5LOVB

Dz-2384 tubulin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
417
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The synthetic diazonamide DZ-2384 has distinct effects on microtubule curvature and dynamics without neurotoxicity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 417
sequence length 426
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lovB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lovB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lovB01
3JALB 4O4JB 3HKCB 5MN6A 4X1IA 5LOVA 3RB8A 4I50B 5J2TB 4YJ3A 5CA0B 5CB4B 1JFFA 5KX5B 2VAWA 5GONB 3VOBA 3ZIDA 3HKBB 4TV9A 4I55B 5ITZA 5JQGB 3JAKA 4DRXB 3JASB 5JCOC 2VXYA 4FFBA 4YJ2A 3RYFB 1JFFB 5FNVB 4WBNA 1W5AA 2BTQB 4B45A 3HKCA 4X20B 3VPAA 5JH7B 1TVKA 3RYHA 3N2GB 4IHJB 4O4LA 1TUBA 4O4HB 5C8YA 3JAWB 5EIBD 2R6R1 3V3TA 4X1KB 4O2AB 4ZOLB 3R4VA 3N2KB 2BTOA 4I4TA 5LP6C 4HNAA 2VAPA 3WGNA 5LA6B 4EB6B 5BMVB 4E6EA 4YJ3B 5M7EA 5LYJA 4IHJA 3UT5B 3HKDB 3RYIA 4TUYA 3RYCA 2BTQA 4ZHQA 4FFBB 1SA0A 5KMGA 4IIJA 5JH7A 4DRXA 2Q1XA 4TV8A 4O4LB 3WGMA 1W59A 5LYJB 5CA1A 5J2TA 4B46A 3RYFA 1TUBB 4ZI7A 1RQ2A 3ZBQA 4EI9A 3HKEB 1W5EA 2RHOA 5EIBC 3HKBA 4YJ2B 2VAMA 5ITZB 4X1KA 5EYPA 1W581 5J2UA 4EB6A 3UT5A 5CA1B 3N2GA 4O2BA 5LXTB 4IIJB 2RHHA 4EI8A 4XCQA 1W5FA 3JARB 4F6RA 4ZOLA 3JALA 3RYCB 3WGLA 4ZHQB 3WGJA 3JAWA 3E22B 4HNAB 3HKDA 4X1YA 4O4IB 2Q1YA 3N2KA 4TV9B 1FFXB 5BMVA 4I50A 4O2BB 5LXTA 1OFUA 5LA6A 5IJ9B 5JVDA 5FNVA 4EI7A 5EYPB 1Z5WA 5IYZB 2GVIA 3M89A 5EZYB 4LNUB 5GONA 1RLUA 1RQ7A 2RHJA 4TUYB 3JATA 5IJ9A 4X1IB 3VO9A 3CB2A 4X20A 5JVDB 5CB4A 3RYHB 5J2UB 5LOVB 5MN5A 4U39A 5CA0A 5IJ0B 5KX5A 5JCOA 4WBNB 2R751 3VOAA 4TV8B 4O4JA 5IYZA 1Z5VA 3C8LA 3JAKB 3HKEA 4KWEA 3JASA 4O4IA 4U3JA 2RHLA 4ZI7B 4I55A 3WGKA 5IJ0A 3ZBPA 4F6RB 1FFXA 4O4HA 5C8YB 1TVKB 4X1YB 4DXDA 5LP6A 4U3JB 3JATB 2XKAA 5MN4A 5EZYA 4O2AA 4LNUA 1SA0B 5KMGB 1FSZA 4M8IA 3VO8A 3M8KA 2XKBA 3E22A 1W5BA 4I4TB 3JARA 5JQGA 3RYIB 5LP6B
chains in the Genus database with same CATH superfamily
4XDGA 1CULC 2XWPA 3HP4A 2UUOA 1F17A 4P7BA 4I5DA 1VGQA 4MVJG 4W82A 3VSAA 3GRCA 4HADA 2GVZC 3L06A 5LQDA 4IMJB 2R1VA 1KR5A 5EJEA 4H3SA 1DSSG 1V1RA 4UVDA 1R73A 4PA6A 3C1TA 4C6TA 5LGTA 1MO5A 5HIJA 2XOKG 1IBKO 3B48A 4DSNA 1KH2A 3MB8A 2Q0AA 4ZRDA 5JJKA 2BTQB 2GHTA 4QICA 1X3SA 4D6PA 4QPJA 1TKCA 4N3AA 2UYGA 3FZNA 4AZSA 5GZ3A 1GM9A 4TOIA 2CWJA 3E1GA 5CP8A 4DNFA 5H3LA 3GNQA 1NT2A 4X7BA 3G8AA 5HHTA 3I2GA 4EATA 4LH6A 3RC3A 3B40A 3A9UA 2I8CA 4TTVA 4EB6B 3WK7A 4C7KA 3VAZA 1IM5A 5JYBA 3KSDO 2VYCA 1NN5A 3T7RA 5J3JA 3ASVA 2D5AA 2RGYA 2XVZA 3QUQA 2CLCX 3SDLA 2A4MA 1K6JA 2X8WA 3TINA 3P9IA 5IK2A 1RBZA 4IOLA 2V6BA 4G4VA 5ILQA 2HMVA 2R70A 4YA6A 3D01A 3PVCA 4BX0A 2WG2A 4WSOA 3LWPC 1R4ZA 1DGSA 3M1XA 1ZH6A 3DHNA 4TZTA 1NBMA 3N0TA 5KC9A 3UB4A 1Z7WA 2RIRA 2YVUA 3KEGA 3QXHA 4GPTA 1FU8A 3NBXX 4KRXA 3LQYA 1S2LA 4LGVA 4UARA 4GO1A 4JOBA 2FTKE 2KHZA 1QIIA 2JEOA 2WTBA 2YHIB 2Z2IA 1I94O 2ZSJA 5B57C 5C8VA 3VPSA 4X8AA 3L4SO 2Z1DA 3BFJA 3L8YA 3OEYA 4YRJA 1XV5A 5C1DA 1U96A 5DGIA 5E9AA 4IINA 1R2QA 1UEIA 3NJ4A 3F8SA 1XEFA 3JQCA 2PO5A 5ECDA 5HCUA 1B74A 4MARA 1F4MA 1MAUA 1R8SA 3G2QA 2PGGA 3KSBC 1MOPA 3OW2F 3HGMA 3I5UA 1M34B 3KCXA 4MZXA 4XRGA 4HSGA 1HDXA 2I1LA 3ORQA 2AE2A 4FDMA 4P92A 1X15A 4CMEA 4UJ3A 3HE3A 1POWA 2LDBA 3A0UA 4XDHA 5BQ5A 4YRIA 5HKKD 1ORTA 1SQBH 3THYB 1IEWA 3B3QA 1U99A 3PC8C 3Q3JB 5F9HA 1VM6A 3VSEA 2PUCA 3LZ6A 3AETA 2CHVA 1TZKA 1RP7A 4IH9A 1AHIA 1YUNA 4JYAB 2C2ZA 1W52X 4UCOA 2BFPA 1BCSB 3RF7A 3TKLA 1HBJA 5C8ZA 1LS6A 3ITNA 1J0CA 3TRDA 4J3JA 1WXFA 1HYBA 1T0UA 2ZBEA 3C5EA 3FPJA 3FWYA 4MWBA 4PCUA 1AKRA 1U90A 2E7ZA 1RYDA 2JKVA 3DG9A 3IUYA 1S3JA 1ZCAA 2H1RA 2PHZA 4MSWC 1Q17A 4H0NA 4JJ6A 4QBGB 5J5CA 1NV8A 4BBAA 1GO1A 3QPVA 5CA0A 2RGWA 4NMXB 3REGA 4MO2A 1KYOF 1VCOA 3RRXA 4DLAA 3OCWA 3JVHA 5LNK6 5YASA 1AKUA 1JQAA 1JDZA 4WERA 3JASA 4QBFA 3MYRA 2GM5A 4X3LA 3V4RA 1VE1A 1VPVA 1WMAA 5JXHA 3TG8A 1FW8A 4O1IA 5BW8A 2YV1A 3RTBA 1UQRA 4W7HA 5F52A 5CNKA 2RQ6A 2TSYB 4O2BF 4JB2A 3W2GA 1IUKA 2RB5A 2QVXX 3I6QA 5AJHA 2AMVA 3SYCA 2VIIA 1JKFA 2MYNA 4QG3A 4EPRA 3WJRA 2AC7A 1D0SA 1YV9A 1OIWA 2XQFA 2BF7A 3A11A 3MPOA 1S3FA 4I50B 2C00A 2BWJA 2L26A 2R66A 3CC4F 2HNAA 2O0KA 2PSSA 4DBVO 2CJWB 2C3YA 3GUUA 4ZU3A 1LBIA 1WG8A 3KEQA 5IW8A 3RD5A 1OA1A 2G6BA 2AMYA 4P58A 4CPDA 2FYUH 4JI1O 4AZ0A 1VCIA 1H3NA 2OO5A 1PHRA 1L4NA 1N33O 3P2MA 4BLUA 4M55A 1PQYA 4KE6A 2Q68A 1V16A 4LF7O 4QTUB 3AFMA 5DB4A 1U5CA 3HRHA 4JGIA 3D64A 4UEKA 3T3EA 3U4DA 5JJ5A 3B9BA 2Y69B 3VO1A 3CPWU 2CXQA 4AJ2A 5LC1A 4BNGA 4F4JA 5A2GA 1ABEA 2GN4A 4H7JA 4DW8A 2C29D 3L6RA 1QHXA 4X44A 3FN4A 3L7DA 3TSOA 2F8TA 1HDOA 1G7CA 4OYLA 3G5LA 1W40A 5DE3A 1A0OA 1XEWX 2ZREA 1EN5A 3ZRXA 1JDSA 1S2DA 3DTTA 4AURA 4J2OA 4B35A 2FSUA 1QIEA 3CMEF 1KYTA 3GFPA 1XYVA 2D62A 3RVPA 3NXKA 3PWKA 4JL8A 2BTQA 2R4TA 4CS3A 4C29A 5ED4A 2RC6A 1Y81A 4EJ0A 4AL4A 4GI5A 2GTHA 5DCUA 1YFZA 2ESRA 1N0VC 2JHCA 1JHXA 2C58A 2XYGA 4R8RA 5IUJC 1CHNA 2FPUA 4NMHA 1Z4PX 3O74A 3H13A 1H2SB 2PWPA 4EB8A 1CXZB 4BAUA 5B36A 2J4DA 4EWLA 2BE9A 2C0QA 5KTRA 1E79G 2BI8A 4EVRA 3EQZA 3DT9A 3LQKA 4R41A 3GPDG 4Q9NA 1JR6A 4PSCA 1DXOA 1JG1A 2KWIA 2IIPA 2C31A 2IP2A 4OU4A 3SS7X 1ZGBA 4IVQA 4NV0A 2OCKA 4DQUA 1GPBA 3EQ6A 2X5KO 4GKBA 3K9WA 1T9BA 3BCRA 1L4YA 4ERNA 2EZPA 1VHAA 2NYAA 3EC1A 1L1FA 1GEGA 2VP4A 2XA1A 3EAQA 3FCUB 1N36B 4U7PB 3LHKA 3VBEA 3WNQA 4QBHA 2Y0EA 1XTZA 4J7KA 3MDOA 1G19A 1ULHA 2J9ZB 3GQVA 4J0HA 5JXIA 2PI4A 2D74A 3DEFA 4BVEA 1W55A 3CC2F 1XCGB 2J4CA 1T2UA 1K5PA 1WCWA 2J0EA 2EZTA 1Z8FA 5HQJA 5BMVA 1QO0A 3CYQA 2IX3A 1F2VA 2WA3A 4E5SA 5KJ1A 3IR6A 2A0LA 3MF4A 3AK2A 4NAUA 1H6BA 4UW9A 2ZD9A 1O3YA 3LNTA 4B9EA 4CCWA 4DT1A 4MVZA 1YJWF 4BN0A 3B77A 3LUHA 1PSWA 4JUCA 4REOA 1S6YA 3DEZA 3RTEA 5K0FA 2OTCA 2FPGA 3GDGA 2IXGA 3HSKA 3FSGD 1C2TA 3D2BA 4IAOA 5AQEA 5EHZA 5HM6A 5ITWA 5E4JA 1N8SA 3P9NA 4D4JA 5HNKA 4PNHA 4PSAA 1M1NB 2PZEA 3GRRA 3PKZA 5B7QA 3TL2A 2E1PA 5L40A 4X65B 1Q5PA 2P9TA 4KRGA 4G6ZA 1N5KA 2EBUA 4K6KA 4NWIA 4TMXA 3GEGA 1MG0A 4ZI7B 2DLNA 2IEGA 2D7DA 4LVCA 1C8VB 2V4ZA 2YQ5A 4BKOA 2N1MA 4G5YA 1U1FA 2RG7A 3GJTA 2QVCA 3AI1A 3K2BA 1RCUA 4L15A 1O94A 4FGWA 4YYEA 2MDTA 4EKIA 5I01A 1G20B 2XKAA 2LPMA 4WKOA 4C4SA 2X0FA 5FI1B 1VPEA 2OWOA 4MA5A 4DNOA 5IHPA 5ED0A 3CCJV 1YI8A 5LLDA 3AEKA 1U3PA 3CUKA 4Y2JA 1ID8A 5EG5A 2CAZC 3NHLA 3TW8B 4JSYA 3RGGA 3KAJA 1X52A 1I08A 4M6WA 2YFKA 1KC1A 3ZTYA 2MW2B 2O50A 2WHRA 3HY3A 5GV8A 2WBLC 1OZGA 4MS1B 3SYMA 4RCVA 3G23A 3NTOA 2JHPA 4EPVA 5J43A 4Z53A 2Z1MA 1U7ZA 4WFFA 2DBQA 1U1IA 1SCBA 4N3CA 3RIGA 3QX3A 2YRFA 1JLMA 2HT1A 2VUSA 4XM1A 4UV8A 4MH0R 1G1AA 3RA6A 3WXMB 3RV4A 1H8HD 1VL6A 3VZBA 2KB0A 3O8LA 4PNPA 1JG7A 1SZJG 2B2NA 5FUBA 1KFJB 4IFEA 4K9RA 4X1KB 5ESDA 3CCQF 2HLDG 2ZT9B 4HAWA 1KC8W 3VM6A 4TMVA 2OUKA 1NKTA 2KBEA 3I3SR 1YCGA 1Z6ZA 3VIUA 4ZBMA 1EP1B 3DTUB 2VDMB 2CJWA 1O94D 4QPDA 3QFCA 4CGZA 2H3HA 1KEVA 1NMSA 5DGCA 4ZYXA 2ZTLA 1OLSA 2JVJA 4MWZA 2J32A 3OPXA 2FFBA 4JI4B 4KQEA 2B9EA 3I2YX 4MKIA 4V2UA 3HU2A 5I7OA 1TNDA 1UFVA 2XHBA 3K6RA 5ICGA 1BEEA 1Q57A 1SC1A 3PPYA 1FOEB 4K9MA 1VIDA 3SIPA 2XIQA 3RJZA 2JGDB 3HXTA 1PQ4A 1HQCA 1YZFA 1T0BA 1U0EA 1VG0B 1KA9H 2VK2A 3OSZA 5B3LA 1JDTA 3HADA 2DPMA 4HWGA 5IXSA 3KZ1E 4D57A 1QCCA 2IM9A 1PR3A 2H9YA 1L4MA 2W6ID 1S02A 4D2IA 3EUWA 2V3VA 4HNSA 1YMVA 4BEWA 2UZHA 1TZCA 4FEGA 4WF9V 4NDAA 2H1HA 1Y67A 5BZBA 4GPD1 1QCDA 1W0JG 1HK7A 2QN6A 4YMLA 3IBFA 3JQ9C 3OD1A 1PGNA 3AVWA 4RMJA 4F6RA 1XTUA 4R1NA 3JALA 4UCFA 3SD7A 1ZC4A 3CMAF 1F20A 2E4VA 1GUDA 2HSWA 4JBHA 3UATA 4D0GA 2IUYA 4EPWA 3LK6A 3V4OA 3U09A 3TUZC 4JLMA 1AR5A 4L6CA 1UPCA 4I4NA 4Y8VA 4GKJB 2VP6A 1WMFA 1UJNA 3E2MA 3PQEA 5LQNA 3DXRB 4CF5A 1XRJA 4DSZA 3CVUA 4EYKA 2VFAA 2DJIA 1R0BA 2IYPA 2WT9A 3ROXA 3H19A 1NF3A 3MTEA 4XD7D 1HZJA 4V38A 4G5SA 5L95A 1I4DD 2HTEA 3F9CA 3KALA 4G5RA 4OTZA 4KZKA 4ZCTA 3T1TA 1QLNA 2EIKB 2EEPA 3DZJA 3TF5A 4EX7A 3SGLA 1OJLA 4DW1A 1E7YA 2AR7A 3OEEA 5JD4A 1NVUQ 3NVKI 2VGMA 5K8IA 3M0EA 4Q3BA 5BWCA 3AHEA 1L5WA 2ZYWX 1NXOA 4LF8B 3EW9A 4MKXA 3JYCA 1XNRO 2R8OA 4V1CI 5TPZA 2BCGY 5GJVC 2DR0A 3AG3C 3G02A 3BGVA 2WJ6A 3WGKA 2IVFA 1CLIA 1XOUA 5KHHA 3D1VA 4BYMA 2KM1A 4A36A 3OPQA 4LY6A 3L4JA 1LJLA 1XAHA 1TU4A 3P2OA 4RH1A 4F4HA 3AM5A 3O7MA 3TQCA 2FR1A 3GFRA 5IJXA 1VQ6V 1CR4A 3DHYA 5K1PA 1CJSA 3HCEA 3OTHA 1FNMA 4Q16A 2PA0A 2VTKA 4IFIA 4YQEA 4ZICA 1SXHA 4JZ2A 1OASA 1NT2B 1G8AA 1M5TA 1L9XA 1TM5E 4KP4A 1LF0A 2GO7A 3UYLA 3UMGA 3HFJA 4G5QA 4ZC1A 1J22A 2O2XA 4DC1A 2DE0X 1MT3A 2CFTA 3DOFA 4TWKA 4C3VA 4HAUA 2BLLA 4D3YA 1BWQA 4C8EA 4CEHB 4CH3A 1BSMA 2VPYA 1Z0SA 3M6VA 3WFZA 2QRVB 1MH9A 2ZCVA 3I9JA 4H16A 4ILEA 2I1WA 3R75A 16PKA 2E1RA 5C1IA 3T7TA 3HLYA 3JQ6A 3K06A 4GQIA 2ZT5A 2R65A 2UKDA 4M1SA 3T95A 4MI3A 1G20A 4UKDA 5BSFA 2PMDA 2XZOA 4NDNE 3TIVA 5BN3B 4G9GA 3CT4A 3RYHA 4AJJA 2PXHA 3AM3A 3ZY3A 2GN8A 4KOEC 3MT8A 1T5HX 1GGFA 1H7MA 4E4TA 3D6AA 2BSAA 5B3SB 5FBLB 1AM4D 4QFCA 4FKMA 3U81A 1RBMA 2VH1A 1MPXA 1F23A 3QTCA 2AJCA 1XDUA 1SZPA 5E1DA 1ORIA 1UANA 1XRNA 1EX1A 2J9XB 1G8FA 3CLRC 5CJ2A 4B08A 5EIFA 1G8KA 2PMEA 1HLGA 4IYRA 2AMTA 3E9ZA 1Z0ZA 3LUBA 1T6ZA 4HFJA 1SBQA 5BSRA 3K3WA 1Z4MA 4EBFA 1LD3A 2GN1A 3PLNA 4L7VA 1ITZA 1Q1QA 1XZ8A 3FUWA 3CSUA 2AQKA 4MQUA 3WRXA 5JFTA 2QJOA 2FMLA 4LF4O 3CCRF 3QYPA 1TT7A 4LVUA 3G5UA 2CYAA 4BQSA 4CE6A 5JJLA 1D2AA 5JWPA 1JEDA 1S8NA 2O19A 1GZ0A 3JZDA 2JAOA 1W0KG 2V6JA 1K2VN 4MVJP 4HWTA 3ONFA 1PVDA 2W5UA 3ENVA 1NXSA 2WWHA 4LFBO 2IEIA 4QEDA 5FPKA 1Y4MA 1F0NA 2BN4A 2XNDD 2VYQA 3BRQA 5EBMC 2ZINA 1T35A 2ID4A 3Q87B 3O0TA 4J0FA 4NOKA 3CVWA 5GJCA 4MDFA 1ONSA 1OLSB 1JJAA 4A5SA 1G6OA 4CLDA 4HDSB 4WK6A 3WGUA 2GBGA 3DNMA 2JH8A 2FZCA 4R2LA 5TVKA 1SHLA 2EP7A 4P84A 4DLNA 1D1QA 2CV0A 2JJ1D 2JIRA 4OHBA 3CZAA 1U2DA 4BY9D 2A30A 4JAUA 1S2NA 3IKLA 5ERGB 1HDYA 3DBLB 2A3QA 2B3TA 1IATA 1ZINA 2JKZA 3DWEX 4HX2A 4R6XA 2YWEA 4G4SO 4D9KA 4QHSA 3CW8X 2AG6A 5EPOA 3WWOA 2I03A 1R64A 1N57A 1YE5A 2PL5A 1QG2A 2NQ8A 2P3SA 4MR9B 5D3MA 3LT2A 5IFLA 1C30A 2H57A 3VH4A 3UN1A 2EINC 2BUCA 2PANA 3D4PA 1Z0IA 3AZPA 1WKVA 4JEUA 2DWQA 4YIKA 2RHTA 1V1MA 2P4VA 1OCEA 1Y3BE 1TQHA 1VRCA 3BDIA 3WK4A 5IRCD 4NCAA 1QR8A 3AG1C 2JIOA 1W96A 3I9LA 3MS4A 4B8WA 4QXAA 4OP2A 2PKRA 2BIFA 3OX1A 2HLHA 5LLSA 3T1VA 3DOIA 4PRKA 1UBJS 1A76A 1Y3CE 2ZULA 4HS9A 4CMHA 1MGPA 1XBLA 1JEAA 1D6NA 2ODTX 4HTFA 5JCJD 3GLSA 4MWEA 4JOQA 2OHWA 1H42A 3GEMA 2C3MA 1AB6A 3D1LA 4RXUA 5EQFA 3VC3A 2CJPA 1GWNA 1VGVA 2HJHA 2OCLA 5CMLA 4WFGA 3KKZA 3FTQA 1A4XA 3JARA 2P3LA 1VYTA 2QTZA 4QPJC 4Q4HB 2QN8A 4W5RA 1QTIA 4FZJA 2NU9A 2QZZA 3AVTA 2AUNA 4GP7A 4JMLA 4QVKA 4U00A 3GCZA 1GH6A 3BIJA 2DFNA 2FGYA 2CBGA 4OU5A 2TMGA 2FTKA 5FNVF 1G6Q1 4ZVKA 4WFKA 4URHA 3WYCA 1LRKA 3G0GA 1FNDA 3DHWC 4FNMA 2PQ2A 4JLBA 2XQKA 4UBMA 3VKVA 1YZBA 1UMKA 4OL0A 3W6UA 3AVYA 5HFMA 5FQOA 4I3FA 1DFGA 1R0KA 1XA3A 4GUAA 2QUJA 4R1SA 1JPUA 3RASA 2FR8A 1T4CA 2Y6UA 1E79A 3PRJA 3KT6A 2BKEA 4DJ5X 1W4RA 1I3CA 2Z4RA 3KUXA 5EHGA 3SQOA 2G04A 2XAQA 4RTJA 1K5GA 3I2FA 3A2FA 4K81B 4OCZA 1W8IA 1ZISA 4QOHA 2QXTA 3OOEA 3N05A 1SA0A 2MWMA 4JOSA 3LBNA 1VKNA 3R7BA 4R2XA 1YAJA 1O58A 4C7UA 3TTTA 2EFHB 1YVRA 4ZWNA 1MX3A 4AZ3B 2ITCC 2YMMA 5A62A 1YQXA 1E1RA 3ICWA 4NMWA 1XTIA 2EBOA 3MJTA 3RU7A 1RRGA 5AM5A 2RHGB 4LNAA 2CTRA 4TS9A 1JQDA 3I01M 1C3LA 3UWSA 3ELCA 1RQGA 3G71V 1FB5A 1J0XO 3H8WA 5TARA 5B6IA 2QIPA 4O4HF 2D4HA 2HIGA 4Z3OA 3CQ9A 3PR3A 5CDHA 3OGCC 3AVOA 3ZNNA 2J9GA 3M6LA 3GPIA 5A7HA 1JG2A 3CCQV 1Z39A 1FVXA 1UFYA 3RRNA 1WZ2A 1RLOA 4E7OA 3G2KA 3PFWO 5DI3B 1QTNA 4B3HA 4J29A 3GLGE 1YFJA 3MELA 1XCJA 1A88A 2GCPA 1KQPA 1PG0A 3T7AA 4PYQA 3ZDFA 1UBNA 2DRIA 2Q3FA 4M1KA 4FMTA 4FM2A 2VJYA 3OU6A 4E5YA 4P4GA 1XPRA 4LXUA 5JI2E 1OFUA 4KQFA 2XUPA 3I6ZA 3CCVV 3Q41A 2P35A 3MQFA 4M38A 5HBRA 3ZV7A 1QR9A 4FYPA 5AW9A 2C2XA 2DHRA 1ZL8A 2D13A 4AJLA 4KWIA 1Y6GA 2ZXWB 3ABMB 1UPTA 2FHSA 3DL4A 3DT8A 4UEQA 4ZODA 5DWDA 1QIKA 1KO5A 2W93A 3WL7A 1E2UA 4Q3LA 2PH5A 1XVIA 2WF8A 3O8OA 1ADYA 4CMIB 3DULA 4QATA 3LY9A 1OV4A 1U2RA 3QOYA 4MGIR 4PAWA 1EHIA 1V9PA 4HG2A 5HJEA 4RV4A 1GPUA 2DH5A 1IVYA 2OXCA 3E48A 3HKEA 2EKPA 3AB3A 3D3JA 4DMFA 4I0XA 3CYPB 1DQSA 5COQA 3EFFK 1QIHA 3PC3A 1WA8A 2VTDA 1S77D 1VP9A 3KYDB 5FL3A 4Y6PA 4C5CA 4DREA 4WY8A 2HG5C 2IW3A 3CWCA 4IHQA 3V9PA 1A2QA 1YMQA 3QUAA 3T2MA 2ZJ4A 4DDKA 5LQCA 3ADOA 1E94E 1VJ1A 4D9GA 4B3RB 5E8JA 4CMJA 4KBFA 5CBFA 1UJCA 3HNPA 1EHCA 4W9NC 5NLLA 4OHZA 4D9NA 4F60A 4ENSA 2FZEA 2N74A 1X42A 3ZWWA 1RAGA 2H1CA 1YJWV 3K0CA 4G9BA 1K0UA 3EXG1 4MTCA 2XMPA 3GLGA 3Q5DA 3DH0A 2X14A 2PUHA 4FDTA 1YZ3A 3T8YA 1OBOA 2I4TA 2MSKA 3O3OB 4U8GA 4IIDA 1TEHA 3AI7A 4JCOA 3QX7A 5TGZA 1J5XA 1R8QA 3IBSA 4J9YB 1SBNE 4XW2A 4EKYA 2XRZA 4J3NA 4GYYA 2JEYA 2OXFA 5ICEA 4C7BA 2QN3A 1QP7A 2AA3A 3I9FA 3L8EA 5EIBD 4J49A 2WWYA 4U7WA 1F51A 5CW2A 1EE1A 2CF6A 1B8OA 2NO6A 1H8EA 2OV2A 2HRUA 2F1HA 3I42A 2P22C 1Z7GA 4DSOA 4P3XA 521PA 5KTTA 1E4EA 2P9FA 1F0YA 2CNWD 2QD1A 1NZJA 2VRWA 3MTAA 1ORRA 3ONWA 1YTFB 2CHSA 2MSCB 2DKFA 3HDQA 2QL6A 3R76A 4LXHA 2A9QA 3MFQA 2WYHA 4IO0A 3VO2A 5G3YA 3GRYA 4B4WA 1BA3A 3N2NA 5LQSA 2H2FA 4MP8A 2Y1LA 3ZHSA 4YONB 1ZA1A 4MVJD 3U37A 2WF9A 3K5PA 1FFCA 4XCXA 3AVPA 2GBFA 1KUQA 1EX7A 1LNZA 2W22A 2X6RA 3KQSA 4X3CA 1LZKA 2J0SA 2F43G 4ADSG 1O89A 5IYBO 1SG6A 3R6TA 3EGDA 4NICA 2GBIA 3ELWA 4M6WB 4ZOCA 1GP2A 4BASA 4BLRA 4PHZA 4QHYA 1EZ1A 4NXNO 1N9ZA 2IEBA 3HN2A 2E5WA 3F6MA 1H0SA 4V0LA 3WTCA 1UMCA 4NTWA 3TCNA 4M53A 3ZNOA 1IIRA 3OEEG 1EFUA 2R3SA 1JILA 4BATA 1PNRA 2ERYA 3RAJA 4XCQA 1RTTA 5ALHA 3OSUA 2GYYA 1S76D 3NTRA 3OHPA 5TVGA 1KDRA 3WJAA 4JI0O 1DGQA 1DJMA 1SVIA 3WZ2A 5G53C 1R0YA 2LIVA 1Y33E 3A6ZA 4UUOA 5K01A 4J0CA 2ODNA 1IQUA 1R4AA 2YRWA 1LPNA 2CWWA 1W57A 1RPAA 2DFLA 2YBEA 1S72F 1B93A 2XMRA 1U9YA 3AG6A 5L3DA 1XDGA 3BSYA 3ABOB 4CLOB 4IUYA 4UXHA 2GVIA 1X8LA 3S0YA 3BCUA 1QP4A 4INPA 4Z4FA 4MICA 2PMBA 4MCHA 3LGXA 3FOBA 4RSHA 3FPBA 1L5LA 3Q6MA 4K0KB 1NGSA 3GQBA 5EQTA 1VF7A 3DLIA 1F1JA 1WW8A 3BHNA 1E1QG 1BD4A 3HCAA 1TTPB 3KAQA 5EKTA 5CK4A 1C0KA 1E98A 1OKKA 1VXOA 1NVVQ 1MZPA 3ZIAD 4K35A 2FPSA 3CEAA 3PGJA 2ZS7A 4DV6B 3U4QA 3ZCTA 4K0RA 2OXIA 2YIBD 1UWCA 4L75A 4MHTA 3OE5A 4N0QA 3FFXA 2GPSA 2PT6A 5DSXA 1J0AA 3AIOA 5AVMA 4UPDA 1M0WA 1SHZA 2BDEA 4Q9DA 4RPLA 3BD6A 5DXAA 1N34O 3RU9A 4CDNA 2Y2UA 4H31A 5HP8A 2G5TA 3KU1A 2PEYA 1M5RA 3OH8A 4JC4A 4BFUA 4IR7A 3GLHE 4URYR 4EY7A 3A25A 3JQ8B 4IV5A 3APQA 3EDCA 4H44B 1FU7A 3O5AA 2P6UA 5IPFA 2P9GA 2ZTVA 1ZR2A 1KC8H 1Q0UA 1T2EA 2VNSA 1M1ZA 1U0TA 1KJ8A 1Y8RB 2YN2A 2QUAA 3L8CA 3IKMB 4DWOA 1NJ2A 2WHYA 5BWNA 2JVKA 5A2QN 5COAA 4AM8A 1QRTA 3TNFA 5JPCA 4GYWA 1ENZA 4IVRA 2KE5A 4CV3A 1RKBA 3ZK7A 4WCEV 3TVDA 4XIIA 2HP3A 1KK0A 1WOYA 1E9EA 2CFCA 1XD8A 4FX2A 3UTCA 2QKSA 4XVHA 4DMUB 4WJLA 5MDHA 1UMDA 3AQIA 5CPFA 2F1IA 5F1OA 3CSDA 1J8QA 1ZEJA 1KJYA 1W48A 2DSNA 2EJTA 3CEHA 3JR3A 4OJTA 3RCBA 5T4HA 3B3JA 4WFEA 3U3JA 3OF3A 1GTVA 2HK9A 1JYSA 5CNMA 4IDNA 3CXUA 1TGVA 2RI1A 3A4MA 3N75A 3V7FA 2IZ0A 5DV9A 4YUAA 4RHXA 1QU7A 1IN6A 1O96A 4G5HA 4NV3A 1K7DA 1UKCA 2AI3A 1GTG1 5LA6F 5CX1A 1J2UA 3HCBA 1H0HA 2AB0A 3CE9A 2PBFA 2ZROA 4HWOA 4DDMA 1C3EA 1DEOA 1RQNA 1U0OC 3PQ7A 1KS2A 1EAMA 4Q21A 4D7TA 4CQMA 3TOVA 4JI5B 1QGZA 2QTGA 4KXWA 1LLFA 1FDTA 1LNQA 3QVOA 5KNBA 4AY3A 4WLFA 3HYNA 5EJMA 2PLFA 1LPSA 2BBWA 1BQEA 2QNIA 3C7TA 4UTPA 2ZR9A 4BU1A 1JPVA 2W6PA 2AIFA 1HR0B 3N59A 2IS2A 4NV1A 2AZ0A 3FNQA 4MRMB 4ETIA 3QP9A 4NP6A 3THWA 1N9GA 3FRIA 3SC3A 5K6TA 3LDHA 4I55F 5ANRB 1IY2A 3DCIA 4DR6B 5BN5A 5AJTA 2Q99A 1K2WA 2IELA 3OZXA 3UUFA 1C9JA 3RU3A 2QL7A 3RNLA 1GN6A 4K9DA 4KAFA 2EHJA 5AJYA 5SY4A 3U3MA 1ZJJA 2OLEA 5JMTA 3EMDA 1H65A 4YMVA 2HLPA 4JJIA 2NP6A 4B5KA 1Z88A 4ZK2A 5D1NA 2QWNB 4A5UB 4D99A 4HD8A 4PYIA 1JA8A 1NQUA 1SZDA 3CZ4A 4H0LB 3R09A 4BVAA 3EGDB 5CIYA 2X4DA 2HPZA 5GM2A 4Y1EA 3SIVA 1PX2A 3TRIA 3FZGA 5A9GA 3ZIAA 1S2IA 4J0DA 3LNNA 1MTZA 1SCNE 2BZ0A 3DR5A 4K9NA 4L02A 5EI5A 1QFSA 4AMZA 3S2EA 5JASA 3VYVA 2WF6A 2Q5LA 1LSUA 4YXWG 1Z0JA 1ZVQA 4Y2SA 1COWA 4S1TA 2RK6A 4M0LA 4PTYA 4FWBA 1CUUA 3EGEA 2H8KA 1L5SA 3CM0A 4GM0A 2IYEA 3ISVA 3O85A 1FMCA 3J81N 1UJMA 2P2GA 3ECAA 5KU1A 4OLHA 4QQRA 1AUXA 5FI3A 4ESVA 1VF5B 2A1TS 3CF4G 1ICIA 2HL6A 3OAAD 4YGYA 3ZLUA 4TV8B 4D9JA 4EX6A 4Z4QA 1ST2A 1Q16A 2A8YA 4HDRB 4BMZA 4KWTA 1NTOA 2X9GA 4URXR 3TW6A 2XKKA 1P3JA 2BR4A 2QTVA 2FUNB 4C22A 3PXBA 1E6EA 1FTYA 1H0RA 1SURA 4C2TA 1DRKA 4DA9A 1J23A 1K1EA 4JP3A 3KZNA 3RFVA 5B1NA 4RJLA 2BMWA 5DTIA 2RHBA 2BDTA 4GGPA 2RN9A 1YBHA 4GC5A 4RZXA 1WCXA 1R9NA 3EXHB 4XD2A 2YC4C 4UOEA 2AN9A 5K8UA 1JJ7A 2ONCA 3NRJA 3A1NA 4LF8O 1XQ8A 3GBVA 4FS3A 1GZSA 5REQA 1M74A 1JQKA 4KI7A 5B12A 2A0KA 5BR1A 4TVBA 2XGMA 5IG2A 1U02A 3DM5A 1ZJWA 3PTLA 2Q8PA 2G8LA 1DUVG 3NBFA 3UBTA 3L8DA 3KS9A 1CW2B 1T5DX 3JD0A 4UNSA 3N8NA 5KDDA 2H4YA 3L43A 3RBZA 4G0PA 4NU5A 1LI5A 1PJ3A 3A6LA 5DLDA 1ZNZA 3ND9A 2ACKA 5SZHB 4R71A 4D82A 1CR2A 1G18A 4NS4A 3R6GA 1T6YA 1MIOA 3HJTA 2AX3A 4XRRA 2J5XA 2OMKA 3AOEA 3FCSB 3I09A 4BVFA 5CFZA 2GZLA 2Q3JA 4CM7A 1IWBB 2K1SA 1SC9A 1EKXA 1GV1A 1WTCA 2AG5A 2CD7A 1XMQO 6Q21A 3W2HA 1KEEA 1I7NA 3U7GA 2BMFA 1SZQA 3NRBA 4UHHA 1A5TA 2QJWA 4Q9AA 3JR7A 1FJHA 3ZP4A 1TCUA 2LNDA 1PJBA 4X41A 5SY9A 4B4UA 3O65A 5LMNB 2A7QA 3AESA 2QTCA 3H17A 3KB2A 3ZW8A 3M70A 4WZBA 1ELOA 3WB0A 1W36C 2JJ1A 2XVYA 3R3UA 4OO3A 2UYKA 2EHDA 4PYMA 1NM5A 3JYQA 3F8TA 1AKYA 3D7NA 4HZUB 3QKWA 4ZKEA 1TEXA 4G09A 3STHA 3PD7A 2UXCO 4H7IA 4L08A 1PR0A 5I7AA 1EVLA 1P5FA 4XYMA 2TMDA 5CBPA 1FXKB 4D26A 2ACEA 1VHJA 4JH0A 1CUHA 2FSVA 1S96A 2A0XA 4TMZA 1N6OA 4LTMA 3K70D 1R0SA 2CLEB 1JVBA 2FZVA 1OZAA 2F3TA 2VGNA 3HGQA 2P5YA 2Z30A 2ZSAA 2DOSA 4YJ2B 2MQEA 2P5OA 2AG1A 1EFVB 2XR1A 2YV5A 4XX1A 4ZYTA 4B80A 5BQ3A 5ILOA 1YL6A 4CQMB 1E8DA 5FPHA 3V4DA 3W5IA 4GLJA 4F91B 3P0JA 1R8XA 5JXWA 1LWOA 2ZFUA 2YNMD 4NBWA 4PAGA 1EJ2A 5K0GA 2CXXA 3HXPA 1YXMA 2FMTA 1LPBB 1T4BA 3GRAA 5JFGA 4FPPA 3EGXB 3DKVA 2BE3A 4IT5A 1W5TA 2AL7A 2YW9A 3FMGA 1W30A 2QMHA 4L4ZA 4PX3A 2BEVB 4KX5A 1N5IA 3CNNA 3QITA 3U7HB 3OZ7A 4R9VA 2WFAA 4XQ9A 3CX6A 5BOSA 2Q5FA 1M56C 4IFBA 1MVNA 1ZTEA 1K4DC 1F2UB 4P36A 4HZ3A 1NUAA 2QK4A 4RIHA 5FWYB 3VQXA 5MHTA 1E5QA 1NVFA 3D36A 2L42A 4B32A 5IJ9A 4XSHA 3F7VC 1KNXA 3AG2C 1IPAA 2Q7HA 2ECFA 4DR5B 2Y0PA 2FU5C 2VJOA 2XMCA 3L8HA 2E6UX 3VNQA 1VDZA 1L5GB 3TTWA 1D0IA 4EA7A 4QTZA 5TMBA 4CIVA 3NWJA 4GLBA 1KEPA 1N6PA 2VATA 1NVTA 1NWHA 1VL2A 4KO8A 1Y89A 2HCJB 3AEKB 1UIRA 4NYMQ 1G7RA 4R3WA 5BQXA 2G0NA 1I4LD 1VQ5V 3A58B 4OHCA 4DLLA 1VTKA 4HY3A 2PF4E 2BGLA 2CK3G 2HBQA 3G6KA 3ZWBA 5CEJA 3HPQA 3D8BA 4MJ3A 3QKUA 4EKDA 3U6KA 3LAWA 1T0AA 1EAYA 2P6OA 1E79D 3OMXA 4K05A 4KJXA 5IULC 4LJRA 3H01A 4HEA6 4KR2A 5EZYA 3C3KA 3D2LA 1B6QA 2IEDA 3DE2X 3RVRA 1Z4NA 1KD1W 2I34A 2CXNA 4IKOA 1F6WA 4B6SA 3B7PA 1S72V 2R68A 4Q15A 2GFQA 4RY9A 4FXOA 1QPBA 1T1SA 4HDKA 2DWEC 1JR4A 3VOBA 1L1QA 4LXYA 1XA4A 1DHRA 3AF2A 4R4JA 3F7NA 4IZHA 3TLYA 2JAQA 2AOTA 5JQGB 2I7XA 3EWNA 2GEBA 5CA3A 1BCSA 1IBSA 4MROA 5JATA 2RBEA 1JZTA 1EZVH 4HDRA 4ZKDA 1L4UA 4Y6GB 1E5XA 2OYSA 1Z35A 5ALSA 2G28A 5IH3A 3ROMA 5IVHA 3L73H 1KFKB 4K40A 4E6PA 1IN8A 1DG1G 3IPYA 3DDCA 4G8CA 1I4OA 3MFYA 4Q7JB 1Z8NA 1OV9A 1A9TA 2EG9A 2P3QA 1Z3IX 4WXPA 3WVNA 4EQ6B 2F66C 5H68A 3PHHA 2K7FA 4U0KA 1E1NA 2W71A 1UAGA 1E3SA 2XW6A 1F14A 3IVRA 1EBBA 1L0NH 3KVYA 3NHFA 3QW4B 2CKMA 1UCFA 2BVNA 4FZ5A 4GS5A 4GZLA 4P4TA 4S0XA 4TWAA 4ZT3A 3FAZA 4NULA 3NJRA 1VQ1A 3I73A 3TEJA 4B6PA 1H23A 4YUWA 1HRKA 1DJNA 2HADA 5K20A 4H33A 3F5QA 3SBDA 4AMBA 1Z18A 3SQMA 1KI1A 2B9ZA 2V8BA 3FMIA 1K73W 3R66A 1DCMA 1FUIA 3GN1A 2C2MA 2XMQA 5IAJA 1DXQA 1RYYA 4ZANA 3LOPA 3IC9A 3BREA 1V43A 2AF3C 3BDVA 2HWYA 4P34A 4EO9A 5IZ4A 3NUQA 4RHEA 2M6LA 2JC3A 4HEA1 3OC0A 2IX9A 4FDVA 4C2BA 4F4UA 1EWVA 1RMQA 4PC2A 1MC8A 4ES6A 5K0LA 2LDXA 1EJBA 3LXXA 1Y9DA 3JD2A 4G1FA 2QSJA 4N12A 1NVXQ 3U9LA 3DJFA 1T43A 2FXIA 1ODFA 5C8DA 4FONA 1LUWA 1J0BA 3RNOA 1ADJA 1RADA 1MOQA 3ZQ6A 3KR1A 5AJZA 1AJEA 4AKTA 4WZBB 1T6BY 1PEDA 5LP6F 3BS4A 3DF9A 5H4GA 1NP7A 3RIHA 1IAVA 1KIFA 2YCLA 2G76A 4ZOLA 1CUVA 3EFOA 1M73E 4P31A 1Z0DA 1V7ZA 1ECPA 5EKSA 4ZVQA 2JLXA 3FKQA 2GFHA 1F3LA 4BNYA 4C78A 1TOAA 4TLDA 4Z2AA 5C5EA 1IEXA 1L5VA 3QE9Y 5KYVA 3MOSA 4QQKA 3LY7A 3HZHA 1Q92A 3DYBA 5B1SA 3UJNA 2QVBA 3ZD6A 2YDEA 3A3NA 3MSXA 3WNVA 2AN5A 2FX2A 2V1XA 3MJFA 5K4AA 2IC5A 4EUHA 4KQIA 1MXHA 4KQJA 1J99A 3KUDA 4RA9A 3UYKA 5B3JC 1FZTA 3C6KA 1T10A 1NONA 3QVWA 3ZHCA 4RZIA 2JCYA 2EULA 1BIFA 4IGKA 4NBLA 1FY2A 5JO0A 3L0OA 2YJ5A 3J7AU 1DTOA 3BAFA 1P4JA 3PS9A 2A5LA 5TQ0A 3VPFA 3T80A 2V7VA 1Z5VA 1TLFA 1JDUA 4BLOA 1R3JC 2GESA 2O7QA 3K71B 1W42A 3DTNA 1IULA 1XNRB 3RT9A 6YASA 4JWTA 3GZNA 5GY7A 2WOJA 3KLMX 4OLFA 1P9OA 1F51E 2VN8A 3D5QA 2CUKA 3L05A 3WQQA 5I8WA 4DCPA 1MMMA 1IJKA 3T61A 5AESA 2YH2A 1Q15A 1VL5A 3ILVA 1O7JA 1TYZA 3W0LB 1COMA 5CA0F 1UWKA 1FYXA 1NBWB 1BYUA 3EWAA 1F2UA 4FLYA 4UCUA 4JTAB 2JRIA 2CVZA 2N47A 2B8EA 3CNOA 3M4JA 4REMA 4KV9A 1IU9A 3ZHUA 2HQSA 5LP6B 4XLTA 4EDHA 5IFKA 2C7QA 3BF7A 4F3KA 4FYHA 1GO0A 1GPWB 1WPGA 2FW9A 1AGNA 1HL7A 2AJ8A 2DPYA 5C2JB 4L6IA 3N4ZA 3BVOA 5EJ5A 1WO8A 1ULTA 2ZRDA 1UBMS 1T8PA 1L5HB 3CUWA 4J0QA 3LJKA 5L3EA 3GJZA 2Q21A 4PG7A 1IBLB 3ZRWB 1Q77A 4OGKA 4CEIB 1U63A 1SCDA 2IIVA 3CRAA 4Q93A 3RT7A 2O3QA 2F17A 1PR2A 1QLHA 3FSJX 1S01A 2ZLBA 4XDYA 3TS1A 3Q7IA 3WZLA 1MA1A 1PJZA 2QX6A 5G1OA 2G1UA 2B5OA 3U3OA 3VSDA 4JBXA 2NZXA 1RXEA 4XIJA 3GLVA 1SB8A 3IJRA 3QVTA 2D6FA 1X8JA 3CCRV 3BD9A 3CX4A 1R8JA 3FZQA 4PHTA 3IIIA 5BVHA 1G5IA 2VDWB 3RUEA 2RCNA 3GPLA 3QEBZ 1G5QA 1M6HA 1FUUA 3FOCA 1APBA 3A6GA 1M8PA 4HH4A 3ZQJA 8GPBA 2WLLB 2V4UA 3BAZA 3STZC 3FTFA 1U7OA 1RPTA 2NSYA 5AVJA 4MMXB 2PGIA 2GUGA 3IPCA 4Q1AA 2NT3A 4IQ8A 4GLXA 5KNBD 1H2FA 3F7YC 4PDRA 1T4DA 1GL7A 1YA4A 2YNMA 1F60A 4GNRA 4H0CA 4KLCA 1GM5A 5E3HA 4QQ8A 4EQ6A 1C1HA 3Q85A 4W5JA 3GU3A 3DR3A 3M99B 2G4CA 2HXSA 2HRYA 2J30A 1NQ3A 2W7TA 3A28A 3ZWQA 1DV2A 4CMEC 3H9VA 1D09A 3PFBA 5KINB 1YOVB 4NWOB 1ZM3A 3LWVC 3QRWA 2DQ3A 4UNIA 3NTUA 4EHNA 5KNCH 4JVMA 4QOFA 2XYQA 3WWZA 4C8IA 2I3BA 3IALA 4ONEA 4HUQA 1NXPA 4GZ5A 3UWPA 5BXQC 3G0HA 5JD5A 1LBTA 4TLLB 1YZUA 2IV7A 4YPVA 3U44A 2CXHA 4FD2A 1XVAA 5M29A 3IAYA 1G66A 3DBHA 4RX1A 4U2CA 2Q0HA 4LF6O 3RLIA 3WKDA 1EXDA 2HB6A 4J7JA 1P7VA 4HDNA 4C4PA 2G1PA 1B8VA 2J5KA 3MT0A 4YACA 1OTXA 2X77A 5T6BA 2P67A 4CKBA 1A4RA 3BH0A 1RM1B 3WGLA 1QNMA 2BFBB 1NJ8A 1QXSA 2GXQA 5AWFC 5AKJA 1D7AA 2H4XA 1L3CA 1XRGA 2NWQA 4BIUA 1K0FA 3KZVA 4FI3F 2IS6A 3QLJA 1ZUNA 2X7XA 3DOUA 1BL8A 4K8XA 4I50A 1VHDA 2C5AA 4L5JA 5JSUA 1Y1SA 4HP8A 5FOSA 4CDRA 2IFTA 1GZDA 3P9CA 1Z56C 3KEMA 3DEIA 3TZBA 4C07A 1AKVA 5A9TA 1EP3B 4TZ0A 5K0SA 3RRYA 1WP8A 4WA8A 1KDTA 1NYQA 2PMKA 3NIDB 3HAXD 3BKXA 1LEHA 1HG0A 3DM9B 3VVMA 5CIQA 3FPCA 4EARA 1UMBB 3FXAA 3I23A 3PQ6A 5H4HA 5BXZA 3LWQC 2JGDA 4FM1A 5HFAA 2X2OA 3DBRA 4FSHA 2GN6A 3NO4A 1IURA 1N0IA 2XYHA 3RKSA 1RI2A 1K88A 2OBFA 3OCZA 1TYBE 2ZPAA 4RSMA 1X39A 3F0GA 2EJCA 3II6X 4NFHA 5JZ9A 4ME6A 2ZSKA 4CBVA 4I55A 5TLSA 1AKTA 2QYTA 5IJWA 4M7WA 1Y3FE 2PDAA 1R3IC 1UK8A 3CH6A 4ZVPA 5HGJA 3L7QA 1DBVO 2OT3B 5D7NA 3TNDA 3VC7A 1DEHA 4KE7A 5FBQB 3IRVA 1QORA 3KB6A 1ENYA 5JJJB 4ZHYB 3KFLA 3VR5H 2QTOA 2X15A 4QE3A 1P1RA 3UICA 2CMGA 3K5LA 1PK9A 2A84A 1P0MA 2C61A 4LBYA 4M0CA 2IH4A 3MAGA 4M60A 4Y2RA 5KQLA 3SQXA 4ZO8A 1VE9A 2NTYC 3HDHA 3ZHYA 4H27A 3G0CA 3M1LA 4B7KA 3DTVA 3DZGA 2Y69C 5AHWA 1P73A 2VTBA 1P4GA 3ZH2A 5CLGA 1WDTA 4XLLA 1MTOA 1N3LA 5TEVA 4G3XA 3AUYA 3LKDA 4UREA 4ZQBA 4US2R 1W4CA 5K5EA 1MSDA 4CEJA 4M86A 4FR5A 4PG8A 2AFRA 3TPFA 3IAHA 3S68A 1E2LA 3QJYA 2F4VO 3WB9A 1UFQA 2Z2ZA 3KSRA 2WSSA 1T9CA 4G86A 4LHWA 4J42A 3VBCA 1E4YA 3AF4A 3DLPX 3FI9A 2QPTA 1Y9EA 5I9IA 3K72B 2VRZA 2F6RA 2JI6A 3V34A 4LY3A 3OLQA 3A14A 3L3BA 4JLNA 1Q7YH 1RYMA 4YFVA 5DRTA 2DU8A 3ZTTA 3TD2A 2DJVA 1YRBA 2BFCB 3MCUA 5L53A 1K66A 4WXMA 4AECA 4TSFA 1RQXA 1OIXA 1RA4A 4KXVA 4JEMA 2I2XB 2Z4TA 2VF5X 5TE9A 2K1EA 3L79A 4K6HA 1TM3E 4A6DA 1GT6A 2X19A 1AB3A 2X8JA 3WGMA 2ZB4A 1QG0A 3IT1A 5E79Z 1CVIA 1S9DA 3PL5A 4TT8A 1JALA 5D00A 2BMDA 2X0RA 3V4PB 2A35A 1JHAA 1NTRA 2GZAA 2JFFA 4MTXA 3DD1A 4MPRA 1F9AA 3CLTC 2W6JG 2EP5A 3T4UA 2VWJA 1OH5A 5TC4A 3ZY2A 4JV5B 5B1OA 3B9RA 4AO6A 3TBHA 4C0BA 3IIKA 5A5DA 1CJKC 2VDWA 5LVAA 5C7YA 4KPYA 1KO7A 2GXSA 3GXBA 1TGOA 2NZ2A 4DYVA 1GUFA 2GF9A 4V39A 1VL8A 2WJAA 2R72A 4LISA 2QGZA 3LY8A 1PR5A 3DE0X 3ORFA 1JAIA 5JEEA 3ZCPA 3IMCA 6NULA 1T91A 3WU2Z 2E75B 3HN6A 3KVNA 3ZWDA 1YBFA 3LCCA 4YV2A 3STUA 4MVRA 1K4KA 2JJ2D 5FA8A 4DGQA 4FFKA 1IXKA 2X6QA 1XVLA 5C18A 1WXGA 3MAQA 4GCZA 2V9YA 3EDOA 2HCFA 4JF3A 5TR9A 2BBSA 3OTQA 1JU9A 4DYHA 2NNWB 1MV8A 1O4WA 2VA9A 5EZYB 4ZOLF 4I0XB 1OLXA 3DZIA 4RHCA 1LC0A 2DKOA 1YVUA 3F90A 3USES 1NVMB 5JAZA 3Q7RA 5DT2A 1BFDA 3AZOA 1S3IA 2J46A 2UZ1B 5BORA 5J2TF 2Y05A 2IE8A 2QJRA 3QY0A 1KI6B 5JAPA 5JI3E 3WSTA 5D51S 1EMDA 3U1TA 3WGTA 1XAJA 4PX2A 4G4YA 1UJWB 1DBFA 4GX5A 4JLUA 3VC2A 4U3JA 3D3WB 1IONA 1U1EA 3DNPA 2XY4A 4YCDA 3C7KA 1IY9A 4UHEA 2XPCA 2AI2A 1MHTA 4KOAA 1Y4SA 1E2MA 1YASA 4FDLA 2H1LA 4BJ5A 3PT9A 3FPFA 2CXRA 4MRVA 3V8NA 4JS0A 3C45A 2V8OA 1DTEA 4B48A 3HJFA 2VLIA 3NLLA 4LDJA 1AO0A 1EFCA 3GC6A 4TTPA 1EVZA 1UFIA 3B6ZA 3AUSA 3MIZA 2AKEA 4Z5XA 2WAXA 1KOJA 3SYTA 5LUAA 5SZIA 2QAGB 1VJCA 3PZBA 4BNIA 4BQIA 1K7FB 4JR2A 2DHCA 4Z8XA 4HEQA 4RFVA 2WC1A 1WZCA 3RFRA 3K5MA 4I55B 4FR0A 3S70A 4F9GA 4FLTA 4LJ9A 1PDWA 2NYVA 1X80A 4RQBA 2I87A 4DG8A 3SWWA 3F5WC 3WO0A 1GZ3A 5AJXA 4N40A 1P0CA 5JS7A 1HYQA 5IUNC 2I55A 1Q3HA 4NS1A 4AYTA 4JHLA 4TYPA 2F3UA 2R1VB 3D8HA 2P7IA 3H2ZA 1J2EA 2G5PA 1TUBA 5HIIA 4BAGA 4X6LA 3NAGA 2R6R1 2ZT6A 3R2JA 2WWVD 4HOYA 4TRRA 1VL0A 5SZJA 3NM5A 2PUAA 1EU1A 3FSEA 3D4IA 1JEEA 3S40A 1ENOA 1ZY2A 1AZSC 4D92A 1OXBB 4NY1A 4MO9A 4DVJA 5JJCA 1JVMA 3WPXA 2UVPB 1TECE 4I7EA 5P21A 4YXWD 4B62A 3ANSA 4HTFB 1T1RA 4JQCA 3WMGA 5FUMA 1YKFA 1M90W 2XWSA 3BF8A 2C5LA 1SESA 1L5ZA 3DA8A 3JTEA 3HCPA 4QLAA 2WD7A 4J7AA 3AZQA 4TKMA 5D3QA 4F6LA 1P7WA 1G4UR 2HFJA 2WEKA 4QUBA 5EB0A 5C52B 4N9WA 3SXPA 3DDZX 4EJ6A 2FW8A 4O4LB 3U3DA 5LQRA 1O97D 5IYCO 1N7HA 1WEKA 3NHRA 5IT9A 1NQAO 2FPIB 3PXCX 2P0YA 2OHOA 4A0HA 1M1KH 1G4AE 1E1QD 3N1UA 1WEHA 1BG6A 2BEWB 3LXMA 1UPGA 4PZ9A 2GK7A 3ZHBA 4JZGA 2PZAA 3NOVA 1BEUB 3HHEA 4GMHA 2JFWA 4CM6A 1THGA 1OH6A 1AJNA 3D6FA 2Q8QA 3B38A 2Y4UA 3MUOA 2BFDA 3ANNA 2YVQA 5JZSA 2O3UA 3VDQA 3W5BA 4QXPA 1TC1A 1QUFA 4KHPO 1AILA 1MDFA 5HW0A 1HC7A 1X1DA 4NR0A 7ADHA 4DV3B 4I6GA 1Q84A 1IN4A 1IRXA 1MOZA 3SPCA 1YB6A 2FG7C 1HLFA 2QTLA 5FLYA 4CV1A 3G0OA 4EPTA 3IHLA 2C4HA 5AW7A 1RI1A 4EMBA 2IKQA 2PWZA 2VF7A 3W1VA 3SI7A 4QE9A 1VJ0A 1QQCA 2NO7A 1YQQA 3V55A 1NJ6A 4YAJA 2PL1A 3A2NA 5HG0A 1VE3A 3K03A 1UAYA 2M6RA 1CUCA 1V41E 1Y8AA 2HXYA 3CGWA 3FGOA 1FP4B 3M1AA 4IDQA 4R84A 1ZGGA 2R9VA 3SKYA 4AX8A 4D9HA 1L7AA 2OQVA 3RPEA 2PLNA 1V54C 3JRWA 2R8YA 5B7NA 3O8NA 1N5RA 1NLZA 4CYMA 2R9RB 1ZCFA 2H9AA 3EWSA 4O0LA 4OQ4A 4NBSA 3BSWA 3RYHB 5DYYA 4LF7B 4G2KA 3VRHA 1R6AA 3SEQA 2ANBA 1E1CB 1I8TA 1SKYB 1BZKA 1OWNA 2PS1A 3PDWA 1SHUX 3LBIA 4HJXA 5F7XA 1R6BX 1W44A 1L5NA 3ZMUA 1MB9A 2JFUA 1XNQO 1CEYA 4PHGA 3DFZA 5DGHA 3VXKA 5HZHA 3B2QA 1W41A 5HFLA 2WLIA 4PQRA 2APJA 3EEQA 3F2VA 3JCUZ 3IUNA 3FSGA 3K32A 2ZBUA 3L5KA 2BJHA 3Q3IA 5AD1A 1IUOA 3ZWCA 4QVIA 1J8DA 1CUIA 2EL7A 2FG5A 4KJZA 2BHSA 4X45A 4P93A 3D8UA 3IBYA 3R9IA 1ONOA 4RJTA 1N34B 3VMFB 1JS1X 1L8DA 1W0KD 2GA8A 3CZCA 4XIYA 9ATCA 1UUFA 1OROA 3GUCA 1YZTA 1MC5A 2WA2A 3OZDA 4HXGA 3W2IA 1EB8A 3JCMM 4JCCA 1V8DA 1J2RA 4RK4A 1HMPA 3AG1B 2IBZH 3AR9A 4RMIA 4ALJA 3JQBC 2GPTA 5DHSA 5K3DA 5JSKA 2WZBA 2P90A 2ZBGA 4XYGA 4A27A 4IDBA 2B78A 3NHZA 1BH6A 4TV9A 2GK6A 1UXJA 2ZYGA 3MAJA 4YROA 2FW7A 4DRXB 2FX3A 3LXRA 1AHNA 4H3KB 2AI1A 2HPAA 3GP5A 2B7LA 1AVTA 1WB7A 2FW0A 2A9KA 5EJ8A 1FFSA 5FNVB 1HE4A 1GKYA 4IHJF 4PG5A 2XMBA 4IDEA 2SKDA 1N0HA 1N2IA 1V4VA 1F38A 2XADA 3C8HA 1E0DA 3KOUA 4LXXA 5A6VA 4XJXA 4GZ3A 4MVWA 3W8RA 2PV7A 1PM9A 4RYLA 2QAGA 1BZYA 1OAKA 2VPXA 3HABA 3N2ZB 4J4BA 3SK0A 3OESA 3T94A 3ZCXA 4C8GA 4PFJA 5J58A 4B3GA 4X93A 1LX6A 1P2TA 1H8EG 1F12A 3GZTB 3ONEA 1QTRA 1OI7A 4LRYA 5ESWA 1G9TA 2XZTA 1NF2A 2LRHA 4MA0A 2QBYB 2JANA 4OYHA 4BOYA 2GDZA 2OGZA 2V7QA 3IAM6 4FZ0A 1CDDA 1Y1LA 3UHPA 5GJWC 1OXMA 5BYAA 2DTEA 1L7VC 1VSUA 2Q2NA 2R2GA 3WK9A 4MW7A 2CVOA 1G6KA 2V6FA 1JD1A 2AZMA 2OZLA 3WLNA 1R3DA 1NURA 1NPTO 1WR8A 3L6BA 4MLZA 2H16A 5CB0A 4FCVA 1TUBB 4O4JF 1H2LA 1RS0A 1U0RA 3Q1KA 1JJ2U 2EW1A 4AHCA 4OMUA 4I66A 2XSZD 2XTJA 4E30A 3UWKA 3GGDA 4RZSA 4AYXA 3R6DA 5KTSA 1TD1A 5DP2A 1KSGA 5DYTA 2YZNA 5FOTA 2HK6A 3LFUA 3UMBA 4JEHA 1C3OB 1GL6A 5J9FA 1XCMA 3CPWF 5LXTB 2PX4A 3BGWA 3WK8A 3CUVA 2ZKOA 2MR5A 4KVZA 4YCCA 1NSYA 3BH7A 3V7YA 3HVRA 3ZHZA 4RWZA 1TL7C 1ZICA 3EMVA 3WIOA 2ZBDA 1CS0A 1PTKA 1U65A 2RIPA 5A2QA 4DADA 3WFIA 1CRPA 2CLDX 2XRFA 4MMZB 4RUKA 1OZFA 2NU9B 2OHVA 2ZYUX 3W05A 3C9TA 1V6CA 4CT0A 3MUFA 2EGUA 4YB8A 1NBAA 1Y3HA 2CGNA 4CM3A 1JI3A 1QS0B 2BEWA 1ABBA 1L7QA 4G36A 4QGAA 4BQNA 1NRIA 2JF0A 2XYRA 2O2GA 5E38A 3VDMA 1U6KA 1ZWLA 4E22A 4WT7A 2PMPA 1O6BA 1I94B 3N2IA 3P2EA 4P86A 2W6QA 2RKOA 3E8HA 2OTJV 1EUYA 2PZJA 2WIFA 1CF2O 3RRBA 4PXAA 1CK4A 4QPPA 2YIVX 1TC2A 1RAEA 2ES4A 5F78A 3ROKA 4DHWA 4UDYX 5AVUA 1T5TA 5LKRA 2F95B 3ABIA 2IA5A 3G49A 3LX5A 4ZTBA 3PPVA 5P8WA 3TM5A 4CL0A 3MXTA 3KE1A 3PR1A 5GZ6A 3KG2A 3PDHA 1QLJA 2WIKA 1GR0A 4OAQA 5I7FA 2C3OA 1K4CC 1G3RA 2DQYA 1XU7A 2HHLA 2WM9B 4JHXA 4LF9B 4MUBA 5TNXA 1NPDA 4I4IA 1XQWA 5HF5A 3CF6R 4AY5A 4ZOQI 3EIOA 1O5IA 4KYVA 2JLRA 1A95A 2VEDA 4E5MA 1BXKA 4IDFA 4RJJA 4WK4B 3X43A 1S1MA 3C15C 4N54A 2LGJA 1OXSC 2I76A 4RPJA 1OFGA 2VJLA 4ZC8A 4ETWA 3TG2A 3WGIA 3T3GA 1NG9A 1YTUA 3B1YA 3SN6A 2ORYA 4YCMA 4O4JB 4BNWA 3L1JA 1FXWF 1VJGA 3H2KA 3GLGB 4OXRA 2VLBA 4R54A 2YUTA 4KUEA 2XF8A 5SICE 2I78A 3DB2A 4A82A 4FE3A 2UZ3A 2GD6A 3CBGA 5IDWA 2WV7A 4XDKA 4QNHB 1PFYA 4J76A 2P2ZA 4ND3A 1Z8HA 4PGAA 2EIKC 3MWDA 5EBWC 4PO1A 3UJDA 1Z15A 3RBAA 1ZPDA 3C4VA 1KRWA 4ZV4A 4EMSA 1GFWA 4U6SA 5PGMA 5I3CA 4OI2A 2W8BC 2I4IA 3DFKA 3QI7A 3W7SA 4HB2A 4MQEA 1QDLB 1YJ5A 3UK2A 4V3BA 5KTNA 4KH1A 3GZ4A 3QIVA 4OH7A 1NU6A 5BW4A 1OW3B 2GEUA 5DGTA 5F21A 2CDAA 4OBBA 4XWOA 2JI9A 3VGJA 5HZGA 5CVVA 3L07A 1LDEA 1ZAUA 3PLAC 4N0PA 3KT3A 2QLBA 4UMEA 3C8DA 4XQCA 2P0EA 2MINA 5ENZA 5K1ZA 5KVQA 5AUQA 3GW8A 1B26A 2OHGA 1S3GA 4LCUC 1CQIB 2GRJA 1J33A 3OKAA 1H1TA 5IDYA 1EHYA 2QD4A 2MOKA 2DQ0A 3HRIA 1QQ5A 4ER7A 2CZGA 3NIWA 3WQRA 2VQEO 4CMIA 2GEJA 3D8SA 5KAFZ 3K1JA 4QSMA 4I36A 3VOSA 2G77B 3L41A 2O4UX 4QAJA 3TUJC 1XMSA 2JD2A 3HKEB 2HPHA 1ZD8A 2ERXA 4NABA 1I32A 2GPJA 3RABA 2WFZA 4JI1B 4C82A 4DV0O 3AU8A 3UKOA 4XFDA 5IYDO 3BUSA 3OQOA 2HAEA 2JJ2G 4PO8A 4JZKA 2MMGA 3PC2A 4EL0A 2JGUA 1S5LZ 3O9ZA 5CIWA 3GLFA 4O59O 1G2QA 3KQTA 3WP1B 1JKIA 4IEFB 4EJSC 3WIBA 4RUFA 1C9KA 3BRCA 5LL6Y 3GP8A 1Z16A 1B1AA 2HK7A 2R8XA 1O96B 2D5IA 1TMOA 2VO1A 2C20A 2XNCA 3BEOA 2O8BA 2BFFA 2J3DA 2VXCA 4IGAA 5DNAA 1E2PA 3UJCA 2C96A 4LHEA 5DBOA 1SEPA 4JI6B 2GEKA 4KFCA 3FHTA 5KJFA 1GUBA 4LK2A 4WNIA 3VKHA 1DKMA 1NAIA 2D1QA 5DYIA 5B58C 1C2YA 2B20A 2ZDHA 4BIZA 5JV5A 4C4ZA 5G1PA 3EMBA 4R7ZA 5ESRA 4J7CA 3TIFA 4UB8Z 5DN6A 1N7IA 3AHCA 3HR8A 5AVYA 3AJ9A 5HE9A 1I2DA 5DNEA 1CS0B 1V37A 5SYAA 4F84A 1PO7A 3PHIA 2OG1A 4AZTA 2YXZA 4K9SA 3OPYB 5GVRA 2EIMB 2JK1A 2LXNA 2RAFA 3TZLA 2IDKA 3UXYA 4JB3A 2KLHA 5LGUA 3L46A 5KPJA 1A8PA 5LL6P 1B43A 3G2PA 1LDGA 3UXEA 2Q5QA 2O7RA 2JGIA 1R6UA 4D5GA 2YZ7A 2E74B 1C5KA 5ALLA 4BNLA 3A26A 1SZXA 3UB2A 3UWMA 4O2AA 2TMKA 4B09A 4X94A 7MDHA 3TXQA 1G60A 4CDMA 2X9QA 3PEYA 4A03A 3I0MA 2PQMA 4LQ4A 4F2GA 3CF2A 5KNCA 3ENWA 1GZ5A 1CYEA 4DDHA 3E58A 3QKRA 2VSQA 1GTSA 3Q9SA 4FYWA 5CVUA 4NI5A 4ABTA 3OCVA 3JASB 3OLXA 4M9XA 1XXHA 3I0NA 1T8WA 2FUG1 2Q9UA 3A1UA 5AHRA 4AJIA 4B85A 2M2IA 1I6MA 1T34A 3OX4A 1A71A 5DN9A 3L8ZA 2PE5A 4NYMR 2IPLA 4BO9A 3ZRSA 1Z68A 2XLCA 4JGSA 1CNEA 3BJZA 4O4LA 4KSBA 2X1HA 2BPOA 2QZJA 4FFNA 2Q50A 2BHTA 4F1WA 4GVPA 5JJEB 2FV8A 2DC1A 3VVBA 5JISA 2C57A 2FQ1A 4TVKA 3KNZA 4DCCA 1QU9A 1J00A 1NUPA 5JAHA 3L4KA 4NOJA 2N3ZA 5D2CA 5GWXA 1ONIA 1JWBB 3QVVA 3LC2O 3MN1A 3NT2A 5CLHA 3QOFA 3ASYA 3JAMA 2CFRA 1H6AA 1V2HE 1FJGB 3NDPA 4TRNA 2BFDB 3KEOA 3LM8A 1R9JA 1N92A 2OIEA 3ND6A 3QZUA 4FFMA 4HMPA 1OFUX 4AQYB 4TN1A 1C3JA 2VR1A 1GX1A 3KUKA 3K59A 1YHQV 4WXEA 5EHIA 5BP7A 4NYIR 3LTEA 1GYRA 1Y9JA 2YI8A 1AI5A 1MRNA 4HLUA 3SKXA 3VYTB 4AZWA 3PQCA 2JGNA 1TTQB 3OE7A 3I6IA 5LYYA 2OFFA 3FHCB 1G98A 2ACWA 4B84A 2C0CA 3PITA 5AHOA 4DNPA 3N9IA 5K4HA 2WJ4A 4QXOA 4ZI7A 1QCYA 4FNGA 3L7MA 1W7AA 4P5DA 2Z2XA 5B1YA 5JAOA 1NE2A 4OHYA 2DYYA 4HGZA 4IXNA 4AF8A 3FFMA 2WSBA 2IUSA 5I4BA 1SELA 2I99A 2D1FA 3OIFA 4R5MA 4ZZIA 3OQ6A 3AG3B 1OOEA 4M22A 4QFDA 4CH5A 1KO4A 1BHO1 1H22A 1XN1A 2D0DA 2YQ4A 1M57C 4C30A 2DOKA 3UV3A 3DO8A 4W5OA 4B8YA 2XBLA 1E2NA 4M1WA 1U6JA 2PNFA 2DMRA 3SHTA 2R7KA 2WZDA 3JQ8A 4X1YA 1Z2PX 4JBYA 4UMFA 1JJ2F 1MORA 4KDRA 3L01A 2IYVA 4KFTA 3ZOPA 1E60A 3IEVA 3HDJA 3RI3A 4FINA 3BB1A 3VA7A 2PXAA 4DB2A 4HNHA 3VH1A 1DC7A 1HE3A 3OY2A 3K9BA 1L7BA 3LF1A 1KMMA 1S4MA 2VSXA 4N18A 4ICGA 4EA8A 5HJ5A 3REFA 1NUQA 1MB2A 2J6IA 3EDYA 3AKDA 4DGSA 4WXYB 3P94A 4HNVA 4MQ5A 3I37X 3UQ8A 3R41A 3T5GA 3GVCA 4RGQA 2FCRA 2JBHA 4LXGA 2E3JA 5LOVB 5AKHA 4B34A 2DHDA 2NVUA 1WCV1 4UBNA 4CIWA 3EJWA 1JR3D 5FWAA 1ZJZA 3E9RA 3NBMA 4W1RA 4FGJA 1E9RA 3X1WA 1N3YA 4MR9A 2MYPA 1AMOA 2YJNA 2MCFA 3A3PA 2V7WA 3HB3B 1X0XA 3I2IA 1JDJA 3O1IC 3B9QA 2FJPA 1UKBA 2CYBA 2VP2A 1H6DA 4U7NA 3ESJA 2VS1A 2H4FA 4QUAA 1A72A 3C1AA 4EYSA 4L2IB 2KGWA 2JCXA 4L95C 4RMGA 5IVPA 4PFSA 2ZVZA 1BRTA 1G5PA 2O3JA 2R8BA 4GXNA 4U7HA 3TBKA 1SQQH 3U4MA 4B76A 3OMLA 4KNVA 4UBIA 3EH1A 4XIFA 1W5BA 3UG7A 4PNEA 3R24A 5F98A 1YB4A 3N6XA 1D2DA 2IYWA 1K9MW 2WPDD 3DMDA 2WYOA 4AP5A 4IWNA 5EJGA 3CCCA 3LLVA 2BEVA 3M7IA 3OOYA 5L51A 4AY4A 1T36B 4GP9A 3H05A 3WJ7A 3THWB 4Q3AA 1CP9A 3K2QA 5LMNO 2YIJA 4HCJA 4IGEA 4HYTA 3SEAA 4BVLA 4DHEA 5ITSA 4JKOA 4JUFA 4UD6A 1ODIA 1RM0A 3LYLA 4QUGA 4XWTA 2BSQA 5HQ3A 1PFGA 5CVJA 3QKSB 2ZPTX 1HF3A 5EL0A 2JARA 2FWBA 1SUBA 1C9DB 5AHXA 1NJIW 2REQA 4E46A 1ZJ4A 4GKVA 5FJIA 1EXMA 3LFOA 3M9XA 3UM9A 4TQUS 2ALEA 1Y98A 3I64A 3W04A 3CINA 3QLUA 2OO7A 4IV8A 5EE5B 2A9RA 4OBXA 4QDTA 3K0TA 3F96A 4IWYA 4ZV9A 5BSEA 2MSDB 2HLDA 3PFFA 2IQQA 4MR8A 4NAVA 3RFUA 5KSYA 1XTPA 3IMPA 1U0JA 1C3OA 2AH5A 3C3MA 4WXHA 4QFMA 3C39A 1JJOA 1T4CB 3PSAA 4YCAA 2Q0OC 4A3SA 1AS2A 1CBUA 1VARA 2YMPA 3EVCA 4HFNA 4LSWA 4LTDA 4OXNA 1IH8A 1RQLA 5CRIA 4HUQB 1PT8A 1VMAA 2ZRAA 1X9GA 1Y6XA 4L50A 1AG9A 5C5IA 5BR8O 1ZCJA 2ZANA 3HCWA 4TLCA 3S3TA 4G8BA 4HDKB 4XB2A 1CJCA 1A8HA 1N7GA 1L7RA 3TXYA 5I51A 3DONA 3LDAA 4GBJA 5KEIA 1XFAA 3COVA 1YS4A 3DZ8A 1UKYA 4CMAA 3AUXA 3V6LA 4BVGA 2K2QB 3AFOA 4C06A 1V7CA 3O1LA 1FMLA 3R9KA 4AXBA 2XEXA 4LF5B 3SPXA 1RPRA 3R3ZA 3UGQA 3S03A 5ICMA 5CA1B 4FR2A 4QOSA 2V7QG 4WNAA 5F1YA 3VPXA 2FMFA 1N3IA 5KJCA 2PUFA 4PLYA 1Z82A 2QYSA 5B2ZA 1KXZA 2JVIA 2Q27A 1W0JA 1T8RA 1ZD5A 2B8TA 3T7KA 4D45A 1YBVA 3H9GA 4Y2PA 5CDGA 1V5FA 4P7JA 1FXVA 4NYKA 2NV6A 3CEPB 3IUMA 5K9ZA 2JLCA 5IJZA 1D6SA 1VK3A 3MPUA 3QE3A 3QVMA 5GIOC 1CKEA 3DAYA 4E14A 5LU9A 2CE4A 2XQVA 3FM9A 1K3UB 1LB1B 1DBWA 2ZI3A 4IDGA 4LJLA 3F6SA 3SEZA 1B06A 5G4UC 1YZGA 4GIBA 3PZRA 4DQDA 1ZLYA 3T1QA 3ZR4B 3AP2A 4D4IA 1YR3A 4DCOA 5DM1A 4ETNA 3OIDA 4KPEC 4JI7O 3V7QA 4GPIB 5CNJA 3G6BA 1MC1A 4LCKA 3QHQA 2JGRA 4BMXA 5HDBB 1YJCA 3BRSA 2XUFA 5CB4A 4UXNA 2AW9A 1F8FA 1MIOB 5E6RB 4EJSB 2V0GA 5BR8B 1G41A 2C2KA 2OLKA 5CYGA 5CNIA 1JIVA 1WKCA 4XGKA 3H4VA 1ML3A 3K1TA 3IA7A 2PYJA 5HBGA 1NVEA 1SVWA 2VT7A 1L4FA 3VTIC 3SF0A 4CUJA 3OI7A 3ABLB 4LZJA 3PJRA 3GLQA 5KNDA 3DXRA 3OZVA 3DCYA 4MVJE 4RS4A 1ZJYA 2E87A 3K5IA 4W8GA 2XNHA 1DMRA 3VYSC 1Q0ZA 2KPOA 2EFJA 4L5IA 3W7BA 1JSZA 4KN6A 2YUIA 3LKBA 5FBKA 2OYQA 3BFVA 5KX5F 1CQPA 4DDTA 3EFOB 4ZN6A 3TIXB 1QKIA 1XROA 3ORYA 1EQUA 1BMFG 3CCSF 2W6OA 1L7NA 5B2EA 5CXQA 1HURA 3CJHA 4FHEA 4NCXA 5HIMA 4AN1A 2DBVO 3SJAA 1QTQA 1TYCA 3R5XA 4FGSA 3ZV4A 4A16A 4JT2A 1X3LA 5AW5A 1VECA 3K8QA 1GNQA 1SNYA 1NPYA 2Q9AA 3PG5A 4F8EA 2I9PA 4TRMA 4WBSA 2FLVA 5U4QA 3PQ3A 4Y2XA 1MABA 5DM2A 1EEHA 4EO7A 4YJ2A 1WSAA 2QLNA 2XXJA 3NEJA 4LJYA 4O2AF 2KJQA 3CLSD 5AKIA 3H2YA 1SOVA 3CCSV 1NTMH 3AL0C 3IJ4A 3HKCA 5BXYA 1KK3A 3PE6A 2C5GA 1JG3A 2PRYA 3F3YA 1FC0A 1ZCZA 1UJ5A 2BTUA 1BKYA 2NAFA 2PV0A 5DNDA 3OKPA 1BGVA 2NO5A 4IH1A 4YLYA 3BCCH 2ZM6O 1USIA 1X7YA 3U26A 3UMYA 1VQNF 4JL6A 5FUQA 4BGUA 4TTIA 3BA8A 3T41A 2BE7A 2HTFA 4TX1A 3X1MA 4PN7A 3V46A 3ITDA 5F4ZA 4DFDA 4ZQHA 3EVZA 5KKAA 1X14A 3WJ1A 4ZYWA 2JJ2A 4NZ9A 4YCLA 4PCVA 4MHOA 1R37A 5BN4B 5JNSA 3KQHA 5HP4A 3J7AC 1KZ4A 1D4AA 5GTHZ 3WRYC 3CVXA 1QWOA 4BECA 1IY1A 1JKJA 1ROPA 2YHAA 1JIIA 1XAGA 2J7KA 2ZWVA 3CU5A 2VOEA 4P1ZA 4BQRA 4BX8A 5JUWA 5IM4A 4R8VA 1SIUA 1H93A 1VLLA 3DV9A 3E0QA 3FCYA 3I62A 3RSHA 4XARA 1GV0A 3BD7A 1U4OA 1RRMA 2A59A 3SVTA 1ZOIA 3T5DA 4FIZA 1P1IA 4LZPA 4COOA 5KQRA 3CLUC 3T9EA 4D6YA 1RABA 4KITB 4M2LA 6REQB 3AR4A 1MD9A 3TQQA 1NBHA 3EIQA 4U5QA 2WU8A 1CY6A 3H2HA 1W4LA 3V1NA 3RM3A 3ZHQA 1NOIA 2DYSC 1A04A 3AW8A 3JARB 4MGYR 4NCHA 1L8LA 2AK2A 1FKAO 2D7CA 1WX1A 4P82A 1PEYA 3WGJA 3HO8A 2XCTB 2OHHA 2VJCA 1U11A 4EPYA 5JPDA 1ZLXA 1FS5A 2J4FA 1BU8A 2ODEA 3FTNA 5A3RA 2XNDG 1SCJA 5A0VA 3BFKA 1XTJA 3GG2A 2UZ1A 1DIRA 1UFRA 2WTEA 1QGYA 2CKDA 1HL3A 2Y0CA 3MMXA 4Q9KA 3NVIB 1CIVA 3WLMA 4BQFA 1X7HA 3MQ2A 4J0KA 3D3WA 3E5MA 4EGJA 1U2SA 1KYVA 3NNSA 2XLBA 3NT4A 5BNIA 1XE3A 7AT1A 4BPBA 3ILSA 3HN7A 3H84A 3K9SA 1Z26A 3A31A 3HPLC 1EFTA 4GX2A 1V16B 2A9VA 3B82A 3OG9A 4Y2UA 4CM4A 3IQZA 4OXIA 1CF9A 4JKIA 3JQFA 1XPJA 3NVMB 3SFVA 3ZGXA 1WIWA 4MUFA 3W3AH 2HK8A 2P4KA 1TVMA 1EQ2A 3S3XA 2GJKA 3D3NA 3MTGA 4OIFA 1J1IA 3WRYA 2JIZD 3PVZA 4WACA 5C8YB 1U2PA 5FLXN 3GHHA 4JUIA 1BW9A 5IHXA 3GPBA 3GHYA 2BC9A 5DM0A 1BE6A 3W3AD 1M2VB 3UA4A 5CVTA 3PGXA 3S8EA 4TT3G 5MN4A 3C9SA 2J59A 2ZR0A 4KQ2A 5C7LO 3FPGA 1M2EA 4HN4B 5DO9A 4XIGS 1ISSA 1JFRA 1CB7A 2FEPA 4DR2B 2QD2A 3C3YA 3GBPA 4IS3A 1P4HA 1LWNA 1Q43A 3INYA 3Q4GA 2NLJC 2HKIA 5CB4B 2OGTA 4ITVA 3WYBA 4ERHA 3U3ZA 2V0CA 1WTAA 3Q8WA 2AFVA 4PCAA 1RSOB 2H1VA 5DMXA 3I2HA 4I4TF 2Y1KA 5FPYA 2QM8A 2CTWA 4X24A 3MIIA 1VC2A 1LLCA 4GYKA 1X70A 4JVOA 1P61B 2IK8A 3UGKA 2B3DA 1CIJA 3W9BA 1KI7A 1OXVA 1SK8A 5JSYA 3CIOA 1S7CA 2H17A 4KEAA 4L8VA 4N5IX 3R7NA 1VPTA 1CNFA 4XYLA 2JLBA 1N2SA 4ZOLB 4IXDA 1TKRA 1X74A 1ZGCA 5GV7A 1M3SA 1PJRA 3NU1A 4CHTA 1WB8A 2R8PA 3CZ5A 3MWYW 3LDDA 1NLUA 4J6EA 4EG5A 3EPKA 2JFXA 1XI1A 2HEIA 4BMSA 4HT3B 1XRRA 1F0PA 3NUGA 4BO8A 3IDSA 1E3IA 2PCLA 3R40A 1SVSA 2E4UA 2J0UB 5EJ9A 2I6TA 5KSZA 1IZZA 1S5PA 1NQWA 4P8RA 1OE0A 1V1RB 5D87A 1QDEA 3K6JA 5E4TA 3DLTA 1OTYA 1XZMA 3L7JA 3QEKA 3UK0A 3V8BA 4Q9JA 2X9VA 3N8KA 4FGZA 4OX9O 4URUR 4EY8A 3HYLA 1I9CA 1WN7A 1RMYA 5IABA 1WP9A 1JV2B 4EB3A 3VYRB 5AVTA 1D2MA 4IBOA 5FLKA 3TLCA 2DT4A 3NVDA 2ZS8A 3NS7A 3G2IA 1CWUA 4TMWA 4UE2A 4URZR 5UKDA 1WUKS 5ALYA 4OLAA 5L6MB 1HT0A 5LMUB 1VHLA 2OXRA 2OHIA 2CXSA 2W6JA 1XZBA 3FAVB 2BELA 2C07A 1EJ0A 2JIBA 1JEJA 1FYEA 4Z2YA 4EB6A 2HX0A 2IYUA 5KSOA 4U2EA 1PZNA 1B3BA 3B8HA 3H1EA 1NM5C 4MQBA 4MV9A 3ABZA 2QLMA 4ZOAA 5FT9A 3DOEA 4QT4A 1U3FA 1NMZA 2WKSA 4IEEA 4MW9A 3DGFC 3OE7G 4Q4JB 1U0FA 2G0TA 3PCXA 2O8CB 3EVKA 5CB4F 3BWDD 1X19A 2HBYA 5AMXA 4E94A 3NOQA 1WVGA 2IKSA 4M37A 1W6RA 2RI6A 4LHXA 3QU4A 2YVAA 1LVGA 4EJMA 2KSDA 3BYQA 1QE0A 2D06A 4Q3OA 1GVNB 1SQXH 2LJ2A 3R23A 1U7PA 5CVDA 3ZV6A 2UZ4A 2WLKA 1GN9A 2EKQA 3HCNA 2WUVA 2WLTA 3H5NA 4X20A 1C1XA 5D3KA 4ZMBA 1MX5A 5F9MA 3V1LA 1YC5A 1D5WA 1XXHE 2Z2KA 4BEBA 4G4ZA 2R6JA 1W36D 1UDWA 1VJDA 3E6AA 3V8VA 1E4EB 4QTTB 2XZPA 4DSTA 4YDQA 1G4HA 1ZA2A 2W2QA 4QQFA 3QELB 2Q1SA 3T5TA 5HY2A 1I6LA 3AETB 4NE2A 3A1FA 1T0IA 3HUUA 3HFRA 1RJ9B 3AY0A 4FHZA 1AQLA 4ZKIA 3Q12A 4LCEA 4OHPA 4PZZA 5AM0A 5SYNA 5TGDA 4BO5A 5JNRA 3UM7A 4CS2A 3GLRA 1VL1A 4FN5A 3H1KH 1QKKA 2FMXA 3KCQA 4YJ2F 5HY4A 1I0LA 1ZL8B 4DIKA 4E31A 3RFCA 3EGIA 3EPPA 5IEBA 3ZDQA 5JT1A 3IBTA 2QLTA 5JZOA 1OT3A 1GDDA 3CXHF 3AI3A 3B1VA 4JBLA 3OWHA 3UK1A 4DY6A 2PMWB 3KLOA 1TCCA 1XELA 1PL8A 1G21B 2QA4F 2YNMC 3UMMA 3MJRA 4ENWA 4PBRA 2FWPA 4EYEA 2D2IA 2FETA 2NMUA 4IRXA 1JDPA 4JLOA 5JG7A 5JCZA 1Y9AA 2Q6IA 2UYOA 3HVJA 3MWEB 3VI4B 1JHVA 1UIMA 2YXYA 4X92A 1EZ4A 4MWCA 3VZQA 3D7RA 4W4TA 3G85A 4B1FA 3U19A 3V97A 1MH1A 2JEUA 4JI8B 1W4AA 2J7PD 5C8YA 1K4YA 4HJRA 2C78A 4A2QA 4KXRA 2BISA 2JFBA 2JLSA 3G5MA 3L1VA 4HWKA 2CMHA 2O9JA 4RD1A 4ZVNA 4EGAA 1F5NA 3LHFA 4IJMA 1FUYB 1C7EA 4DM7A 1KYIA 2BFBA 3G6WA 4BT6A 1NXTA 3FMVA 4OLJA 3A7EA 4PYOA 5F77A 2PY6A 3X1DA 4B83A 1WABA 3C5HA 2AHRA 4I1UA 3T4EA 5A03A 1F7VA 4MK4A 1CR1A 1VGRA 1K7SN 1OA0A 2CDRA 2GN9A 2XDQB 2ZIWB 3L02A 3Q9LA 1VEWA 1Q1NA 4B0OA 2HREA 3E4CA 2QZ9A 1LA2A 5B1AB 2NN4A 1U8EA 2DCMA 3GA7A 2JLQA 4Q3KA 3R1IA 4RY8A 5ES4B 2W90A 1LFDB 3N4YA 1BCRA 2WHEA 3VCZA 1GKFA 3GRFA 4I9GA 3EXEB 1N0UA 1OH8A 5TXGA 2D8AA 4C76A 5AUOB 1DQPA 3CUTA 3P20A 4DPMA 4F04A 4WTOA 2ZRGA 5JH7A 4Z1MG 3IHWA 4LJKA 4LOJA 3Q11A 2AOUA 2DTDA 3AC0A 1K34A 4C89A 1L5QA 2V96A 3WNBA 2G9IA 1Y4ZA 4PANA 1COWG 1PEAA 2GJ9A 2Z3ZA 4D4MA 5E3IA 4IPTA 1HNWB 2PXCA 4BTLA 4RH0A 5ALKA 4MPDA 1Y82A 2R7AA 5FFFA 4WQMA 3LUCA 5DX8A 4BNHA 3EEOA 2HJSA 2SECE 2ZB8A 3NBUA 4N6NA 1NQXA 3LHIA 1ZIDA 2ZQ5A 4BRWA 1N36O 2ZIVB 2JBWA 3CW2A 4ZI2A 4PSKA 2QSYA 1DAIA 3GUZA 3EB9A 3G2HA 3IJEB 5KQSA 4FYYA 4RIIA 1K5QA 4PCLA 4AICA 2FZKA 3OOSA 3LO5A 3PQ5A 3ADKA 3CX5F 4DEYA 4NUTA 3QNMA 1SBIA 3UMRA 1O57A 3L0SA 4OFWA 4RKWA 4AU1A 1QDUA 1AF4A 2HJGA 2IUFA 3BWMA 4WFHA 2WE7A 3QBTA 3DDHA 4RPCA 4ZEMA 1FQOA 2NACA 2HA6A 3GYBA 3G9UA