3VI6A

Crystal structure of human ribosomal protein l30e
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S ribosomal protein L30
publication title Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3vi6A00
2I6DA 2QI2A 1K73H 3CMEF 1VQMF 3CCUF 3PLAC 5DCVA 2OZBA 3JCMM 4TZZA 2OTJF 1KC8H 3CCEF 5GIOC 1VQ4F 5FLXM 2AIFA 2LBWA 4BY9D 3HJWC 5GANK 3LWQC 3I55F 3OW2F 1QVGF 4BW0B 1VQNF 3G4SF 3WXMB 4C4WC 1ZWZA 3N4YA 1S72F 4LCKA 3CCLF 3HAXD 3CC2F 3NVKE 2CZWA 1Q81H 4X3LA 2KTVA 2VGNA 1QVFF 1VQPF 2OTLF 3IR9A 1KD1H 3CCQF 3J80M 5FJ4C 1K9MH 3JAMM 1YHQF 2WALA 1IPAA 1X7OA 1RLGA 3LWPC 3CCJF 1SDSA 5GINC 2OHWA 1YJWF 1DT9A 3NK6A 1CK2A 2KG4A 2QEXF 2HVYD 5G4VC 1VQ7F 3CC4F 3RA6A 1KQSF 1RA4A 1W2BF 1XBIA 1GO0A 5EWRA 1M1KH 1M90H 3E1YA 1YI2F 1VQOF 3J81M 1VQKF 3NVIB 1N8RH 1GZ0A 1VQLF 3I56F 1W3EX 3LWRC 1GO1A 2LBXA 3LFOA 4NUTA 1CN7A 3FFMA 1NJIH 3CCSF 3CPQA 3MCAB 3G6EF 1VQ9F 2QA4F 5IT9M 3VMFB 2ALEA 3PAFA 3ON1A 2KTUA 3CPWF 2JNBA 1Q82H 1Q86H 3NMUC 3AGKA 1VQ8F 1W40A 1Q7YH 1YJNF 3OBWA 1W41A 3N4ZA 3CCRF 1PXWA 5A2QM 1YITF 3CCMF 1X7PA 3CD6F 3GYQA 3CC7F 1W42A 3VI6A 5GIPC 3CCVF 3G71F 1VQ5F 3OBYA 3CMAF 3LWVC 3E20B 1T0KB 1VQ6F 2FC3A 1H7MA 1YIJF 1E7KA 2BO1A 3CG6A 3NK7A 1YJ9F 1X52A 2VGMA 3LWOC 5G4UC 1K8AH 5EO3A 3V7QA 3CXCF 3V7EA 3RA5A 5GAPK 3SIUA 3SIVA 4X3MA 1NMUB 3J7AR 3O85A 1JJ2F
chains in the Genus database with same CATH superfamily
1UFYA 4O4LB 2L26A 1K73H 1VQMF 3CCUF 3PLAC 5GONA 1OFUA 2OZBA 3MDOA 1FFXB 3JCMM 2UYNA 5LOVA 2CHTA 5CA0B 3CCEF 3HKCB 5LP6B 4BY9D 3HJWC 3LWQC 2IAFA 3G4SF 4X1KB 4C4WC 1ZWZA 4LCKA 1TUBB 2RHLA 5ITZB 3JATA 3VO8A 3TD5A 1UI9A 5EB1B 2ZODA 2VGNA 5JCOA 2GLZA 3ELCA 4X1IB 3CCQF 3JAMM 1IPAA 1X7OA 3JAWB 3VCZA 4I50B 3LWPC 2UYPA 2KG4A 2PMPA 5HP8A 1RQ2A 3HKEB 3RA6A 5BMVB 1W2BF 3M84A 4O4HA 1GO0A 5EWRA 1W5FA 4BT5A 4FFBA 3VOBA 5IJ0B 3MCQA 4TUYB 4G4WA 3HKDA 3J81M 1N8RH 2CW4A 1RLUA 3I56F 1W3EX 4NQ3A 3LWRC 3TD4A 3KHNA 4EI9A 5LYJA 4ZHQB 3IEWA 3CCSF 2HQSC 4EI7A 4ZI7A 1NQ3A 3CYQA 1FSZA 2ALEA 2UZHA 4O2AA 2CVLA 1U3LA 3ZP7A 3K2XA 3NMUC 4E6EA 1SA0B 3WJPA 5IJ9B 3CCMF 1X7PA 4O4IA 3CC7F 4KWEA 2OTMA 5LXTB 1VQ5F 4I55B 3OBYA 4O4JA 1Z5VA 5JVDB 3JVHA 4LNUA 1VQ6F 1TVKA 3VTIC 1YJ9F 3NK7A 1X52A 5J2TA 5G4UC 3WGLA 3V7EA 5LA6A 1Z5WA 2ZVYA 5FNVB 2LBTA 3C9SA 5CA1B 3SIUA 3GHZA 1NMUB 5C8YA 3P4EA 2Q1XA 1T0KB 1DBFA 3E22A 2HP0B 4B62A 1VHAA 3JAKB 5HXZA 4BVTA 2F9ZC 4IIJB 5DCVA 3JARA 4F6RB 3N2KA 2IQQA 1W5EA 5J2UA 1CLIA 4TZZA 1KC8H 3S06A 3ESJA 1VQ4F 2AIFA 2LBWA 1R1MA 5EAZA 4YJ3A 3I55F 1QVGF 3U0OA 4BVQA 3WPXA 4ERHA 1VQNF 5EZYB 4EB6A 3IEQA 2H8EA 4YJ2B 3UT5B 3N4YA 3JASA 3VIUA 3WXMB 3RYCA 3CCLF 3NVKE 2CZWA 1JY8A 1FNKA 4X3LA 1YQNA 2NMUA 1IV4A 1QVFF 3S02A 5HY2A 5FJ4C 5KMGA 4U3JB 1GX1A 1QD9A 1RLGA 1T0AA 4TV9A 3FPIA 5AVMA 4WBNA 3WGKA 2OHWA 1DT9A 5HY4A 4DXDA 1CK2A 5KX5B 5JH7A 2B33A 2QEXF 5G4VC 3CC4F 5CB4B 1KNKA 4O2BA 3I3FA 5EIBD 1M1KH 3CB2A 1IV1A 3RYHB 4ZOLB 1KNJA 2G9IA 2W8BC 3TD3A 5IYZA 2UYKA 1GZ0A 3HKBB 4RHAA 1VQLF 2CWJA 3Q8HA 3FD6A 3RYFA 1Q8RA 4IHJA 3LMEA 5EYPA 1RQ7A 2CHSA 3WGJA 3ON1A 4DRXA 2KTUA 4X20B 2JNBA 3N2GA 4HNAA 2BTOA 1Q82H 3C8LA 4X1YA 1Q86H 3QTYA 3AGKA 1W40A 1W5AA 1ONIA 1W41A 3N4ZA 2ZF8A 2GZLA 2N48A 3WGMA 3T80A 1YITF 3VYUC 5EB0A 3FBAA 3S0WA 3EORA 3JALA 3VI6A 3ERNA 5GIPC 4ZHVA 3G71F 3CCVF 1FNJA 3ZO8A 3LWVC 1JFFB 3E22B 5JQGB 1H7MA 3RYIB 2BO1A 3WJRA 3BYQA 5HY0A 4I4TB 5EO3A 4O4LA 2DT4A 3FD5A 3C9UA 3J7AR 2Z1EA 1FFXA 3B6NA 2I6DA 3K14A 5CA0A 3HKCA 4ZHWA 1QU9A 2VAWA 2HS4A 2HP3A 2Z1UA 2V9YA 4X1KA 1W59A 2OTJF 2HRYA 1TUBA 5ITZA 4G4ZA 5FLXM 3OW2F 1PF5A 5GONB 4BW0B 4BVRA 4X1IA 5HXUA 4BT4A 5LOVB 2UYNB 2RHHA 2QTPA 1S72F 2Z01A 4PWTA 3JAWA 4I50A 1Q81H 5MN5A 3ZP4A 4U39A 1VQPF 2OTLF 3WPWA 1KD1H 4G4YA 4B46A 2HS3A 4BVSA 1YHQF 3IKFA 3HKEA 3JATB 5BMVA 3HTNA 3P10A 3CCJF 1U43A 2BTUA 5GINC 5IJ0A 3F0GA 1JJ2F 1YJWF 3NK6A 3KE1A 2RHJA 2HVYD 1XV2A 1VQ7F 1XBIA 1JN1A 2R751 4ZHYB 3M4SA 2RB9A 1X25A 1VQKF 3WJQA 3GTZA 2DYYA 4O4HB 2YYEA 1GO1A 1SZQA 2HX0A 2LBXA 4NUTA 4FFBB 1J7HA 3HKDB 1XHOA 1NJIH 4TV8A 3MCAB 3G6EF 5IT9M 3VMFB 5EIBC 1SA0A 2I6RA 3PAFA 5IJ9A 1VH8A 5LYJB 2VAPA 2IG8A 3QUWA 5LXTA 4ZI7B 1VQVA 2PHNA 4I55A 2CSLA 3KIZA 5JVDA 1VQ8F 3OBWA 5MN4A 2ZAUA 4C8EA 4O2AB 4B5CA 3CCRF 5A2QM 3GYQA 4R40B 3DC2A 1W581 5B8FA 3L7QA 2H8CA 5LP6C 3E20B 5HWEA 4BT3A 2FC3A 5FNVA 1YIJF 5CA1A 3CG6A 3KJJA 2VGMA 4O4IB 4RQOA 3C9RA 1K8AH 3I7TA 2HS0A 4O4JB 2HRUA 2HP0A 1ODEA 4LNUB 1TVKB 4B45A 3JAKA 5GAPK 2GVIA 3SIVA 4IIJA 5J2TB 4C8GA 4F6RA 2Z1FA 3CYPB 3O85A 1IV3A 3F6MA 5LA6B 3IKEA 2QI2A 3V3TA 3HWUA 3CMEF 2ZVZA 5C8YB 5EZYA 4YJ2A 3UT5A 1JD1A 1U40A 2MQEA 3MQWA 5GIOC 4BT7A 5GANK 3JARB 3N2KB 3MBMA 1QAHA 5J2UB 3M1XA 1YGYA 2AMTA 2YXZA 2Q1YA 4G88A 4U3JA 2LCAA 3CC2F 3F0EA 4G4XA 3HAXD 4G4VA 3ZOPA 2KTVA 2VAMA 4YJ3B 2AIZP 1W5BA 2P6YA 3LYBA 4EB6B 3IR9A 2K1SA 3J80M 1COMA 1K9MH 3JASB 5KX5A 3RYCB 3P0ZA 2WALA 3OONA 3S0HA 5LP6A 5CB4A 1SDSA 3LDTA 3RYHA 4ZOLA 1U3PA 2Z1TA 5KMGB 1OAPA 3HKBA 1KQSF 1RA4A 4TV8B 4TV9B 1XRGA 4WBNB 1H47A 4C81A 1M90H 3E1YA 1H48A 2RHOA 1YI2F 1VQOF 2H6LA 1W57A 5JH7B 3NVIB 5HP7A 4O2BB 3LFOA 1CN7A 1W55A 3FFMA 4X20A 4BT2A 3S03A 2EWCA 3K0TA 3CPQA 3D54A 5IYZB 1VQ9F 2QA4F 3VOAA 4TUYA 3RYFB 3WGNA 4IHJB 5EYPB 3F0FA 3CPWF 3VYSC 5MN6A 2R6R1 3D01A 3D00A 1Q7YH 4XCQA 1YJNF 1JFFA 4ZHQA 2KGWA 5JQGA 2VXYA 1PXWA 4DRXB 3RYIA 5JCOC 5HY1A 3CD6F 3N2GB 4HNAB 3K12A 1W42A 4X1YB 3DDNA 1IV2A 4I4TA 2UYJA 3RE3A 3CMAF 3F0DA 4EI8A 2FGYA 4NWOB 4C8IA 1E7KA 2BTQB 3LWOC 4ZK7A 1VK3A 3JALB 4BT6A 3V7QA 3CXCF 3IMPA 3R0PA 3RA5A 3S0YA 2ZOVA 3V4DA 3KJKA 4M8IA 4X3MA 3VYTC 3QHDA 3C9TA 4C82A
chains in the Genus database with same CATH topology
2I6DA 2QI2A 3V3TA 1K73H 3CMEF 5HXZA 4BVTA 1VQMF 2F9ZC 3CCUF 3PLAC 5DCVA 2OZBA 3JCMM 4TZZA 2OTJF 1KC8H 3CCEF 5GIOC 1VQ4F 5FLXM 2AIFA 2LBWA 4BY9D 3HJWC 5GANK 3LWQC 3I55F 3OW2F 1QVGF 4BW0B 4BVQA 4BVRA 1VQNF 5HXUA 3G4SF 3WXMB 4C4WC 1ZWZA 3N4YA 1S72F 4LCKA 3CCLF 3HAXD 3CC2F 3NVKE 2CZWA 1Q81H 4X3LA 2KTVA 2VGNA 1QVFF 2GLZA 1VQPF 2OTLF 3IR9A 1KD1H 5HY2A 3CCQF 3J80M 5FJ4C 1K9MH 3JAMM 4BVSA 1YHQF 2WALA 1IPAA 1X7OA 1RLGA 3LWPC 3CCJF 1SDSA 5GINC 2OHWA 1YJWF 1DT9A 3NK6A 5HY4A 1CK2A 2KG4A 2QEXF 2HVYD 5G4VC 1VQ7F 3CC4F 3RA6A 1KQSF 1RA4A 1W2BF 1XBIA 1GO0A 5EWRA 1M1KH 1M90H 3E1YA 1YI2F 1VQOF 3J81M 1VQKF 3NVIB 1N8RH 1GZ0A 1VQLF 3I56F 1W3EX 4NQ3A 3LWRC 1GO1A 2LBXA 3LFOA 4NUTA 4EI9A 1CN7A 3FFMA 1NJIH 3CCSF 3CPQA 3MCAB 4EI7A 3G6EF 1VQ9F 2QA4F 5IT9M 3VMFB 2ALEA 3PAFA 3ON1A 2KTUA 3CPWF 2JNBA 1Q82H 1Q86H 3NMUC 3D00A 3AGKA 1VQ8F 1W40A 1Q7YH 4XCQA 1YJNF 3OBWA 1W41A 3N4ZA 3CCRF 1PXWA 5A2QM 1YITF 3CCMF 1X7PA 5HY1A 3CD6F 3GYQA 3CC7F 1W42A 3VI6A 5GIPC 3CCVF 3G71F 1VQ5F 3OBYA 3CMAF 4EI8A 3LWVC 3E20B 5HWEA 1T0KB 1VQ6F 2FC3A 1H7MA 2FGYA 1YIJF 1E7KA 2BO1A 3CG6A 3NK7A 1YJ9F 1X52A 2VGMA 3LWOC 5G4UC 5HY0A 1K8AH 5EO3A 3V7QA 3CXCF 3V7EA 3RA5A 5GAPK 3SIUA 3SIVA 4X3MA 1NMUB 3J7AR 3O85A 1JJ2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  2QI2 A;  1K73 H;  3CME F;  1VQM F;  3CCU F;  3PLA C;  5DCV A;  2OZB A;  3JCM M;  4TZZ A;  2OTJ F;  1KC8 H;  3CCE F;  5GIO C;  1VQ4 F;  5FLX M;  2AIF A;  2LBW A;  4BY9 D;  3HJW C;  5GAN K;  3LWQ C;  3I55 F;  3OW2 F;  1QVG F;  4BW0 B;  1VQN F;  3G4S F;  3WXM B;  4C4W C;  1ZWZ A;  3N4Y A;  1S72 F;  4LCK A;  3CCL F;  3HAX D;  3CC2 F;  3NVK E;  2CZW A;  1Q81 H;  4X3L A;  2KTV A;  2VGN A;  1QVF F;  1VQP F;  2OTL F;  3IR9 A;  1KD1 H;  3CCQ F;  3J80 M;  5FJ4 C;  1K9M H;  3JAM M;  1YHQ F;  2WAL A;  1IPA A;  1X7O A;  1RLG A;  3LWP C;  3CCJ F;  1SDS A;  5GIN C;  2OHW A;  1YJW F;  1DT9 A;  3NK6 A;  1CK2 A;  2KG4 A;  2QEX F;  2HVY D;  5G4V C;  1VQ7 F;  3CC4 F;  3RA6 A;  1KQS F;  1RA4 A;  1W2B F;  1XBI A;  1GO0 A;  5EWR A;  1M1K H;  1M90 H;  3E1Y A;  1YI2 F;  1VQO F;  3J81 M;  1VQK F;  3NVI B;  1N8R H;  1GZ0 A;  1VQL F;  3I56 F;  1W3E X;  3LWR C;  1GO1 A;  2LBX A;  3LFO A;  4NUT A;  1CN7 A;  3FFM A;  1NJI H;  3CCS F;  3CPQ A;  3MCA B;  3G6E F;  1VQ9 F;  2QA4 F;  5IT9 M;  3VMF B;  2ALE A;  3PAF A;  3ON1 A;  2KTU A;  3CPW F;  2JNB A;  1Q82 H;  1Q86 H;  3NMU C;  3AGK A;  1VQ8 F;  1W40 A;  1Q7Y H;  1YJN F;  3OBW A;  1W41 A;  3N4Z A;  3CCR F;  1PXW A;  5A2Q M;  1YIT F;  3CCM F;  1X7P A;  3CD6 F;  3GYQ A;  3CC7 F;  1W42 A;  3VI6 A;  5GIP C;  3CCV F;  3G71 F;  1VQ5 F;  3OBY A;  3CMA F;  3LWV C;  3E20 B;  1T0K B;  1VQ6 F;  2FC3 A;  1H7M A;  1YIJ F;  1E7K A;  2BO1 A;  3CG6 A;  3NK7 A;  1YJ9 F;  1X52 A;  2VGM A;  3LWO C;  5G4U C;  1K8A H;  5EO3 A;  3V7Q A;  3CXC F;  3V7E A;  3RA5 A;  5GAP K;  3SIU A;  3SIV A;  4X3M A;  1NMU B;  3J7A R;  3O85 A;  1JJ2 F; 
#chains in the Genus database with same CATH topology
 1UFY A;  4O4L B;  2L26 A;  1K73 H;  1VQM F;  3CCU F;  3PLA C;  5GON A;  1OFU A;  2OZB A;  3MDO A;  1FFX B;  3JCM M;  2UYN A;  5LOV A;  2CHT A;  5CA0 B;  3CCE F;  3HKC B;  5LP6 B;  4BY9 D;  3HJW C;  3LWQ C;  2IAF A;  3G4S F;  4X1K B;  4C4W C;  1ZWZ A;  4LCK A;  1TUB B;  2RHL A;  5ITZ B;  3JAT A;  3VO8 A;  3TD5 A;  1UI9 A;  5EB1 B;  2ZOD A;  2VGN A;  5JCO A;  2GLZ A;  3ELC A;  4X1I B;  3CCQ F;  3JAM M;  1IPA A;  1X7O A;  3JAW B;  3VCZ A;  4I50 B;  3LWP C;  2UYP A;  2KG4 A;  2PMP A;  5HP8 A;  1RQ2 A;  3HKE B;  3RA6 A;  5BMV B;  1W2B F;  3M84 A;  4O4H A;  1GO0 A;  5EWR A;  1W5F A;  4BT5 A;  4FFB A;  3VOB A;  5IJ0 B;  3MCQ A;  4TUY B;  4G4W A;  3HKD A;  3J81 M;  1N8R H;  2CW4 A;  1RLU A;  3I56 F;  1W3E X;  4NQ3 A;  3LWR C;  3TD4 A;  3KHN A;  4EI9 A;  5LYJ A;  4ZHQ B;  3IEW A;  3CCS F;  2HQS C;  4EI7 A;  4ZI7 A;  1NQ3 A;  3CYQ A;  1FSZ A;  2ALE A;  2UZH A;  4O2A A;  2CVL A;  1U3L A;  3ZP7 A;  3K2X A;  3NMU C;  4E6E A;  1SA0 B;  3WJP A;  5IJ9 B;  3CCM F;  1X7P A;  4O4I A;  3CC7 F;  4KWE A;  2OTM A;  5LXT B;  1VQ5 F;  4I55 B;  3OBY A;  4O4J A;  1Z5V A;  5JVD B;  3JVH A;  4LNU A;  1VQ6 F;  1TVK A;  3VTI C;  1YJ9 F;  3NK7 A;  1X52 A;  5J2T A;  5G4U C;  3WGL A;  3V7E A;  5LA6 A;  1Z5W A;  2ZVY A;  5FNV B;  2LBT A;  3C9S A;  5CA1 B;  3SIU A;  3GHZ A;  1NMU B;  5C8Y A;  3P4E A;  2Q1X A;  1T0K B;  1DBF A;  3E22 A;  2HP0 B;  4B62 A;  1VHA A;  3JAK B;  5HXZ A;  4BVT A;  2F9Z C;  4IIJ B;  5DCV A;  3JAR A;  4F6R B;  3N2K A;  2IQQ A;  1W5E A;  5J2U A;  1CLI A;  4TZZ A;  1KC8 H;  3S06 A;  3ESJ A;  1VQ4 F;  2AIF A;  2LBW A;  1R1M A;  5EAZ A;  4YJ3 A;  3I55 F;  1QVG F;  3U0O A;  4BVQ A;  3WPX A;  4ERH A;  1VQN F;  5EZY B;  4EB6 A;  3IEQ A;  2H8E A;  4YJ2 B;  3UT5 B;  3N4Y A;  3JAS A;  3VIU A;  3WXM B;  3RYC A;  3CCL F;  3NVK E;  2CZW A;  1JY8 A;  1FNK A;  4X3L A;  1YQN A;  2NMU A;  1IV4 A;  1QVF F;  3S02 A;  5HY2 A;  5FJ4 C;  5KMG A;  4U3J B;  1GX1 A;  1QD9 A;  1RLG A;  1T0A A;  4TV9 A;  3FPI A;  5AVM A;  4WBN A;  3WGK A;  2OHW A;  1DT9 A;  5HY4 A;  4DXD A;  1CK2 A;  5KX5 B;  5JH7 A;  2B33 A;  2QEX F;  5G4V C;  3CC4 F;  5CB4 B;  1KNK A;  4O2B A;  3I3F A;  5EIB D;  1M1K H;  3CB2 A;  1IV1 A;  3RYH B;  4ZOL B;  1KNJ A;  2G9I A;  2W8B C;  3TD3 A;  5IYZ A;  2UYK A;  1GZ0 A;  3HKB B;  4RHA A;  1VQL F;  2CWJ A;  3Q8H A;  3FD6 A;  3RYF A;  1Q8R A;  4IHJ A;  3LME A;  5EYP A;  1RQ7 A;  2CHS A;  3WGJ A;  3ON1 A;  4DRX A;  2KTU A;  4X20 B;  2JNB A;  3N2G A;  4HNA A;  2BTO A;  1Q82 H;  3C8L A;  4X1Y A;  1Q86 H;  3QTY A;  3AGK A;  1W40 A;  1W5A A;  1ONI A;  1W41 A;  3N4Z A;  2ZF8 A;  2GZL A;  2N48 A;  3WGM A;  3T80 A;  1YIT F;  3VYU C;  5EB0 A;  3FBA A;  3S0W A;  3EOR A;  3JAL A;  3VI6 A;  3ERN A;  5GIP C;  4ZHV A;  3G71 F;  3CCV F;  1FNJ A;  3ZO8 A;  3LWV C;  1JFF B;  3E22 B;  5JQG B;  1H7M A;  3RYI B;  2BO1 A;  3WJR A;  3BYQ A;  5HY0 A;  4I4T B;  5EO3 A;  4O4L A;  2DT4 A;  3FD5 A;  3C9U A;  3J7A R;  2Z1E A;  1FFX A;  3B6N A;  2I6D A;  3K14 A;  5CA0 A;  3HKC A;  4ZHW A;  1QU9 A;  2VAW A;  2HS4 A;  2HP3 A;  2Z1U A;  2V9Y A;  4X1K A;  1W59 A;  2OTJ F;  2HRY A;  1TUB A;  5ITZ A;  4G4Z A;  5FLX M;  3OW2 F;  1PF5 A;  5GON B;  4BW0 B;  4BVR A;  4X1I A;  5HXU A;  4BT4 A;  5LOV B;  2UYN B;  2RHH A;  2QTP A;  1S72 F;  2Z01 A;  4PWT A;  3JAW A;  4I50 A;  1Q81 H;  5MN5 A;  3ZP4 A;  4U39 A;  1VQP F;  2OTL F;  3WPW A;  1KD1 H;  4G4Y A;  4B46 A;  2HS3 A;  4BVS A;  1YHQ F;  3IKF A;  3HKE A;  3JAT B;  5BMV A;  3HTN A;  3P10 A;  3CCJ F;  1U43 A;  2BTU A;  5GIN C;  5IJ0 A;  3F0G A;  1JJ2 F;  1YJW F;  3NK6 A;  3KE1 A;  2RHJ A;  2HVY D;  1XV2 A;  1VQ7 F;  1XBI A;  1JN1 A;  2R75 1;  4ZHY B;  3M4S A;  2RB9 A;  1X25 A;  1VQK F;  3WJQ A;  3GTZ A;  2DYY A;  4O4H B;  2YYE A;  1GO1 A;  1SZQ A;  2HX0 A;  2LBX A;  4NUT A;  4FFB B;  1J7H A;  3HKD B;  1XHO A;  1NJI H;  4TV8 A;  3MCA B;  3G6E F;  5IT9 M;  3VMF B;  5EIB C;  1SA0 A;  2I6R A;  3PAF A;  5IJ9 A;  1VH8 A;  5LYJ B;  2VAP A;  2IG8 A;  3QUW A;  5LXT A;  4ZI7 B;  1VQV A;  2PHN A;  4I55 A;  2CSL A;  3KIZ A;  5JVD A;  1VQ8 F;  3OBW A;  5MN4 A;  2ZAU A;  4C8E A;  4O2A B;  4B5C A;  3CCR F;  5A2Q M;  3GYQ A;  4R40 B;  3DC2 A;  1W58 1;  5B8F A;  3L7Q A;  2H8C A;  5LP6 C;  3E20 B;  5HWE A;  4BT3 A;  2FC3 A;  5FNV A;  1YIJ F;  5CA1 A;  3CG6 A;  3KJJ A;  2VGM A;  4O4I B;  4RQO A;  3C9R A;  1K8A H;  3I7T A;  2HS0 A;  4O4J B;  2HRU A;  2HP0 A;  1ODE A;  4LNU B;  1TVK B;  4B45 A;  3JAK A;  5GAP K;  2GVI A;  3SIV A;  4IIJ A;  5J2T B;  4C8G A;  4F6R A;  2Z1F A;  3CYP B;  3O85 A;  1IV3 A;  3F6M A;  5LA6 B;  3IKE A;  2QI2 A;  3V3T A;  3HWU A;  3CME F;  2ZVZ A;  5C8Y B;  5EZY A;  4YJ2 A;  3UT5 A;  1JD1 A;  1U40 A;  2MQE A;  3MQW A;  5GIO C;  4BT7 A;  5GAN K;  3JAR B;  3N2K B;  3MBM A;  1QAH A;  5J2U B;  3M1X A;  1YGY A;  2AMT A;  2YXZ A;  2Q1Y A;  4G88 A;  4U3J A;  2LCA A;  3CC2 F;  3F0E A;  4G4X A;  3HAX D;  4G4V A;  3ZOP A;  2KTV A;  2VAM A;  4YJ3 B;  2AIZ P;  1W5B A;  2P6Y A;  3LYB A;  4EB6 B;  3IR9 A;  2K1S A;  3J80 M;  1COM A;  1K9M H;  3JAS B;  5KX5 A;  3RYC B;  3P0Z A;  2WAL A;  3OON A;  3S0H A;  5LP6 A;  5CB4 A;  1SDS A;  3LDT A;  3RYH A;  4ZOL A;  1U3P A;  2Z1T A;  5KMG B;  1OAP A;  3HKB A;  1KQS F;  1RA4 A;  4TV8 B;  4TV9 B;  1XRG A;  4WBN B;  1H47 A;  4C81 A;  1M90 H;  3E1Y A;  1H48 A;  2RHO A;  1YI2 F;  1VQO F;  2H6L A;  1W57 A;  5JH7 B;  3NVI B;  5HP7 A;  4O2B B;  3LFO A;  1CN7 A;  1W55 A;  3FFM A;  4X20 A;  4BT2 A;  3S03 A;  2EWC A;  3K0T A;  3CPQ A;  3D54 A;  5IYZ B;  1VQ9 F;  2QA4 F;  3VOA A;  4TUY A;  3RYF B;  3WGN A;  4IHJ B;  5EYP B;  3F0F A;  3CPW F;  3VYS C;  5MN6 A;  2R6R 1;  3D01 A;  3D00 A;  1Q7Y H;  4XCQ A;  1YJN F;  1JFF A;  4ZHQ A;  2KGW A;  5JQG A;  2VXY A;  1PXW A;  4DRX B;  3RYI A;  5JCO C;  5HY1 A;  3CD6 F;  3N2G B;  4HNA B;  3K12 A;  1W42 A;  4X1Y B;  3DDN A;  1IV2 A;  4I4T A;  2UYJ A;  3RE3 A;  3CMA F;  3F0D A;  4EI8 A;  2FGY A;  4NWO B;  4C8I A;  1E7K A;  2BTQ B;  3LWO C;  4ZK7 A;  1VK3 A;  3JAL B;  4BT6 A;  3V7Q A;  3CXC F;  3IMP A;  3R0P A;  3RA5 A;  3S0Y A;  2ZOV A;  3V4D A;  3KJK A;  4M8I A;  4X3M A;  3VYT C;  3QHD A;  3C9T A;  4C82 A; 
#chains in the Genus database with same CATH homology
 2I6D A;  2QI2 A;  3V3T A;  1K73 H;  3CME F;  5HXZ A;  4BVT A;  1VQM F;  2F9Z C;  3CCU F;  3PLA C;  5DCV A;  2OZB A;  3JCM M;  4TZZ A;  2OTJ F;  1KC8 H;  3CCE F;  5GIO C;  1VQ4 F;  5FLX M;  2AIF A;  2LBW A;  4BY9 D;  3HJW C;  5GAN K;  3LWQ C;  3I55 F;  3OW2 F;  1QVG F;  4BW0 B;  4BVQ A;  4BVR A;  1VQN F;  5HXU A;  3G4S F;  3WXM B;  4C4W C;  1ZWZ A;  3N4Y A;  1S72 F;  4LCK A;  3CCL F;  3HAX D;  3CC2 F;  3NVK E;  2CZW A;  1Q81 H;  4X3L A;  2KTV A;  2VGN A;  1QVF F;  2GLZ A;  1VQP F;  2OTL F;  3IR9 A;  1KD1 H;  5HY2 A;  3CCQ F;  3J80 M;  5FJ4 C;  1K9M H;  3JAM M;  4BVS A;  1YHQ F;  2WAL A;  1IPA A;  1X7O A;  1RLG A;  3LWP C;  3CCJ F;  1SDS A;  5GIN C;  2OHW A;  1YJW F;  1DT9 A;  3NK6 A;  5HY4 A;  1CK2 A;  2KG4 A;  2QEX F;  2HVY D;  5G4V C;  1VQ7 F;  3CC4 F;  3RA6 A;  1KQS F;  1RA4 A;  1W2B F;  1XBI A;  1GO0 A;  5EWR A;  1M1K H;  1M90 H;  3E1Y A;  1YI2 F;  1VQO F;  3J81 M;  1VQK F;  3NVI B;  1N8R H;  1GZ0 A;  1VQL F;  3I56 F;  1W3E X;  4NQ3 A;  3LWR C;  1GO1 A;  2LBX A;  3LFO A;  4NUT A;  4EI9 A;  1CN7 A;  3FFM A;  1NJI H;  3CCS F;  3CPQ A;  3MCA B;  4EI7 A;  3G6E F;  1VQ9 F;  2QA4 F;  5IT9 M;  3VMF B;  2ALE A;  3PAF A;  3ON1 A;  2KTU A;  3CPW F;  2JNB A;  1Q82 H;  1Q86 H;  3NMU C;  3D00 A;  3AGK A;  1VQ8 F;  1W40 A;  1Q7Y H;  4XCQ A;  1YJN F;  3OBW A;  1W41 A;  3N4Z A;  3CCR F;  1PXW A;  5A2Q M;  1YIT F;  3CCM F;  1X7P A;  5HY1 A;  3CD6 F;  3GYQ A;  3CC7 F;  1W42 A;  3VI6 A;  5GIP C;  3CCV F;  3G71 F;  1VQ5 F;  3OBY A;  3CMA F;  4EI8 A;  3LWV C;  3E20 B;  5HWE A;  1T0K B;  1VQ6 F;  2FC3 A;  1H7M A;  2FGY A;  1YIJ F;  1E7K A;  2BO1 A;  3CG6 A;  3NK7 A;  1YJ9 F;  1X52 A;  2VGM A;  3LWO C;  5G4U C;  5HY0 A;  1K8A H;  5EO3 A;  3V7Q A;  3CXC F;  3V7E A;  3RA5 A;  5GAP K;  3SIU A;  3SIV A;  4X3M A;  1NMU B;  3J7A R;  3O85 A;  1JJ2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...