3VI6A

Crystal structure of human ribosomal protein l30e
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S ribosomal protein L30
publication title Crystallization and preliminary X-ray structure analysis of human ribosomal protein L30e
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribosomal protein
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3vi6A00
3HAXD 3CMEF 3LWVC 3CCLF 3CCUF 1IPAA 1X7PA 3IR9A 3CCMF 1XBIA 3MCAB 1W42A 1KD1H 1YJ9F 1RA4A 2VGMA 1X52A 4TZZA 3RA5A 4LCKA 3J81M 1X7OA 3OW2F 3CCVF 1W40A 1RLGA 5G4UC 5GAPK 2WALA 3LFOA 5EWRA 1VQ8F 5GANK 3I56F 5FJ4C 4BY9D 3CCSF 1Q82H 2QEXF 1VQOF 3WXMB 1GO0A 2KG4A 5GIOC 2ALEA 1KC8H 3NVKE 3JCMM 5G4VC 1K9MH 3CCRF 4NUTA 1DT9A 3FFMA 3LWQC 3VMFB 1Q86H 1VQ4F 1E7KA 1GZ0A 1W3EX 3GYQA 3AGKA 3G4SF 3CG6A 1GO1A 1NJIH 1QVGF 1T0KB 3SIUA 3N4ZA 3O85A 1S72F 2LBWA 3OBWA 1VQ9F 3CCEF 1YHQF 3G71F 2OTJF 2I6DA 2HVYD 3N4YA 1JJ2F 1N8RH 3NVIB 2QA4F 2AIFA 3PAFA 3LWOC 2FC3A 1QVFF 1KQSF 3RA6A 3J80M 2QI2A 5EO3A 2JNBA 3E20B 4X3MA 3OBYA 1VQMF 3CC7F 4C4WC 2KTVA 2BO1A 1K73H 3NMUC 3CCQF 3VI6A 1VQPF 1M1KH 1PXWA 1VQ6F 1H7MA 1ZWZA 1YI2F 1NMUB 5GINC 3CC2F 3LWRC 3HJWC 3CC4F 3PLAC 3CMAF 3CCJF 1CN7A 1Q81H 1SDSA 3NK7A 3NK6A 3V7QA 5DCVA 2VGNA 3I55F 1YITF 3CPQA 1W2BF 1VQNF 1W41A 3J7AR 1K8AH 5IT9M 2CZWA 5FLXM 3CD6F 2OHWA 3E1YA 5A2QM 1YJNF 1YJWF 1VQLF 2OZBA 3JAMM 4X3LA 3ON1A 3G6EF 1VQKF 3SIVA 1CK2A 3CPWF 3LWPC 2KTUA 4BW0B 2LBXA 1VQ5F 5GIPC 1VQ7F 2OTLF 3V7EA 1M90H 1YIJF 1Q7YH 3CXCF
chains in the Genus database with same CATH superfamily
3CMEF 3WPXA 3LWVC 3CCLF 5FNVA 5MN4A 3IR9A 3MDOA 3VIUA 1SZQA 4EB6B 3N2KB 4F6RB 1W5BA 3IEQA 4X1YA 3S0WA 3IKFA 5B8FA 3JASA 1X52A 1QAHA 3RA5A 3VO8A 5C8YA 4DXDA 2DYYA 3M84A 1JY8A 2WALA 5GANK 4C81A 4BY9D 1IV2A 3CCSF 3R0PA 5BMVB 2FGYA 4LNUB 4I50A 5LYJA 4I55B 3S03A 4O2AB 4BT7A 3ZOPA 5IYZB 2HS4A 1K9MH 4G4WA 5J2TB 3CCRF 4BVSA 3LWQC 1VQ4F 3RYHB 3AGKA 3G4SF 3VTIC 2F9ZC 2R751 2LBWA 5IJ9B 1SA0A 3D54A 3JAKA 5LP6B 2UZHA 3RYFB 1N8RH 2HVYD 2H6LA 4BT5A 5CA1B 4DRXA 3GTZA 2RHJA 2QTPA 1KQSF 3RE3A 5JVDA 3HKDB 2QI2A 2HQSC 1U40A 1VQMF 4C4WC 5LOVB 2KTVA 2BO1A 3CYQA 5MN6A 3HKCA 4O4HB 4TV9B 2Z1TA 4C8EA 3DC2A 3P4EA 4ZHQB 3JARA 1NMUB 4U3JA 5GINC 1NQ3A 5ITZB 3CCJF 4ZOLA 5EYPB 3IEWA 1Q81H 1SDSA 3NK7A 4X1IB 5J2UB 3VOBA 2VGNA 1YITF 1TVKB 1TUBA 4O4LB 3MQWA 3N2GA 1K8AH 5FLXM 2OHWA 4WBNA 5A2QM 3C9SA 3C9UA 4G4XA 1ODEA 1VQKF 2CVLA 3G6EF 3KHNA 3SIVA 4HNAA 1CK2A 4TUYB 2G9IA 3ZP4A 2UYNB 1ONIA 2BTUA 4BW0B 3K0TA 5LXTB 2GVIA 1VQ7F 1XV2A 2OTLF 1W57A 3F0DA 5JH7A 2AIZP 3CXCF 3CCUF 3KE1A 1IPAA 4EB6A 5KX5B 3N2KA 4F6RA 1XBIA 4G4VA 4IHJA 1YQNA 1FNKA 1YJ9F 2ZF8A 2VGMA 3QUWA 4TZZA 4LCKA 3VYSC 4TV8A 1H47A 1X7OA 3JALB 3JVHA 1RLGA 1R1MA 2ZVZA 2ZOVA 5EWRA 5FJ4C 4M8IA 5BMVA 1Q82H 4O2BB 4EI7A 4NWOB 4I55A 3WXMB 3U0OA 4ZHVA 4G4YA 4O2AA 2HRUA 3M4SA 5IYZA 3LMEA 3NVKE 1YGYA 5J2TA 3D01A 3FFMA 2Z01A 3S0YA 3VMFB 1Z5WA 3WGKA 3K12A 1W3EX 3GYQA 3QHDA 1NJIH 3HTNA 1QVGF 2VAPA 3S02A 2RB9A 3V3TA 1X25A 3IMPA 3JATB 2W8BC 5JCOA 2OTJF 5LP6A 3RYFA 2I6DA 3MCQA 3N4YA 2IAFA 2UYPA 5CA1A 2Z1FA 3KJKA 4X1KA 3C9TA 3LWOC 4EI8A 4O4IB 2GLZA 3VYUC 1QVFF 2Q1XA 3HKDA 2VAWA 2ZAUA 2HP3A 5EO3A 2JNBA 5LOVA 3CC7F 3HKBA 1K73H 2R6R1 4PWTA 3CCQF 5JQGB 4X20B 3VI6A 1OAPA 3F0GA 4ZHQA 2H8EA 4ZI7A 3KIZA 2LBTA 2CHTA 3I7TA 2Z1EA 3M1XA 5IJ0B 3WJPA 5ITZA 3JAWB 1GX1A 5CB4B 5HY4A 3FBAA 5EYPA 2OTMA 1Q8RA 1Z5VA 3EORA 3CMAF 3CC4F 3PLAC 4X1IA 3NK6A 3MBMA 3GHZA 5DCVA 3VYTC 1TVKA 4O4LA 3I55F 3CPQA 2BTQB 2YXZA 4XCQA 5HP7A 4YJ2A 2K1SA 1JN1A 2VAMA 4X1YB 1U43A 1VQLF 5KMGA 2OZBA 1UI9A 3JAMM 2VXYA 3ON1A 3WPWA 4TUYA 2UYNA 3CPWF 3LWPC 5HY0A 5HXZA 5LXTA 5GIPC 1FNJA 3TD5A 5HWEA 1PF5A 3WGJA 5KX5A 2MQEA 1X7PA 4BT6A 4FFBB 3CCMF 1RQ7A 1VQVA 4O4JB 1FFXA 1W42A 2HRYA 1KD1H 1COMA 1JFFB 3RYIB 3TD3A 1U3PA 3F6MA 2I6RA 2ZVYA 3E22B 3K14A 4G4ZA 5GAPK 4RQOA 3LFOA 3VOAA 1VQ8F 1UFYA 1VHAA 3JAKB 1XRGA 4KWEA 3ESJA 2EWCA 2NMUA 4EI9A 2CWJA 3ZO8A 1GO0A 2KG4A 4B62A 5GIOC 2ALEA 1KC8H 5JCOC 5GONB 5EZYB 3JCMM 5LP6C 5G4VC 4C82A 1DT9A 5EIBC 1IV4A 1Q86H 3QTYA 2CW4A 1GZ0A 2CHSA 3CG6A 4C8GA 1GO1A 3SIUA 5LA6B 1VK3A 3O85A 5HXUA 2IQQA 3CCEF 1W55A 4I4TB 1JJ2F 4ZOLB 2QA4F 4LNUA 2AIFA 1QU9A 4BVRA 3ZP7A 3RA6A 3RYCB 2BTOA 3WGMA 1W5FA 2IG8A 2RHHA 2PMPA 2L26A 3N2GB 3RYHA 1IV1A 4B46A 2KGWA 2YYEA 4X20A 4B5CA 4ZK7A 4BT4A 5JQGA 2H8CA 3NMUC 2P6YA 1PXWA 1VQ6F 1H7MA 4HNAB 3WJRA 2V9YA 5IJ0A 1KNKA 2N48A 3CC2F 3JAWA 5CB4A 3LWRC 3UT5B 5IJ9A 3CB2A 3F0EA 3HKEB 1CN7A 2UYKA 5MN5A 3BYQA 4YJ3B 1J7HA 1QD9A 1VQNF 1W41A 4IHJB 3WJQA 5IT9M 3E1YA 3T80A 4NQ3A 2B33A 1YJNF 2RHLA 1U3LA 4TV8B 4O4HA 4TV9A 4X3LA 4IIJB 3P10A 4C8IA 5CA0B 1VQ5F 2HP0B 3V7EA 1M90H 1YIJF 1Q7YH 5HY1A 3HAXD 4ZHWA 5J2UA 5FNVB 5HP8A 1OFUA 4FFBA 2HS0A 4O4JA 3FD6A 4BT2A 4G88A 3MCAB 2HX0A 1JFFA 3RYIA 1RA4A 4U39A 3JASB 5EAZA 1IV3A 3J81M 3OW2F 3CCVF 1XHOA 3E22A 3F0FA 1W40A 4R40B 5C8YB 5G4UC 1W59A 3I56F 4BVTA 4RHAA 2QEXF 4X1KB 1VQOF 5EB0A 2CSLA 4I50B 2Q1YA 5LYJB 1W5AA 5GONA 5EZYA 3C8LA 3WGNA 2DT4A 4NUTA 1CLIA 3VCZA 1E7KA 3HKBB 3L7QA 3K2XA 1T0KB 5LA6A 3LYBA 2RHOA 3I3FA 3N4ZA 4ZI7B 3JALA 4E6EA 1S72F 3FPIA 3OBWA 3KJJA 1VQ9F 1W581 1YHQF 3G71F 4I4TA 1JD1A 3DDNA 1SA0B 4BT3A 4O2BA 3OONA 3NVIB 1RLUA 3PAFA 2FC3A 3D00A 4DRXB 3RYCA 3P0ZA 1H48A 4BVQA 2GZLA 3J80M 5JVDB 3S06A 4YJ2B 2UYJA 5HY2A 5EB1B 3TD4A 3E20B 4X3MA 3OBYA 5KMGB 1VQPF 1M1KH 1VH8A 3HKCB 1ZWZA 5AVMA 1YI2F 3JARB 3LDTA 3JATA 4U3JB 4ZHYB 2ZODA 3ELCA 2Z1UA 1W5EA 2AMTA 3UT5A 1T0AA 3HJWC 3ERNA 4ERHA 3HKEA 3WGLA 3IKEA 3S0HA 3C9RA 1RQ2A 4O4IA 3V7QA 1W2BF 4YJ3A 1TUBB 2PHNA 2LCAA 3J7AR 1FFXB 3FD5A 2CZWA 3CD6F 1YJWF 3HWUA 4WBNB 1FSZA 3B6NA 1KNJA 4B45A 4IIJA 3V4DA 2KTUA 5EIBD 5CA0A 2HS3A 1DBFA 2LBXA 2HP0A 3CYPB 5JH7B 3Q8HA
chains in the Genus database with same CATH topology
3HAXD 3CMEF 3LWVC 3CCLF 3CCUF 5HWEA 1IPAA 1X7PA 3IR9A 3CCMF 1XBIA 3MCAB 1W42A 1KD1H 1YJ9F 1RA4A 2VGMA 1X52A 4TZZA 3RA5A 4LCKA 3J81M 1X7OA 3OW2F 3CCVF 1W40A 1RLGA 5G4UC 5GAPK 2WALA 3LFOA 5EWRA 1VQ8F 5GANK 3I56F 5FJ4C 4BY9D 4BVTA 3CCSF 1Q82H 2QEXF 4EI7A 4EI9A 2FGYA 1VQOF 3WXMB 1GO0A 2KG4A 5GIOC 2ALEA 1KC8H 3NVKE 3JCMM 5G4VC 1K9MH 3CCRF 4NUTA 1DT9A 3FFMA 4BVSA 3LWQC 3VMFB 1Q86H 1VQ4F 1E7KA 1GZ0A 1W3EX 3GYQA 3AGKA 3G4SF 3CG6A 1GO1A 2F9ZC 1NJIH 1QVGF 1T0KB 3SIUA 3N4ZA 3V3TA 3O85A 5HXUA 1S72F 2LBWA 3OBWA 1VQ9F 3CCEF 1YHQF 3G71F 2OTJF 2I6DA 2HVYD 3N4YA 1JJ2F 1N8RH 3NVIB 2QA4F 2AIFA 3PAFA 3LWOC 4EI8A 2FC3A 3D00A 4BVRA 2GLZA 1QVFF 1KQSF 3RA6A 4BVQA 3J80M 2QI2A 5EO3A 5HY2A 2JNBA 3E20B 4X3MA 3OBYA 1VQMF 3CC7F 4C4WC 2KTVA 2BO1A 1K73H 3NMUC 3CCQF 3VI6A 1VQPF 1M1KH 1PXWA 1VQ6F 1H7MA 1ZWZA 1YI2F 1NMUB 5GINC 3CC2F 3LWRC 3HJWC 5HY4A 3CC4F 3PLAC 3CMAF 3CCJF 1CN7A 1Q81H 1SDSA 3NK7A 3NK6A 3V7QA 5DCVA 2VGNA 3I55F 1YITF 3CPQA 1W2BF 1VQNF 4XCQA 1W41A 3J7AR 1K8AH 5IT9M 2CZWA 5FLXM 3CD6F 2OHWA 3E1YA 5A2QM 1YJNF 4NQ3A 1YJWF 1VQLF 2OZBA 3JAMM 4X3LA 3ON1A 3G6EF 1VQKF 3SIVA 1CK2A 3CPWF 3LWPC 5HY0A 2KTUA 4BW0B 5HXZA 2LBXA 1VQ5F 5GIPC 1VQ7F 2OTLF 3V7EA 1M90H 1YIJF 1Q7YH 3CXCF 5HY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAX D;  3CME F;  3LWV C;  3CCL F;  3CCU F;  1IPA A;  1X7P A;  3IR9 A;  3CCM F;  1XBI A;  3MCA B;  1W42 A;  1KD1 H;  1YJ9 F;  1RA4 A;  2VGM A;  1X52 A;  4TZZ A;  3RA5 A;  4LCK A;  3J81 M;  1X7O A;  3OW2 F;  3CCV F;  1W40 A;  1RLG A;  5G4U C;  5GAP K;  2WAL A;  3LFO A;  5EWR A;  1VQ8 F;  5GAN K;  3I56 F;  5FJ4 C;  4BY9 D;  3CCS F;  1Q82 H;  2QEX F;  1VQO F;  3WXM B;  1GO0 A;  2KG4 A;  5GIO C;  2ALE A;  1KC8 H;  3NVK E;  3JCM M;  5G4V C;  1K9M H;  3CCR F;  4NUT A;  1DT9 A;  3FFM A;  3LWQ C;  3VMF B;  1Q86 H;  1VQ4 F;  1E7K A;  1GZ0 A;  1W3E X;  3GYQ A;  3AGK A;  3G4S F;  3CG6 A;  1GO1 A;  1NJI H;  1QVG F;  1T0K B;  3SIU A;  3N4Z A;  3O85 A;  1S72 F;  2LBW A;  3OBW A;  1VQ9 F;  3CCE F;  1YHQ F;  3G71 F;  2OTJ F;  2I6D A;  2HVY D;  3N4Y A;  1JJ2 F;  1N8R H;  3NVI B;  2QA4 F;  2AIF A;  3PAF A;  3LWO C;  2FC3 A;  1QVF F;  1KQS F;  3RA6 A;  3J80 M;  2QI2 A;  5EO3 A;  2JNB A;  3E20 B;  4X3M A;  3OBY A;  1VQM F;  3CC7 F;  4C4W C;  2KTV A;  2BO1 A;  1K73 H;  3NMU C;  3CCQ F;  3VI6 A;  1VQP F;  1M1K H;  1PXW A;  1VQ6 F;  1H7M A;  1ZWZ A;  1YI2 F;  1NMU B;  5GIN C;  3CC2 F;  3LWR C;  3HJW C;  3CC4 F;  3PLA C;  3CMA F;  3CCJ F;  1CN7 A;  1Q81 H;  1SDS A;  3NK7 A;  3NK6 A;  3V7Q A;  5DCV A;  2VGN A;  3I55 F;  1YIT F;  3CPQ A;  1W2B F;  1VQN F;  1W41 A;  3J7A R;  1K8A H;  5IT9 M;  2CZW A;  5FLX M;  3CD6 F;  2OHW A;  3E1Y A;  5A2Q M;  1YJN F;  1YJW F;  1VQL F;  2OZB A;  3JAM M;  4X3L A;  3ON1 A;  3G6E F;  1VQK F;  3SIV A;  1CK2 A;  3CPW F;  3LWP C;  2KTU A;  4BW0 B;  2LBX A;  1VQ5 F;  5GIP C;  1VQ7 F;  2OTL F;  3V7E A;  1M90 H;  1YIJ F;  1Q7Y H;  3CXC F; 
#chains in the Genus database with same CATH topology
 3CME F;  3WPX A;  3LWV C;  3CCL F;  5FNV A;  5MN4 A;  3IR9 A;  3MDO A;  3VIU A;  1SZQ A;  4EB6 B;  3N2K B;  4F6R B;  1W5B A;  3IEQ A;  4X1Y A;  3S0W A;  3IKF A;  5B8F A;  3JAS A;  1X52 A;  1QAH A;  3RA5 A;  3VO8 A;  5C8Y A;  4DXD A;  2DYY A;  3M84 A;  1JY8 A;  2WAL A;  5GAN K;  4C81 A;  4BY9 D;  1IV2 A;  3CCS F;  3R0P A;  5BMV B;  2FGY A;  4LNU B;  4I50 A;  5LYJ A;  4I55 B;  3S03 A;  4O2A B;  4BT7 A;  3ZOP A;  5IYZ B;  2HS4 A;  1K9M H;  4G4W A;  5J2T B;  3CCR F;  4BVS A;  3LWQ C;  1VQ4 F;  3RYH B;  3AGK A;  3G4S F;  3VTI C;  2F9Z C;  2R75 1;  2LBW A;  5IJ9 B;  1SA0 A;  3D54 A;  3JAK A;  5LP6 B;  2UZH A;  3RYF B;  1N8R H;  2HVY D;  2H6L A;  4BT5 A;  5CA1 B;  4DRX A;  3GTZ A;  2RHJ A;  2QTP A;  1KQS F;  3RE3 A;  5JVD A;  3HKD B;  2QI2 A;  2HQS C;  1U40 A;  1VQM F;  4C4W C;  5LOV B;  2KTV A;  2BO1 A;  3CYQ A;  5MN6 A;  3HKC A;  4O4H B;  4TV9 B;  2Z1T A;  4C8E A;  3DC2 A;  3P4E A;  4ZHQ B;  3JAR A;  1NMU B;  4U3J A;  5GIN C;  1NQ3 A;  5ITZ B;  3CCJ F;  4ZOL A;  5EYP B;  3IEW A;  1Q81 H;  1SDS A;  3NK7 A;  4X1I B;  5J2U B;  3VOB A;  2VGN A;  1YIT F;  1TVK B;  1TUB A;  4O4L B;  3MQW A;  3N2G A;  1K8A H;  5FLX M;  2OHW A;  4WBN A;  5A2Q M;  3C9S A;  3C9U A;  4G4X A;  1ODE A;  1VQK F;  2CVL A;  3G6E F;  3KHN A;  3SIV A;  4HNA A;  1CK2 A;  4TUY B;  2G9I A;  3ZP4 A;  2UYN B;  1ONI A;  2BTU A;  4BW0 B;  3K0T A;  5LXT B;  2GVI A;  1VQ7 F;  1XV2 A;  2OTL F;  1W57 A;  3F0D A;  5JH7 A;  2AIZ P;  3CXC F;  3CCU F;  3KE1 A;  1IPA A;  4EB6 A;  5KX5 B;  3N2K A;  4F6R A;  1XBI A;  4G4V A;  4IHJ A;  1YQN A;  1FNK A;  1YJ9 F;  2ZF8 A;  2VGM A;  3QUW A;  4TZZ A;  4LCK A;  3VYS C;  4TV8 A;  1H47 A;  1X7O A;  3JAL B;  3JVH A;  1RLG A;  1R1M A;  2ZVZ A;  2ZOV A;  5EWR A;  5FJ4 C;  4M8I A;  5BMV A;  1Q82 H;  4O2B B;  4EI7 A;  4NWO B;  4I55 A;  3WXM B;  3U0O A;  4ZHV A;  4G4Y A;  4O2A A;  2HRU A;  3M4S A;  5IYZ A;  3LME A;  3NVK E;  1YGY A;  5J2T A;  3D01 A;  3FFM A;  2Z01 A;  3S0Y A;  3VMF B;  1Z5W A;  3WGK A;  3K12 A;  1W3E X;  3GYQ A;  3QHD A;  1NJI H;  3HTN A;  1QVG F;  2VAP A;  3S02 A;  2RB9 A;  3V3T A;  1X25 A;  3IMP A;  3JAT B;  2W8B C;  5JCO A;  2OTJ F;  5LP6 A;  3RYF A;  2I6D A;  3MCQ A;  3N4Y A;  2IAF A;  2UYP A;  5CA1 A;  2Z1F A;  3KJK A;  4X1K A;  3C9T A;  3LWO C;  4EI8 A;  4O4I B;  2GLZ A;  3VYU C;  1QVF F;  2Q1X A;  3HKD A;  2VAW A;  2ZAU A;  2HP3 A;  5EO3 A;  2JNB A;  5LOV A;  3CC7 F;  3HKB A;  1K73 H;  2R6R 1;  4PWT A;  3CCQ F;  5JQG B;  4X20 B;  3VI6 A;  1OAP A;  3F0G A;  4ZHQ A;  2H8E A;  4ZI7 A;  3KIZ A;  2LBT A;  2CHT A;  3I7T A;  2Z1E A;  3M1X A;  5IJ0 B;  3WJP A;  5ITZ A;  3JAW B;  1GX1 A;  5CB4 B;  5HY4 A;  3FBA A;  5EYP A;  2OTM A;  1Q8R A;  1Z5V A;  3EOR A;  3CMA F;  3CC4 F;  3PLA C;  4X1I A;  3NK6 A;  3MBM A;  3GHZ A;  5DCV A;  3VYT C;  1TVK A;  4O4L A;  3I55 F;  3CPQ A;  2BTQ B;  2YXZ A;  4XCQ A;  5HP7 A;  4YJ2 A;  2K1S A;  1JN1 A;  2VAM A;  4X1Y B;  1U43 A;  1VQL F;  5KMG A;  2OZB A;  1UI9 A;  3JAM M;  2VXY A;  3ON1 A;  3WPW A;  4TUY A;  2UYN A;  3CPW F;  3LWP C;  5HY0 A;  5HXZ A;  5LXT A;  5GIP C;  1FNJ A;  3TD5 A;  5HWE A;  1PF5 A;  3WGJ A;  5KX5 A;  2MQE A;  1X7P A;  4BT6 A;  4FFB B;  3CCM F;  1RQ7 A;  1VQV A;  4O4J B;  1FFX A;  1W42 A;  2HRY A;  1KD1 H;  1COM A;  1JFF B;  3RYI B;  3TD3 A;  1U3P A;  3F6M A;  2I6R A;  2ZVY A;  3E22 B;  3K14 A;  4G4Z A;  5GAP K;  4RQO A;  3LFO A;  3VOA A;  1VQ8 F;  1UFY A;  1VHA A;  3JAK B;  1XRG A;  4KWE A;  3ESJ A;  2EWC A;  2NMU A;  4EI9 A;  2CWJ A;  3ZO8 A;  1GO0 A;  2KG4 A;  4B62 A;  5GIO C;  2ALE A;  1KC8 H;  5JCO C;  5GON B;  5EZY B;  3JCM M;  5LP6 C;  5G4V C;  4C82 A;  1DT9 A;  5EIB C;  1IV4 A;  1Q86 H;  3QTY A;  2CW4 A;  1GZ0 A;  2CHS A;  3CG6 A;  4C8G A;  1GO1 A;  3SIU A;  5LA6 B;  1VK3 A;  3O85 A;  5HXU A;  2IQQ A;  3CCE F;  1W55 A;  4I4T B;  1JJ2 F;  4ZOL B;  2QA4 F;  4LNU A;  2AIF A;  1QU9 A;  4BVR A;  3ZP7 A;  3RA6 A;  3RYC B;  2BTO A;  3WGM A;  1W5F A;  2IG8 A;  2RHH A;  2PMP A;  2L26 A;  3N2G B;  3RYH A;  1IV1 A;  4B46 A;  2KGW A;  2YYE A;  4X20 A;  4B5C A;  4ZK7 A;  4BT4 A;  5JQG A;  2H8C A;  3NMU C;  2P6Y A;  1PXW A;  1VQ6 F;  1H7M A;  4HNA B;  3WJR A;  2V9Y A;  5IJ0 A;  1KNK A;  2N48 A;  3CC2 F;  3JAW A;  5CB4 A;  3LWR C;  3UT5 B;  5IJ9 A;  3CB2 A;  3F0E A;  3HKE B;  1CN7 A;  2UYK A;  5MN5 A;  3BYQ A;  4YJ3 B;  1J7H A;  1QD9 A;  1VQN F;  1W41 A;  4IHJ B;  3WJQ A;  5IT9 M;  3E1Y A;  3T80 A;  4NQ3 A;  2B33 A;  1YJN F;  2RHL A;  1U3L A;  4TV8 B;  4O4H A;  4TV9 A;  4X3L A;  4IIJ B;  3P10 A;  4C8I A;  5CA0 B;  1VQ5 F;  2HP0 B;  3V7E A;  1M90 H;  1YIJ F;  1Q7Y H;  5HY1 A;  3HAX D;  4ZHW A;  5J2U A;  5FNV B;  5HP8 A;  1OFU A;  4FFB A;  2HS0 A;  4O4J A;  3FD6 A;  4BT2 A;  4G88 A;  3MCA B;  2HX0 A;  1JFF A;  3RYI A;  1RA4 A;  4U39 A;  3JAS B;  5EAZ A;  1IV3 A;  3J81 M;  3OW2 F;  3CCV F;  1XHO A;  3E22 A;  3F0F A;  1W40 A;  4R40 B;  5C8Y B;  5G4U C;  1W59 A;  3I56 F;  4BVT A;  4RHA A;  2QEX F;  4X1K B;  1VQO F;  5EB0 A;  2CSL A;  4I50 B;  2Q1Y A;  5LYJ B;  1W5A A;  5GON A;  5EZY A;  3C8L A;  3WGN A;  2DT4 A;  4NUT A;  1CLI A;  3VCZ A;  1E7K A;  3HKB B;  3L7Q A;  3K2X A;  1T0K B;  5LA6 A;  3LYB A;  2RHO A;  3I3F A;  3N4Z A;  4ZI7 B;  3JAL A;  4E6E A;  1S72 F;  3FPI A;  3OBW A;  3KJJ A;  1VQ9 F;  1W58 1;  1YHQ F;  3G71 F;  4I4T A;  1JD1 A;  3DDN A;  1SA0 B;  4BT3 A;  4O2B A;  3OON A;  3NVI B;  1RLU A;  3PAF A;  2FC3 A;  3D00 A;  4DRX B;  3RYC A;  3P0Z A;  1H48 A;  4BVQ A;  2GZL A;  3J80 M;  5JVD B;  3S06 A;  4YJ2 B;  2UYJ A;  5HY2 A;  5EB1 B;  3TD4 A;  3E20 B;  4X3M A;  3OBY A;  5KMG B;  1VQP F;  1M1K H;  1VH8 A;  3HKC B;  1ZWZ A;  5AVM A;  1YI2 F;  3JAR B;  3LDT A;  3JAT A;  4U3J B;  4ZHY B;  2ZOD A;  3ELC A;  2Z1U A;  1W5E A;  2AMT A;  3UT5 A;  1T0A A;  3HJW C;  3ERN A;  4ERH A;  3HKE A;  3WGL A;  3IKE A;  3S0H A;  3C9R A;  1RQ2 A;  4O4I A;  3V7Q A;  1W2B F;  4YJ3 A;  1TUB B;  2PHN A;  2LCA A;  3J7A R;  1FFX B;  3FD5 A;  2CZW A;  3CD6 F;  1YJW F;  3HWU A;  4WBN B;  1FSZ A;  3B6N A;  1KNJ A;  4B45 A;  4IIJ A;  3V4D A;  2KTU A;  5EIB D;  5CA0 A;  2HS3 A;  1DBF A;  2LBX A;  2HP0 A;  3CYP B;  5JH7 B;  3Q8H A; 
#chains in the Genus database with same CATH homology
 3HAX D;  3CME F;  3LWV C;  3CCL F;  3CCU F;  5HWE A;  1IPA A;  1X7P A;  3IR9 A;  3CCM F;  1XBI A;  3MCA B;  1W42 A;  1KD1 H;  1YJ9 F;  1RA4 A;  2VGM A;  1X52 A;  4TZZ A;  3RA5 A;  4LCK A;  3J81 M;  1X7O A;  3OW2 F;  3CCV F;  1W40 A;  1RLG A;  5G4U C;  5GAP K;  2WAL A;  3LFO A;  5EWR A;  1VQ8 F;  5GAN K;  3I56 F;  5FJ4 C;  4BY9 D;  4BVT A;  3CCS F;  1Q82 H;  2QEX F;  4EI7 A;  4EI9 A;  2FGY A;  1VQO F;  3WXM B;  1GO0 A;  2KG4 A;  5GIO C;  2ALE A;  1KC8 H;  3NVK E;  3JCM M;  5G4V C;  1K9M H;  3CCR F;  4NUT A;  1DT9 A;  3FFM A;  4BVS A;  3LWQ C;  3VMF B;  1Q86 H;  1VQ4 F;  1E7K A;  1GZ0 A;  1W3E X;  3GYQ A;  3AGK A;  3G4S F;  3CG6 A;  1GO1 A;  2F9Z C;  1NJI H;  1QVG F;  1T0K B;  3SIU A;  3N4Z A;  3V3T A;  3O85 A;  5HXU A;  1S72 F;  2LBW A;  3OBW A;  1VQ9 F;  3CCE F;  1YHQ F;  3G71 F;  2OTJ F;  2I6D A;  2HVY D;  3N4Y A;  1JJ2 F;  1N8R H;  3NVI B;  2QA4 F;  2AIF A;  3PAF A;  3LWO C;  4EI8 A;  2FC3 A;  3D00 A;  4BVR A;  2GLZ A;  1QVF F;  1KQS F;  3RA6 A;  4BVQ A;  3J80 M;  2QI2 A;  5EO3 A;  5HY2 A;  2JNB A;  3E20 B;  4X3M A;  3OBY A;  1VQM F;  3CC7 F;  4C4W C;  2KTV A;  2BO1 A;  1K73 H;  3NMU C;  3CCQ F;  3VI6 A;  1VQP F;  1M1K H;  1PXW A;  1VQ6 F;  1H7M A;  1ZWZ A;  1YI2 F;  1NMU B;  5GIN C;  3CC2 F;  3LWR C;  3HJW C;  5HY4 A;  3CC4 F;  3PLA C;  3CMA F;  3CCJ F;  1CN7 A;  1Q81 H;  1SDS A;  3NK7 A;  3NK6 A;  3V7Q A;  5DCV A;  2VGN A;  3I55 F;  1YIT F;  3CPQ A;  1W2B F;  1VQN F;  4XCQ A;  1W41 A;  3J7A R;  1K8A H;  5IT9 M;  2CZW A;  5FLX M;  3CD6 F;  2OHW A;  3E1Y A;  5A2Q M;  1YJN F;  4NQ3 A;  1YJW F;  1VQL F;  2OZB A;  3JAM M;  4X3L A;  3ON1 A;  3G6E F;  1VQK F;  3SIV A;  1CK2 A;  3CPW F;  3LWP C;  5HY0 A;  2KTU A;  4BW0 B;  5HXZ A;  2LBX A;  1VQ5 F;  5GIP C;  1VQ7 F;  2OTL F;  3V7E A;  1M90 H;  1YIJ F;  1Q7Y H;  3CXC F;  5HY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...