3VI6A

Crystal structure of human ribosomal protein l30e
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
molecule keywords 60S ribosomal protein L30
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3vi6A00
1VQ8F 1W41A 3LWPC 3LFOA 1K8AH 1VQ5F 1DT9A 3OW2F 1NMUB 1ZWZA 1W2BF 2WALA 1RA4A 2LBWA 3CD6F 3PAFA 3V7EA 2LBXA 3NK6A 5GINC 4BY9D 1Q7YH 1N8RH 1Q81H 3I55F 1CK2A 1E7KA 1RLGA 2OTJF 5EWRA 1M90H 3RA6A 2CZWA 1QVFF 3LWQC 5FJ4C 3N4ZA 2BO1A 1VQMF 3RA5A 1Q86H 2OHWA 3JAMM 5G4UC 4X3MA 1W42A 3E20B 3AGKA 1VQNF 3SIVA 3VMFB 1JJ2F 3HAXD 3CC2F 5GAPK 1GO0A 2KG4A 3CCUF 3WXMB 3NK7A 3LWRC 1IPAA 3CMAF 4TZZA 3CCEF 1CN7A 2OZBA 1T0KB 3MCAB 1VQLF 1YI2F 1GZ0A 2KTUA 1VQPF 1Q82H 3JCMM 3NVKE 3CPQA 4C4WC 3J7AR 3CCQF 1VQ6F 3CG6A 3CCMF 3CCRF 1H7MA 1VQ7F 1VQKF 2FC3A 3N4YA 3OBWA 3G4SF 1X7PA 2I6DA 1GO1A 2ALEA 3LWOC 5DCVA 2VGMA 1VQ9F 3FFMA 3IR9A 3LWVC 1K73H 1YIJF 3J81M 2OTLF 3PLAC 1KC8H 1W3EX 3CXCF 5GIPC 1XBIA 3CMEF 3CCLF 1S72F 5GANK 1VQ4F 2QEXF 1NJIH 3CCJF 1QVGF 1YITF 1SDSA 5FLXM 5G4VC 3SIUA 3NVIB 3O85A 4LCKA 1YHQF 3I56F 1K9MH 2VGNA 4BW0B 3G71F 3GYQA 1KQSF 3CC7F 3VI6A 3CC4F 1X52A 1X7OA 3NMUC 1M1KH 5EO3A 2KTVA 1YJWF 3CCVF 2QI2A 3G6EF 2AIFA 3CPWF 1YJNF 1W40A 4X3LA 2QA4F 3J80M 2HVYD 2JNBA 1YJ9F 1PXWA 3ON1A 4NUTA 3V7QA 1KD1H 3E1YA 3HJWC 5GIOC 5A2QM 3CCSF 3OBYA 5IT9M 1VQOF
chains in the Genus database with same CATH superfamily
3JVHA 3QTYA 5JH7B 2AMTA 3LWPC 2UYPA 1K8AH 3WJQA 3ZOPA 4YJ3B 3L7QA 4BVRA 2PHNA 3CD6F 3PAFA 4TV8A 3I3FA 2UYNB 2H8CA 2R6R1 4U3JA 5KX5B 2Z1EA 2EWCA 2RHJA 1RLGA 3VTIC 1QVFF 3LWQC 5GONB 1GX1A 5KMGA 2NMUA 1COMA 3E22B 4G88A 3RYCB 2BTQB 1TUBA 4G4YA 4X1YB 3V4DA 4TUYB 3JAMM 5G4UC 1VQNF 4PWTA 4TV9A 3SIVA 3VMFB 5GAPK 3N2KB 4EB6B 3QHDA 5FNVA 3CCUF 4WBNB 3VYTC 4ZHQA 1OFUA 4TZZA 3ZO8A 1Z5WA 3MCAB 1VQLF 5EZYB 1GZ0A 4FFBA 1VH8A 5CB4A 4EI9A 3F6MA 2QTPA 3CCRF 4G4XA 1H7MA 4TV9B 3N4YA 4NQ3A 3FD5A 2Q1XA 4BVTA 2DYYA 3G4SF 1R1MA 3WGKA 3JAWA 1GO1A 3VIUA 3LWOC 5DCVA 3P10A 1VQ9F 3IR9A 3RYIB 1YIJF 3J81M 3JATA 3PLAC 3M4SA 5EB0A 3VOBA 3UT5B 4B62A 5CA0B 3MCQA 2CWJA 1W5AA 3SIUA 4LCKA 5LA6B 3I56F 3G71F 5EYPA 3CYPB 3VI6A 2L26A 1X52A 3RE3A 1X7OA 5IJ0A 2KTVA 4O2AB 2HRYA 3CCVF 2HRUA 3D00A 4E6EA 2HS4A 2UYKA 1J7HA 1IV2A 3TD4A 2ZODA 2QA4F 3UT5A 1FNKA 3VYSC 3ZP4A 2ZOVA 1YJ9F 1PXWA 3HKBA 2VAMA 3V7QA 2UYNA 3OBYA 5KX5A 3RYHB 5ITZA 1FSZA 1W41A 1ONIA 1FFXB 3LFOA 3T80A 3S0WA 1NMUB 1SZQA 2FGYA 3WPWA 3RYCA 1VHAA 3JARB 1RA4A 4DXDA 1XRGA 3V7EA 2LBXA 2Z1TA 3NK6A 5GINC 1KNJA 4KWEA 3VO8A 5LP6A 3I55F 5GONA 2IG8A 5LOVA 4F6RB 5HXZA 1IV4A 5FJ4C 4B45A 3N4ZA 3RA5A 1Q86H 3RYHA 4TUYA 2OHWA 2LBTA 3WGJA 4EI8A 3N2GA 4IHJA 2G9IA 3KJJA 2N48A 3V3TA 2RB9A 1JJ2F 4BT7A 1GO0A 2KG4A 2KGWA 4U3JB 3WXMB 4ZHYB 2MQEA 1DBFA 3LWRC 1U3LA 1W5BA 3CCEF 4F6RA 1UI9A 1XV2A 5IYZB 5MN6A 2OZBA 4FFBB 1T0KB 3M84A 4X1KB 5LYJA 1Q82H 2YXZA 1VQVA 3CCQF 3IEQA 1JFFB 5EAZA 3JAKB 1Z5VA 4I4TB 2ZVYA 4O2BA 1SA0A 5IJ9B 5LP6C 1VQKF 2FC3A 3F0GA 3OBWA 5J2UA 4EB6A 1W57A 1X7PA 3WGMA 5KMGB 3D54A 5JQGA 5JCOC 1IV3A 1W581 4O4IB 1H48A 2CSLA 3LWVC 4O4LA 2OTLF 3C8LA 1KC8H 1W3EX 1XBIA 3ERNA 2UYJA 4C8GA 2F9ZC 4XCQA 3DC2A 5GANK 3JASA 1KNKA 2V9YA 1NJIH 2GLZA 3MDOA 4BT3A 1YITF 1SDSA 3P0ZA 2RHHA 5HY4A 4ZHQB 1YHQF 3JALB 1UFYA 5MN4A 2HQSC 5EZYA 3I7TA 1RQ7A 1U3PA 3HWUA 3NMUC 4C82A 4ZOLA 3TD3A 1YJWF 2BTUA 2AIFA 3LMEA 4X3LA 3HKBB 2UZHA 3J80M 2HVYD 4I50B 5FNVB 5JCOA 4O4JB 5HY0A 4LNUB 4BT2A 2RHLA 2VAPA 5A2QM 4ZI7B 5JVDB 4R40B 5J2TA 5IT9M 3S0YA 2I6RA 4ZHVA 2Q1YA 1ZWZA 3C9RA 2WALA 4G4VA 1QD9A 2LBWA 5LA6A 4DRXB 4C8EA 1Q7YH 2GZLA 2K1SA 1N8RH 1CK2A 1W5FA 3IKEA 4IIJA 1VQMF 2RHOA 5ITZB 2ZAUA 5HXUA 1T0AA 5LXTB 4C8IA 2HS3A 4X3MA 1W42A 3IKFA 4X1KA 3E20B 5LYJB 3AGKA 1TUBB 4X1YA 1TVKA 2VXYA 3HAXD 3S06A 1W59A 1H47A 3FD6A 5EB1B 4BVQA 1SA0B 5IJ9A 3HKDB 1QAHA 3TD5A 3IMPA 3P4EA 3HKCA 3WPXA 4I55A 2YYEA 3VYUC 3R0PA 1VQPF 1YGYA 3Q8HA 5EIBD 3NVKE 5LXTA 1Q8RA 1ODEA 1VQ6F 4O2BB 3LYBA 3LDTA 4IHJB 4C81A 3CG6A 4YJ3A 1VQ7F 1TVKB 3JAWB 5HY1A 5MN5A 5CA1A 2I6DA 2ALEA 5J2TB 3ESJA 4G4WA 5B8FA 5C8YB 4HNAA 4BT5A 3HKEA 3VCZA 3CMEF 3K12A 1S72F 3HTNA 3CB2A 3RYFB 2CW4A 3GHZA 1IV1A 4EI7A 2QEXF 1VQ4F 3F0FA 4BT6A 3CYQA 5FLXM 4ERHA 3JALA 5G4VC 1JD1A 2VGNA 4BW0B 4WBNA 3GYQA 3CC7F 2B33A 1JN1A 1PF5A 2LCAA 3K0TA 4ZOLB 3ZP7A 5EYPB 2HP0A 5JVDA 1RQ2A 3KJKA 3JAKA 4YJ2B 5EO3A 2QI2A 3G6EF 3MQWA 3N2GB 2Z1UA 3VOAA 4O2AA 1YJNF 3HKEB 4I50A 3RYFA 2JNBA 1YQNA 3F0EA 4LNUA 3BYQA 2GVIA 1NQ3A 2R751 3HKDA 4NUTA 1KD1H 4ZHWA 3HJWC 4RQOA 5GIOC 3CCSF 1VQOF 3KIZA 1U40A 1VQ8F 1XHOA 2VAWA 3FPIA 4O4HB 3JASB 1W55A 2HP0B 2IQQA 3C9TA 4BT4A 1VQ5F 1DT9A 3OW2F 4X1IA 1W2BF 2ZF8A 4I4TA 3S03A 5CB4B 5CA0A 5LP6B 3KE1A 3JARA 2DT4A 4BY9D 3B6NA 1Q81H 2W8BC 5JQGB 1E7KA 1QU9A 2H6LA 4IIJB 5EWRA 2OTJF 1M90H 3RA6A 2CZWA 4B46A 4O4LB 2BO1A 4G4ZA 4I55B 3WGLA 4ZK7A 5EIBC 3C9UA 3F0DA 3WGNA 4O4JA 4X1IB 3EORA 3DDNA 3U0OA 3KHNA 3CC2F 3D01A 4ZI7A 3S02A 2CVLA 3NK7A 1IPAA 4X20A 3RYIA 3CMAF 3E22A 1CN7A 2IAFA 3JATB 2BTOA 1YI2F 2KTUA 3JCMM 5IYZA 1FFXA 3CPQA 4BVSA 3J7AR 4C4WC 2AIZP 1VK3A 3CCMF 2CHSA 4M8IA 2HP3A 2ZVZA 3OONA 2PMPA 2Z1FA 4O4IA 3M1XA 2HS0A 5J2UB 2VGMA 3K2XA 3FFMA 3WJPA 4RHAA 4X20B 1K73H 2CHTA 4HNAB 3CXCF 5GIPC 4U39A 2Z01A 4YJ2A 4B5CA 3CCLF 1FNJA 5BMVA 3ELCA 1JY8A 1CLIA 3CCJF 1QVGF 4DRXA 2H8EA 3N2KA 3WJRA 1W5EA 3NVIB 3O85A 3C9SA 5CA1B 1RLUA 1K9MH 3QUWA 1KQSF 5HP7A 3CC4F 5JH7A 3K14A 3S0HA 5HP8A 3MBMA 1M1KH 5AVMA 5HY2A 4O4HA 2OTMA 2HX0A 3CPWF 1W40A 1JFFA 4NWOB 4TV8B 5HWEA 3FBAA 5BMVB 2P6YA 3ON1A 3IEWA 1X25A 1U43A 1OAPA 5LOVB 3E1YA 3HKCB 3GTZA 5IJ0B 5C8YA
chains in the Genus database with same CATH topology
1VQ8F 1W41A 3LWPC 3LFOA 1K8AH 1VQ5F 1DT9A 3OW2F 1NMUB 2FGYA 1ZWZA 1W2BF 2WALA 4BVRA 1RA4A 2LBWA 3CD6F 3PAFA 3V7EA 2LBXA 3NK6A 5GINC 4BY9D 1Q7YH 1N8RH 1Q81H 3I55F 1CK2A 1E7KA 1RLGA 2OTJF 5EWRA 1M90H 3RA6A 2CZWA 1QVFF 5HXZA 3LWQC 5FJ4C 3N4ZA 2BO1A 1VQMF 3RA5A 1Q86H 5HXUA 2OHWA 3JAMM 5G4UC 4X3MA 4EI8A 1W42A 3E20B 3AGKA 1VQNF 3SIVA 3VMFB 3V3TA 1JJ2F 3HAXD 3CC2F 5GAPK 1GO0A 2KG4A 4BVQA 3CCUF 3WXMB 3NK7A 3LWRC 1IPAA 3CMAF 4TZZA 3CCEF 1CN7A 2OZBA 1T0KB 3MCAB 1VQLF 1YI2F 1GZ0A 2KTUA 1VQPF 1Q82H 3JCMM 4EI9A 3CPQA 4BVSA 3J7AR 3CCQF 3NVKE 4C4WC 1VQ6F 3CG6A 3CCMF 3CCRF 1H7MA 1VQ7F 1VQKF 2FC3A 3N4YA 3OBWA 4NQ3A 4BVTA 5HY1A 3G4SF 1X7PA 2I6DA 1GO1A 2ALEA 3LWOC 5DCVA 2VGMA 1VQ9F 3FFMA 3IR9A 3LWVC 1K73H 1YIJF 3J81M 2OTLF 3PLAC 1KC8H 1W3EX 3CXCF 5GIPC 1XBIA 3CMEF 2F9ZC 4XCQA 3CCLF 1S72F 5GANK 1VQ4F 4EI7A 2QEXF 1NJIH 3CCJF 1QVGF 2GLZA 1YITF 1SDSA 5FLXM 5G4VC 5HY4A 3SIUA 3NVIB 3O85A 4LCKA 1YHQF 3I56F 1K9MH 2VGNA 4BW0B 3G71F 3GYQA 1KQSF 3CC7F 3VI6A 3CC4F 1X52A 1X7OA 3NMUC 1M1KH 5EO3A 2KTVA 1YJWF 5HY2A 3CCVF 3D00A 2QI2A 3G6EF 2AIFA 3CPWF 1YJNF 1W40A 4X3LA 2QA4F 5HWEA 3J80M 2HVYD 2JNBA 1YJ9F 1PXWA 3ON1A 5HY0A 4NUTA 3V7QA 1KD1H 3E1YA 3HJWC 5GIOC 5A2QM 3CCSF 3OBYA 5IT9M 1VQOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 F;  1W41 A;  3LWP C;  3LFO A;  1K8A H;  1VQ5 F;  1DT9 A;  3OW2 F;  1NMU B;  1ZWZ A;  1W2B F;  2WAL A;  1RA4 A;  2LBW A;  3CD6 F;  3PAF A;  3V7E A;  2LBX A;  3NK6 A;  5GIN C;  4BY9 D;  1Q7Y H;  1N8R H;  1Q81 H;  3I55 F;  1CK2 A;  1E7K A;  1RLG A;  2OTJ F;  5EWR A;  1M90 H;  3RA6 A;  2CZW A;  1QVF F;  3LWQ C;  5FJ4 C;  3N4Z A;  2BO1 A;  1VQM F;  3RA5 A;  1Q86 H;  2OHW A;  3JAM M;  5G4U C;  4X3M A;  1W42 A;  3E20 B;  3AGK A;  1VQN F;  3SIV A;  3VMF B;  1JJ2 F;  3HAX D;  3CC2 F;  5GAP K;  1GO0 A;  2KG4 A;  3CCU F;  3WXM B;  3NK7 A;  3LWR C;  1IPA A;  3CMA F;  4TZZ A;  3CCE F;  1CN7 A;  2OZB A;  1T0K B;  3MCA B;  1VQL F;  1YI2 F;  1GZ0 A;  2KTU A;  1VQP F;  1Q82 H;  3JCM M;  3NVK E;  3CPQ A;  4C4W C;  3J7A R;  3CCQ F;  1VQ6 F;  3CG6 A;  3CCM F;  3CCR F;  1H7M A;  1VQ7 F;  1VQK F;  2FC3 A;  3N4Y A;  3OBW A;  3G4S F;  1X7P A;  2I6D A;  1GO1 A;  2ALE A;  3LWO C;  5DCV A;  2VGM A;  1VQ9 F;  3FFM A;  3IR9 A;  3LWV C;  1K73 H;  1YIJ F;  3J81 M;  2OTL F;  3PLA C;  1KC8 H;  1W3E X;  3CXC F;  5GIP C;  1XBI A;  3CME F;  3CCL F;  1S72 F;  5GAN K;  1VQ4 F;  2QEX F;  1NJI H;  3CCJ F;  1QVG F;  1YIT F;  1SDS A;  5FLX M;  5G4V C;  3SIU A;  3NVI B;  3O85 A;  4LCK A;  1YHQ F;  3I56 F;  1K9M H;  2VGN A;  4BW0 B;  3G71 F;  3GYQ A;  1KQS F;  3CC7 F;  3VI6 A;  3CC4 F;  1X52 A;  1X7O A;  3NMU C;  1M1K H;  5EO3 A;  2KTV A;  1YJW F;  3CCV F;  2QI2 A;  3G6E F;  2AIF A;  3CPW F;  1YJN F;  1W40 A;  4X3L A;  2QA4 F;  3J80 M;  2HVY D;  2JNB A;  1YJ9 F;  1PXW A;  3ON1 A;  4NUT A;  3V7Q A;  1KD1 H;  3E1Y A;  3HJW C;  5GIO C;  5A2Q M;  3CCS F;  3OBY A;  5IT9 M;  1VQO F; 
#chains in the Genus database with same CATH topology
 3JVH A;  3QTY A;  5JH7 B;  2AMT A;  3LWP C;  2UYP A;  1K8A H;  3WJQ A;  3ZOP A;  4YJ3 B;  3L7Q A;  4BVR A;  2PHN A;  3CD6 F;  3PAF A;  4TV8 A;  3I3F A;  2UYN B;  2H8C A;  2R6R 1;  4U3J A;  5KX5 B;  2Z1E A;  2EWC A;  2RHJ A;  1RLG A;  3VTI C;  1QVF F;  3LWQ C;  5GON B;  1GX1 A;  5KMG A;  2NMU A;  1COM A;  3E22 B;  4G88 A;  3RYC B;  2BTQ B;  1TUB A;  4G4Y A;  4X1Y B;  3V4D A;  4TUY B;  3JAM M;  5G4U C;  1VQN F;  4PWT A;  4TV9 A;  3SIV A;  3VMF B;  5GAP K;  3N2K B;  4EB6 B;  3QHD A;  5FNV A;  3CCU F;  4WBN B;  3VYT C;  4ZHQ A;  1OFU A;  4TZZ A;  3ZO8 A;  1Z5W A;  3MCA B;  1VQL F;  5EZY B;  1GZ0 A;  4FFB A;  1VH8 A;  5CB4 A;  4EI9 A;  3F6M A;  2QTP A;  3CCR F;  4G4X A;  1H7M A;  4TV9 B;  3N4Y A;  4NQ3 A;  3FD5 A;  2Q1X A;  4BVT A;  2DYY A;  3G4S F;  1R1M A;  3WGK A;  3JAW A;  1GO1 A;  3VIU A;  3LWO C;  5DCV A;  3P10 A;  1VQ9 F;  3IR9 A;  3RYI B;  1YIJ F;  3J81 M;  3JAT A;  3PLA C;  3M4S A;  5EB0 A;  3VOB A;  3UT5 B;  4B62 A;  5CA0 B;  3MCQ A;  2CWJ A;  1W5A A;  3SIU A;  4LCK A;  5LA6 B;  3I56 F;  3G71 F;  5EYP A;  3CYP B;  3VI6 A;  2L26 A;  1X52 A;  3RE3 A;  1X7O A;  5IJ0 A;  2KTV A;  4O2A B;  2HRY A;  3CCV F;  2HRU A;  3D00 A;  4E6E A;  2HS4 A;  2UYK A;  1J7H A;  1IV2 A;  3TD4 A;  2ZOD A;  2QA4 F;  3UT5 A;  1FNK A;  3VYS C;  3ZP4 A;  2ZOV A;  1YJ9 F;  1PXW A;  3HKB A;  2VAM A;  3V7Q A;  2UYN A;  3OBY A;  5KX5 A;  3RYH B;  5ITZ A;  1FSZ A;  1W41 A;  1ONI A;  1FFX B;  3LFO A;  3T80 A;  3S0W A;  1NMU B;  1SZQ A;  2FGY A;  3WPW A;  3RYC A;  1VHA A;  3JAR B;  1RA4 A;  4DXD A;  1XRG A;  3V7E A;  2LBX A;  2Z1T A;  3NK6 A;  5GIN C;  1KNJ A;  4KWE A;  3VO8 A;  5LP6 A;  3I55 F;  5GON A;  2IG8 A;  5LOV A;  4F6R B;  5HXZ A;  1IV4 A;  5FJ4 C;  4B45 A;  3N4Z A;  3RA5 A;  1Q86 H;  3RYH A;  4TUY A;  2OHW A;  2LBT A;  3WGJ A;  4EI8 A;  3N2G A;  4IHJ A;  2G9I A;  3KJJ A;  2N48 A;  3V3T A;  2RB9 A;  1JJ2 F;  4BT7 A;  1GO0 A;  2KG4 A;  2KGW A;  4U3J B;  3WXM B;  4ZHY B;  2MQE A;  1DBF A;  3LWR C;  1U3L A;  1W5B A;  3CCE F;  4F6R A;  1UI9 A;  1XV2 A;  5IYZ B;  5MN6 A;  2OZB A;  4FFB B;  1T0K B;  3M84 A;  4X1K B;  5LYJ A;  1Q82 H;  2YXZ A;  1VQV A;  3CCQ F;  3IEQ A;  1JFF B;  5EAZ A;  3JAK B;  1Z5V A;  4I4T B;  2ZVY A;  4O2B A;  1SA0 A;  5IJ9 B;  5LP6 C;  1VQK F;  2FC3 A;  3F0G A;  3OBW A;  5J2U A;  4EB6 A;  1W57 A;  1X7P A;  3WGM A;  5KMG B;  3D54 A;  5JQG A;  5JCO C;  1IV3 A;  1W58 1;  4O4I B;  1H48 A;  2CSL A;  3LWV C;  4O4L A;  2OTL F;  3C8L A;  1KC8 H;  1W3E X;  1XBI A;  3ERN A;  2UYJ A;  4C8G A;  2F9Z C;  4XCQ A;  3DC2 A;  5GAN K;  3JAS A;  1KNK A;  2V9Y A;  1NJI H;  2GLZ A;  3MDO A;  4BT3 A;  1YIT F;  1SDS A;  3P0Z A;  2RHH A;  5HY4 A;  4ZHQ B;  1YHQ F;  3JAL B;  1UFY A;  5MN4 A;  2HQS C;  5EZY A;  3I7T A;  1RQ7 A;  1U3P A;  3HWU A;  3NMU C;  4C82 A;  4ZOL A;  3TD3 A;  1YJW F;  2BTU A;  2AIF A;  3LME A;  4X3L A;  3HKB B;  2UZH A;  3J80 M;  2HVY D;  4I50 B;  5FNV B;  5JCO A;  4O4J B;  5HY0 A;  4LNU B;  4BT2 A;  2RHL A;  2VAP A;  5A2Q M;  4ZI7 B;  5JVD B;  4R40 B;  5J2T A;  5IT9 M;  3S0Y A;  2I6R A;  4ZHV A;  2Q1Y A;  1ZWZ A;  3C9R A;  2WAL A;  4G4V A;  1QD9 A;  2LBW A;  5LA6 A;  4DRX B;  4C8E A;  1Q7Y H;  2GZL A;  2K1S A;  1N8R H;  1CK2 A;  1W5F A;  3IKE A;  4IIJ A;  1VQM F;  2RHO A;  5ITZ B;  2ZAU A;  5HXU A;  1T0A A;  5LXT B;  4C8I A;  2HS3 A;  4X3M A;  1W42 A;  3IKF A;  4X1K A;  3E20 B;  5LYJ B;  3AGK A;  1TUB B;  4X1Y A;  1TVK A;  2VXY A;  3HAX D;  3S06 A;  1W59 A;  1H47 A;  3FD6 A;  5EB1 B;  4BVQ A;  1SA0 B;  5IJ9 A;  3HKD B;  1QAH A;  3TD5 A;  3IMP A;  3P4E A;  3HKC A;  3WPX A;  4I55 A;  2YYE A;  3VYU C;  3R0P A;  1VQP F;  1YGY A;  3Q8H A;  5EIB D;  3NVK E;  5LXT A;  1Q8R A;  1ODE A;  1VQ6 F;  4O2B B;  3LYB A;  3LDT A;  4IHJ B;  4C81 A;  3CG6 A;  4YJ3 A;  1VQ7 F;  1TVK B;  3JAW B;  5HY1 A;  5MN5 A;  5CA1 A;  2I6D A;  2ALE A;  5J2T B;  3ESJ A;  4G4W A;  5B8F A;  5C8Y B;  4HNA A;  4BT5 A;  3HKE A;  3VCZ A;  3CME F;  3K12 A;  1S72 F;  3HTN A;  3CB2 A;  3RYF B;  2CW4 A;  3GHZ A;  1IV1 A;  4EI7 A;  2QEX F;  1VQ4 F;  3F0F A;  4BT6 A;  3CYQ A;  5FLX M;  4ERH A;  3JAL A;  5G4V C;  1JD1 A;  2VGN A;  4BW0 B;  4WBN A;  3GYQ A;  3CC7 F;  2B33 A;  1JN1 A;  1PF5 A;  2LCA A;  3K0T A;  4ZOL B;  3ZP7 A;  5EYP B;  2HP0 A;  5JVD A;  1RQ2 A;  3KJK A;  3JAK A;  4YJ2 B;  5EO3 A;  2QI2 A;  3G6E F;  3MQW A;  3N2G B;  2Z1U A;  3VOA A;  4O2A A;  1YJN F;  3HKE B;  4I50 A;  3RYF A;  2JNB A;  1YQN A;  3F0E A;  4LNU A;  3BYQ A;  2GVI A;  1NQ3 A;  2R75 1;  3HKD A;  4NUT A;  1KD1 H;  4ZHW A;  3HJW C;  4RQO A;  5GIO C;  3CCS F;  1VQO F;  3KIZ A;  1U40 A;  1VQ8 F;  1XHO A;  2VAW A;  3FPI A;  4O4H B;  3JAS B;  1W55 A;  2HP0 B;  2IQQ A;  3C9T A;  4BT4 A;  1VQ5 F;  1DT9 A;  3OW2 F;  4X1I A;  1W2B F;  2ZF8 A;  4I4T A;  3S03 A;  5CB4 B;  5CA0 A;  5LP6 B;  3KE1 A;  3JAR A;  2DT4 A;  4BY9 D;  3B6N A;  1Q81 H;  2W8B C;  5JQG B;  1E7K A;  1QU9 A;  2H6L A;  4IIJ B;  5EWR A;  2OTJ F;  1M90 H;  3RA6 A;  2CZW A;  4B46 A;  4O4L B;  2BO1 A;  4G4Z A;  4I55 B;  3WGL A;  4ZK7 A;  5EIB C;  3C9U A;  3F0D A;  3WGN A;  4O4J A;  4X1I B;  3EOR A;  3DDN A;  3U0O A;  3KHN A;  3CC2 F;  3D01 A;  4ZI7 A;  3S02 A;  2CVL A;  3NK7 A;  1IPA A;  4X20 A;  3RYI A;  3CMA F;  3E22 A;  1CN7 A;  2IAF A;  3JAT B;  2BTO A;  1YI2 F;  2KTU A;  3JCM M;  5IYZ A;  1FFX A;  3CPQ A;  4BVS A;  3J7A R;  4C4W C;  2AIZ P;  1VK3 A;  3CCM F;  2CHS A;  4M8I A;  2HP3 A;  2ZVZ A;  3OON A;  2PMP A;  2Z1F A;  4O4I A;  3M1X A;  2HS0 A;  5J2U B;  2VGM A;  3K2X A;  3FFM A;  3WJP A;  4RHA A;  4X20 B;  1K73 H;  2CHT A;  4HNA B;  3CXC F;  5GIP C;  4U39 A;  2Z01 A;  4YJ2 A;  4B5C A;  3CCL F;  1FNJ A;  5BMV A;  3ELC A;  1JY8 A;  1CLI A;  3CCJ F;  1QVG F;  4DRX A;  2H8E A;  3N2K A;  3WJR A;  1W5E A;  3NVI B;  3O85 A;  3C9S A;  5CA1 B;  1RLU A;  1K9M H;  3QUW A;  1KQS F;  5HP7 A;  3CC4 F;  5JH7 A;  3K14 A;  3S0H A;  5HP8 A;  3MBM A;  1M1K H;  5AVM A;  5HY2 A;  4O4H A;  2OTM A;  2HX0 A;  3CPW F;  1W40 A;  1JFF A;  4NWO B;  4TV8 B;  5HWE A;  3FBA A;  5BMV B;  2P6Y A;  3ON1 A;  3IEW A;  1X25 A;  1U43 A;  1OAP A;  5LOV B;  3E1Y A;  3HKC B;  3GTZ A;  5IJ0 B;  5C8Y A; 
#chains in the Genus database with same CATH homology
 1VQ8 F;  1W41 A;  3LWP C;  3LFO A;  1K8A H;  1VQ5 F;  1DT9 A;  3OW2 F;  1NMU B;  2FGY A;  1ZWZ A;  1W2B F;  2WAL A;  4BVR A;  1RA4 A;  2LBW A;  3CD6 F;  3PAF A;  3V7E A;  2LBX A;  3NK6 A;  5GIN C;  4BY9 D;  1Q7Y H;  1N8R H;  1Q81 H;  3I55 F;  1CK2 A;  1E7K A;  1RLG A;  2OTJ F;  5EWR A;  1M90 H;  3RA6 A;  2CZW A;  1QVF F;  5HXZ A;  3LWQ C;  5FJ4 C;  3N4Z A;  2BO1 A;  1VQM F;  3RA5 A;  1Q86 H;  5HXU A;  2OHW A;  3JAM M;  5G4U C;  4X3M A;  4EI8 A;  1W42 A;  3E20 B;  3AGK A;  1VQN F;  3SIV A;  3VMF B;  3V3T A;  1JJ2 F;  3HAX D;  3CC2 F;  5GAP K;  1GO0 A;  2KG4 A;  4BVQ A;  3CCU F;  3WXM B;  3NK7 A;  3LWR C;  1IPA A;  3CMA F;  4TZZ A;  3CCE F;  1CN7 A;  2OZB A;  1T0K B;  3MCA B;  1VQL F;  1YI2 F;  1GZ0 A;  2KTU A;  1VQP F;  1Q82 H;  3JCM M;  4EI9 A;  3CPQ A;  4BVS A;  3J7A R;  3CCQ F;  3NVK E;  4C4W C;  1VQ6 F;  3CG6 A;  3CCM F;  3CCR F;  1H7M A;  1VQ7 F;  1VQK F;  2FC3 A;  3N4Y A;  3OBW A;  4NQ3 A;  4BVT A;  5HY1 A;  3G4S F;  1X7P A;  2I6D A;  1GO1 A;  2ALE A;  3LWO C;  5DCV A;  2VGM A;  1VQ9 F;  3FFM A;  3IR9 A;  3LWV C;  1K73 H;  1YIJ F;  3J81 M;  2OTL F;  3PLA C;  1KC8 H;  1W3E X;  3CXC F;  5GIP C;  1XBI A;  3CME F;  2F9Z C;  4XCQ A;  3CCL F;  1S72 F;  5GAN K;  1VQ4 F;  4EI7 A;  2QEX F;  1NJI H;  3CCJ F;  1QVG F;  2GLZ A;  1YIT F;  1SDS A;  5FLX M;  5G4V C;  5HY4 A;  3SIU A;  3NVI B;  3O85 A;  4LCK A;  1YHQ F;  3I56 F;  1K9M H;  2VGN A;  4BW0 B;  3G71 F;  3GYQ A;  1KQS F;  3CC7 F;  3VI6 A;  3CC4 F;  1X52 A;  1X7O A;  3NMU C;  1M1K H;  5EO3 A;  2KTV A;  1YJW F;  5HY2 A;  3CCV F;  3D00 A;  2QI2 A;  3G6E F;  2AIF A;  3CPW F;  1YJN F;  1W40 A;  4X3L A;  2QA4 F;  5HWE A;  3J80 M;  2HVY D;  2JNB A;  1YJ9 F;  1PXW A;  3ON1 A;  5HY0 A;  4NUT A;  3V7Q A;  1KD1 H;  3E1Y A;  3HJW C;  5GIO C;  5A2Q M;  3CCS F;  3OBY A;  5IT9 M;  1VQO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...