX A;  4R40 B;  4O4J B;  2B33 A;  5IJ0 A;  1FSZ A;  4KWE A;  5GIO C;  3F6M A;  3IEQ A;  3J7A R;  5EZY A;  3JAK B;  1GX1 A;  2NMU A;  1YHQ F;  4O4L A;  4IHJ A;  1OAP A;  3CPW F;  3VMF B;  2RHL A;  1RQ7 A;  2HS3 A;  1W41 A;  4IHJ B;  1KD1 H;  4BT3 A;  1IV1 A;  3K14 A;  1FNK A;  4RHA A;  3I3F A;  3VO8 A;  4X1I B;  1KNK A;  2UYJ A;  5FNV A;  5JVD A;  1IV4 A;  2OTL F;  1JN1 A;  1SA0 B;  3N2K B;  4G4W A;  1CK2 A;  4BW0 B;  5GIN C;  3CXC F;  3P10 A;  4EB6 B;  2YXZ A;  1QVF F;  3PAF A;  3K12 A;  1E7K A;  2RHH A;  3C8L A;  4X20 B;  3HKE B;  5EWR A;  4ZK7 A;  2HRU A;  2Z01 A;  4BT4 A;  3HKD B;  3CCQ F;  1YIT F;  2PMP A;  5IT9 M;  4I4T A;  1T0K B;  3GYQ A;  2UYN B;  2I6D A;  5HY1 A;  2AMT A;  1YQN A;  3M4S A;  3WGN A;  4ZHQ B;  3VYT C;  3CCE F;  5B8F A;  3HKC A;  2OZB A;  5EYP A;  3C9T A;  4TUY A;  3TD4 A;  4C8I A;  3OW2 F;  3S03 A;  3D54 A;  3LFO A;  3ZP7 A;  3RYH B;  3E22 B;  3CC2 F;  3UT5 A;  1JY8 A;  3JAM M;  4O4I B;  4X1Y A;  2N48 A;  1K8A H;  4YJ2 B;  3C9R A;  5KMG A;  5JH7 A;  5CB4 A;  3ZP4 A;  3CYP B;  4BY9 D;  3M84 A;  4BT7 A;  2HQS C;  5CB4 B;  1YJW F;  3QHD A;  3F0F A;  3VYS C;  1YIJ F;  1R1M A;  4G4V A;  4LCK A;  2UYK A;  3WJR A;  1X7O A;  3EOR A;  3NVI B;  5ITZ A;  2RB9 A;  3FD5 A;  3OON A;  3VOA A;  1X25 A;  1GO1 A;  3IEW A;  3I55 F;  3JAL B;  3KHN A;  3N2G B;  3JAS A;  4WBN A;  5EO3 A;  4EI8 A;  1S72 F;  4C81 A;  3JAS B;  1U3P A;  1XRG A;  1VQ7 F;  1VQ8 F;  1W5A A;  4HNA B;  3RA6 A;  2HRY A;  3CB2 A;  5EAZ A;  4O2A A;  3ERN A;  5MN4 A;  4TV9 A;  1YI2 F;  1CLI A;  4IIJ B;  5JQG A;  5FJ4 C;  1IPA A;  2MQE A;  2HVY D;  1K73 H;  1W2B F;  5LXT B;  5HY0 A;  2FGY A;  2UZH A;  3CCM F;  1TVK B;  5GON A;  1W55 A;  1U40 A;  3SIU A;  2LBT A;  4U39 A;  5J2U A;  2VGN A;  3RYI A;  4I55 A;  5J2U B;  4LNU B;  2LCA A;  4TV8 A;  4F6R B;  5HY4 A;  3WXM B;  2OHW A;  5LOV B;  2H6L A;  3IR9 A;  3ZO8 A;  1YGY A;  3LDT A;  4B46 A;  2HX0 A;  4BVS A;  2H8C A;  2IAF A;  3U0O A;  3CMA F;  2BTO A;  3LME A;  1FFX B;  2DT4 A;  2R75 1;  5EB0 A;  5IJ0 B;  3E20 B;  1U43 A;  2V9Y A;  4FFB A;  3KJJ A;  2G9I A;  2HS4 A; 
#chains in the Genus database with same CATH homology
 2KG4 A;  1T0K B;  3MCA B;  3J81 M;  3GYQ A;  3OBW A;  2I6D A;  3LWR C;  3N4Y A;  4NUT A;  5HY1 A;  5HWE A;  3CCE F;  4BVT A;  2OZB A;  3LWO C;  1VQM F;  5GAN K;  3CCJ F;  3OW2 F;  3RA5 A;  1VQN F;  3CME F;  3NMU C;  1N8R H;  3LFO A;  3NVK E;  3HAX D;  4NQ3 A;  1H7M A;  3CC2 F;  3JAM M;  3FFM A;  1K8A H;  3VI6 A;  4C4W C;  3G71 F;  3V3T A;  2LBX A;  5GIP C;  3J80 M;  2QA4 F;  4BY9 D;  1VQ6 F;  3O85 A;  4BVR A;  2ALE A;  3AGK A;  1NJI H;  2GLZ A;  5HY2 A;  1X7P A;  1JJ2 F;  5G4U C;  1YJW F;  3HJW C;  2F9Z C;  1W42 A;  1YIJ F;  4LCK A;  5GAP K;  3E1Y A;  1X7O A;  3CG6 A;  3CPQ A;  3CCU F;  4BVQ A;  1KC8 H;  1KQS F;  3NVI B;  4TZZ A;  2QI2 A;  1GO1 A;  1K9M H;  3I55 F;  2WAL A;  3V7Q A;  1Q86 H;  3CD6 F;  3PLA C;  5HXU A;  2VGM A;  5EO3 A;  1M1K H;  4EI8 A;  1S72 F;  3ON1 A;  5A2Q M;  2QEX F;  5FLX M;  4EI7 A;  1Q81 H;  5HXZ A;  3LWP C;  1GZ0 A;  1Q7Y H;  1VQ7 F;  1VQ8 F;  3CC7 F;  4X3M A;  3RA6 A;  3I56 F;  1RLG A;  1M90 H;  3D00 A;  4EI9 A;  4X3L A;  3CCV F;  3NK7 A;  1QVG F;  1YI2 F;  5FJ4 C;  1X52 A;  1IPA A;  1YJN F;  2HVY D;  1YJ9 F;  1VQP F;  3SIV A;  5GIO C;  3CCL F;  2AIF A;  3J7A R;  2KTV A;  1W2B F;  2CZW A;  1K73 H;  5HY0 A;  2FGY A;  1VQK F;  1VQL F;  2OTJ F;  1GO0 A;  2FC3 A;  4XCQ A;  1YHQ F;  3G6E F;  3CCM F;  3CC4 F;  3CPW F;  3VMF B;  3LWV C;  3G4S F;  3SIU A;  5DCV A;  1W41 A;  1KD1 H;  2VGN A;  1W40 A;  2BO1 A;  3NK6 A;  2JNB A;  1Q82 H;  1CN7 A;  2LBW A;  2OTL F;  3LWQ C;  2KTU A;  1CK2 A;  5HY4 A;  1ZWZ A;  4BW0 B;  1XBI A;  3WXM B;  2OHW A;  3CCR F;  1NMU B;  1PXW A;  3IR9 A;  5GIN C;  3V7E A;  3CXC F;  1W3E X;  4BVS A;  1QVF F;  3PAF A;  1RA4 A;  1VQ5 F;  1SDS A;  5G4V C;  1E7K A;  3CMA F;  1VQ4 F;  3CCS F;  1DT9 A;  3N4Z A;  3OBY A;  5EWR A;  3E20 B;  3JCM M;  1VQO F;  3CCQ F;  1YIT F;  1VQ9 F;  5IT9 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...