3VI6A

Crystal structure of human ribosomal protein l30e
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
b'KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S ribosomal protein L30
publication title Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3vi6A00
1VQ7F 3E20B 1E7KA 1N8RH 1VQMF 3CG6A 1Q81H 3NVKE 3LFOA 3OW2F 3OBWA 5IT9M 1DT9A 1SDSA 1YJ9F 1T0KB 1GO0A 3E1YA 2OHWA 3FFMA 3LWRC 3AGKA 1RA4A 1Q86H 1W42A 1YJWF 3SIVA 3GYQA 3LWPC 3G4SF 2KG4A 2OTLF 5EWRA 3CCMF 2QA4F 5GINC 1VQ4F 3NVIB 3N4YA 3HAXD 3PLAC 3N4ZA 2LBWA 1KD1H 2JNBA 1W2BF 3I55F 3VMFB 1XBIA 1VQNF 1RLGA 3MCAB 1K9MH 2AIFA 5DCVA 3G71F 1QVGF 2VGNA 2QI2A 5FLXM 3CPWF 1YI2F 3SIUA 3CC7F 5GAPK 1X52A 2BO1A 2CZWA 3HJWC 3V7QA 2VGMA 2I6DA 3CPQA 3RA6A 1CN7A 1YITF 1KC8H 1IPAA 1W3EX 3J80M 3NK6A 4NUTA 3I56F 3CMEF 1VQ8F 1W40A 4X3LA 2FC3A 3CCUF 1Q82H 1M1KH 4LCKA 3NMUC 1VQLF 4C4WC 3CXCF 1Q7YH 5FJ4C 3WXMB 5G4VC 3JAMM 3CC2F 1QVFF 3J7AR 1S72F 2KTVA 1VQOF 3NK7A 2ALEA 3LWOC 3CD6F 4TZZA 2KTUA 3G6EF 1GO1A 1YHQF 3IR9A 3CCQF 2OZBA 3RA5A 2WALA 1GZ0A 2OTJF 3VI6A 3J81M 1X7PA 1KQSF 3PAFA 1ZWZA 1VQ9F 3CC4F 2HVYD 5G4UC 1M90H 3OBYA 5GIPC 1X7OA 2QEXF 1CK2A 1VQKF 1VQ6F 3CCVF 4X3MA 3LWVC 4BW0B 3CCSF 3CCRF 3LWQC 1YJNF 3O85A 5A2QM 5EO3A 1YIJF 1PXWA 5GANK 1VQPF 3V7EA 1K73H 3JCMM 3CMAF 1NJIH 5GIOC 3ON1A 1JJ2F 1W41A 3CCEF 3CCLF 1K8AH 1VQ5F 1NMUB 3CCJF 2LBXA 1H7MA 4BY9D
chains in the Genus database with same CATH superfamily
3M84A 4DXDA 1JFFA 3E20B 3VOBA 1E7KA 2KGWA 4EI8A 5J2UA 1VQMF 3VYSC 1Q81H 4O4JB 3LFOA 3OW2F 5JVDB 2QTPA 2VAMA 1DT9A 3S0YA 3E1YA 5IJ9B 3C9RA 3LWRC 3RYFA 1RA4A 2CW4A 3GTZA 3VIUA 2I6RA 4B5CA 3N2GA 5IJ0A 1W5AA 3JVHA 2OTLF 5KMGB 3JASA 3L7QA 2Z01A 5EWRA 1X25A 4C82A 4DRXA 3TD5A 3LYBA 1IV1A 1KD1H 1RQ2A 2UYJA 3HWUA 5MN4A 2RB9A 5LYJA 1VQNF 3JAKA 3HKEB 3MCAB 1RLGA 2AIFA 1RQ7A 1QVGF 2VGNA 3Q8HA 2QI2A 4O4HB 3S06A 1W55A 2ZAUA 5HWEA 4LNUB 2PMPA 2VGMA 4ZHQA 4ZOLB 2GZLA 3UT5A 5HY2A 2VAWA 1TVKA 1KC8H 1IPAA 2Z1TA 4IHJA 5LP6C 2IQQA 3RYHA 2LCAA 1YGYA 2GLZA 4U3JB 4BT6A 2VAPA 3CCUF 1Q82H 5CA1B 4LCKA 4EB6B 5JQGA 5HXZA 3JAWA 4WBNB 4C4WC 3FBAA 5LOVB 2ZVZA 5EIBC 2HP0B 3JAMM 5HY1A 3J7AR 4X1IA 2HP3A 1S72F 1RLUA 3N2KB 1KNJA 3HKBA 3HKCB 1GO1A 5KX5B 3CC4F 1X7PA 2Z1EA 1VQ9F 4ZHVA 5G4UC 5EB0A 3TD4A 2UYNA 4BT5A 4YJ2B 1OFUA 2W8BC 5JH7B 2DT4A 5HP7A 4BT7A 2CWJA 2HRUA 3HKDB 3E22A 1VQPF 1K73H 2L26A 1NJIH 5GIOC 3D00A 3K14A 1NMUB 3JATB 2LBXA 4C81A 1VQ7F 3KJJA 1SZQA 4O4JA 3MBMA 1IV3A 4X1KB 4TV9B 5JVDA 2HQSC 3NVKE 4NWOB 2YXZA 5HY4A 5IJ9A 5IT9M 1W581 3D01A 4EI9A 3MDOA 4IIJB 1YJ9F 1SDSA 1GO0A 1FNJA 2EWCA 3QHDA 4X20B 2ZOVA 2RHJA 5KMGA 1H47A 3C8LA 4TV8A 2HX0A 2QA4F 5GINC 5FNVB 1VHAA 3WPXA 2LBWA 2GVIA 3P0ZA 3IEQA 3VMFB 1SA0B 3KIZA 4BT2A 4O2BB 2UYPA 5HXUA 4O4HA 1K9MH 5EYPB 5HP8A 4LNUA 1NQ3A 2OTMA 1YI2F 4X1YB 1JN1A 2G9IA 5BMVA 2BO1A 2I6DA 3RA6A 3VYTC 1YITF 5EB1B 4FFBB 3F0DA 2PHNA 4I4TB 3I56F 5LA6A 4BVQA 1W40A 4C8GA 4EB6A 1GX1A 4TUYB 4WBNA 4BT4A 1R1MA 1XV2A 5LOVA 5LXTB 1VQLF 4U39A 2HP0A 1Q7YH 3IMPA 3CC2F 3P4EA 1KNKA 2RHHA 2H8EA 3N2KA 3LWOC 4I50A 3EORA 3HKCA 3WGMA 5KX5A 2ZF8A 5J2TB 4ERHA 3IR9A 3CCQF 5ITZB 3RA5A 5C8YB 2OTJF 4G4ZA 1IV4A 2NMUA 3S02A 2QEXF 5GIPC 5J2UB 5CA0A 4YJ2A 4HNAB 5LP6B 4M8IA 4G4VA 3WJPA 5JH7A 2B33A 3FD5A 4G4WA 1W57A 4F6RB 5JCOA 3CCSF 4ZI7B 3HKDA 1UI9A 1YJNF 3O85A 4G4XA 1PXWA 3RE3A 3RYCA 3V7EA 3IKFA 3N2GB 4XCQA 5IJ0B 3CMAF 4YJ3A 1W41A 3JASB 1K8AH 1VQ5F 4DRXB 2AIZP 5MN5A 2N48A 1H7MA 3CCJF 1N8RH 5EZYA 3KHNA 1QU9A 3M4SA 2IAFA 2V9YA 2ZVYA 3GHZA 2HS3A 4IIJA 3JAKB 1U3PA 3K12A 2OHWA 4KWEA 1FSZA 1ODEA 5GONB 4X20A 3U0OA 3K2XA 3WGJA 1YJWF 3MCQA 1W5EA 3DC2A 4ZHYB 4ZHQB 3RYIB 4ZK7A 2KG4A 3K0TA 3WJRA 2BTUA 4O4IB 4RQOA 4R40B 1XRGA 3CCMF 1VQ4F 3N4YA 3HAXD 3PLAC 2K1SA 3VCZA 4O2AB 3T80A 1W2BF 4O2BA 3I55F 3VO8A 5JQGB 3DDNA 5EYPA 5B8FA 3JAWB 3G71F 4X1YA 4BT3A 3CPWF 5GAPK 4EI7A 1X52A 2CZWA 3HJWC 4I55B 1DBFA 1CN7A 1QD9A 4B45A 1VK3A 1W3EX 3NK6A 3F0GA 2H8CA 3CYPB 1ONIA 3LDTA 3CYQA 4TUYA 4B62A 1M1KH 4RHAA 3WJQA 1PF5A 3NMUC 3HKEA 1FFXB 2FGYA 3JALB 3JARB 2CHSA 4G88A 3WXMB 3F6MA 2IG8A 3IKEA 1QVFF 1U40A 5CB4B 3I7TA 4ZOLA 1VQOF 2ALEA 5J2TA 3CD6F 1JD1A 2CSLA 2KTUA 1CLIA 5C8YA 1YHQF 2OZBA 4U3JA 3FD6A 2WALA 2AMTA 3J81M 1KQSF 5CA1A 1M90H 3OBYA 1VQKF 1X7OA 1VQ6F 1CK2A 4HNAA 5LP6A 4C8EA 2LBTA 5IYZB 3ELCA 1JY8A 4F6RA 5HY0A 3P10A 3VTIC 4ZI7A 4BVSA 4BW0B 1H48A 3CCRF 3LMEA 2ZODA 3M1XA 1TUBB 3JCMM 1IV2A 3FPIA 3KE1A 4O4LB 4TV8B 3C9SA 3CCEF 3S0HA 4BY9D 2VXYA 2DYYA 2BTQB 3WGNA 4G4YA 1JFFB 3CG6A 2UZHA 3BYQA 3OBWA 3VOAA 5GONA 4B46A 1T0KB 3FFMA 3AGKA 1Q86H 1W42A 3RYFB 3RYIA 5BMVB 3SIVA 3GYQA 1QAHA 3CB2A 3LWPC 3VYUC 3G4SF 4O4IA 2R751 3WPWA 2RHOA 3NVIB 3JATA 2HRYA 2CHTA 4O2AA 3N4ZA 3QTYA 5LA6B 3D54A 2JNBA 3QUWA 4X1KA 4TV9A 1U43A 3WGLA 1XBIA 1VH8A 4PWTA 5LYJB 1W5FA 5DCVA 2HS4A 5FLXM 3SIUA 3CC7F 4I55A 4NQ3A 1W59A 3V4DA 3V7QA 3CPQA 3F0EA 2UYKA 4I50B 1Z5WA 3UT5B 5FNVA 3J80M 2F9ZC 1COMA 1TVKB 2Q1XA 2R6R1 4NUTA 3ZP4A 4IHJB 3B6NA 2Z1UA 3CMEF 3V3TA 1VQ8F 3ERNA 4X3LA 3RYHB 1UFYA 2FC3A 3ZOPA 3IEWA 4C8IA 3I3FA 5EIBD 1FFXA 1SA0A 4BVTA 4BVRA 5JCOC 2P6YA 3JALA 3JARA 5CA0B 2H6LA 3S03A 3CXCF 1U3LA 5FJ4C 5CB4A 5G4VC 3ZO8A 3ESJA 3OONA 1YQNA 2KTVA 1Z5VA 4X1IB 1Q8RA 3S0WA 1OAPA 3NK7A 2RHLA 4FFBA 3RYCB 4TZZA 4I4TA 3TD3A 3G6EF 4YJ3B 5MN6A 3KJKA 3HKBB 1GZ0A 2CVLA 3VI6A 2HVYD 3PAFA 1ZWZA 3C9TA 2YYEA 3HTNA 3WGKA 5IYZA 1FNKA 5EZYB 5LXTA 5EAZA 2UYNB 1T0AA 3CCVF 3F0FA 4X3MA 2Z1FA 3LWVC 3R0PA 2MQEA 2BTOA 3C9UA 1XHOA 2Q1YA 3LWQC 5EO3A 1TUBA 5A2QM 1YIJF 5AVMA 4E6EA 5GANK 4O4LA 2HS0A 1VQVA 3ZP7A 3E22B 4ZHWA 3ON1A 1JJ2F 1J7HA 5ITZA 3CCLF 3MQWA 1W5BA
chains in the Genus database with same CATH topology
1VQ7F 3E20B 1E7KA 1N8RH 4EI8A 1VQMF 3CG6A 1Q81H 3NVKE 3LFOA 3OW2F 3OBWA 5HY4A 5IT9M 1DT9A 4EI9A 1SDSA 1YJ9F 1T0KB 1GO0A 3E1YA 2OHWA 3FFMA 3LWRC 3AGKA 1RA4A 1Q86H 1W42A 1YJWF 3SIVA 3GYQA 3LWPC 3G4SF 2KG4A 2OTLF 5EWRA 3CCMF 2QA4F 5GINC 1VQ4F 3NVIB 3N4YA 3HAXD 3PLAC 3N4ZA 2LBWA 1KD1H 2JNBA 1W2BF 3I55F 3VMFB 1XBIA 1VQNF 1RLGA 3MCAB 5HXUA 1K9MH 2AIFA 5DCVA 3G71F 1QVGF 2VGNA 2QI2A 5FLXM 3CPWF 1YI2F 5HWEA 3SIUA 3CC7F 5GAPK 4EI7A 4NQ3A 1X52A 2BO1A 2CZWA 3HJWC 3V7QA 2VGMA 2I6DA 3CPQA 3RA6A 1CN7A 5HY2A 1YITF 1KC8H 1IPAA 1W3EX 3J80M 2F9ZC 3NK6A 4NUTA 3I56F 4BVQA 3CMEF 3V3TA 2GLZA 1VQ8F 1W40A 4X3LA 2FC3A 3CCUF 1Q82H 1M1KH 4BVTA 4BVRA 4LCKA 3NMUC 5HXZA 1VQLF 2FGYA 4C4WC 3CXCF 1Q7YH 5FJ4C 3WXMB 5G4VC 3JAMM 3CC2F 5HY1A 1QVFF 3J7AR 1S72F 2KTVA 1VQOF 3NK7A 2ALEA 3LWOC 3CD6F 4TZZA 2KTUA 3G6EF 1GO1A 1YHQF 3IR9A 3CCQF 2OZBA 3RA5A 2WALA 1GZ0A 2OTJF 3VI6A 3J81M 1X7PA 1KQSF 3PAFA 1ZWZA 1VQ9F 3CC4F 2HVYD 5G4UC 1M90H 3OBYA 5GIPC 1X7OA 2QEXF 1CK2A 1VQKF 1VQ6F 5HY0A 3CCVF 4X3MA 3LWVC 4BVSA 4BW0B 3CCSF 3CCRF 3LWQC 1YJNF 3O85A 5EO3A 5A2QM 1YIJF 1PXWA 5GANK 1VQPF 3V7EA 1K73H 3JCMM 4XCQA 3CMAF 1NJIH 5GIOC 3ON1A 1JJ2F 1W41A 3CCEF 3CCLF 1K8AH 1VQ5F 3D00A 1NMUB 3CCJF 2LBXA 1H7MA 4BY9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 F;  3E20 B;  1E7K A;  1N8R H;  1VQM F;  3CG6 A;  1Q81 H;  3NVK E;  3LFO A;  3OW2 F;  3OBW A;  5IT9 M;  1DT9 A;  1SDS A;  1YJ9 F;  1T0K B;  1GO0 A;  3E1Y A;  2OHW A;  3FFM A;  3LWR C;  3AGK A;  1RA4 A;  1Q86 H;  1W42 A;  1YJW F;  3SIV A;  3GYQ A;  3LWP C;  3G4S F;  2KG4 A;  2OTL F;  5EWR A;  3CCM F;  2QA4 F;  5GIN C;  1VQ4 F;  3NVI B;  3N4Y A;  3HAX D;  3PLA C;  3N4Z A;  2LBW A;  1KD1 H;  2JNB A;  1W2B F;  3I55 F;  3VMF B;  1XBI A;  1VQN F;  1RLG A;  3MCA B;  1K9M H;  2AIF A;  5DCV A;  3G71 F;  1QVG F;  2VGN A;  2QI2 A;  5FLX M;  3CPW F;  1YI2 F;  3SIU A;  3CC7 F;  5GAP K;  1X52 A;  2BO1 A;  2CZW A;  3HJW C;  3V7Q A;  2VGM A;  2I6D A;  3CPQ A;  3RA6 A;  1CN7 A;  1YIT F;  1KC8 H;  1IPA A;  1W3E X;  3J80 M;  3NK6 A;  4NUT A;  3I56 F;  3CME F;  1VQ8 F;  1W40 A;  4X3L A;  2FC3 A;  3CCU F;  1Q82 H;  1M1K H;  4LCK A;  3NMU C;  1VQL F;  4C4W C;  3CXC F;  1Q7Y H;  5FJ4 C;  3WXM B;  5G4V C;  3JAM M;  3CC2 F;  1QVF F;  3J7A R;  1S72 F;  2KTV A;  1VQO F;  3NK7 A;  2ALE A;  3LWO C;  3CD6 F;  4TZZ A;  2KTU A;  3G6E F;  1GO1 A;  1YHQ F;  3IR9 A;  3CCQ F;  2OZB A;  3RA5 A;  2WAL A;  1GZ0 A;  2OTJ F;  3VI6 A;  3J81 M;  1X7P A;  1KQS F;  3PAF A;  1ZWZ A;  1VQ9 F;  3CC4 F;  2HVY D;  5G4U C;  1M90 H;  3OBY A;  5GIP C;  1X7O A;  2QEX F;  1CK2 A;  1VQK F;  1VQ6 F;  3CCV F;  4X3M A;  3LWV C;  4BW0 B;  3CCS F;  3CCR F;  3LWQ C;  1YJN F;  3O85 A;  5A2Q M;  5EO3 A;  1YIJ F;  1PXW A;  5GAN K;  1VQP F;  3V7E A;  1K73 H;  3JCM M;  3CMA F;  1NJI H;  5GIO C;  3ON1 A;  1JJ2 F;  1W41 A;  3CCE F;  3CCL F;  1K8A H;  1VQ5 F;  1NMU B;  3CCJ F;  2LBX A;  1H7M A;  4BY9 D; 
#chains in the Genus database with same CATH topology
 3M84 A;  4DXD A;  1JFF A;  3E20 B;  3VOB A;  1E7K A;  2KGW A;  4EI8 A;  5J2U A;  1VQM F;  3VYS C;  1Q81 H;  4O4J B;  3LFO A;  3OW2 F;  5JVD B;  2QTP A;  2VAM A;  1DT9 A;  3S0Y A;  3E1Y A;  5IJ9 B;  3C9R A;  3LWR C;  3RYF A;  1RA4 A;  2CW4 A;  3GTZ A;  3VIU A;  2I6R A;  4B5C A;  3N2G A;  5IJ0 A;  1W5A A;  3JVH A;  2OTL F;  5KMG B;  3JAS A;  3L7Q A;  2Z01 A;  5EWR A;  1X25 A;  4C82 A;  4DRX A;  3TD5 A;  3LYB A;  1IV1 A;  1KD1 H;  1RQ2 A;  2UYJ A;  3HWU A;  5MN4 A;  2RB9 A;  5LYJ A;  1VQN F;  3JAK A;  3HKE B;  3MCA B;  1RLG A;  2AIF A;  1RQ7 A;  1QVG F;  2VGN A;  3Q8H A;  2QI2 A;  4O4H B;  3S06 A;  1W55 A;  2ZAU A;  5HWE A;  4LNU B;  2PMP A;  2VGM A;  4ZHQ A;  4ZOL B;  2GZL A;  3UT5 A;  5HY2 A;  2VAW A;  1TVK A;  1KC8 H;  1IPA A;  2Z1T A;  4IHJ A;  5LP6 C;  2IQQ A;  3RYH A;  2LCA A;  1YGY A;  2GLZ A;  4U3J B;  4BT6 A;  2VAP A;  3CCU F;  1Q82 H;  5CA1 B;  4LCK A;  4EB6 B;  5JQG A;  5HXZ A;  3JAW A;  4WBN B;  4C4W C;  3FBA A;  5LOV B;  2ZVZ A;  5EIB C;  2HP0 B;  3JAM M;  5HY1 A;  3J7A R;  4X1I A;  2HP3 A;  1S72 F;  1RLU A;  3N2K B;  1KNJ A;  3HKB A;  3HKC B;  1GO1 A;  5KX5 B;  3CC4 F;  1X7P A;  2Z1E A;  1VQ9 F;  4ZHV A;  5G4U C;  5EB0 A;  3TD4 A;  2UYN A;  4BT5 A;  4YJ2 B;  1OFU A;  2W8B C;  5JH7 B;  2DT4 A;  5HP7 A;  4BT7 A;  2CWJ A;  2HRU A;  3HKD B;  3E22 A;  1VQP F;  1K73 H;  2L26 A;  1NJI H;  5GIO C;  3D00 A;  3K14 A;  1NMU B;  3JAT B;  2LBX A;  4C81 A;  1VQ7 F;  3KJJ A;  1SZQ A;  4O4J A;  3MBM A;  1IV3 A;  4X1K B;  4TV9 B;  5JVD A;  2HQS C;  3NVK E;  4NWO B;  2YXZ A;  5HY4 A;  5IJ9 A;  5IT9 M;  1W58 1;  3D01 A;  4EI9 A;  3MDO A;  4IIJ B;  1YJ9 F;  1SDS A;  1GO0 A;  1FNJ A;  2EWC A;  3QHD A;  4X20 B;  2ZOV A;  2RHJ A;  5KMG A;  1H47 A;  3C8L A;  4TV8 A;  2HX0 A;  2QA4 F;  5GIN C;  5FNV B;  1VHA A;  3WPX A;  2LBW A;  2GVI A;  3P0Z A;  3IEQ A;  3VMF B;  1SA0 B;  3KIZ A;  4BT2 A;  4O2B B;  2UYP A;  5HXU A;  4O4H A;  1K9M H;  5EYP B;  5HP8 A;  4LNU A;  1NQ3 A;  2OTM A;  1YI2 F;  4X1Y B;  1JN1 A;  2G9I A;  5BMV A;  2BO1 A;  2I6D A;  3RA6 A;  3VYT C;  1YIT F;  5EB1 B;  4FFB B;  3F0D A;  2PHN A;  4I4T B;  3I56 F;  5LA6 A;  4BVQ A;  1W40 A;  4C8G A;  4EB6 A;  1GX1 A;  4TUY B;  4WBN A;  4BT4 A;  1R1M A;  1XV2 A;  5LOV A;  5LXT B;  1VQL F;  4U39 A;  2HP0 A;  1Q7Y H;  3IMP A;  3CC2 F;  3P4E A;  1KNK A;  2RHH A;  2H8E A;  3N2K A;  3LWO C;  4I50 A;  3EOR A;  3HKC A;  3WGM A;  5KX5 A;  2ZF8 A;  5J2T B;  4ERH A;  3IR9 A;  3CCQ F;  5ITZ B;  3RA5 A;  5C8Y B;  2OTJ F;  4G4Z A;  1IV4 A;  2NMU A;  3S02 A;  2QEX F;  5GIP C;  5J2U B;  5CA0 A;  4YJ2 A;  4HNA B;  5LP6 B;  4M8I A;  4G4V A;  3WJP A;  5JH7 A;  2B33 A;  3FD5 A;  4G4W A;  1W57 A;  4F6R B;  5JCO A;  3CCS F;  4ZI7 B;  3HKD A;  1UI9 A;  1YJN F;  3O85 A;  4G4X A;  1PXW A;  3RE3 A;  3RYC A;  3V7E A;  3IKF A;  3N2G B;  4XCQ A;  5IJ0 B;  3CMA F;  4YJ3 A;  1W41 A;  3JAS B;  1K8A H;  1VQ5 F;  4DRX B;  2AIZ P;  5MN5 A;  2N48 A;  1H7M A;  3CCJ F;  1N8R H;  5EZY A;  3KHN A;  1QU9 A;  3M4S A;  2IAF A;  2V9Y A;  2ZVY A;  3GHZ A;  2HS3 A;  4IIJ A;  3JAK B;  1U3P A;  3K12 A;  2OHW A;  4KWE A;  1FSZ A;  1ODE A;  5GON B;  4X20 A;  3U0O A;  3K2X A;  3WGJ A;  1YJW F;  3MCQ A;  1W5E A;  3DC2 A;  4ZHY B;  4ZHQ B;  3RYI B;  4ZK7 A;  2KG4 A;  3K0T A;  3WJR A;  2BTU A;  4O4I B;  4RQO A;  4R40 B;  1XRG A;  3CCM F;  1VQ4 F;  3N4Y A;  3HAX D;  3PLA C;  2K1S A;  3VCZ A;  4O2A B;  3T80 A;  1W2B F;  4O2B A;  3I55 F;  3VO8 A;  5JQG B;  3DDN A;  5EYP A;  5B8F A;  3JAW B;  3G71 F;  4X1Y A;  4BT3 A;  3CPW F;  5GAP K;  4EI7 A;  1X52 A;  2CZW A;  3HJW C;  4I55 B;  1DBF A;  1CN7 A;  1QD9 A;  4B45 A;  1VK3 A;  1W3E X;  3NK6 A;  3F0G A;  2H8C A;  3CYP B;  1ONI A;  3LDT A;  3CYQ A;  4TUY A;  4B62 A;  1M1K H;  4RHA A;  3WJQ A;  1PF5 A;  3NMU C;  3HKE A;  1FFX B;  2FGY A;  3JAL B;  3JAR B;  2CHS A;  4G88 A;  3WXM B;  3F6M A;  2IG8 A;  3IKE A;  1QVF F;  1U40 A;  5CB4 B;  3I7T A;  4ZOL A;  1VQO F;  2ALE A;  5J2T A;  3CD6 F;  1JD1 A;  2CSL A;  2KTU A;  1CLI A;  5C8Y A;  1YHQ F;  2OZB A;  4U3J A;  3FD6 A;  2WAL A;  2AMT A;  3J81 M;  1KQS F;  5CA1 A;  1M90 H;  3OBY A;  1VQK F;  1X7O A;  1VQ6 F;  1CK2 A;  4HNA A;  5LP6 A;  4C8E A;  2LBT A;  5IYZ B;  3ELC A;  1JY8 A;  4F6R A;  5HY0 A;  3P10 A;  3VTI C;  4ZI7 A;  4BVS A;  4BW0 B;  1H48 A;  3CCR F;  3LME A;  2ZOD A;  3M1X A;  1TUB B;  3JCM M;  1IV2 A;  3FPI A;  3KE1 A;  4O4L B;  4TV8 B;  3C9S A;  3CCE F;  3S0H A;  4BY9 D;  2VXY A;  2DYY A;  2BTQ B;  3WGN A;  4G4Y A;  1JFF B;  3CG6 A;  2UZH A;  3BYQ A;  3OBW A;  3VOA A;  5GON A;  4B46 A;  1T0K B;  3FFM A;  3AGK A;  1Q86 H;  1W42 A;  3RYF B;  3RYI A;  5BMV B;  3SIV A;  3GYQ A;  1QAH A;  3CB2 A;  3LWP C;  3VYU C;  3G4S F;  4O4I A;  2R75 1;  3WPW A;  2RHO A;  3NVI B;  3JAT A;  2HRY A;  2CHT A;  4O2A A;  3N4Z A;  3QTY A;  5LA6 B;  3D54 A;  2JNB A;  3QUW A;  4X1K A;  4TV9 A;  1U43 A;  3WGL A;  1XBI A;  1VH8 A;  4PWT A;  5LYJ B;  1W5F A;  5DCV A;  2HS4 A;  5FLX M;  3SIU A;  3CC7 F;  4I55 A;  4NQ3 A;  1W59 A;  3V4D A;  3V7Q A;  3CPQ A;  3F0E A;  2UYK A;  4I50 B;  1Z5W A;  3UT5 B;  5FNV A;  3J80 M;  2F9Z C;  1COM A;  1TVK B;  2Q1X A;  2R6R 1;  4NUT A;  3ZP4 A;  4IHJ B;  3B6N A;  2Z1U A;  3CME F;  3V3T A;  1VQ8 F;  3ERN A;  4X3L A;  3RYH B;  1UFY A;  2FC3 A;  3ZOP A;  3IEW A;  4C8I A;  3I3F A;  5EIB D;  1FFX A;  1SA0 A;  4BVT A;  4BVR A;  5JCO C;  2P6Y A;  3JAL A;  3JAR A;  5CA0 B;  2H6L A;  3S03 A;  3CXC F;  1U3L A;  5FJ4 C;  5CB4 A;  5G4V C;  3ZO8 A;  3ESJ A;  3OON A;  1YQN A;  2KTV A;  1Z5V A;  4X1I B;  1Q8R A;  3S0W A;  1OAP A;  3NK7 A;  2RHL A;  4FFB A;  3RYC B;  4TZZ A;  4I4T A;  3TD3 A;  3G6E F;  4YJ3 B;  5MN6 A;  3KJK A;  3HKB B;  1GZ0 A;  2CVL A;  3VI6 A;  2HVY D;  3PAF A;  1ZWZ A;  3C9T A;  2YYE A;  3HTN A;  3WGK A;  5IYZ A;  1FNK A;  5EZY B;  5LXT A;  5EAZ A;  2UYN B;  1T0A A;  3CCV F;  3F0F A;  4X3M A;  2Z1F A;  3LWV C;  3R0P A;  2MQE A;  2BTO A;  3C9U A;  1XHO A;  2Q1Y A;  3LWQ C;  5EO3 A;  1TUB A;  5A2Q M;  1YIJ F;  5AVM A;  4E6E A;  5GAN K;  4O4L A;  2HS0 A;  1VQV A;  3ZP7 A;  3E22 B;  4ZHW A;  3ON1 A;  1JJ2 F;  1J7H A;  5ITZ A;  3CCL F;  3MQW A;  1W5B A; 
#chains in the Genus database with same CATH homology
 1VQ7 F;  3E20 B;  1E7K A;  1N8R H;  4EI8 A;  1VQM F;  3CG6 A;  1Q81 H;  3NVK E;  3LFO A;  3OW2 F;  3OBW A;  5HY4 A;  5IT9 M;  1DT9 A;  4EI9 A;  1SDS A;  1YJ9 F;  1T0K B;  1GO0 A;  3E1Y A;  2OHW A;  3FFM A;  3LWR C;  3AGK A;  1RA4 A;  1Q86 H;  1W42 A;  1YJW F;  3SIV A;  3GYQ A;  3LWP C;  3G4S F;  2KG4 A;  2OTL F;  5EWR A;  3CCM F;  2QA4 F;  5GIN C;  1VQ4 F;  3NVI B;  3N4Y A;  3HAX D;  3PLA C;  3N4Z A;  2LBW A;  1KD1 H;  2JNB A;  1W2B F;  3I55 F;  3VMF B;  1XBI A;  1VQN F;  1RLG A;  3MCA B;  5HXU A;  1K9M H;  2AIF A;  5DCV A;  3G71 F;  1QVG F;  2VGN A;  2QI2 A;  5FLX M;  3CPW F;  1YI2 F;  5HWE A;  3SIU A;  3CC7 F;  5GAP K;  4EI7 A;  4NQ3 A;  1X52 A;  2BO1 A;  2CZW A;  3HJW C;  3V7Q A;  2VGM A;  2I6D A;  3CPQ A;  3RA6 A;  1CN7 A;  5HY2 A;  1YIT F;  1KC8 H;  1IPA A;  1W3E X;  3J80 M;  2F9Z C;  3NK6 A;  4NUT A;  3I56 F;  4BVQ A;  3CME F;  3V3T A;  2GLZ A;  1VQ8 F;  1W40 A;  4X3L A;  2FC3 A;  3CCU F;  1Q82 H;  1M1K H;  4BVT A;  4BVR A;  4LCK A;  3NMU C;  5HXZ A;  1VQL F;  2FGY A;  4C4W C;  3CXC F;  1Q7Y H;  5FJ4 C;  3WXM B;  5G4V C;  3JAM M;  3CC2 F;  5HY1 A;  1QVF F;  3J7A R;  1S72 F;  2KTV A;  1VQO F;  3NK7 A;  2ALE A;  3LWO C;  3CD6 F;  4TZZ A;  2KTU A;  3G6E F;  1GO1 A;  1YHQ F;  3IR9 A;  3CCQ F;  2OZB A;  3RA5 A;  2WAL A;  1GZ0 A;  2OTJ F;  3VI6 A;  3J81 M;  1X7P A;  1KQS F;  3PAF A;  1ZWZ A;  1VQ9 F;  3CC4 F;  2HVY D;  5G4U C;  1M90 H;  3OBY A;  5GIP C;  1X7O A;  2QEX F;  1CK2 A;  1VQK F;  1VQ6 F;  5HY0 A;  3CCV F;  4X3M A;  3LWV C;  4BVS A;  4BW0 B;  3CCS F;  3CCR F;  3LWQ C;  1YJN F;  3O85 A;  5EO3 A;  5A2Q M;  1YIJ F;  1PXW A;  5GAN K;  1VQP F;  3V7E A;  1K73 H;  3JCM M;  4XCQ A;  3CMA F;  1NJI H;  5GIO C;  3ON1 A;  1JJ2 F;  1W41 A;  3CCE F;  3CCL F;  1K8A H;  1VQ5 F;  3D00 A;  1NMU B;  3CCJ F;  2LBX A;  1H7M A;  4BY9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...