3VI6A

Crystal structure of human ribosomal protein l30e
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 60S ribosomal protein L30
publication title Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3vi6A00
4BW0B 1NMUB 3SIVA 3V7QA 1YI2F 3E20B 4BY9D 5IT9M 1W40A 1W3EX 2HVYD 3NMUC 2OTLF 1T0KB 1XBIA 2VGMA 3SIUA 3JAMM 1VQ4F 1K9MH 1X7OA 3G6EF 2BO1A 3LWPC 1X7PA 1Q7YH 1YIJF 3CCLF 1QVGF 3V7EA 2LBXA 1RA4A 1VQ5F 3CG6A 3N4YA 2OZBA 1GZ0A 3LWOC 1VQLF 4X3MA 3VMFB 3RA6A 1Q86H 3CCSF 3LWQC 1W41A 1X52A 3CCVF 3CCEF 2KG4A 4TZZA 1N8RH 5FLXM 1Q81H 5G4UC 5G4VC 1KQSF 1DT9A 3O85A 1YJNF 1VQNF 1Q82H 3NVIB 1W2BF 3CCUF 3J7AR 2OTJF 1NJIH 5DCVA 2QA4F 2WALA 3CC4F 3NK7A 3CCMF 1GO0A 1SDSA 3I55F 3I56F 1K8AH 3NVKE 1VQ7F 1IPAA 3LWRC 2I6DA 1H7MA 3G4SF 3OW2F 5EWRA 1YHQF 1YITF 3ON1A 1ZWZA 3NK6A 1M1KH 3MCAB 1VQPF 1YJWF 1KC8H 1E7KA 3HJWC 3JCMM 3PAFA 1QVFF 5GINC 3CMEF 5GIOC 2AIFA 3J80M 3J81M 1VQ9F 1CK2A 2KTVA 3AGKA 3LWVC 3CCRF 5FJ4C 3CPWF 3HAXD 3FFMA 2ALEA 3N4ZA 1M90H 1VQ8F 1W42A 1CN7A 4NUTA 1KD1H 5EO3A 5GIPC 3GYQA 2JNBA 3CC2F 5GANK 1K73H 4C4WC 1RLGA 2CZWA 1JJ2F 1VQMF 3CPQA 3G71F 1YJ9F 2VGNA 5A2QM 3CCQF 2OHWA 3CD6F 3PLAC 5GAPK 4X3LA 2KTUA 2LBWA 2FC3A 3RA5A 1S72F 3OBWA 1VQKF 3E1YA 4LCKA 3LFOA 3CC7F 3IR9A 3VI6A 1VQ6F 3OBYA 1PXWA 3WXMB 2QI2A 1VQOF 3CXCF 1GO1A 2QEXF 3CCJF 3CMAF
chains in the Genus database with same CATH superfamily
3RYFA 5HY4A 4G88A 3CB2A 3E20B 5LYJA 5EYPA 3N2KB 4ZI7B 1FFXA 3JATB 4ZHQA 3P4EA 3WJQA 1ONIA 1W581 3NMUC 1SA0A 2W8BC 2OTLF 4M8IA 5LP6A 3SIUA 3JARB 3F0DA 1W55A 1J7HA 4F6RA 4U39A 2YXZA 4O2AB 3CCLF 1QVGF 2LBXA 5LP6C 4BVQA 3CG6A 3N4YA 4G4XA 3JAKB 2HRUA 3HWUA 4EB6B 3ELCA 3C8LA 2DYYA 5EB1B 4YJ3A 4I55A 5FLXM 5CA1B 3D00A 3O85A 1W2BF 3CCUF 4BT2A 3JVHA 4PWTA 4FFBA 1CLIA 3VYTC 1QAHA 1VQVA 2WALA 3JASB 1FNKA 5EIBC 3CCMF 2IG8A 3LMEA 5EZYB 1JY8A 3IEWA 3OW2F 4LNUB 3JALB 2L26A 2BTUA 5AVMA 3KJKA 5MN6A 1KNJA 1VQPF 1KC8H 2NMUA 2Z1UA 2UZHA 3WGLA 3CMEF 2CVLA 5KX5B 1VQ9F 1U43A 2PMPA 3VOBA 5CA0B 3AGKA 5GONA 5HY0A 3VTIC 3LWVC 4BT3A 5FJ4C 4YJ2A 4TUYA 2EWCA 1M90H 3JAWA 4EI9A 1CN7A 2HP0B 3RYCA 5CB4B 5JQGB 1KD1H 4I50A 3Q8HA 3VYSC 4C8EA 3GYQA 5GANK 3WPWA 2CZWA 2KGWA 1JJ2F 3JASA 3TD3A 3CPQA 5IYZA 4O2BA 2OHWA 4ZK7A 5HY1A 4DRXA 2HP3A 3OBWA 4RHAA 1VQKF 3RYFB 3T80A 3MQWA 3VI6A 3OBYA 3S02A 5IJ0A 1GO1A 2RHOA 5LYJB 2GLZA 5EYPB 3F0GA 1FFXB 4ZHQB 3U0OA 5HWEA 5MN5A 2DT4A 5LP6B 1W40A 1W3EX 2HVYD 3DC2A 2HS4A 1XRGA 1T0KB 1W57A 5EB0A 5HXZA 1K9MH 2BO1A 3LWPC 3V3TA 1IV3A 4O4IA 1Q7YH 3M84A 1VK3A 3V7EA 2I6RA 3TD5A 4YJ3B 1W5EA 4I55B 4KWEA 2ZVYA 4X3MA 2CW4A 5KMGA 3RA6A 2Q1XA 2B33A 1W41A 2V9YA 3K0TA 4FFBB 2CSLA 3CCEF 1N8RH 1RLUA 2FGYA 4ERHA 3L7QA 3MCQA 2UYNA 4X1YB 1Q82H 4G4ZA 1NJIH 2QA4F 5HP7A 3CC4F 2G9IA 1GO0A 1OAPA 3HKEA 1K8AH 4NQ3A 1XHOA 4BT7A 1IPAA 2ZAUA 1H7MA 3LYBA 1R1MA 4X1IA 3RE3A 3WGJA 3S03A 2YYEA 4C82A 1YHQF 5LXTA 3ON1A 1Z5VA 1ZWZA 5GONB 1VH8A 3MCAB 4B46A 4ZHWA 5B8FA 4YJ2B 2UYJA 4B45A 1YJWF 1E7KA 4TUYB 3UT5A 1PF5A 5GINC 3JAWB 5GIOC 3J80M 1JD1A 3RYCB 4I50B 5ITZA 3K2XA 3D01A 3CPWF 3HAXD 2ALEA 2PHNA 3F6MA 1ODEA 1W42A 2VAWA 4WBNA 3ZP4A 4X1YA 4O2BB 4BVRA 5IYZB 5GIPC 4DRXB 3CC2F 2RHHA 3FBAA 1VQMF 2HS3A 2VGNA 4E6EA 3QHDA 5IJ0B 3I7TA 2KTUA 2LBWA 1Q8RA 3TD4A 2FC3A 2IQQA 3GHZA 3K14A 3RA5A 3I3FA 1S72F 1RQ7A 2HS0A 5HY2A 3DDNA 1VQ6F 4O4HB 5BMVA 2HX0A 3RYHA 2QI2A 2Z01A 3WXMB 1VQOF 1VQ7F 3CCJF 3B6NA 1TVKB 3ZO8A 4X1KA 4BW0B 4BVTA 4BT4A 1RQ2A 3P0ZA 3SIVA 1OFUA 3HKCA 1YI2F 4BY9D 5IT9M 5J2TA 2Q1YA 4HNAB 3ESJA 3P10A 4TV8A 4O4IB 3S06A 3JAMM 3E22A 1VQ4F 2H8CA 1X7OA 1UFYA 3VCZA 3G6EF 3N2GA 3WGKA 1X7PA 4EI7A 3BYQA 5JVDA 2ZODA 3KJJA 1RA4A 5KMGB 4O4HA 2OZBA 1FSZA 3WJPA 3LWOC 2N48A 4IHJA 1TVKA 1W5FA 3CCSF 2UYNB 2F9ZC 3CCVF 4TV9A 2KG4A 3WPXA 4C8IA 4IIJA 4TZZA 2HRYA 2RHLA 1Q81H 5G4UC 1KQSF 2Z1TA 3HKEB 1DT9A 1T0AA 4HNAA 3J7AR 3C9RA 3EORA 2QTPA 4X20A 4X1IB 1TUBA 3NK7A 3I55F 5LXTB 3F0EA 3HTNA 1IV4A 1COMA 3MDOA 3IKFA 2I6DA 4XCQA 2CHTA 5EWRA 3UT5B 3S0WA 2GZLA 1YITF 5LA6A 3NK6A 1M1KH 3D54A 3S0YA 5ITZB 5HP8A 3KE1A 2ZF8A 3HJWC 1VHAA 3K12A 4R40B 2AMTA 1KNKA 2AIFA 3VOAA 5IJ9A 4WBNB 5JH7B 1CK2A 1FNJA 2KTVA 2LCAA 1H47A 1U3LA 4O4LA 1IV1A 2RB9A 3HKDA 3N4ZA 2P6YA 4O4JA 1VQ8F 1YGYA 4DXDA 4NUTA 4RQOA 1U3PA 3IEQA 4NWOB 5EO3A 5FNVA 4ZHVA 4ZOLA 1K73H 4G4VA 4C4WC 1RLGA 5JCOA 2GVIA 4B62A 3G71F 1H48A 2VXYA 5EIBD 1U40A 5A2QM 3M1XA 5BMVB 3RYHB 5C8YA 2VAMA 5MN4A 1Z5WA 4X1KB 3E1YA 4LCKA 5JCOC 2R751 3VO8A 1PXWA 3HKCB 4I4TA 4EI8A 3RYIA 3CXCF 4U3JA 2QEXF 5J2TB 3CMAF 1JFFA 3C9UA 3M4SA 1NMUB 4TV8B 3KIZA 3V7QA 5JH7A 3C9SA 3CYPB 5LOVA 2CHSA 3R0PA 2Z1FA 3HKBA 3E22B 3N2GB 4BT5A 3S0HA 5JVDB 1XBIA 4BT6A 2VGMA 2OTMA 3N2KA 4ZI7A 3JATA 1UI9A 4C8GA 3GTZA 2H6LA 1W5AA 1YIJF 3QTYA 3V4DA 4IHJB 1YQNA 3C9TA 3JARA 1VQ5F 1QD9A 2HQSC 1W5BA 4O2AA 3WJRA 1QU9A 4TV9B 1GZ0A 2ZVZA 3QUWA 4IIJB 1VQLF 3FD5A 5J2UB 3VMFB 3MBMA 1Q86H 3LWQC 1X52A 3FD6A 1NQ3A 3JAKA 3VIUA 4X20B 2K1SA 4G4WA 1TUBB 5G4VC 4EB6A 1YJNF 1VQNF 3NVIB 2OTJF 2ZOVA 3ZP7A 3F0FA 2BTOA 4C81A 3WGMA 5DCVA 5CA1A 1DBFA 1SDSA 3I56F 3IKEA 3NVKE 3CYQA 2Z1EA 5LA6B 5HXUA 3LWRC 3G4SF 3FPIA 3LDTA 5IJ9B 5EZYA 4O4LB 2LBTA 3ERNA 4BVSA 4LNUA 1XV2A 3JALA 3HKDB 3PAFA 3JCMM 2UYKA 1QVFF 4O4JB 2UYPA 3VYUC 5J2UA 3J81M 3KHNA 3CCRF 5FNVB 3FFMA 1X25A 4ZOLB 2CWJA 3IMPA 5KX5A 4G4YA 3WGNA 1SZQA 1SA0B 5CA0A 3ZOPA 2BTQB 1JN1A 1W59A 2JNBA 1GX1A 2VAPA 5C8YB 5EAZA 4F6RB 1IV2A 2HP0A 2R6R1 1YJ9F 5CB4A 5JQGA 3CCQF 3PLAC 3CD6F 5GAPK 3OONA 4X3LA 2IAFA 4I4TB 3RYIB 2AIZP 4ZHYB 4U3JB 4B5CA 2MQEA 3LFOA 2RHJA 3CC7F 3IR9A 1JFFB 5LOVB 2H8EA 3HKBB
chains in the Genus database with same CATH topology
4BW0B 4BVTA 5HY4A 1NMUB 3CCJF 3SIVA 3V7QA 5HWEA 1YI2F 3E20B 4BY9D 5IT9M 1W40A 1W3EX 2HVYD 3NMUC 2OTLF 1T0KB 1XBIA 2VGMA 5HXZA 3SIUA 3JAMM 1VQ4F 1K9MH 1X7OA 3G6EF 2BO1A 3LWPC 3V3TA 1X7PA 4EI7A 1Q7YH 1YIJF 3CCLF 1QVGF 3V7EA 2LBXA 1RA4A 1VQ5F 4BVQA 3CG6A 3N4YA 2OZBA 1GZ0A 3LWOC 1VQLF 4X3MA 3VMFB 3RA6A 1Q86H 3CCSF 2F9ZC 3LWQC 1W41A 1X52A 3CCVF 3CCEF 2KG4A 4TZZA 1N8RH 2FGYA 5FLXM 1Q81H 5G4UC 5G4VC 1KQSF 3D00A 1DT9A 3O85A 1YJNF 1VQNF 1Q82H 3NVIB 1W2BF 3CCUF 3J7AR 2OTJF 1NJIH 5DCVA 2QA4F 2WALA 3CC4F 3NK7A 3CCMF 1GO0A 1SDSA 3I55F 3I56F 1K8AH 4NQ3A 3NVKE 1VQ7F 1IPAA 5HXUA 3LWRC 2I6DA 1H7MA 3G4SF 3OW2F 4XCQA 5EWRA 1YHQF 1YITF 3ON1A 1ZWZA 3NK6A 1M1KH 3MCAB 1VQPF 1YJWF 1KC8H 4BVSA 1E7KA 3HJWC 3JCMM 3PAFA 1QVFF 5GINC 3CMEF 5GIOC 2AIFA 3J80M 3J81M 1VQ9F 1CK2A 2KTVA 3AGKA 5HY0A 3LWVC 3CCRF 5FJ4C 3CPWF 3HAXD 3FFMA 2ALEA 3N4ZA 1M90H 1VQ8F 1W42A 4EI9A 4NUTA 1CN7A 1KD1H 4BVRA 5EO3A 5GIPC 3GYQA 2JNBA 3CC2F 5GANK 1K73H 4C4WC 1RLGA 2CZWA 1JJ2F 1VQMF 3CPQA 3G71F 1YJ9F 2VGNA 5A2QM 3CCQF 2OHWA 3CD6F 3PLAC 5GAPK 4X3LA 5HY1A 2KTUA 2LBWA 2FC3A 3RA5A 1S72F 3OBWA 1VQKF 3E1YA 4LCKA 3LFOA 5HY2A 3CC7F 3IR9A 3VI6A 1VQ6F 3OBYA 1PXWA 3WXMB 2QI2A 4EI8A 1VQOF 3CXCF 1GO1A 2QEXF 2GLZA 3CMAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW0 B;  1NMU B;  3SIV A;  3V7Q A;  1YI2 F;  3E20 B;  4BY9 D;  5IT9 M;  1W40 A;  1W3E X;  2HVY D;  3NMU C;  2OTL F;  1T0K B;  1XBI A;  2VGM A;  3SIU A;  3JAM M;  1VQ4 F;  1K9M H;  1X7O A;  3G6E F;  2BO1 A;  3LWP C;  1X7P A;  1Q7Y H;  1YIJ F;  3CCL F;  1QVG F;  3V7E A;  2LBX A;  1RA4 A;  1VQ5 F;  3CG6 A;  3N4Y A;  2OZB A;  1GZ0 A;  3LWO C;  1VQL F;  4X3M A;  3VMF B;  3RA6 A;  1Q86 H;  3CCS F;  3LWQ C;  1W41 A;  1X52 A;  3CCV F;  3CCE F;  2KG4 A;  4TZZ A;  1N8R H;  5FLX M;  1Q81 H;  5G4U C;  5G4V C;  1KQS F;  1DT9 A;  3O85 A;  1YJN F;  1VQN F;  1Q82 H;  3NVI B;  1W2B F;  3CCU F;  3J7A R;  2OTJ F;  1NJI H;  5DCV A;  2QA4 F;  2WAL A;  3CC4 F;  3NK7 A;  3CCM F;  1GO0 A;  1SDS A;  3I55 F;  3I56 F;  1K8A H;  3NVK E;  1VQ7 F;  1IPA A;  3LWR C;  2I6D A;  1H7M A;  3G4S F;  3OW2 F;  5EWR A;  1YHQ F;  1YIT F;  3ON1 A;  1ZWZ A;  3NK6 A;  1M1K H;  3MCA B;  1VQP F;  1YJW F;  1KC8 H;  1E7K A;  3HJW C;  3JCM M;  3PAF A;  1QVF F;  5GIN C;  3CME F;  5GIO C;  2AIF A;  3J80 M;  3J81 M;  1VQ9 F;  1CK2 A;  2KTV A;  3AGK A;  3LWV C;  3CCR F;  5FJ4 C;  3CPW F;  3HAX D;  3FFM A;  2ALE A;  3N4Z A;  1M90 H;  1VQ8 F;  1W42 A;  1CN7 A;  4NUT A;  1KD1 H;  5EO3 A;  5GIP C;  3GYQ A;  2JNB A;  3CC2 F;  5GAN K;  1K73 H;  4C4W C;  1RLG A;  2CZW A;  1JJ2 F;  1VQM F;  3CPQ A;  3G71 F;  1YJ9 F;  2VGN A;  5A2Q M;  3CCQ F;  2OHW A;  3CD6 F;  3PLA C;  5GAP K;  4X3L A;  2KTU A;  2LBW A;  2FC3 A;  3RA5 A;  1S72 F;  3OBW A;  1VQK F;  3E1Y A;  4LCK A;  3LFO A;  3CC7 F;  3IR9 A;  3VI6 A;  1VQ6 F;  3OBY A;  1PXW A;  3WXM B;  2QI2 A;  1VQO F;  3CXC F;  1GO1 A;  2QEX F;  3CCJ F;  3CMA F; 
#chains in the Genus database with same CATH topology
 3RYF A;  5HY4 A;  4G88 A;  3CB2 A;  3E20 B;  5LYJ A;  5EYP A;  3N2K B;  4ZI7 B;  1FFX A;  3JAT B;  4ZHQ A;  3P4E A;  3WJQ A;  1ONI A;  1W58 1;  3NMU C;  1SA0 A;  2W8B C;  2OTL F;  4M8I A;  5LP6 A;  3SIU A;  3JAR B;  3F0D A;  1W55 A;  1J7H A;  4F6R A;  4U39 A;  2YXZ A;  4O2A B;  3CCL F;  1QVG F;  2LBX A;  5LP6 C;  4BVQ A;  3CG6 A;  3N4Y A;  4G4X A;  3JAK B;  2HRU A;  3HWU A;  4EB6 B;  3ELC A;  3C8L A;  2DYY A;  5EB1 B;  4YJ3 A;  4I55 A;  5FLX M;  5CA1 B;  3D00 A;  3O85 A;  1W2B F;  3CCU F;  4BT2 A;  3JVH A;  4PWT A;  4FFB A;  1CLI A;  3VYT C;  1QAH A;  1VQV A;  2WAL A;  3JAS B;  1FNK A;  5EIB C;  3CCM F;  2IG8 A;  3LME A;  5EZY B;  1JY8 A;  3IEW A;  3OW2 F;  4LNU B;  3JAL B;  2L26 A;  2BTU A;  5AVM A;  3KJK A;  5MN6 A;  1KNJ A;  1VQP F;  1KC8 H;  2NMU A;  2Z1U A;  2UZH A;  3WGL A;  3CME F;  2CVL A;  5KX5 B;  1VQ9 F;  1U43 A;  2PMP A;  3VOB A;  5CA0 B;  3AGK A;  5GON A;  5HY0 A;  3VTI C;  3LWV C;  4BT3 A;  5FJ4 C;  4YJ2 A;  4TUY A;  2EWC A;  1M90 H;  3JAW A;  4EI9 A;  1CN7 A;  2HP0 B;  3RYC A;  5CB4 B;  5JQG B;  1KD1 H;  4I50 A;  3Q8H A;  3VYS C;  4C8E A;  3GYQ A;  5GAN K;  3WPW A;  2CZW A;  2KGW A;  1JJ2 F;  3JAS A;  3TD3 A;  3CPQ A;  5IYZ A;  4O2B A;  2OHW A;  4ZK7 A;  5HY1 A;  4DRX A;  2HP3 A;  3OBW A;  4RHA A;  1VQK F;  3RYF B;  3T80 A;  3MQW A;  3VI6 A;  3OBY A;  3S02 A;  5IJ0 A;  1GO1 A;  2RHO A;  5LYJ B;  2GLZ A;  5EYP B;  3F0G A;  1FFX B;  4ZHQ B;  3U0O A;  5HWE A;  5MN5 A;  2DT4 A;  5LP6 B;  1W40 A;  1W3E X;  2HVY D;  3DC2 A;  2HS4 A;  1XRG A;  1T0K B;  1W57 A;  5EB0 A;  5HXZ A;  1K9M H;  2BO1 A;  3LWP C;  3V3T A;  1IV3 A;  4O4I A;  1Q7Y H;  3M84 A;  1VK3 A;  3V7E A;  2I6R A;  3TD5 A;  4YJ3 B;  1W5E A;  4I55 B;  4KWE A;  2ZVY A;  4X3M A;  2CW4 A;  5KMG A;  3RA6 A;  2Q1X A;  2B33 A;  1W41 A;  2V9Y A;  3K0T A;  4FFB B;  2CSL A;  3CCE F;  1N8R H;  1RLU A;  2FGY A;  4ERH A;  3L7Q A;  3MCQ A;  2UYN A;  4X1Y B;  1Q82 H;  4G4Z A;  1NJI H;  2QA4 F;  5HP7 A;  3CC4 F;  2G9I A;  1GO0 A;  1OAP A;  3HKE A;  1K8A H;  4NQ3 A;  1XHO A;  4BT7 A;  1IPA A;  2ZAU A;  1H7M A;  3LYB A;  1R1M A;  4X1I A;  3RE3 A;  3WGJ A;  3S03 A;  2YYE A;  4C82 A;  1YHQ F;  5LXT A;  3ON1 A;  1Z5V A;  1ZWZ A;  5GON B;  1VH8 A;  3MCA B;  4B46 A;  4ZHW A;  5B8F A;  4YJ2 B;  2UYJ A;  4B45 A;  1YJW F;  1E7K A;  4TUY B;  3UT5 A;  1PF5 A;  5GIN C;  3JAW B;  5GIO C;  3J80 M;  1JD1 A;  3RYC B;  4I50 B;  5ITZ A;  3K2X A;  3D01 A;  3CPW F;  3HAX D;  2ALE A;  2PHN A;  3F6M A;  1ODE A;  1W42 A;  2VAW A;  4WBN A;  3ZP4 A;  4X1Y A;  4O2B B;  4BVR A;  5IYZ B;  5GIP C;  4DRX B;  3CC2 F;  2RHH A;  3FBA A;  1VQM F;  2HS3 A;  2VGN A;  4E6E A;  3QHD A;  5IJ0 B;  3I7T A;  2KTU A;  2LBW A;  1Q8R A;  3TD4 A;  2FC3 A;  2IQQ A;  3GHZ A;  3K14 A;  3RA5 A;  3I3F A;  1S72 F;  1RQ7 A;  2HS0 A;  5HY2 A;  3DDN A;  1VQ6 F;  4O4H B;  5BMV A;  2HX0 A;  3RYH A;  2QI2 A;  2Z01 A;  3WXM B;  1VQO F;  1VQ7 F;  3CCJ F;  3B6N A;  1TVK B;  3ZO8 A;  4X1K A;  4BW0 B;  4BVT A;  4BT4 A;  1RQ2 A;  3P0Z A;  3SIV A;  1OFU A;  3HKC A;  1YI2 F;  4BY9 D;  5IT9 M;  5J2T A;  2Q1Y A;  4HNA B;  3ESJ A;  3P10 A;  4TV8 A;  4O4I B;  3S06 A;  3JAM M;  3E22 A;  1VQ4 F;  2H8C A;  1X7O A;  1UFY A;  3VCZ A;  3G6E F;  3N2G A;  3WGK A;  1X7P A;  4EI7 A;  3BYQ A;  5JVD A;  2ZOD A;  3KJJ A;  1RA4 A;  5KMG B;  4O4H A;  2OZB A;  1FSZ A;  3WJP A;  3LWO C;  2N48 A;  4IHJ A;  1TVK A;  1W5F A;  3CCS F;  2UYN B;  2F9Z C;  3CCV F;  4TV9 A;  2KG4 A;  3WPX A;  4C8I A;  4IIJ A;  4TZZ A;  2HRY A;  2RHL A;  1Q81 H;  5G4U C;  1KQS F;  2Z1T A;  3HKE B;  1DT9 A;  1T0A A;  4HNA A;  3J7A R;  3C9R A;  3EOR A;  2QTP A;  4X20 A;  4X1I B;  1TUB A;  3NK7 A;  3I55 F;  5LXT B;  3F0E A;  3HTN A;  1IV4 A;  1COM A;  3MDO A;  3IKF A;  2I6D A;  4XCQ A;  2CHT A;  5EWR A;  3UT5 B;  3S0W A;  2GZL A;  1YIT F;  5LA6 A;  3NK6 A;  1M1K H;  3D54 A;  3S0Y A;  5ITZ B;  5HP8 A;  3KE1 A;  2ZF8 A;  3HJW C;  1VHA A;  3K12 A;  4R40 B;  2AMT A;  1KNK A;  2AIF A;  3VOA A;  5IJ9 A;  4WBN B;  5JH7 B;  1CK2 A;  1FNJ A;  2KTV A;  2LCA A;  1H47 A;  1U3L A;  4O4L A;  1IV1 A;  2RB9 A;  3HKD A;  3N4Z A;  2P6Y A;  4O4J A;  1VQ8 F;  1YGY A;  4DXD A;  4NUT A;  4RQO A;  1U3P A;  3IEQ A;  4NWO B;  5EO3 A;  5FNV A;  4ZHV A;  4ZOL A;  1K73 H;  4G4V A;  4C4W C;  1RLG A;  5JCO A;  2GVI A;  4B62 A;  3G71 F;  1H48 A;  2VXY A;  5EIB D;  1U40 A;  5A2Q M;  3M1X A;  5BMV B;  3RYH B;  5C8Y A;  2VAM A;  5MN4 A;  1Z5W A;  4X1K B;  3E1Y A;  4LCK A;  5JCO C;  2R75 1;  3VO8 A;  1PXW A;  3HKC B;  4I4T A;  4EI8 A;  3RYI A;  3CXC F;  4U3J A;  2QEX F;  5J2T B;  3CMA F;  1JFF A;  3C9U A;  3M4S A;  1NMU B;  4TV8 B;  3KIZ A;  3V7Q A;  5JH7 A;  3C9S A;  3CYP B;  5LOV A;  2CHS A;  3R0P A;  2Z1F A;  3HKB A;  3E22 B;  3N2G B;  4BT5 A;  3S0H A;  5JVD B;  1XBI A;  4BT6 A;  2VGM A;  2OTM A;  3N2K A;  4ZI7 A;  3JAT A;  1UI9 A;  4C8G A;  3GTZ A;  2H6L A;  1W5A A;  1YIJ F;  3QTY A;  3V4D A;  4IHJ B;  1YQN A;  3C9T A;  3JAR A;  1VQ5 F;  1QD9 A;  2HQS C;  1W5B A;  4O2A A;  3WJR A;  1QU9 A;  4TV9 B;  1GZ0 A;  2ZVZ A;  3QUW A;  4IIJ B;  1VQL F;  3FD5 A;  5J2U B;  3VMF B;  3MBM A;  1Q86 H;  3LWQ C;  1X52 A;  3FD6 A;  1NQ3 A;  3JAK A;  3VIU A;  4X20 B;  2K1S A;  4G4W A;  1TUB B;  5G4V C;  4EB6 A;  1YJN F;  1VQN F;  3NVI B;  2OTJ F;  2ZOV A;  3ZP7 A;  3F0F A;  2BTO A;  4C81 A;  3WGM A;  5DCV A;  5CA1 A;  1DBF A;  1SDS A;  3I56 F;  3IKE A;  3NVK E;  3CYQ A;  2Z1E A;  5LA6 B;  5HXU A;  3LWR C;  3G4S F;  3FPI A;  3LDT A;  5IJ9 B;  5EZY A;  4O4L B;  2LBT A;  3ERN A;  4BVS A;  4LNU A;  1XV2 A;  3JAL A;  3HKD B;  3PAF A;  3JCM M;  2UYK A;  1QVF F;  4O4J B;  2UYP A;  3VYU C;  5J2U A;  3J81 M;  3KHN A;  3CCR F;  5FNV B;  3FFM A;  1X25 A;  4ZOL B;  2CWJ A;  3IMP A;  5KX5 A;  4G4Y A;  3WGN A;  1SZQ A;  1SA0 B;  5CA0 A;  3ZOP A;  2BTQ B;  1JN1 A;  1W59 A;  2JNB A;  1GX1 A;  2VAP A;  5C8Y B;  5EAZ A;  4F6R B;  1IV2 A;  2HP0 A;  2R6R 1;  1YJ9 F;  5CB4 A;  5JQG A;  3CCQ F;  3PLA C;  3CD6 F;  5GAP K;  3OON A;  4X3L A;  2IAF A;  4I4T B;  3RYI B;  2AIZ P;  4ZHY B;  4U3J B;  4B5C A;  2MQE A;  3LFO A;  2RHJ A;  3CC7 F;  3IR9 A;  1JFF B;  5LOV B;  2H8E A;  3HKB B; 
#chains in the Genus database with same CATH homology
 4BW0 B;  4BVT A;  5HY4 A;  1NMU B;  3CCJ F;  3SIV A;  3V7Q A;  5HWE A;  1YI2 F;  3E20 B;  4BY9 D;  5IT9 M;  1W40 A;  1W3E X;  2HVY D;  3NMU C;  2OTL F;  1T0K B;  1XBI A;  2VGM A;  5HXZ A;  3SIU A;  3JAM M;  1VQ4 F;  1K9M H;  1X7O A;  3G6E F;  2BO1 A;  3LWP C;  3V3T A;  1X7P A;  4EI7 A;  1Q7Y H;  1YIJ F;  3CCL F;  1QVG F;  3V7E A;  2LBX A;  1RA4 A;  1VQ5 F;  4BVQ A;  3CG6 A;  3N4Y A;  2OZB A;  1GZ0 A;  3LWO C;  1VQL F;  4X3M A;  3VMF B;  3RA6 A;  1Q86 H;  3CCS F;  2F9Z C;  3LWQ C;  1W41 A;  1X52 A;  3CCV F;  3CCE F;  2KG4 A;  4TZZ A;  1N8R H;  2FGY A;  5FLX M;  1Q81 H;  5G4U C;  5G4V C;  1KQS F;  3D00 A;  1DT9 A;  3O85 A;  1YJN F;  1VQN F;  1Q82 H;  3NVI B;  1W2B F;  3CCU F;  3J7A R;  2OTJ F;  1NJI H;  5DCV A;  2QA4 F;  2WAL A;  3CC4 F;  3NK7 A;  3CCM F;  1GO0 A;  1SDS A;  3I55 F;  3I56 F;  1K8A H;  4NQ3 A;  3NVK E;  1VQ7 F;  1IPA A;  5HXU A;  3LWR C;  2I6D A;  1H7M A;  3G4S F;  3OW2 F;  4XCQ A;  5EWR A;  1YHQ F;  1YIT F;  3ON1 A;  1ZWZ A;  3NK6 A;  1M1K H;  3MCA B;  1VQP F;  1YJW F;  1KC8 H;  4BVS A;  1E7K A;  3HJW C;  3JCM M;  3PAF A;  1QVF F;  5GIN C;  3CME F;  5GIO C;  2AIF A;  3J80 M;  3J81 M;  1VQ9 F;  1CK2 A;  2KTV A;  3AGK A;  5HY0 A;  3LWV C;  3CCR F;  5FJ4 C;  3CPW F;  3HAX D;  3FFM A;  2ALE A;  3N4Z A;  1M90 H;  1VQ8 F;  1W42 A;  4EI9 A;  4NUT A;  1CN7 A;  1KD1 H;  4BVR A;  5EO3 A;  5GIP C;  3GYQ A;  2JNB A;  3CC2 F;  5GAN K;  1K73 H;  4C4W C;  1RLG A;  2CZW A;  1JJ2 F;  1VQM F;  3CPQ A;  3G71 F;  1YJ9 F;  2VGN A;  5A2Q M;  3CCQ F;  2OHW A;  3CD6 F;  3PLA C;  5GAP K;  4X3L A;  5HY1 A;  2KTU A;  2LBW A;  2FC3 A;  3RA5 A;  1S72 F;  3OBW A;  1VQK F;  3E1Y A;  4LCK A;  3LFO A;  5HY2 A;  3CC7 F;  3IR9 A;  3VI6 A;  1VQ6 F;  3OBY A;  1PXW A;  3WXM B;  2QI2 A;  4EI8 A;  1VQO F;  3CXC F;  1GO1 A;  2QEX F;  2GLZ A;  3CMA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...