3VI6A

Crystal structure of human ribosomal protein l30e
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
molecule keywords 60S ribosomal protein L30
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3vi6A00
1SDSA 3HAXD 3WXMB 1YJNF 3AGKA 1VQMF 2I6DA 1N8RH 3CXCF 1K73H 3N4ZA 3CPWF 3JAMM 2WALA 1IPAA 2ALEA 3ON1A 1W42A 3I55F 3RA5A 1M90H 3CPQA 4C4WC 3CMEF 2LBXA 5G4UC 3J81M 2AIFA 3CCRF 1Q86H 5DCVA 2KG4A 3JCMM 1VQ9F 3CCJF 1ZWZA 1KQSF 1KC8H 2OTLF 5GIPC 1VQPF 1YJWF 1W3EX 5GIOC 1NMUB 1QVFF 1K8AH 3J80M 5G4VC 1X7OA 1JJ2F 2VGMA 3CC2F 1Q82H 1QVGF 5A2QM 3VI6A 1YJ9F 3V7QA 5EWRA 3LWQC 5FLXM 2HVYD 3SIUA 2QEXF 3CCEF 1VQKF 2JNBA 3E1YA 1VQ6F 2KTVA 1NJIH 1KD1H 3CC7F 2VGNA 4NUTA 3CCQF 3FFMA 1YITF 4BY9D 1W41A 3CMAF 3OBWA 1K9MH 1YHQF 1RLGA 1VQLF 1PXWA 3NK6A 2LBWA 2OHWA 3G6EF 3NMUC 3V7EA 3HJWC 5IT9M 4TZZA 1M1KH 1DT9A 2FC3A 3GYQA 1VQ5F 3LFOA 2QI2A 1H7MA 3N4YA 3G4SF 1S72F 1YIJF 3E20B 4X3LA 3LWRC 1YI2F 3CG6A 1E7KA 5GAPK 1Q81H 3NVKE 5FJ4C 1VQNF 3J7AR 4LCKA 1RA4A 3CCSF 1GO0A 1CK2A 2OZBA 4X3MA 5GANK 3CC4F 1VQOF 3MCAB 3CCMF 3OW2F 3CD6F 3VMFB 1W40A 3CCLF 2KTUA 5GINC 1GZ0A 4BW0B 3I56F 3CCVF 3NK7A 1GO1A 3CCUF 3RA6A 1X52A 1X7PA 2BO1A 3OBYA 3LWPC 1T0KB 3PAFA 2QA4F 3PLAC 3NVIB 2CZWA 1VQ7F 3LWVC 2OTJF 1W2BF 1CN7A 3G71F 5EO3A 1XBIA 1VQ8F 3LWOC 3O85A 1VQ4F 3IR9A 3SIVA 1Q7YH
chains in the Genus database with same CATH superfamily
2V9YA 3S0YA 3AGKA 1Z5VA 1J7HA 1QU9A 3LYBA 3M4SA 5JCOA 3JAMM 2WALA 1W42A 3HWUA 2Z01A 3K0TA 3CPQA 3E22A 2LBXA 1VK3A 3CCRF 3DDNA 2KG4A 4YJ3B 5KX5A 4X1YB 2Q1XA 4ZHQA 4I4TA 1DBFA 4YJ3A 4BT5A 4ZK7A 2HP0B 3F0GA 4FFBA 3T80A 3RE3A 3F0EA 3TD4A 1IV2A 5GIOC 1NMUB 5JH7B 3N2GB 1W5EA 1JY8A 4XCQA 1W57A 5A2QM 1RLUA 3CB2A 4C8EA 3FBAA 1TVKB 4X20B 2KGWA 3SIUA 1UI9A 2JNBA 3EORA 4X20A 1TUBA 2DT4A 2KTVA 4IHJB 4TUYA 4U39A 2VGNA 4G4WA 3M84A 4G4ZA 3RYFA 1YHQF 1VQLF 3RYFB 3NK6A 1XHOA 2ZF8A 2LBWA 2YYEA 1NQ3A 2AMTA 2BTUA 5GONA 3WGMA 2YXZA 1U40A 3HKDA 5C8YA 1SA0A 3JALA 1DT9A 2FC3A 3JVHA 3P0ZA 2H6LA 4ZHQB 3GYQA 3QTYA 2R6R1 3JATB 3S06A 3RYHA 4O4JB 1W59A 3E20B 3C9SA 4G4VA 5HWEA 1R1MA 5EB1B 1E7KA 1T0AA 3WJPA 5GAPK 5FJ4C 3J7AR 4C81A 3N2GA 3CCSF 1CK2A 4X3MA 5GANK 2HX0A 2VXYA 4X1KB 3CD6F 3VMFB 1W40A 3IKEA 1W5AA 1RQ7A 5EZYB 5BMVB 3WJQA 5LYJA 2CVLA 2R751 4ZHYB 2Z1UA 2BO1A 3PAFA 3K2XA 2QA4F 4B62A 1FSZA 1VQ7F 3N2KB 3DC2A 2PHNA 2UZHA 4IIJA 2HP3A 4BVQA 4F6RB 5IYZB 3LWVC 4ZI7B 3G71F 1W2BF 1CN7A 1XBIA 3VYSC 2HS4A 3LDTA 4BT6A 4O4LB 4TV9B 4C8GA 3SIVA 1W5BA 4WBNB 3CYPB 2CWJA 1SDSA 5EYPA 2L26A 2Z1TA 4WBNA 3WXMB 4EB6B 2Z1FA 1VQMF 4I55B 4X1IA 1VH8A 2VAMA 1QAHA 1IPAA 2ALEA 3ON1A 2CHSA 3ZOPA 3MQWA 2I6RA 5B8FA 3I55F 5LXTA 1M90H 3L7QA 3HKCB 3S02A 3C9RA 2HRYA 5DCVA 4ZOLB 1Q86H 5CB4A 3RYIA 2H8CA 1H48A 4X1YA 2OTLF 5GIPC 5J2TB 1VQPF 5LA6B 1XV2A 3U0OA 5LA6A 1U3PA 1K8AH 3J80M 1X7OA 1KNJA 5C8YB 5JQGA 3MCQA 4HNAB 5EWRA 5FLXM 2QEXF 4TV8A 5LP6C 2UYKA 4NUTA 4BY9D 3FFMA 1YITF 4IHJA 3Q8HA 1K9MH 1RLGA 4M8IA 2HQSC 3VYTC 2H8EA 1SZQA 2HS3A 2W8BC 1Z5WA 3FD6A 3HJWC 5IT9M 3ZO8A 1FNJA 3JASB 1ODEA 4LNUA 4G4XA 1W55A 3JASA 5ITZB 2Q1YA 3JARB 4TUYB 2ZVYA 3VCZA 3WPWA 3LFOA 3N4YA 4I50A 1S72F 3VO8A 5GONB 1YI2F 3CG6A 5HY2A 1Q81H 4O4JA 2N48A 1GO0A 5JVDB 3GHZA 3CCMF 3OW2F 3KHNA 3ZP7A 3RYCB 3KJKA 4NQ3A 3JAWB 2RHHA 2LBTA 3CCVF 3FPIA 3NK7A 3F6MA 1JN1A 2GLZA 2BTOA 5J2UA 3RA6A 3TD5A 5CA1B 1X52A 3FD5A 2IAFA 3MBMA 3OBYA 1T0KB 4R40B 5HXUA 4RQOA 3KJJA 4C82A 4RHAA 5FNVA 2VAPA 5EO3A 3LWOC 4O2AB 2K1SA 1Q7YH 1CLIA 2DYYA 1RQ2A 3I7TA 3HAXD 4ZHWA 3UT5B 4O2BA 4BVSA 2I6DA 3CXCF 1K73H 1OAPA 3N4ZA 5IJ0B 3WGKA 3CPWF 2ZAUA 2F9ZC 1X25A 3JAKA 3RA5A 1FFXA 4C4WC 3CMEF 1Q8RA 3J81M 2AIFA 3B6NA 2GZLA 3CCJF 5EIBD 1ZWZA 1KQSF 1KC8H 2IG8A 4DRXA 5EAZA 2HRUA 2MQEA 1YJWF 3WJRA 3ZP4A 5EB0A 5G4VC 2VGMA 3CC2F 4U3JB 5KX5B 5IYZA 3RYIB 3C9UA 3V4DA 2NMUA 3VI6A 3WPXA 1YJ9F 3P4EA 4B45A 5J2TA 3KIZA 3LWQC 2HVYD 1SA0B 3JALB 1VQKF 3E1YA 1VQ6F 5HY0A 4I50B 1KD1H 3HKEA 3K14A 1YGYA 2BTQB 2PMPA 4TV8B 2FGYA 3CCQF 1U3LA 3OONA 3VTIC 3UT5A 1COMA 3IKFA 3CMAF 3JATA 3KE1A 4I55A 4X1IB 4B5CA 5JH7A 5JQGB 2OHWA 3V7EA 5HP8A 1FFXB 5JCOC 4TZZA 3HTNA 3D00A 3GTZA 2CW4A 5LP6A 2RHJA 5HP7A 5LOVB 4NWOB 5ITZA 2RHOA 2QI2A 2UYNA 3R0PA 1H7MA 1U43A 2ZVZA 3G4SF 5CA1A 1YIJF 1JD1A 2VAWA 4X3LA 3LWRC 1IV1A 3NVKE 1VQVA 4O4HA 4BT7A 3V3TA 3C8LA 2OZBA 1PF5A 4O4HB 3IEQA 3CC4F 5HXZA 3MCAB 5HY1A 2GVIA 4DXDA 3WGJA 4O2AA 4ZI7A 4I4TB 2KTUA 4BVRA 3IEWA 4O4LA 4TV9A 4BVTA 3S03A 4EI9A 1X7PA 1UFYA 3LWPC 3NVIB 1IV3A 4G4YA 2OTJF 4BT2A 4LNUB 3VYUC 1VQ8F 3F0FA 3O85A 4O4IA 3E22B 5FNVB 5LP6B 1VHAA 1ONIA 3VOAA 4ZOLA 4DRXB 5MN4A 5CB4B 1YJNF 3VOBA 3D01A 2HP0A 1YQNA 1N8RH 5EIBC 3N2KA 4G88A 3F0DA 3WGLA 3HKBA 4C8IA 1H47A 5G4UC 2RB9A 3MDOA 1KNKA 2RHLA 2P6YA 3M1XA 3JCMM 3RYCA 1VQ9F 4FFBB 5KMGB 2IQQA 5KMGA 2HS0A 4PWTA 5J2UB 5HY4A 3TD3A 1W3EX 3JAKB 1QVFF 1JJ2F 3HKCA 1Q82H 1QVGF 2B33A 4YJ2A 3JARA 1GX1A 3K12A 3VIUA 3V7QA 2G9IA 3CCEF 2AIZP 1W581 1NJIH 3CC7F 4EI8A 3ESJA 1W41A 4ERHA 3OBWA 5IJ9B 1PXWA 2Z1EA 4BT3A 4EI7A 5IJ0A 3D54A 5AVMA 5IJ9A 3G6EF 3HKBB 3NMUC 1JFFA 2CSLA 4IIJB 4F6RA 2ZOVA 2UYPA 3S0HA 1M1KH 3WGNA 3HKEB 4ZHVA 1VQ5F 4HNAA 3I3FA 3S0WA 5MN5A 3CYQA 5EYPB 1TUBB 2OTMA 3ELCA 4B46A 5BMVA 1VQNF 4KWEA 4LCKA 1RA4A 4X1KA 4U3JA 1VQOF 4YJ2B 5LOVA 2EWCA 1W5FA 2UYNB 3BYQA 3HKDB 3CCLF 5LYJB 4BT4A 2QTPA 4E6EA 5GINC 2UYJA 1GZ0A 4BW0B 5MN6A 3I56F 3QUWA 1GO1A 4O2BB 2CHTA 3CCUF 3IMPA 5CA0A 3LMEA 3RYHB 5JVDA 1XRGA 5CA0B 3QHDA 4EB6A 2ZODA 3PLAC 2CZWA 1JFFB 1FNKA 3ERNA 3P10A 3JAWA 2LCAA 1QD9A 3C9TA 1OFUA 1TVKA 5LXTB 1VQ4F 3IR9A 1IV4A 4O4IB 5EZYA
chains in the Genus database with same CATH topology
1SDSA 3HAXD 3WXMB 1YJNF 3AGKA 4BVSA 1VQMF 2I6DA 1N8RH 3CXCF 1K73H 3N4ZA 3CPWF 3JAMM 2WALA 1IPAA 2ALEA 3ON1A 2F9ZC 1W42A 3I55F 3RA5A 1M90H 3CPQA 4C4WC 3CMEF 2LBXA 5G4UC 3J81M 2AIFA 3CCRF 1Q86H 5DCVA 2KG4A 3JCMM 1VQ9F 3CCJF 1ZWZA 1KQSF 1KC8H 2OTLF 5GIPC 1VQPF 1YJWF 5HY4A 1W3EX 5GIOC 1NMUB 1QVFF 1K8AH 3J80M 5G4VC 1X7OA 4XCQA 1JJ2F 2VGMA 3CC2F 1Q82H 1QVGF 5A2QM 3VI6A 1YJ9F 3V7QA 5EWRA 3LWQC 5FLXM 2HVYD 3SIUA 2QEXF 3CCEF 1VQKF 2JNBA 3E1YA 1VQ6F 5HY0A 2KTVA 1NJIH 1KD1H 3CC7F 2VGNA 4NUTA 4EI8A 2FGYA 3FFMA 3CCQF 1YITF 4BY9D 1W41A 3CMAF 3OBWA 1K9MH 1YHQF 1RLGA 1VQLF 1PXWA 3NK6A 4EI7A 2LBWA 2OHWA 3G6EF 3NMUC 3V7EA 3HJWC 5IT9M 4TZZA 1M1KH 3D00A 1DT9A 2FC3A 3GYQA 1VQ5F 3LFOA 2QI2A 1H7MA 3N4YA 3G4SF 1S72F 1YIJF 3E20B 5HWEA 4X3LA 3LWRC 1YI2F 3CG6A 5HY2A 1E7KA 5GAPK 1Q81H 3NVKE 5FJ4C 1VQNF 3J7AR 4LCKA 1RA4A 3V3TA 3CCSF 1GO0A 1CK2A 2OZBA 4X3MA 5GANK 3CC4F 5HXZA 1VQOF 3MCAB 3CCMF 3OW2F 5HY1A 3CD6F 3VMFB 1W40A 3CCLF 4NQ3A 2KTUA 5GINC 1GZ0A 4BW0B 4BVRA 3I56F 3NK7A 3CCVF 1GO1A 2GLZA 3CCUF 3RA6A 4BVTA 1X52A 4EI9A 1X7PA 2BO1A 3OBYA 3LWPC 1T0KB 3PAFA 2QA4F 3PLAC 3NVIB 5HXUA 2CZWA 1VQ7F 4BVQA 3LWVC 2OTJF 1W2BF 1CN7A 3G71F 5EO3A 1XBIA 1VQ8F 3LWOC 3O85A 1VQ4F 3IR9A 3SIVA 1Q7YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDS A;  3HAX D;  3WXM B;  1YJN F;  3AGK A;  1VQM F;  2I6D A;  1N8R H;  3CXC F;  1K73 H;  3N4Z A;  3CPW F;  3JAM M;  2WAL A;  1IPA A;  2ALE A;  3ON1 A;  1W42 A;  3I55 F;  3RA5 A;  1M90 H;  3CPQ A;  4C4W C;  3CME F;  2LBX A;  5G4U C;  3J81 M;  2AIF A;  3CCR F;  1Q86 H;  5DCV A;  2KG4 A;  3JCM M;  1VQ9 F;  3CCJ F;  1ZWZ A;  1KQS F;  1KC8 H;  2OTL F;  5GIP C;  1VQP F;  1YJW F;  1W3E X;  5GIO C;  1NMU B;  1QVF F;  1K8A H;  3J80 M;  5G4V C;  1X7O A;  1JJ2 F;  2VGM A;  3CC2 F;  1Q82 H;  1QVG F;  5A2Q M;  3VI6 A;  1YJ9 F;  3V7Q A;  5EWR A;  3LWQ C;  5FLX M;  2HVY D;  3SIU A;  2QEX F;  3CCE F;  1VQK F;  2JNB A;  3E1Y A;  1VQ6 F;  2KTV A;  1NJI H;  1KD1 H;  3CC7 F;  2VGN A;  4NUT A;  3CCQ F;  3FFM A;  1YIT F;  4BY9 D;  1W41 A;  3CMA F;  3OBW A;  1K9M H;  1YHQ F;  1RLG A;  1VQL F;  1PXW A;  3NK6 A;  2LBW A;  2OHW A;  3G6E F;  3NMU C;  3V7E A;  3HJW C;  5IT9 M;  4TZZ A;  1M1K H;  1DT9 A;  2FC3 A;  3GYQ A;  1VQ5 F;  3LFO A;  2QI2 A;  1H7M A;  3N4Y A;  3G4S F;  1S72 F;  1YIJ F;  3E20 B;  4X3L A;  3LWR C;  1YI2 F;  3CG6 A;  1E7K A;  5GAP K;  1Q81 H;  3NVK E;  5FJ4 C;  1VQN F;  3J7A R;  4LCK A;  1RA4 A;  3CCS F;  1GO0 A;  1CK2 A;  2OZB A;  4X3M A;  5GAN K;  3CC4 F;  1VQO F;  3MCA B;  3CCM F;  3OW2 F;  3CD6 F;  3VMF B;  1W40 A;  3CCL F;  2KTU A;  5GIN C;  1GZ0 A;  4BW0 B;  3I56 F;  3CCV F;  3NK7 A;  1GO1 A;  3CCU F;  3RA6 A;  1X52 A;  1X7P A;  2BO1 A;  3OBY A;  3LWP C;  1T0K B;  3PAF A;  2QA4 F;  3PLA C;  3NVI B;  2CZW A;  1VQ7 F;  3LWV C;  2OTJ F;  1W2B F;  1CN7 A;  3G71 F;  5EO3 A;  1XBI A;  1VQ8 F;  3LWO C;  3O85 A;  1VQ4 F;  3IR9 A;  3SIV A;  1Q7Y H; 
#chains in the Genus database with same CATH topology
 2V9Y A;  3S0Y A;  3AGK A;  1Z5V A;  1J7H A;  1QU9 A;  3LYB A;  3M4S A;  5JCO A;  3JAM M;  2WAL A;  1W42 A;  3HWU A;  2Z01 A;  3K0T A;  3CPQ A;  3E22 A;  2LBX A;  1VK3 A;  3CCR F;  3DDN A;  2KG4 A;  4YJ3 B;  5KX5 A;  4X1Y B;  2Q1X A;  4ZHQ A;  4I4T A;  1DBF A;  4YJ3 A;  4BT5 A;  4ZK7 A;  2HP0 B;  3F0G A;  4FFB A;  3T80 A;  3RE3 A;  3F0E A;  3TD4 A;  1IV2 A;  5GIO C;  1NMU B;  5JH7 B;  3N2G B;  1W5E A;  1JY8 A;  4XCQ A;  1W57 A;  5A2Q M;  1RLU A;  3CB2 A;  4C8E A;  3FBA A;  1TVK B;  4X20 B;  2KGW A;  3SIU A;  1UI9 A;  2JNB A;  3EOR A;  4X20 A;  1TUB A;  2DT4 A;  2KTV A;  4IHJ B;  4TUY A;  4U39 A;  2VGN A;  4G4W A;  3M84 A;  4G4Z A;  3RYF A;  1YHQ F;  1VQL F;  3RYF B;  3NK6 A;  1XHO A;  2ZF8 A;  2LBW A;  2YYE A;  1NQ3 A;  2AMT A;  2BTU A;  5GON A;  3WGM A;  2YXZ A;  1U40 A;  3HKD A;  5C8Y A;  1SA0 A;  3JAL A;  1DT9 A;  2FC3 A;  3JVH A;  3P0Z A;  2H6L A;  4ZHQ B;  3GYQ A;  3QTY A;  2R6R 1;  3JAT B;  3S06 A;  3RYH A;  4O4J B;  1W59 A;  3E20 B;  3C9S A;  4G4V A;  5HWE A;  1R1M A;  5EB1 B;  1E7K A;  1T0A A;  3WJP A;  5GAP K;  5FJ4 C;  3J7A R;  4C81 A;  3N2G A;  3CCS F;  1CK2 A;  4X3M A;  5GAN K;  2HX0 A;  2VXY A;  4X1K B;  3CD6 F;  3VMF B;  1W40 A;  3IKE A;  1W5A A;  1RQ7 A;  5EZY B;  5BMV B;  3WJQ A;  5LYJ A;  2CVL A;  2R75 1;  4ZHY B;  2Z1U A;  2BO1 A;  3PAF A;  3K2X A;  2QA4 F;  4B62 A;  1FSZ A;  1VQ7 F;  3N2K B;  3DC2 A;  2PHN A;  2UZH A;  4IIJ A;  2HP3 A;  4BVQ A;  4F6R B;  5IYZ B;  3LWV C;  4ZI7 B;  3G71 F;  1W2B F;  1CN7 A;  1XBI A;  3VYS C;  2HS4 A;  3LDT A;  4BT6 A;  4O4L B;  4TV9 B;  4C8G A;  3SIV A;  1W5B A;  4WBN B;  3CYP B;  2CWJ A;  1SDS A;  5EYP A;  2L26 A;  2Z1T A;  4WBN A;  3WXM B;  4EB6 B;  2Z1F A;  1VQM F;  4I55 B;  4X1I A;  1VH8 A;  2VAM A;  1QAH A;  1IPA A;  2ALE A;  3ON1 A;  2CHS A;  3ZOP A;  3MQW A;  2I6R A;  5B8F A;  3I55 F;  5LXT A;  1M90 H;  3L7Q A;  3HKC B;  3S02 A;  3C9R A;  2HRY A;  5DCV A;  4ZOL B;  1Q86 H;  5CB4 A;  3RYI A;  2H8C A;  1H48 A;  4X1Y A;  2OTL F;  5GIP C;  5J2T B;  1VQP F;  5LA6 B;  1XV2 A;  3U0O A;  5LA6 A;  1U3P A;  1K8A H;  3J80 M;  1X7O A;  1KNJ A;  5C8Y B;  5JQG A;  3MCQ A;  4HNA B;  5EWR A;  5FLX M;  2QEX F;  4TV8 A;  5LP6 C;  2UYK A;  4NUT A;  4BY9 D;  3FFM A;  1YIT F;  4IHJ A;  3Q8H A;  1K9M H;  1RLG A;  4M8I A;  2HQS C;  3VYT C;  2H8E A;  1SZQ A;  2HS3 A;  2W8B C;  1Z5W A;  3FD6 A;  3HJW C;  5IT9 M;  3ZO8 A;  1FNJ A;  3JAS B;  1ODE A;  4LNU A;  4G4X A;  1W55 A;  3JAS A;  5ITZ B;  2Q1Y A;  3JAR B;  4TUY B;  2ZVY A;  3VCZ A;  3WPW A;  3LFO A;  3N4Y A;  4I50 A;  1S72 F;  3VO8 A;  5GON B;  1YI2 F;  3CG6 A;  5HY2 A;  1Q81 H;  4O4J A;  2N48 A;  1GO0 A;  5JVD B;  3GHZ A;  3CCM F;  3OW2 F;  3KHN A;  3ZP7 A;  3RYC B;  3KJK A;  4NQ3 A;  3JAW B;  2RHH A;  2LBT A;  3CCV F;  3FPI A;  3NK7 A;  3F6M A;  1JN1 A;  2GLZ A;  2BTO A;  5J2U A;  3RA6 A;  3TD5 A;  5CA1 B;  1X52 A;  3FD5 A;  2IAF A;  3MBM A;  3OBY A;  1T0K B;  4R40 B;  5HXU A;  4RQO A;  3KJJ A;  4C82 A;  4RHA A;  5FNV A;  2VAP A;  5EO3 A;  3LWO C;  4O2A B;  2K1S A;  1Q7Y H;  1CLI A;  2DYY A;  1RQ2 A;  3I7T A;  3HAX D;  4ZHW A;  3UT5 B;  4O2B A;  4BVS A;  2I6D A;  3CXC F;  1K73 H;  1OAP A;  3N4Z A;  5IJ0 B;  3WGK A;  3CPW F;  2ZAU A;  2F9Z C;  1X25 A;  3JAK A;  3RA5 A;  1FFX A;  4C4W C;  3CME F;  1Q8R A;  3J81 M;  2AIF A;  3B6N A;  2GZL A;  3CCJ F;  5EIB D;  1ZWZ A;  1KQS F;  1KC8 H;  2IG8 A;  4DRX A;  5EAZ A;  2HRU A;  2MQE A;  1YJW F;  3WJR A;  3ZP4 A;  5EB0 A;  5G4V C;  2VGM A;  3CC2 F;  4U3J B;  5KX5 B;  5IYZ A;  3RYI B;  3C9U A;  3V4D A;  2NMU A;  3VI6 A;  3WPX A;  1YJ9 F;  3P4E A;  4B45 A;  5J2T A;  3KIZ A;  3LWQ C;  2HVY D;  1SA0 B;  3JAL B;  1VQK F;  3E1Y A;  1VQ6 F;  5HY0 A;  4I50 B;  1KD1 H;  3HKE A;  3K14 A;  1YGY A;  2BTQ B;  2PMP A;  4TV8 B;  2FGY A;  3CCQ F;  1U3L A;  3OON A;  3VTI C;  3UT5 A;  1COM A;  3IKF A;  3CMA F;  3JAT A;  3KE1 A;  4I55 A;  4X1I B;  4B5C A;  5JH7 A;  5JQG B;  2OHW A;  3V7E A;  5HP8 A;  1FFX B;  5JCO C;  4TZZ A;  3HTN A;  3D00 A;  3GTZ A;  2CW4 A;  5LP6 A;  2RHJ A;  5HP7 A;  5LOV B;  4NWO B;  5ITZ A;  2RHO A;  2QI2 A;  2UYN A;  3R0P A;  1H7M A;  1U43 A;  2ZVZ A;  3G4S F;  5CA1 A;  1YIJ F;  1JD1 A;  2VAW A;  4X3L A;  3LWR C;  1IV1 A;  3NVK E;  1VQV A;  4O4H A;  4BT7 A;  3V3T A;  3C8L A;  2OZB A;  1PF5 A;  4O4H B;  3IEQ A;  3CC4 F;  5HXZ A;  3MCA B;  5HY1 A;  2GVI A;  4DXD A;  3WGJ A;  4O2A A;  4ZI7 A;  4I4T B;  2KTU A;  4BVR A;  3IEW A;  4O4L A;  4TV9 A;  4BVT A;  3S03 A;  4EI9 A;  1X7P A;  1UFY A;  3LWP C;  3NVI B;  1IV3 A;  4G4Y A;  2OTJ F;  4BT2 A;  4LNU B;  3VYU C;  1VQ8 F;  3F0F A;  3O85 A;  4O4I A;  3E22 B;  5FNV B;  5LP6 B;  1VHA A;  1ONI A;  3VOA A;  4ZOL A;  4DRX B;  5MN4 A;  5CB4 B;  1YJN F;  3VOB A;  3D01 A;  2HP0 A;  1YQN A;  1N8R H;  5EIB C;  3N2K A;  4G88 A;  3F0D A;  3WGL A;  3HKB A;  4C8I A;  1H47 A;  5G4U C;  2RB9 A;  3MDO A;  1KNK A;  2RHL A;  2P6Y A;  3M1X A;  3JCM M;  3RYC A;  1VQ9 F;  4FFB B;  5KMG B;  2IQQ A;  5KMG A;  2HS0 A;  4PWT A;  5J2U B;  5HY4 A;  3TD3 A;  1W3E X;  3JAK B;  1QVF F;  1JJ2 F;  3HKC A;  1Q82 H;  1QVG F;  2B33 A;  4YJ2 A;  3JAR A;  1GX1 A;  3K12 A;  3VIU A;  3V7Q A;  2G9I A;  3CCE F;  2AIZ P;  1W58 1;  1NJI H;  3CC7 F;  4EI8 A;  3ESJ A;  1W41 A;  4ERH A;  3OBW A;  5IJ9 B;  1PXW A;  2Z1E A;  4BT3 A;  4EI7 A;  5IJ0 A;  3D54 A;  5AVM A;  5IJ9 A;  3G6E F;  3HKB B;  3NMU C;  1JFF A;  2CSL A;  4IIJ B;  4F6R A;  2ZOV A;  2UYP A;  3S0H A;  1M1K H;  3WGN A;  3HKE B;  4ZHV A;  1VQ5 F;  4HNA A;  3I3F A;  3S0W A;  5MN5 A;  3CYQ A;  5EYP B;  1TUB B;  2OTM A;  3ELC A;  4B46 A;  5BMV A;  1VQN F;  4KWE A;  4LCK A;  1RA4 A;  4X1K A;  4U3J A;  1VQO F;  4YJ2 B;  5LOV A;  2EWC A;  1W5F A;  2UYN B;  3BYQ A;  3HKD B;  3CCL F;  5LYJ B;  4BT4 A;  2QTP A;  4E6E A;  5GIN C;  2UYJ A;  1GZ0 A;  4BW0 B;  5MN6 A;  3I56 F;  3QUW A;  1GO1 A;  4O2B B;  2CHT A;  3CCU F;  3IMP A;  5CA0 A;  3LME A;  3RYH B;  5JVD A;  1XRG A;  5CA0 B;  3QHD A;  4EB6 A;  2ZOD A;  3PLA C;  2CZW A;  1JFF B;  1FNK A;  3ERN A;  3P10 A;  3JAW A;  2LCA A;  1QD9 A;  3C9T A;  1OFU A;  1TVK A;  5LXT B;  1VQ4 F;  3IR9 A;  1IV4 A;  4O4I B;  5EZY A; 
#chains in the Genus database with same CATH homology
 1SDS A;  3HAX D;  3WXM B;  1YJN F;  3AGK A;  4BVS A;  1VQM F;  2I6D A;  1N8R H;  3CXC F;  1K73 H;  3N4Z A;  3CPW F;  3JAM M;  2WAL A;  1IPA A;  2ALE A;  3ON1 A;  2F9Z C;  1W42 A;  3I55 F;  3RA5 A;  1M90 H;  3CPQ A;  4C4W C;  3CME F;  2LBX A;  5G4U C;  3J81 M;  2AIF A;  3CCR F;  1Q86 H;  5DCV A;  2KG4 A;  3JCM M;  1VQ9 F;  3CCJ F;  1ZWZ A;  1KQS F;  1KC8 H;  2OTL F;  5GIP C;  1VQP F;  1YJW F;  5HY4 A;  1W3E X;  5GIO C;  1NMU B;  1QVF F;  1K8A H;  3J80 M;  5G4V C;  1X7O A;  4XCQ A;  1JJ2 F;  2VGM A;  3CC2 F;  1Q82 H;  1QVG F;  5A2Q M;  3VI6 A;  1YJ9 F;  3V7Q A;  5EWR A;  3LWQ C;  5FLX M;  2HVY D;  3SIU A;  2QEX F;  3CCE F;  1VQK F;  2JNB A;  3E1Y A;  1VQ6 F;  5HY0 A;  2KTV A;  1NJI H;  1KD1 H;  3CC7 F;  2VGN A;  4NUT A;  4EI8 A;  2FGY A;  3FFM A;  3CCQ F;  1YIT F;  4BY9 D;  1W41 A;  3CMA F;  3OBW A;  1K9M H;  1YHQ F;  1RLG A;  1VQL F;  1PXW A;  3NK6 A;  4EI7 A;  2LBW A;  2OHW A;  3G6E F;  3NMU C;  3V7E A;  3HJW C;  5IT9 M;  4TZZ A;  1M1K H;  3D00 A;  1DT9 A;  2FC3 A;  3GYQ A;  1VQ5 F;  3LFO A;  2QI2 A;  1H7M A;  3N4Y A;  3G4S F;  1S72 F;  1YIJ F;  3E20 B;  5HWE A;  4X3L A;  3LWR C;  1YI2 F;  3CG6 A;  5HY2 A;  1E7K A;  5GAP K;  1Q81 H;  3NVK E;  5FJ4 C;  1VQN F;  3J7A R;  4LCK A;  1RA4 A;  3V3T A;  3CCS F;  1GO0 A;  1CK2 A;  2OZB A;  4X3M A;  5GAN K;  3CC4 F;  5HXZ A;  1VQO F;  3MCA B;  3CCM F;  3OW2 F;  5HY1 A;  3CD6 F;  3VMF B;  1W40 A;  3CCL F;  4NQ3 A;  2KTU A;  5GIN C;  1GZ0 A;  4BW0 B;  4BVR A;  3I56 F;  3NK7 A;  3CCV F;  1GO1 A;  2GLZ A;  3CCU F;  3RA6 A;  4BVT A;  1X52 A;  4EI9 A;  1X7P A;  2BO1 A;  3OBY A;  3LWP C;  1T0K B;  3PAF A;  2QA4 F;  3PLA C;  3NVI B;  5HXU A;  2CZW A;  1VQ7 F;  4BVQ A;  3LWV C;  2OTJ F;  1W2B F;  1CN7 A;  3G71 F;  5EO3 A;  1XBI A;  1VQ8 F;  3LWO C;  3O85 A;  1VQ4 F;  3IR9 A;  3SIV A;  1Q7Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...