5LOVB

Dz-2384 tubulin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
417
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title The synthetic diazonamide DZ-2384 has distinct effects on microtubule curvature and dynamics without neurotoxicity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 165
structure length 417
sequence length 426
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lovB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lovB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lovB01
5JQGA 1OFUA 1W5BA 5GONB 4WBNB 2Q1XA 5CA1B 5CB4A 1TUBB 5LA6B 5IJ0A 4I4TA 3HKEA 4X1KA 5KMGB 1RQ2A 5BMVA 4O4HA 4O2AA 2BTOA 3HKCB 2BTQB 4U3JB 5JVDB 1RQ7A 4O2BA 1FSZA 3RB8A 4I50B 3VPAA 5ITZA 4XCQA 3RYCA 5IYZA 5MN4A 4TV8A 5J2UA 4YJ2A 3WGJA 4X1IB 1SA0A 2XKBA 4U3JA 5EIBC 2BTQA 5JVDA 5MN6A 3N2GB 4LNUB 3HKDB 4ZOLA 5LOVA 2GVIA 3RYHA 1TVKB 4X1YA 5JCOA 3WGMA 1Z5WA 4YJ3A 3JATA 5EYPB 4E6EA 4IIJA 4F6RA 4O4JB 4HNAA 2R751 5KX5A 2R6R1 1FFXB 4TUYA 3JAWB 3JALA 5LP6A 4LNUA 4EI7A 3VO8A 3N2KA 3HKBB 4ZHQB 4TV9B 4FFBA 5M7EA 3E22B 5GONA 4WBNA 1JFFB 5IJ9B 4O4IB 5CA1A 1TUBA 4O4LB 1W5AA 5LA6A 5EIBD 5J2TB 2VAMA 5LYJB 3E22A 2RHLA 2RHOA 5KMGA 4X20B 2VXYA 3JASB 3RYFB 3HKCA 5FNVB 3WGKA 4I55B 3JAKB 5CA0A 4I50A 1W581 3M89A 1W59A 4IHJB 3M8KA 4M8IA 3C8LA 4X20A 4X1IA 3R4VA 2RHJA 4ZI7B 2XKAA 3N2GA 5EZYB 4EB6B 3HKDA 1RLUA 5LXTB 3ZIDA 3RYIB 3WGNA 1TVKA 3JARB 5JH7B 3UT5B 3ZBPA 5EYPA 4O4JA 4DRXB 1Z5VA 1FFXA 5CA0B 4EI9A 3JAWA 5JQGB 1W5FA 3RYIA 3HKBA 4DXDA 4ZHQA 3V3TA 4TV9A 4KWEA 2RHHA 1JFFA 5IJ9A 3WGLA 4O4IA 5IJ0B 4I4TB 3HKEB 4X1KB 4O4LA 5BMVB 4O4HB 4O2AB 5J2TA 5MN5A 5C8YB 5LYJA 4O2BB 2VAPA 2VAWA 5ITZB 3RYCB 3JASA 3RYFA 4TV8B 5FNVA 4YJ2B 5J2UB 5IYZB 3JAKA 4I55A 1SA0B 3VO9A 4IHJA 5C8YA 2Q1YA 4ZOLB 5LOVB 3RYHB 4X1YB 3CB2A 3VOAA 4YJ3B 5JCOC 3JATB 1W5EA 4ZI7A 4IIJB 4F6RB 4HNAB 5EZYA 4EB6A 5KX5B 5LXTA 3VOBA 3ZBQA 4TUYB 4B45A 3JALB 3JARA 5CB4B 5LP6B 5JH7A 4U39A 4B46A 5LP6C 3UT5A 4EI8A 3N2KB 4DRXA 4FFBB
chains in the Genus database with same CATH superfamily
2PD6A 3RC3A 3QY9A 2G1PA 3O6VA 4KXMA 2R8RA 2QW1A 1IULA 1RC0A 1C1XB 3L4JA 2HP0A 1RAEA 3I39X 3ZNOA 1YR6A 5GWXA 3HXMA 3FZNA 3SZ3A 1VQ1A 3R5XA 2PXXA 2A67A 2FGKA 3ELYA 3G67A 1V7QA 2J5RA 3HM2A 2X4GA 2XUPA 4HPWA 4G97A 1DQYA 3ABLB 5CLHA 2R5FA 2PMEA 1JPNA 4CHGA 3OZIA 4F3KA 4FLMA 1T3ZA 5JFOA 3KR9A 4PC7A 4AFNA 1QIFA 4TLAA 1YQTA 5AW6A 4IS3A 1IQUA 3JD4A 3MCTA 1LFAA 3A6EA 2NXWA 1RJ9A 1JJAA 5ALDA 3ICPA 1M7HA 1AB5A 2HT6A 3LOUA 3WFJA 5CB8A 5K6RA 4LGYA 1RHKA 2Q7XA 1ZH2A 3VNVA 5FTWA 1WNSA 4LBVA 1UKVY 4JBIA 1QF9A 3RT3C 3W5AA 3WGVA 3TBHA 2V6FA 2JF0A 2V98A 4LFCB 3U4CA 1BMQA 4TKUB 1XNGA 3TPFA 1TL7C 1IZ7A 1CQIB 4COKA 4MRVA 3VTZA 1U0LA 2H1OA 4W7IA 3DB1A 4FYVA 1UCFA 3ROTA 5JASA 2RNBA 3D4OA 1T0AA 3CPSA 3OONA 1JVBA 5FH9A 4HWKA 1IEWA 5KX5A 3OTOO 3RWRD 3RHTA 4C8IA 2A1TS 4HZUB 4XA8A 3L93A 1RAFA 1VIVA 2XOEA 1EK5A 1ADYA 5DYYA 1WW3A 1FFTB 4XQ9A 4UHKA 2L0XA 1MENA 2BMAA 4ZN6A 5FA5A 3EQ7A 4JU9A 1I08A 4UTNA 2C1XA 3ASOB 1RZUA 4QSMA 2Q2WA 2P9FA 3FAZA 2XITA 3ETNA 5K5EA 4MI1A 2R6FA 3HFGA 3OE1A 3EHDA 3DZCA 3Q2OA 3R1IA 5TPZA 2GYYA 1SC5B 1RRCA 3KBBA 1CR1A 3GDGA 1BHBA 1TTPB 1RQRA 1JVSA 2R85A 3HB7A 3A2KA 1V39A 2J0SA 3AEIA 1W1IA 2L2QA 4B3BA 5KTKA 1NWCA 1Z4KA 1KEWA 2QSZA 1C4WA 3BRCA 3EZLA 4NOMA 2INGX 3PZRA 1RQXA 1RPRA 1M54A 2OWDA 3EGDB 5A02A 4BY9D 2HXGA 1BHQ1 4B43A 1ZHOA 3VMFA 1GN4A 4CFSA 3MBKA 3LYHA 3OQIA 2R3SA 4LHSA 3P2OA 3ND5A 2DFLA 4AULA 2KLHA 5DNEA 1W42A 1LR1A 5E2AA 5A5GA 1PK8A 3QVSA 5A9GA 5GTHZ 3AQIA 1ISHA 1JECA 5B1YA 2CFSA 2X6CA 3CCQV 1R0RE 2GZRA 5TRTA 3URKA 1DIOB 3FM9A 2BMFA 2QN8A 3OQNA 4K03A 4HRXA 2UZIR 4XJTA 4HGPA 3Q1LA 5LYJA 1M1ZA 4X9XA 2OB2A 3PGJA 3K4QA 3DEJA 5KNBA 1WCIB 1JEYA 1WBBA 5FAKA 1REQA 2OHWA 4FPXA 1SESA 1CP3A 2BUAA 1WU8A 3G1TA 4FR5A 3JQBA 4UXJA 3NHYA 1C30B 3M4NA 2ID9A 3SQLA 5B58C 3V8VA 1M5UA 2C1EA 3AL2A 3NVMB 3AEUB 1IDOA 1AQLA 4WOKA 4CQMD 4R7TA 4MVJD 5L53A 1TIBA 3KKOA 4MPTA 3DXRA 1AZLA 4K05A 1B76A 3ELCA 5I8WA 3DPIA 2TSYB 1P0IA 1PJAA 3OZFA 4RUFA 3PAFA 2ATEA 2H17A 5I4IA 2ZUSA 4S1OA 3VBCA 4BOYA 3WKCA 4K9DA 2FSFA 4DR1B 4CHTA 5FR2A 2XAJA 1KYQA 5FYQA 1JFRA 4Z4FA 4JI3B 4DCMA 1WDKA 2E9SA 4JI5B 4DV1O 2OPHA 1M2EA 1OCZC 2Y1KA 4N3BA 2K2QB 2P9BA 1YKGA 3SE7A 1QK3A 1OA0A 5LHIA 4Q01A 2EZUA 3D8SA 4IF4A 3BMQA 1ZICA 1VQPF 4BNYA 1AF7A 4XSHA 4TWIA 3E58A 5KJCA 3GC6A 2OXFA 4L0MA 2CHTA 2ZU0C 3SG0A 4JK3A 1GQ2A 4DR4O 4OLAA 1DTWB 3G89A 5L3EA 4EFLA 5IY5C 1IJKA 3CB4A 3LWDA 5ENVA 1E0DA 4OHRA 1YQWA 2IDMA 4CEJA 4F71A 4JYMA 4ESEA 3A3KA 2LR0A 1MEOA 4AUNA 3ILYA 3EULA 4JSYA 4LRQA 2DWEC 3JPWA 2EC5A 1YE3A 2H4WA 3OO1A 1H2BA 3WLEA 1JCHA 3GEMA 2C0PA 3P71T 3SYAA 1FUKA 5ILQA 2HSDA 1LRKA 3GLFB 1PR1A 1YQGA 3MJVA 2JI6A 1BA2A 5KNDD 1P9LA 2YWXA 1Z73A 1CE8A 4KQGA 3S6JA 3VFDA 1DCFA 1OYOA 1KI7A 1Y1PA 2GYWA 2XT9A 2OTCA 2XKBA 2V5VA 2CXSA 2IITA 3N0TA 2WF5A 4QYIB 4WN9A 1QR6A 2BN4A 1IXYA 2O1XA 2PXAA 3MCVA 4YMGA 2IH3C 5HCNA 4DY4A 2UYHA 4WEQA 4M1EA 4K46A 1NI4A 4JFAA 2DWOA 2OD7A 4CV0A 2QEXV 1IPAA 4QRDA 4GOLD 4ZO6A 1QVAA 2EF1A 4DK0A 3G0BA 1XVLA 5K4AA 5B7PA 3NASA 5AVRA 3BE8A 3IVXA 5LYYA 3CZ5A 5I47A 4XWAA 5C3UA 2IOFA 1NNLA 4MW4A 4I0XA 3H01A 1V54B 3CYQA 3G17A 1I3NA 3BCSA 1BAPA 5JCOC 3SPXA 3ROGA 4YASA 1W93A 3VH4A 4IHQA 4HRYA 3CSXA 2FPIA 1LF5A 3DFZA 3HJTA 5C5CA 4ZYYA 3UCSC 3D59A 5E6UA 2AZ0A 2BDUA 2ZJYA 4QAQA 1YU6A 2QXTA 3KD2A 4HDKB 2WB4A 3ME5A 2N9UA 2E0IA 4QD3A 3FWHA 4C2TA 1WMSA 4D45A 4DR2B 2X7RB 4KQMA 2PD4A 4ES6A 3E4CA 1YRAA 3FF1A 3HP4A 1E1QG 5IBCA 3O8OA 3JWHA 5HY0A 3RAPR 4YO7A 1V48A 3IX7A 3NTLA 4WUTA 2PRKA 3JAWA 2AH5A 2WG2A 3EMDA 2Z08A 5TF0A 2OXRA 5AVZA 5JG7A 4DF3A 3HYSA 2HJRA 1VQLV 4CMCA 2JAQA 4XLZA 4DIBA 1MT0A 4IJMA 4FC6A 5A3VA 3EEOA 3CBGA 2M7WA 3UK1A 1QKJA 4TUYB 1KR5A 1ZIPA 3U0OA 4GKKO 3CCVV 3G88A 1GEGA 1QNLA 4DNOA 3ZX5A 4V3CA 3M5WA 3EJWA 4AILC 2W6MA 4EKDA 1CY2A 4DREA 1U2SA 4GT1A 2BUCA 2CGEA 4YA6A 4UVAA 3ZOKA 4YJ2A 2NO1A 2V9CA 4X3OA 3P2KA 3N4YA 2IEIA 2QAGB 3HCAA 1L5SA 5A4JA 1LNQA 3F2VA 5JSQA 1KF0A 4BNJA 3KQQA 5C53B 3QLVC 4FMDF 3HBAA 5ALFA 1YA6A 2XNDD 4D6YA 4PZUA 5KUMA 4I6JA 1YNSA 5FOSA 3I34X 3GDHA 2H51A 4PRZA 4PZEA 4XPIB 5E9JA 1W96A 5KDOA 3G6BA 4KQFA 4CXMA 4YI5A 3VNQA 3WIOA 2VQFB 1USKA 1CB7A 4JQOA 2QMZA 3ZMUA 5E4TA 1NBEA 3U31A 3PBKA 2ZODA 2D7DA 1GPDG 1KIAA 1SZXA 1ZVJA 4ESVA 3C4JA 4TOIA 3IKFA 2FSVA 2J0EA 4A5SA 2GKSA 3OQJA 4OAQA 4IM7A 3RHZA 2FX3A 4DA9A 5CLFA 1IIRA 5AI6A 4RK7A 2C82A 2D2EA 4LRWA 1O5TA 3ZS8A 2VN8A 3SICE 4PDVA 3INNA 3S1LA 2QTVB 3ZCSA 3G2HA 4URZR 3CH5A 4LXYA 5GMOA 5HKKA 1AA6A 4BNWA 1Q7YW 1VSTA 1XMIA 1TGOA 3K0KA 4FLZA 5JDIA 3WK7A 3CY6A 2JGRA 4H59A 4KR7A 4IUBS 2R7LA 2RDMA 4FU0A 4BFVA 3E7XA 3GUZA 3QU2A 2BFMA 4JSRA 2QTZA 1OXSC 5CD9A 5A3RA 2FUG1 3T5DA 5AVWA 4TRMA 2F43G 1ILEA 5LQJA 2VJQA 3MTBA 1KEKA 2Q1XA 1ZUNA 1TKBA 2ZYIA 5BMVA 5EESA 1NHGA 3A9WA 3VI3B 1PYDA 4KWTA 3N3BC 4J03A 3GW8A 4J2HA 1FP6A 4AMUA 3PGVA 2ONJA 3ETLA 3GLIE 4HTAA 3QM1A 2P67A 3A4LA 4AY3A 1OFGA 2CHQA 1OGJA 4RE6A 3DLAA 2EW1A 3W1EA 2CXOA 2DQ3A 3PDWA 4Q3LA 3KR1A 4EPYA 1K73H 2I55A 3DUWA 1I36A 3OURA 4WH0A 3GGOA 5LZ7A 2ZVQX 1XDBA 3UCXA 1RRMA 2XXAB 2JKZA 4W5OA 2HPAA 3A0BZ 1NW4A 4ALJA 4BKPA 4ZVRA 2JEOA 3LT4A 1JEAA 2FX5A 5CBHA 2PUVA 1DAKA 4R01A 2XOKA 1PV2A 4CNQA 2Q6IA 3UV7A 4F92B 5T4BA 2ASVA 1F1JA 1R1MA 2O6LA 2D8MA 3TD3A 4FS8A 2QYTA 3TH5A 1X38A 4JOCA 5HWSA 4XDZA 3R7SA 4KO4S 3TSWA 1H4SA 3EFHA 3M6LA 4IXDA 2X42A 4ZVUA 3KLPX 2LZ0A 3GCDA 4NPAA 1WZ2A 3ABLC 4NU8X 2RAVA 4GI5A 1XTBA 3N8IA 3L8YA 1NA5A 4JROA 4DBZA 4QJIA 2QQGA 3HU1A 2ZR2A 1H2YA 3HFSA 2HI0A 4CL2A 2FPPA 4GS5A 2XR1A 3UWPA 4DUYB 4AX4A 3HJUA 2I9PA 3GEEA 3TRIA 1PR0A 3LL7A 2DYKA 3DLTA 2I0FA 4MVXA 1L3IA 1YU9A 2Q5OA 2HTEA 2VAWA 3VPDA 4LYHA 2ZYRA 2DFVA 3OEWA 4EQZA 1FXKA 1ZMXA 4LHYA 4C14A 1GQFA 5DHTA 4ZVMA 2HQ1A 1J2TA 4XX1A 1W5BA 3DHVA 4RWEA 1MMMA 2GRAA 2IXAA 3WAKA 3KVOA 4W63A 1TJ5A 1TW3A 3RB8A 4YXWG 2XUQA 3UICA 5I7HA 1P0FA 4B82A 1R5OA 2UZ4A 2H4HA 2ZLBA 1FFBA 4YUXA 2PXCA 3LKDA 1VQMV 5CMUA 2QTHA 4HNRA 5FPSA 3X1ZA 1U5AA 3QOFA 2PD3A 3TZKA 1I1HA 4ZT3A 3WNVA 1B0PA 3ROZA 2JDIG 4GLXA 3BMXA 5AHXA 1QP8A 2NPOA 1XRLA 3GBVA 5LNK6 1EFTA 1RM4A 4BEWA 3STXA 5EZYB 4ZZ0A 1X15A 1M34E 3ITEA 3NAQA 2ZKOA 3ASOC 1ZCZA 3VQTA 3LUAA 3M9WA 1X77A 4FHFA 5EJ5A 4YJGB 4MV6A 2Q41A 4HX5A 2OP0A 4D4JA 1L0LH 2TMGA 1ZM7A 1ZOSA 4I1VA 2AFHA 2VP5A 3K53A 5K0TA 4LXQA 2A94A 3JARA 2M9MA 3FPLA 5HOEA 4QU0A 4OI2A 5J2UF 2CHSA 3C3PA 1F3LA 4BVHA 4AY6A 3AVWA 4RD6A 3OKAA 2OXEA 4Z3KA 1VLJA 3EUAA 4FXPA 1ZD2P 4M8NE 4M0FA 1GV0A 4TKVB 4OBBA 4J0FA 4X3MA 3V4RA 3WAGA 1T3LA 2B33A 3ASZA 5JADA 4TQGA 3ET4A 4UE3S 1CYDA 3QHAA 2ZXEA 4LF5B 2Q0XA 4RXTA 3K03A 4BTEA 5TGZA 1VL6A 3G79A 4TGLA 3VH1A 1EUDB 3JAKB 1KEEB 3P4UA 3PGA1 4RIEA 2Y92A 2C9BA 4E3WA 1QC5B 3OWXA 3MWDA 4O4LF 3UF0A 3MB8A 1D1TA 5J4LA 2GK4A 4S1VA 4BUJA 3TL6A 4J9VA 5HZHA 1SO8A 5AJTA 2XMRA 2XGMA 4JXZA 2VHQA 1K0FA 2CVOA 3OR7C 5G4UC 1VIAA 3KSBC 4RCVA 3HWWA 4JAVC 4V2IA 2RGUA 3U3XA 1GT91 1D09A 2ZJZA 1E3DA 1DADA 5KSPA 3IP6A 1HLFA 4Q7JB 2I1LA 1U8ZA 1YVWA 1BEEA 4WI1A 4Z2AA 2V7XA 4EO7A 3KU1A 1KH2A 2ZUBA 1Q17A 3KDSE 5BNZA 3G8YA 4ED9A 4WCEV 1T3GA 2QI9C 1JP7A 3B5IA 1XJWA 2XAFA 1GDTA 1XQYA 5KCZA 1JU9A 1TPZA 4QGFA 5FR1A 4U1RA 1BKDR 1LI5A 3R7FA 3R3YA 1HX7A 4KO8A 2J85A 4RK1A 1WF6A 3BFXA 5C52B 1U2GC 1XZCA 3RK0A 2P7IA 2RHCA 2QF7A 3ZHBA 1WV0A 2VDJA 1ZCJA 4MLCA 1Z7GA 121PA 4QU5A 2HY7A 3T15A 4C6SA 1O77A 1QQAA 2I8CA 1ISPA 2UUPA 4I4IA 2Q7HA 1H05A 1GSIA 2XXJA 3H9BA 1YZLA 2PZKA 1VJCA 1T6ZA 3MDOA 4CI9A 2JIPA 3SX4A 2AQIA 3MHHC 3DW1X 4B7XA 1LC3A 4O4JB 2AFIB 4FVTA 1JIJA 4YGYA 4PA7A 2AXEA 4MLZA 4XDHA 3HDQA 3M6AA 2KG7A 1K6EA 2ETNA 3BD7A 1LK5A 3NQ41 2QUKA 1DJOA 1C7RA 5I5EA 3Q4HA 1QVGF 4WNCA 2XBMA 2W6JA 4B4KA 4BVRA 2A9HA 3UG6A 3TZBA 4A5UB 3NXSA 5KTSA 4KMOA 1QVFU 3PX2A 4EUKA 5IDWA 3T5CA 5JAZA 4JVSB 1Q77A 4P4SB 2D62A 2FSIA 3WBKA 2YBEA 5EUBA 1PVOA 5KINB 2FZLA 3H2KA 2NXNA 3L1JA 2FR8C 2DHQA 3W4JA 3OQPA 1YR8A 1YDGA 1T2EA 2HLDA 1G7TA 1H1LA 2PUGA 5CG2A 3EWNA 2R6JA 2GARA 4YTEA 3LNNA 2GEDA 2VWGA 5KS2A 1K63A 3KVVA 5J4YA 1J8QA 3OLQA 5G02A 4HGQA 1V2GA 1PNMA 1ZW1A 4Y2YA 1QRUA 3D0RA 4MCHA 3MELA 3TRJA 1P9OA 2PJUA 5EHIA 1QVZA 4LV5B 1U9YA 4L0DA 2JLQA 1PVDA 1J33A 4M8KA 2FUEA 4JENA 2WFLB 2Z2JA 5LBQA 4QWMA 1G8HA 4QPKA 3U7IA 3NVDA 2X5NA 3CUSA 4CM8A 3OZCA 4BO8A 5HQ3B 4P80A 3CHYA 2YZNA 1CR4A 3T94A 1FJHA 3MILA 1V54C 3RYHB 5EUCA 4KDEA 3X43A 1OA1A 4CVNA 3M3DA 4JI8B 4J76A 2XHEA 5PNTA 5IXYA 4FFKA 1D2GA 4MZXA 5K0JA 3AU9A 4MAFA 1CUAA 2VFAA 3CKKA 5KHGA 4NECA 1ZL2A 1K6JA 1TVKB 3FWZA 1XHOA 1VOTA 2TYSB 4JQSA 3VH2A 4EUNA 4G37A 2W2OA 4FFNA 2G09A 3FRIA 5G0TA 4L5IA 1PXWA 2Q6OA 4BKUA 1KZHA 4RTOA 3L4BC 1J5PA 1QV9A 1C8VB 1ISSA 3UM7A 2EFGA 7YASA 2O20A 1JA1A 1QIIA 3N39C 3PFGA 4XWYA 3BGDA 1NOKA 3D4PA 1KZ6A 4TWRA 3I62A 1HY3A 5T41A 1U7HA 4UMVA 2VTBA 2ACEA 1E6CA 4BRZA 1C0PA 3J7TA 2X1VA 4P81A 2BYTA 3ZIAD 5JS8A 3NM6B 1WD7A 2HMSA 3SS7X 3Q2KA 3V4LA 3UT5A 1PWZA 2V6GA 3UW3A 4Q9JA 1DKOA 1FNDA 5AVVA 1N2CA 2AQKA 9MHTA 1J1UA 2IW5A 2BTQB 1K97A 5KVSA 2XY4A 1IE3A 3TLXA 1C3JA 2R7AA 3N53A 4KK4A 3HKDB 1YZYA 2Z2XA 4UNNA 1CUFA 3ZK7A 4C7OA 2AKYA 4L28A 2ZJOA 1T0PA 3QUSA 4G86A 5HILA 1T34A 2QAGC 5LP6A 4R2IA 1G8YA 1RJEA 3NLLA 3E5MA 3OM8A 2GF2A 8ADHA 2V54A 4G0UA 1RPNA 2JI9A 3IR9A 1AA9A 2WILA 3OPVA 4G36A 4CTMA 4JV5O 4I50A 3KO8A 3OMXA 2Q2VA 4L76A 2V8BA 2H59A 1XREA 5AI8A 2UXDO 1MC8A 1E77A 3V5NA 1D4AA 2QIOA 2BI7A 1DBSA 5KJ6A 2V3VA 1N4CA 4KWEA 3J7AC 1EI9A 3WLIA 1A5ZA 4TWZA 1T9BA 3U6BA 3OR6C 2IFTA 2CVZA 2VPQA 2SBTA 5JNSA 5FWYA 2HCBA 4E08A 3TAUA 1XO1A 1ND5A 2A1TR 5IYZF 3R3JA 3ENKA 1P60A 5HPYB 3VQWA 3VM6A 4D3XA 4YT8A 4Q3NA 3G82C 2Z4SA 4D82A 1IUOA 1YQUA 1DJNA 4EYGA 2R6GA 3AI7A 4LCJA 5ALXA 4P58A 3W79A 4A8JC 1OB2A 3B7GA 1P9RA 1R4ZA 4KWHA 1GNSA 1ENPA 3BICA 4AU1A 3X2QB 1IQPA 1RNLA 2ZT6A 4NQZA 1FDOA 1IPHA 4C88A 2FMLA 3DE1X 1OLXA 2WSIA 4XUCA 5HY2A 1P2BA 3HN6A 3L6UA 1R8QA 3ORQA 1YACA 3EYWA 4RLHA 4TRRA 5KKAA 1GNPA 4B9EA 2R86A 4O1HA 3NVKI 3PX7A 3FDZA 3E1GA 3UK0A 2RGAA 1PX2A 4KEAA 2C29D 3BMOA 3S4YA 1R0YA 3VOAA 2ECPA 1YHQV 3ETCA 4YYZA 2GXQA 4C04A 5AW4A 1SUBA 1E9SA 3Q6MA 5DN9A 2DPMA 5DMXA 1X59A 1ZNWA 3IUSA 2HF8A 1FNMA 2BGJA 3GNLA 1YEWA 3L8MA 4N12A 3RREA 2R1TB 4EUSA 3L0OA 4CIVA 1FYWA 4M0DA 3G7NA 3OUTA 1GZ5A 4WKCA 3AL0C 4KYVA 3OIGA 3FOZA 1L4BA 3F73A 1WBDA 2A9VA 1UWKA 3L74H 2FEWB 3D6FA 2JLZA 3M2PA 3K5LA 2L42A 2BD0A 1TMGE 5D6OA 1IURA 5AQEA 4HR7A 4QDOA 2ZAGA 5T5QA 4ERHA 3QNMA 4L8YA 1W5FA 2I76A 1JQ5A 1K9SA 4Z4HA 2MK3A 4KOAA 4LK2A 4R31A 4YCCA 3C16C 1E4EB 2OT3B 2QL6A 1OYWA 4Y2UA 5DNVA 8OHMA 1KP9A 4EHKA 2QTLA 3FJ1A 5BN5A 2VXBA 4XFDA 3CH7A 3E3OA 4BJ1A 5IP5A 3SYMA 3HB5X 5FL3A 2A59A 4RV4A 4BECA 4KC0A 4BE9A 2IXEA 3VAAA 3S02A 2ZYGA 3HXLA 4HNVA 4BNDA 5ARCA 2HREA 3ERNA 2PN1A 2HBQA 4WBNF 1U96A 2MSNA 1P0PA 3IBGA 1NT2B 9GPBA 2D2CB 4CLOB 1KB9F 3AOEC 3BA1A 4ZDJA 4I5EA 4BEVA 2VAMA 1LPAB 2J9RA 1AJEA 4RHUA 2I4TA 3WRYA 2AV6A 5BNFA 4OHVA 3K0FB 2H57A 1LRLA 4RSHA 2UYYA 2Z1DA 1OCZB 1ODIA 2FMUA 4MPPA 1C0KA 1T3HA 3FW1A 4NJMA 7ADHA 5CVVA 1CEEA 1FMTA 1XCGB 1E79D 1A72A 3NO4A 4C1BA 4A73A 2PNFA 2EULA 4A8TA 2XT6A 4E5SA 3ISJA 4MT8A 4AJNA 1G64A 4AJOA 3ABKB 3A36A 1UKBA 3O93A 3C6ZA 5G41A 2VJCA 3AUTA 4YJFA 1AJNA 4ZV9A 5DIFA 1X87A 1R3LC 1EP1B 3A3YA 4OQEA 4D41A 1X2EA 2R65A 2PJRA 1WMEA 3SPCA 1DSSG 3V4ZA 2CJYA 3A4IA 5FPPA 4PBRA 3K9NA 2WHYA 2HVJC 3B13B 1W52X 2NLJC 3W8FA 1V43A 1F6DA 2CJXA 4IH4A 4R0VA 3CE6A 1P2VA 2WSMA 4ZU6X 3CPHA 3QENA 4U3FH 1ODSA 1DAHA 2GNOA 3ZU3A 5EB1B 1EKXA 3KHTA 5KUTA 3ZLJA 4LWSB 2HA7A 4UUJC 3I55F 4V0MA 4UCQA 1NPTO 5AJVB 2YDEA 3MCAA 3WWEA 5HM8A 3MIZA 2B21A 5EIHA 4AF6A 1BDIA 4P36A 1PJLA 3IHWA 4TZKA 4PO8A 4GX2A 2H7YA 5FNVA 2F9LA 5A2QA 2OCIA 4P4UA 2GJ4A 1JJ2U 4DWJA 2O2XA 1VCIA 4EL5A 3GLGA 1OLUA 2G7MC 5HZGA 3A06A 1SEPA 2PBZA 4J41A 2JEXA 1LI4A 1ULTA 1XNJA 3BFKA 3RW0A 3GJZA 3V42A 2B1JA 3AESA 2HT1A 2HHHB 4G63A 1QIDA 4PV1B 2IOQA 3OGIB 1RR6A 4J8PA 3MG9A 3PVSA 3WWYA 1AM4D 2YZ7A 5MFZA 2CSUA 2CV2A 4FDVA 1EPUA 2ZDQA 2I6XA 4WNIA 4YRDA 2Q4EA 2IIVA 4AS3A 1GADO 2VJDA 1GR1A 2ZYVX 4Q4JB 1F8FA 1DT5A 5CLLA 2XDQA 3GT4A 2GEBA 3PZBA 1KORA 2ECOA 2I03A 1U7WA 3CWQA 1RJFA 2W00A 4BNZA 2ZOSA 5GINE 4TV8B 2Q5JA 1KO8A 4M99A 5AI9A 4C6TB 2BSQA 4Y9SA 4DV0O 1P6UA 1IN4A 3RS5A 1GLGA 1NJIW 5JJIA 1E6EA 3EDRA 3M6XA 3FGZA 3OX2A 4HL6A 4MW9A 3AI2A 3UJNA 1OX4B 3LWZA 5HE9A 2HVYD 1N2EA 3Q41A 1KNKA 1XRQA 3HCEA 4UE6A 3D6AA 5K3DA 1W4AA 4WFQA 1ORDA 3CC4V 4F56A 4OPAA 3JVHA 3EEFA 4E33A 3KHNA 3OGCC 1LDMA 3ABSB 3CUEF 1RBMA 3PPVA 3UAZA 1HEIA 4Q16A 5U4XA 2FPMA 3RSGA 2QNRA 1SUSA 2WD9A 4K8XA 3AR2A 4OY3A 1QFZA 4WUVA 1DC7A 1Q74A 4IIUA 3VHQA 1I3LA 3RABA 1G4AE 1WW8A 5JSZA 4ETNA 1BNCA 3ZX6A 3RFTA 3FCOA 3GB9A 3CW2A 1BMFD 2A5LA 1LLDA 4DJJA 4KPEC 1BG6A 1EZJA 1DWPA 4K6CA 1ORVA 2QUZA 3ZLVA 2PYLA 3CF2A 5C5IA 4M46A 5AHWA 1MC5A 2HJSA 3OA0A 2PWZA 4HTFB 4O4HA 3OPXA 1UADA 2ZIGA 5DHFA 5L3VA 3COSA 3SJBA 3KPUA 4IUDS 4OXRA 4IL6Z 4BVGA 4JY7A 4GI3A 1JR3E 3E81A 2WLTA 1L9KA 4LHWA 2OA0A 3E22A 3QWFA 3MDSA 2Z3YA 5FWAA 1C41A 3JR7A 1ORTA 5HTOA 2H8PC 1RP7A 2AZDA 3QW4B 4DJAA 2V7PA 3E1KA 1XTTA 3ZQ6A 4GL4A 4UHBA 3CH6A 4BFXA 3AZQA 1GZ0A 1AURA 2ZD9A 1W76A 3R40A 1C9EA 1GA4A 3OG9A 4E1BA 4BLQA 2MINA 1G3MA 3H87A 4LOHA 4PZLA 2APJA 5EEHA 5F52A 3HR4A 1XMPA 3H1IH 4BMNA 4CETA 3D4LA 3UA4A 2JLSA 3IQWA 1Q7RA 4TSFD 5MF6A 3DDHA 6REQA 2YYSA 4LRUA 2JFWA 1XBLA 2Y67A 2D1QA 4FMTA 4URUR 1FUEA 3DEFA 1BW9B 1AI6A 1P18A 1BVHA 4O4IB 4I0WB 5LA6A 3WKEA 4DV2B 4C30A 5FLEX 3TSYA 1XNRO 2FN7A 2AE1A 3U60B 2O7NA 3G0IA 4S12A 2HUPA 3VDXA 1TO6A 1PGOA 4CCSA 3ZBPA 1PP9H 4D8XA 1BFUA 1EXMA 1KEZA 1WSBA 2UYNA 2H65A 4R9VA 1UDWA 1GTMA 1F7YA 1TADA 4FIDA 4PG6A 3EXIB 4IGGA 2NZJA 2X6AA 1H85A 4FHCA 2ADMA 3LDAA 3FKSD 2YS8A 3VYVA 1TA0A 1L7XA 4ND6A 3OCJA 3TTWA 1U6IA 3ILVA 5IUKC 3K4PA 1E6UA 5I7AA 1P2TA 1SXJE 3CPWU 5KX5F 2CBXA 5FBWB 3SF0A 1WDWB 1EJ2A 3W8NA 3UBTA 4MKIA 1Y5RA 4GWKA 1KMMA 1SVMA 4JTAB 3GJ7A 4JLSA 4N9WA 3I9LA 4N41A 1UR5A 2WHEA 1HF3A 4DT1A 4Z9FA 3AXSA 2NACA 1D04A 5ALJA 3UMSA 4E5MA 4RGBA 2O23A 2K87A 4OGFA 3OH8A 3TECE 1RTKA 1DTSA 4N21A 5IWCA 1WQ4A 2ZSBA 3QJYA 3V8BA 2ZG6A 4UQOA 3WISA 5HP8A 1QBGA 4X84A 2IRWA 1ZAKA 4ESHA 1PZEA 2RFLA 4GZ5A 4FGJA 3RN4A 3PQ8A 3PDIA 1XZNA 2XF2A 5DNUA 2BSXA 1FP4B 1NTRA 5DULA 4KHZA 2EW2A 4ER7A 2YVLA 1ZN7A 2R7NA 4KIWA 4LHXA 5CVDA 4LE0A 1RI1A 3BEDA 3WJ2A 5K20A 1SHLA 4N1AA 2PI4A 3USZA 2OGWA 4R9RA 4CS2A 3KL4A 3MBIA 1U28C 2OV2A 1F4LA 3D1JA 5IF3A 5K8VA 4XYBA 3R7AA 4E51A 3HP1A 2O3JA 3VZCA 4G41A 4OQFA 5F76A 3JVDA 3PT9A 1PW7A 1TF5A 4LDJA 1RHJA 4LRSB 4W5QA 2OTJV 1HSOA 4D81A 3V34A 3UWDA 4BYMA 5LYJF 4UAUA 4IO0A 1V8BA 4GYYA 4R1NA 4EY4A 3CM0A 4DK1A 1G66A 3F7YC 3L0ZA 1O9BA 1KQFA 4LCUC 3HDTA 4AVYA 4RHFA 1IPEA 1QX3A 4OJKA 2DWQA 4YJDA 2QAIA 4LI0A 3NFRA 4I55A 2QUHA 2ZUWA 1VIYA 5LMUO 4HG2A 1GU7A 1MXFA 1XHEA 3NIWA 4DMKA 1JRLA 2PMPA 1G21E 1NZDA 5J23A 1W9MA 3MWFA 3V8MA 2A0LA 1EFRD 2N42A 4BNMA 4UARA 1Z5NA 4TT3D 1EH5A 2AIFA 4FLYA 2UU9B 1CVLA 1S3SA 4WGFA 4WOBA 4EJSC 3X2QC 3NHMA 3IIKA 3O5AA 3OZSA 1K3FA 4CG2A 4Q3CA 1ZUQA 3RU7A 5EP1A 1BQ4A 1NQXA 4K87A 1VHJA 1PJZA 4F4IA 1JG6A 3BHPA 4MULA 3PFCA 2W58A 3WLTA 4YFVA 4D0RA 5BVHB 1R6UA 4GYCB 1IUKA 1FTGA 4EI9A 3PYLA 2YIBA 4Q05A 2QRMA 2A0XA 4IICA 4PNZA 1RE1A 4YO8A 4CTNA 2QZ9A 1XEWX 3FIUA 2B98A 2C88A 5DCUA 1AC5A 3C3MA 2B4KA 3HADA 3NWPA 2IU3A 2NIPA 1YUNA 1Y81A 2A1UA 1XZFA 4HDNA 1ZSNA 4MLPA 3A1UA 1YRLA 3KHUA 5FOTA 3A7EA 2HMTA 5GJCA 1IDSA 1X2BA 2PF4E 4TMFA 4JL8A 2FVXA 1OWMA 4C0JA 4CDNA 1OILA 1ZA1A 2WLIB 3DKKA 1E2EA 1JZTA 4IVQA 3ROMA 1E2IA 1FFDA 4MVQA 1JG1A 5EC8A 4BMSA 3M7IA 3D54A 4DVGA 2JK0A 1UJMA 1IX9A 4CCAA 2W8BA 2F48A 3ETDA 2R62A 2AR0A 5EN4A 4L6IA 4PZAA 5EMMA 5JWRA 4RSMA 5CM2Z 1JT2A 3CZPA 4EW1A 1KD1W 3N2NA 3NOOA 3W04A 5HX7A 1XAGA 4MI3A 3JVIA 4MIEA 4DXDA 1UFVA 2QG6A 4KXRA 2N3ZA 2OYRA 3U39A 3GRKA 1VDMA 4EECA 2NVUA 1WXHA 2F62A 1E7RA 3R9IA 1PBTA 1CY6A 1XKQA 3DHEA 4MLDA 2D5LA 3BWYA 1WE2A 1U31A 2BFEA 2A78A 2ECQA 4XM0A 2R47A 3BULA 1T2AA 5HUHA 2M1XA 5I4KA 4HF7A 1QK4A 4D4HA 2J3KA 4L85A 2BBTA 3ZGZA 1QHTA 3DBOB 3P2IA 4OFWA 1WPGA 2C5EA 1M0SA 5ISMA 1DBIA 1M8GA 1JE1A 4U6NA 2GK6A 4EB6B 4LF6B 5JS1A 3ZMSA 1KJ8A 3MB5A 4OQNA 2BFWA 1AJQA 3O1JC 1YIJF 3EISA 2HQBA 3GEPA 4DDWA 3CC2V 4I4TB 5T4FA 5E95A 3RG8A 1AQ6A 1Y3FE 1JEEA 2P77A 4P2GA 5H3LA 1JR3D 1T8YA 3ABKC 5FO0A 4GQAA 1QFXA 3VHXA 1EDBA 1B15A 1OASA 1JPVA 1RKBA 1GAXA 3QVJA 3RJZA 4PQYA 4DDUA 3DT9A 1JG4A 1N5IA 2JS7A 3ONFA 1QYIA 5MHTA 3NHBA 2RH4A 2YY5A 3FZEA 3OUUA 4OP1A 4ZJYA 1CEQA 4ZHQB 2QORA 2Z2YA 3BYQA 1XXHE 4KSYA 3VTAA 4G9EA 4NV0A 3USCS 1R4MB 1FFSA 2Z9BA 3KJZA 3UMFA 1RYNA 5ENZA 2ZBEA 5LD2B 4PYIA 2WLMA 4D3SA 4D8VA 3R3XA 2DUWA 5REQB 4DNFA 3P45A 4YRRA 1AKVA 3GCZA 4BNHA 4EHHA 3FYSA 2HDHA 4CN8A 1XCOA 2W2PA 3QE0A 3K31A 1CVIA 3DAFA 2BKXA 3TGWA 4DQDA 4EKNB 5INTA 1SZQA 3A7DA 2I4OA 2JCBA 1N78A 2CLLB 4WOPA 2ZIMA 4YJ2F 3FGNA 3H9EO 4BRWA 1OROA 2PVCA 2ZYWX 5DM6V 1AO0A 2ZW9A 2EEZA 3KJNA 4P0PB 4YQEA 1QHEA 2RBEA 5IZ4A 2X9GA 1UBEA 3BYZA 5TQ2A 5A0FA 2J3MA 3ULKA 4EFBA 4FMCF 1RE0A 1IHYA 4MPRA 4HX2A 3Q5GA 1DBPA 2NVWA 4HDSB 2ZRGA 3S2IA 4F6LA 3UH1A 5EERA 4ARZB 1J5EO 1O6GA 2HU2A 4NZPA 2AVDA 4X20A 2QKYA 3EFOB 1RSZA 4DV4O 3D2LA 3RTEA 2JIZD 2FE4A 4Y6OA 5KB3A 1SXJD 1JFFA 3NHLA 1PQ4A 2FL4A 1C1DA 4MVJG 1T4GA 4YDRA 3I23A 1L4LA 2HIGA 3A70A 1BJRE 3FNGA 4BQFA 4KDFA 1QG2A 3SQOA 4AI8A 1M72A 4EX7A 4U2CA 1VCOA 2OBXA 4EPVA 1GN2A 1G8FA 5CB4B 5BV7A 5C8XA 4RZQA 1T35A 2FDCA 4WPGA 1QDLB 2MSDB 2AD5A 2ZE6A 1GXSB 2EZOA 4JI2B 3JQEA 1ONPA 3VNAA 4KE6A 5JI3E 2PZ8A 2ZVDA 1WKBA 3GOQA 4B7ZA 3RA6A 4W7SA 1YC2A 2MR6A 3B6NA 1BXKA 2VNKA 3FMPB 3K0GA 4I19A 1WM1A 2JG3A 4ZI5A 3FFTA 5LDDC 4KQ2A 3NHSA 2Q6KA 1OBVA 3MMZA 1ADFA 5A7FA 3TSAA 1KMCA 4I5FA 3CLSC 1C80A 2PIDA 4WDRA 2RHDA 3X1DA 2GK7A 2ZI5A 1Y42X 5EHGA 2PV7A 2CWWA 1YGPA 4HQNA 2LE0A 1XV5A 4MVCA 3GHYA 1PFYA 2GBLA 1UBNA 4LWOA 1H8EA 1QE0A 3UMMA 5J1SB 1NLMA 3SXJA 2OSVA 4ME6A 1SA0B 1KO5A 1QPBA 3O8LA 3VR1A 2N74A 2QWQB 4H33A 4JHXA 4BVBA 2EDCA 1H2SB 5BMVF 2IYSA 4MUNA 4GE3A 4DA0A 3RTCA 3H5OA 1RP1A 3D8UA 1FE8A 1RHMA 2DKFA 2QRKA 1K6IA 4AO6A 2VDUE 3ZWVA 4HBGA 3GVXA 2QPAA 4JJ6A 5TB5A 4RORA 1DEXA 4D02A 5CXQA 3NR7A 2C7VA 1H47A 1TDJA 2X8JA 1U8XX 1XZKA 4EY3A 1OJLA 1G8PA 4BIZA 3ZO8A 3P30A 2PKQO 5ALRA 4FYYA 1PR5A 1M8KA 2CXUA 2WPDD 2Y1FA 2GN1A 4GUAA 5H5JA 1E64A 3DWEX 2AW3A 3PKZA 3DE5X 4WFAV 3HGTA 1QH8B 2ZDIA 3UTCA 5G0WA 4XIYA 2PVPA 1FRNA 1GNLA 3UUWA 5CJPA 5DYIA 3OIUA 4LJSA 4D9KA 4RS3A 1EXWA 3EQ6A 1DFIA 3F9CA 4CI0B 4LH6A 2J3JA 1Q1EA 3ISTA 4ALNA 2OTLV 4X41A 1I7LA 1UEIA 2ZDHA 1T9GR 1WDLA 3GP3A 3UO8B 3NC1C 4WZBB 4H6PA 2H2AA 2H6LA 5LOVB 1JDZA 1LSOA 4IFBA 3FAKA 4ENWA 2FRXA 3RRFA 4A8JB 4BJ3A 3W8RA 3TUZC 2F90A 4JELA 3VSCA 5E9WA 4MKGA 3HO1A 4BV9A 1U0GA 4OM7A 3V7WA 2YL2A 1BEUB 3CVWA 3S1AA 2HA2A 3EZNA 1YVRA 4C4XA 3LSSA 1G7RA 3BHNA 2XGOA 3CRRA 3QUQA 4DXWA 4B40A 4DMRA 1GM5A 1V7ZA 4B5CA 5IT5A 3T3DA 2ENWA 3VR6A 2HSWA 5GADl 1WS6A 3I04M 1JWAB 3GPCA 2I34A 1KAHA 5JRDS 1C3OB 2GRUA 2X4LA 4GLFA 1HTWA 4O2AB 1S1CA 3GZTB 4JB8A 1UP6A 3C97A 5AVUA 3R7NA 4QG3A 3AYXB 2IS6A 2OOSA 3IDAA 2B6NA 2NTVA 2JFPA 2J7PD 4ARCA 3FDIA 2GFQA 1S2OA 5EWJB 3SPIA 3RJ9A 2YI8A 3N58A 4DLYA 3ROXA 1TAQA 3BHJA 4G4SP 3AK4A 4YRQA 1GO3F 3M6IA 4GOXA 1ZJ5A 1EZVH 5FIUA 4RVGA 3WU2Z 2OHXA 5JAIA 2F2TA 1YFZA 1O03A 1VSUA 3V97A 2RB9A 4Y2XA 2ETXA 2J6BA 1NQ5A 5A3JA 4EKWA 3DMPA 4IVRA 4MKZA 4OGWA 2P79A 3RVBA 4QPNA 4OJQA 3SGIA 2SCUB 4O0LA 3UIEA 4EF6A 1A32A 1HO3A 1V16A 3CCSF 2G5PA 3QI2A 1DKRA 3ENWA 2IPLA 2JVDA 3O8RA 5TLSA 3L6RA 3ASYA 4FK5C 3CR3C 3R3VA 1VHTA 4BDSA 2WAXA 2JGMA 3CR8A 4N4AA 4JT4A 4ZVOA 2E4UA 5DNAA 5D5PA 1HE5A 1NF3A 5IAEA 1F2TA 3SY8A 3B7PA 1B74A 1JPUA 1WPQA 4KQJA 4EIWA 3GT3A 3RIHA 2AOVA 2AX3A 4TTJA 4H0LB 3U44B 2C8VA 1DX4A 4H15A 5B1IA 1R0ZA 2ERXA 4H6XA 2ZVZA 4C78A 2XNDG 1NVKA 4HATA 3WYGA 3RYCA 2A79B 2P0EA 4DMFA 2JGKA 3CF0A 3B3JA 1VP3A 1NQAO 3O3OB 1DI0A 3R6WA 1TO2E 4O5OA 4B09A 4RKEA 4Z2WA 3A0UA 3WHIA 3CPJB 5IBRA 2BGMA 4QGSA 4MR9A 4JGSA 4W1RA 2W0FC 1V11A 2WD7A 1FX0A 1YI0A 1GARA 3GWZA 1JI3A 1G18A 3NMUF 3TQRA 2G36A 4TMYA 2QR4A 2ZNJA 1RU3A 3QNEA 1LBTA 1XD9A 4UPVA 1D0VA 4NMXB 5B4TA 2FTKE 1VQ4F 3LHFA 2HSZA 4TV9A 2Q1TA 1R64A 3HA7A 4B3MO 4RC9A 5AM0A 4CM9D 1A95A 3OT5A 2XZLA 4X3LA 2R8EA 4JGIA 1MAWA 3MYYA 1Z15A 3QKRB 3A04A 2EIXA 3PHIA 5ED0A 1A1SA 4NFSA 2F1HA 4GX1A 5DEOA 2Z6VA 1NUHA 4N18A 4FCTA 3JQFA 2IZZA 1N6LA 2YNMC 1H2FA 4PYOA 3L7OA 4F86A 1M6YA 2HCRA 3COVA 2YHIA 3JYQA 1E32A 3H19A 1TZMA 4DLLA 1L2TA 3PA8A 4PPGA 1NDUA 1G8KA 3WXBA 1GUBA 2XUFA 2J59A 5ESDA 2E3JA 2JFXA 2RGNC 3IEWA 2EIHA 4CKWB 5AW8A 4QBKA 5B8FA 3JQPA 4X8MA 4DG8A 1IHPA 1FFXA 2EJCA 2JVKA 1UPBA 5H0IA 4F6CA 4JJFA 4QUIA 3CN9A 4L2IB 3UK6A 1BS2A 2I4LA 4OMDA 4IR7A 1EWYA 2F1MA 2WFAA 4MJXA 1FX1A 2JAPA 3C4VA 2E4WA 3SSMA 3NKFA 1YL6A 4DY6A 4X65O 4UDXX 3ZJYA 4KXVA 4TZZA 3DMDA 3HCRA 4RESA 2ZIOA 4GMFA 3UHJA 4HPJB 3CP1A 1EJBA 3QW2A 5FQNA 2OUIA 1HNWB 3WDKA 2WUGA 1NJ5A 5LDHA 3N05A 4REMA 3WGTA 3V4PB 3L77A 4IDPA 2V59A 2R6R1 3RWOA 3WX0A 4GYWA 3A3NA 5KBYA 1KRHA 1LY1A 2P27A 4CM6A 3V7UA 1U0TA 4QXRA 1G3UA 4OHYA 3AIKA 1EVIA 5JAPA 1KE1A 1BRTA 5I51A 1TC2A 4DR3B 2Z09A 1TGVA 3RQSA 4YRIA 4NYKA 1KAOA 1KZ4A 2V03A 3RFVA 1E3JA 2ZTSA 3CO5A 3LYUA 1O97C 2EILB 4N82A 4AY4A 1W2HA 2ZYAA 3C8HA 2CUZA 4ZPJA 3SMVA 2X3FA 4B31A 4D7AA 3X1WA 1YOBA 3AIMA 4P98A 4GYKA 2WU4A 4IZOA 1FB5A 2NUAA 3I4FA 3EOBI 1LV8A 5DU2A 2HMVA 1CNEA 3D64A 2JI8A 3COJA 1P7PA 1N6IA 3K9AA 4IJUA 3MT8A 3HUEA 2H3OA 1UXJA 1LGYA 3EJ6A 3KK0A 2R4TA 4P3XA 4DUGD 3OZXA 3BF8A 2FW0A 3QBVA 3CT4A 4H27A 2VLBA 3H3XA 2JLVA 4HCJA 4JA2A 3TRFA 1IIBA 1RCTE 2WIAA 3K2XA 1PFVA 1Q5OA 1ZGAA 3RU2A 5H8WA 1ZS9A 1YJAA 1RRGA 4XUGB 1Z5PA 1X9IA 5CVEA 3OLVA 1ISGA 4UM5A 2QX6A 2AJ8A 2I29A 1A7UA 1J09A 4PGFA 3G2QA 2I3DA 4G24A 4Z49A 3D1LA 4CGYA 1GDHA 4QOHA 4KQXA 4D80A 3HH8A 4WESB 5KTMA 4YV7A 4F9GA 1YH3A 4B3SO 3ADPA 3WJ1A 1LEHA 3ZHSA 3EY4A 4GBJA 4DBLC 2JLXA 4N7BA 5TIIA 1TEXA 4C7JA 1QB8A 1BDHA 4CGZA 1RQ7A 3A4TA 1PT6A 3MTDA 5B1BB 1IBLO 1YB7A 3CF4G 3TPZA 1MZEA 3FTCA 2RKWA 1FF9A 3GTZA 5DRYA 1N1DA 2H85A 1Y3AA 1T36A 2VWJA 4IIJA 2QA4F 3R3SA 3SNHA 4EQ6B 1PEKE 2QMUA 1E0JA 5J59A 5J5CA 2QVLA 3RVYA 4JLUA 1TK2A 5LD2C 4ER6A 3OLYA 4URYR 2K9PA 4TMVA 1R6DA 3DZGA 3FNBA 5F7XA 3OFNA 1R00A 3S2UA 3TM4A 4C0HA 1SQBH 2N1BA 2GB4A 2ZBRA 4DW0A 1P5JA 2Z9DA 4JLPA 3KZXA 3EVGA 2AN5A 3ECCA 5L40A 1Z0ZA 1CKEA 4NOJA 5FP0A 4Z3DA 3INYA 3NB0A 2XTJA 3RTAA 2AN4A 4R40A 3NJ4A 5TQVA 2VHCA 4N0EA 2C2AA 2V45A 3ED5A 3ZOZA 3AF5A 2YFQA 3PWZA 5LP6F 2B99A 3I56V 2FRDC 4MJ7A 4KLCA 2QM3A 4QELA 4JASA 1XTRA 4EABA 1ES9A 2W6QA 3MLBA 1Y1SA 3JALA 5HK9A 4G9GA 1J21A 5FB3A 4I50F 3V6MA 2HAEA 2Z6AA 4RFSA 5HBRA 1FP2A 1UJNA 3HR7A 1G9TA 3T41A 3CCUV 3ZV5A 3BH0A 3V9AA 1W2WB 2GCOA 4X54A 1R1DA 1AKEA 3THWA 2PZFA 4YDQA 1LV7A 1ENOA 1T2VA 4Z4EA 4D9IA 1T9HA 4LSZA 3QSYA 3W5SA 3CNLA 1DJQA 3KDAA 3HG7A 1JB9A 2AVNA 4GGOA 3BDIA 4LG1A 5DN6G 2WAOA 4LKOA 3I8SA 4U6QA 1FLDA 1FTWA 2R9RB 5JWHA 1HYQA 3KQOA 4EG8A 5LBTA 2FJ0A 3RGBA 3JQAA 1QHGA 1N2OA 4Y2TA 5KNCD 5AW7A 2NZVG 2JFOA 3LDEA 2Y1CA 4ONEA 1XCLA 4IH1A 1KSFX 1Y8ZA 2GSWA 4LEIA 4MS4B 1Q3KA 4WFFA 5JZSA 4G88A 3G4SF 5JOQA 1NT4A 3E8XA 2HS0A 3CZAA 5C1IA 1PLKA 2IX9A 3SJCA 4X66O 4LYAA 4DQVA 3PSHA 3R8CA 1V3VA 3I9V1 4S05A 2H2HA 4PG4A 4MUEA 2WK1A 5IDVA 3PXCX 5JQGB 1BCCH 2RKOA 1BMTA 3O3MB 4RA9A 5SZJA 4I2VA 1UPFA 2PHZA 2G67A 1AB3A 4H4EA 4HI0E 4HVCA 1R7RA 3AERB 3BIJA 3ADKA 1OWNA 1ISFA 4XDGA 2YJNA 4MVUA 5FHQA 4BMOB 1E2FA 2VTVA 4B7AA 4TVBA 3EEQA 5K0FA 4Y9UA 4TYPA 2XTAA 3KKQA 4W9RA 3RS9A 1MLDA 5DASA 4NENA 1IK6A 6YASA 1HT0A 3HI6A 3KSZO 1JSZA 1HPLA 1GO0A 4RENA 1KTVA 2XZTA 2OAQ1 4WE3A 1QFYA 2VSFA 3IPCA 3Q3CA 3I2YX 4IDDA 1F5NA 1L3CA 3NX4A 3RBXA 4EHBA 1KQ3A 2VIIA 1P8JA 1GQSA 3RF6A 3DDUA 4Q34A 4P86A 1T9GS 3ET5A 1YIAA 4KFTA 1LFDB 1Y33E 3OF5A 4L3WA 1XQVA 3KAKA 2F1RA 3DOHA 1SVNA 2WTEA 1QHHB 2J4CA 5DM0A 2OFOA 3L46A 4GNRA 2AQ8A 4PYNA 4EJSB 3D9QX 4KR3A 5AXCA 1DO8A 1QHYA 4F3NA 4EGFA 3QXXA 3UG7A 1WXDA 2PZEA 2YWCA 4FSHA 2B2XA 1M9NA 4U8HA 4M1YA 3KSAC 3ZI7A 4TWKA 1W6RA 1V25A 3PQ2A 1KAEA 4C9BA 3VZPA 1J9ZA 1DBWA 3DMRA 4MHSA 2PGNA 4WZAA 4NU5A 4W8HA 3UAWA 3J7AR 5EXSA 3RAGA 4X1IA 3MNFA 2X2OA 3DXXA 1L0BA 1F4PA 2OWEA 1XLTC 4OHZA 2M2IA 3U7JA 3KM0A 2R1VB 1E3WA 5CPFA 3DG9A 4NCAA 4V0RA 5FPQA 2Z8YA 1F2UB 1NUTA 4WX2B 3LT0A 1S3GA 1I2MA 5KYUB 2VWKA 1PNQA 4RY8A 3B6IA 2JD0A 3HGMA 1R27A 2Q21A 1Z0KA 4DCSA 1I10A 1PQUA 1W57A 2F93B 2F6RA 3RTBA 4KJXA 1G63A 2WFMA 3EBLA 4PI2A 3VDRA 5C7OO 2CTRA 1R5JA 3CNEA 3SJ7A 1SB9A 1DPGA 4M88A 4F04A 4LY3A 5AI0A 4GM0A 5J4KA 1ULZA 2WT9A 4XW2A 4PSUA 3ESBA 2LQTA 1RPZA 1ID8A 1LQ2A 2GAIA 5TPWB 3UB2A 5K01A 4H0CA 5COAA 4MWOA 1OCEA 1K33A 1GGNA 3AG6A 3DOEA 2NQTA 2PUDA 3ZIAG 2QEQA 4Z0HO 3S3WA 4NXMO 4C6HA 2Q3MA 2PAAA 3OEED 1FDIA 2ZBUA 1GRRA 1U7UA 3G6KA 4LBEC 2OCGA 5FNVF 4X61A 4DIFA 2D0PB 3EEIA 1XK7A 5CVCA 3PI6A 4W4TA 1OX6A 3E61A 2J7KA 2FOLA 1VYVA 4N39A 3HCBA 2EL9A 1CW2B 3NHUA 3NZEA 1Q1BA 3F0TA 1T3SA 3A0RA 1E5DA 4EPTA 1ZWLA 2VJMB 2H0QA 4BZWA 1EM8A 3OQVA 3E9RA 3FTQA 3VKUA 3RF7A 1YI8A 2IEZA 5A4FS 1XVTA 2QLMA 1QO0A 5EVJA 1MQ8B 4PICA 3Q8KA 4NNJA 2IEDA 2PRJA 2JBAB 1HM5A 4J9YB 3U0VA 2R751 5F2OA 4EY6A 2GTSA 2O0MA 3RUCA 3GFRA 1J0BA 3OPQA 5DYNA 3TGUH 4KFRA 3O73A 2O0JA 4OOFA 5KTPA 1VECA 3BS4A 4CLDA 3KTFA 4BFWA 1WB4A 1YXBA 1U0BB 4I14A 3B09A 3QWBA 4RNCA 2BOVA 4PXAA 3DWFA 2XWQA 3G9ZA 3OQOA 4BWYA 4LJAA 4ABTA 4X7PA 1WTCA 2E55A 2EP8A 4HB4A 4N03A 1VSQA 2VAPA 1RKXA 5HQTA 1WB9A 3IUEA 4L7VA 5TC4A 3C90A 1H66A 3CCJV 4IMRA 2X23A 2HMUA 4P22A 5TMBA 4KLZA 2JEZA 4PZPA 5H2FZ 3RJTA 4D7TA 5LN1A 1NZJA 2POQX 2QTRA 1SXGA 4L50A 4DUZB 2JBHA 1PZMA 3GYBA 4RHCA 2VJKA 4DC1A 1TW2A 2OEPA 2O2EA 4MCAA 1N9KA 3EUEA 3E5NA 4M98A 3SM9A 4OB8A 2VHUA 4MW5A 2ZAUA 2VPZA 1Q43A 4NHEA 4QDKA 5JZBA 3TUJC 1EFKA 3A1CA 3OPYA 1MMFB 3IT0A 4JUIA 4BP8A 2O4CA 1U2DA 4QNRA 2ZWOA 3U1BA 2O2HA 3UTDA 4ENPA 4YGXB 4IEEA 2QX4A 1F23A 3PRKE 3QQ5A 2JJ1D 1KMHB 4FLUA 2K7FA 1XWIA 3CMAV 1E3LA 3H4IA 4IFTA 2EJWA 2EIJB 1AZWA 1Y8RB 1EQAA 2DFNA 1G4UR 1POWA 4LC0A 2JLYA 3PKIA 1BROA 1MRNA 4O4HF 4FNOA 1L5OA 5EKUA 4F60A 3UK7A 1FRVA 3DE2X 7AT1A 3F0GA 1LTHR 3C3EA 3L6BA 1I32A 1CUCA 3PFHA 5JTUA 4CBCA 3BTOA 1KQGA 4Q9HA 4JEHA 4N3AA 3PL1A 2GPAA 4JVLA 4PX3A 1QIKA 5K99A 1A1VA 2PKYX 4QIWF 4X88A 2D5IA 3MINA 1UAYA 1NJ6A 1T5EA 4NWIA 2E18A 4RLFA 4RY9A 1OIVA 1KJYA 2JATA 2W37A 2DQZA 2WSBA 3K3PA 1CQPA 4XDLA 2LO1A 1XU4A 3IP3A 4NZZA 2BEJA 3G8BA 4G09A 4OU5A 2EILC 4C22A 3DNPA 3L5OA 4MAMA 1SUWA 3BWDD 3U7GA 1TM5E 4MWBA 1NVVQ 3NIDB 4AKHA 3L0CA 1R8JA 3I5DA 2R9VA 4J7XA 5FT9A 3CCLF 2ZRHA 4TMZA 1VF7A 1PT7A 1TE2A 3EIOA 5JO0A 5TISZ 1XLUA 3R7BA 1FXUA 3OZTA 3I3OA 5CYGA 2GPJA 3OZRA 2ZBDA 3Q8XB 5LA6F 1ZR4A 4BGEA 4RVOA 3DGEA 3ZTTA 1DMRA 1GDDA 1E79G 4YAFA 2Q50A 2ZJ7A 3H8WA 3O83A 2VNSA 3TIFA 4YCBA 2Z0MA 3GP5A 2OBNA 4MXDA 3EIQA 4Y6GB 1VP9A 3OTOB 3M89A 1DAGA 5E3HA 5JJNB 2L18A 3ENZA 3ETHA 3ZNNA 3FWYA 4ZOCA 4G3XA 4LF7O 2ODMA 2VNAA 5AOCA 5DCLA 3W9YA 2I33A 3ZKAA 4OVKA 3C45A 3K6SA 3W7UA 1PYOA 1N5KA 5DNCA 3NFYA 3H6KA 3OAAA 4MS1A 5HQJA 1XTIA 2XW6A 1Q90D 3FD9A 3C1UA 1XJ0A 1L9XA 4AJKA 2PZGA 2VJAA 1ZRNA 4Q4DA 2IVFA 4KHPO 3DFKA 4OPMA 5ITZA 5B1BC 1H22A 1SCQA 2FWJA 1CP9A 1DTOA 1FNBA 4HAMA 3REQB 1DF4A 1NM5C 3HDGA 1DIBA 2CDYA 2XH8A 2YXBA 3VTKA 1P80A 4NH0A 1NN1A 3LKZA 3FF4A 3K8YA 3W05A 1NI5A 1HLDA 2IUUA 4YQFA 2XDAA 4UUPA 2WAMA 5B55A 3W6UA 2JGLA 1X7XB 3FI9A 4L4UA 5FFNA 4PSAA 1QVWA 4FHDA 4NBNA 3TTVA 1V3UA 4G5RA 4J7UA 3R7WB 4OQLA 2WJIA 4FBMA 4ALKA 2GPWA 3N0VA 1GG2A 3KJKA 2FFQA 2W22A 1VBMA 4FN5A 4D99A 5MN5A 1TYZA 1SBQA 4Y1RB 2VQSA 3KKZA 1Q0RA 3DAOA 2QDOA 1DQNA 4D8TA 1J1ZA 1T8SA 3CVVA 4NEHB 1UL1X 2BCEA 5ALNA 3OUZA 4BZQA 4YHHO 2GHIA 3QEBZ 2I2BA 3SZUA 4WY8A 1T6BY 1RPAA 1T26A 3UJBA 4XWWA 1SN7A 3I5UA 4G65A 4EG5A 1R1BA 4DA6A 4ZEVA 3CCRF 3PNBA 2WFZA 5TS3A 3FCSB 3FY4A 1G1MA 4Q12A 3INTA 4BIMA 3R8XA 2EU8A 2CXNA 4PV7A 2REOA 1Q82H 3E1SA 4QO7A 2B8WA 4YIKA 2QJRA 2GTPA 1EWVA 1XELA 1GY8A 3JRWA 3LC0A 4I55F 2EL7A 2H08A 2BLNA 3HQ4O 1UKEA 1PJQA 5C1DA 2Z1TA 4DM4A 4V0SA 2P41A 4XSGA 2Y0BA 3JSLA 1TJPB 3KCNA 5JH7A 1D2MA 4N3NA 4FFBB 3ZY6A 5KNLA 4YAIA 5ICEA 1BX0A 2AR9A 4DV1B 3C3YA 3KJIA 3LAWA 2YXLA 2BTOA 1YJWF 1BQ3A 3R7DA 3FUVA 1M33A 4X85A 1EXNA 2GNAA 5BSVA 2JA1A 3NHJA 3IAM6 4ZMBA 1NMQA 5IDYA 2GI4A 2HGSA 1PNRA 1DEKA 2X8LA 1AR4A 1PNVA 2IYUA 4AZVA 4X8OA 3TG8A 3IQEA 5JPCA 2GUGA 1Q3HA 1DT3A 4DR4B 4FGWA 4XDYA 4HEHA 4G4VA 4ZT2A 4RM2A 1GRJA 1PR6A 1FDRA 4CEHA 2IHNA 1KBQA 3LY7A 2Q2NA 5JHGB 3NDIA 1VGVA 3UY4A 1LW7A 2WUVA 1QNFA 1P1HA 1Z39A 4ZVLA 5SYMA 4CKCA 3ABZA 4J91A 3IR6A 3FYUA 1SFRA 2A33A 2VAVA 3AW9A 1KSGA 3FFXA 1YJ5A 3KKNA 2QT1A 2QSUA 3F6CA 1HEYA 2VWHA 2NYRA 1AG9A 1DAMA 3T7IA 3OZEA 1FQKA 2PJZA 3OZDA 2OPBA 3COPA 1Y9ZA 1S2NA 2O0KA 1AHPA 2UYQA 1VQPV 1GZ6A 4QRHA 1MJNA 4F4LA 1RBYA 2PUAA 1OXXK 3AFHA 2O14A 1UOEA 2I3AA 2ALEA 2VSOA 4ACBA 3BSYA 3Q7SA 3ZE7A 3DCIA 1X7WB 3GJYA 3WNBA 2DJ5A 4GR9A 5HCIA 1J9GA 3VPSA 1UBSB 1F60A 5B4VA 3DYIA 3B1WA 3F3SA 1MD9A 4TSFG 3LY8A 1MB3A 2W6IA 1IHDA 5ALVA 2AOTB 4BMXA 3C7DB 2PLNA 2Z1MA 3DEZA 1ZM2A 1DJLA 3ZK8A 4Z1MA 5AW5A 2IELA 3GLVA 4ZEMA 2F9ZC 4QEKA 4XB1A 4QFCA 4JOBA 6GPBA 1NJ8A 2Y1GA 5CYFA 1U1GA 5SZKB 1FL9A 8ABPA 4YH1A 1NATA 4FBGA 2YHSA 3C6KA 3FB6C 4OQPA 2DYRB 2BAGA 3KPWA 4PGAA 1L8DA 4KNVA 4LNUA 5IG2A 3HJWC 1YL5A 2IYYA 3TRKA 2WV7A 4DG5A 4CQLA 2PZBA 2X19A 1QPGA 2CVLA 1E2GA 3DV0B 3VR2D 1Y3CE 3E20B 1ISMA 1ESCA 2FWAA 3NS7A 4PAWA 3GYQA 4RF2A 4LQ4A 3ORYA 4HQOA 3VDQA 2QYHA 2W48A 5B66Z 4CT5A 3C6MA 5FJIA 4DZRA 2D3WA 1RCFA 4PHCA 1TIKA 1U0FA 2RGXA 1Z7WA 4DB4A 4RUKA 5ER9A 3MMXA 3ZZNA 3KJHA 1T4CB 4JYBA 1I7PA 1EFPB 1L4NA 3I5MA 1DQRA 4PX2A 3MWGA 2IL1A 3R0XA 4OPHA 2E5LO 3NVKE 2QGFA 5GIOE 4GKKB 1FKAO 2G0NA 1M1NB 3EQ2A 2H92A 3FB8C 4H0NA 3AB8A 2ZT5A 2Q8PA 3CEPB 1AGPA 4YALA 3OQ1A 5ALOA 2HRDA 3AFNA 4OAOA 5DOZA 4ZT5A 2WZBA 4E12A 4WECA 2I6RA 2Q73A 4BO7A 5IS2A 2XKAA 1CWUA 3D6HA 3E9DA 1QS0B 5LIRA 2V7WA 4DDVA 1TMKA 4MP3A 3K70D 2GZHA 1I7DA 2QYOA 4JR0A 2DULA 1A4RA 3I9NA 5BQPA 4EGCB 2AD1A 4TZ0A 1N3YA 2YBDA 1R74A 1JEDA 3DVSX 2VSQA 1UMBB 3W4IA 3T99A 1X25A 2P4VA 4JJGA 3PQEA 1YV9A 2C3YA 4N3CA 1B06A 1EHYA 4IIVA 4B0OA 3WLLA 5FQOA 1JN0A 4PA9A 4Q7EA 3S81A 3KQMA 4CH3A 4RQBA 4R9SA 3OCZA 3A0HZ 1KZYC 2X5KO 2WMOB 3IQDB 3Q85A 1P7WA 2NU9A 3BMNA 2NUTA 1G9XA 3O75A 4MB2A 4F97A 1TA4A 4PAGA 4DSUA 2QIPA 4DSAA 2O59A 1CTQA 1EVEA 1XZBA 4G2KA 1MORA 5I9NA 1LJ8A 3CPQA 2LD4A 5FUQA 3RVMA 4HYYA 1LVUA 4A27A 4DARA 2YV2A 2FSGA 3ESRA 5HY1A 2G08A 4IIXA 4D96A 5GIPE 4QPZA 3BJEA 4WKPA 3AI1A 1NQVA 3HVRA 4ZVVA 4TT3G 3ZE0B 4N76A 1ZD4A 5DGTA 4HUJA 1ZL8A 1XU7A 1TU4A 1KI6B 4HFRA 4TRNA 3F5MA 2FW1A 3VUEA 5B1HA 1KJWA 3P2MA 3DBRA 5ALMA 1PL4A 4CH5A 4Y9TA 1CDOA 1PL8A 3IGAC 4LXIA 2KWIA 4BQSA 1F0YA 1T6NA 2GFIA 2UVPA 1W25A 2HWXA 2AUNA 1Q7CA 4F8EA 3G02A 3EMKA 1CUUA 4PPNA 3A1FA 3I2HA 2EKPA 1D2EA 3EVKA 3DDNA 4JBXA 3QELA 4P3NA 3M4SA 4RU1A 3PTZA 1DT9A 3Q5DA 4V03A 1ZK3A 4BNVA 2PY6A 3AEKB 2OLJA 2BPOA 1I5RA 3FOWA 2CZGA 2EIJC 1BGYH 3UJ7A 3VZSA 4RD1A 3NJ8A 1ZIYA 4KFMA 1M75A 3HLKA 3QO7A 3ZGVA 4DYDA 4K86A 4EWLA 1K68A 3I6BA 4F4CA 1YBVA 2WQ6A 4FQ7A 2H2DA 3HDJA 2WABA 3ZQ4A 3V8RA 4LFBO 4EENA 3BA6A 3A1DA 2QKCA 3AP2A 3MAJA 1ENVA 3KOOA 3C5VA 3PENA 2HLHA 3BDVA 1UINA 3DT8A 2PX0A 1U3GA 3M7MX 2ACVA 1Y76B 5THQA 1QCCA 2W4IA 1PM9A 1RMYA 3BDAA 4J1NA 4E2WA 4B8ZA 1N5DA 1P19A 2FPGB 1I4TD 4ARUA 2EQBA 3E05A 5EJAA 3GD5A 2IPAB 1DDOA 3KYCB 5AHOA 1IBSA 3IIMA 3RRJA 3MTEA 2HU7A 5KAPA 1GTJ1 3MJSA 3PUKA 1PLJA 1K7XB 1N33O 3V8QA 1P1CA 5HUQA 2PZMA 3ZTYA 2GSDA 4X6UA 3RW9A 1Y3DE 2XB8A 3PQ4A 1A5SB 4MMXB 3FD6A 1AN0A 4RDCA 1ESEA 4JYAO 2R0QC 3AVYA 3T4EA 3ZHZA 3FRJA 5EFZA 4YRAA 3AJDA 4GZ6A 3RS3A 5T64A 2I87A 1T10A 5SZIA 4Q0MA 3LT2A 2NADA 2GJAA 4X6XA 1BE8A 3JS5A 2X15A 1OLSA 5EKSA 2WSSA 4FQ5A 4HT3B 4NI5A 3EGVA 3JASB 4HXGA 2W0MA 5GJBA 3PJDA 1GX1A 3BFRA 3K0SA 2V4DA 3Q3VA 1L7VC 3LUBA 2FEMA 2DH6A 5T6BA 3CG6A 3WYNA 5DJ5A 4Z7QB 4HNGA 4MPDA 1C0IA 2QWNB 2VOJA 1VQ5F 1QVGU 1A9ZA 5C4MA 1PGPA 1TLFA 1O95D 4N8SA 1CNMA 1Z5UA 4UFPA 1U1FA 1QVVA 2OHFA 1HRKA 3NV7A 3F6EX 1MPTA 4N7RA 3RTGA 3BTSA 3DOOA 1EB8A 1VQ4V 1YTFD 1JLKA 2BFBB 3M1IA 3HMKA 4NBVA 3PVZA 1IZ3A 3O38A 1XOIA 3JVEA 2XGJA 5J63A 1H65A 2DC1A 3OMIB 1CFJA 4KFSA 1VHDA 2FWRA 1ZESA 4Z4IA 4AB1A 4JUBA 1NU8A 1RKUA 2ATVA 4MCIA 1GIAA 4YR7A 1GWNA 1YITF 3Q0TA 4F5ZA 2HS3A 2QTBA 3G7SA 1YDMA 5CCEA 4OA8A 3TI7A 4D3YA 3GBSA 3QKSB 2IW3A 2VF2A 3HU5A 3L7BA 3AEQB 2G7ZA 3DONA 2WIJA 5HZMA 4FKZA 4HP8A 3W9SA 4QLOA 3IOEA 1URFA 1G5RA 4TS9A 3W0LB 4C4OA 2H06A 3ANSA 3C8DA 4TL6A 4NYJQ 4FB5A 4AYWA 1FTQA 4PO3X 3I30X 4IRMA 3U7FB 1P1JA 1R6BX 3PRJA 3SIRA 1B43A 1NVTA 1RZ3A 2AJDA 1FBNA 1TMOA 3KQSA 2ZAIA 2O8FA 2QRVB 1K27A 3L7IA 2TRSB 1Q86H 2HRBA 4ZQIA 3E0XA 4NNPA 2RCYA 3D81A 2IPXA 3IELA 1X39A 5J40A 3E0QA 4FFDA 4PPYA 2DT5A 4ZBMA 3E3NA 4OH1A 1VG0B 3UB3A 2I3ZA 1PO7A 4QO8A 3RASA 1M6NA 5F9HA 2JIZG 1KYOF 3G3EA 4MH0R 3AI3A 4RK5A 3E9YA 3VR5D 1U9CA 4MGYR 4PX5A 2DETA 2OL4A 3EFEA 4BX3A 3IJ5A 1W19A 1XZHA 3OCWA 3GLHA 2OCBA 1F17A 3PK0A 1E98A 5TVGA 1ECLA 2Q67A 4TV9F 3N27A 3OOSA 4Z7NB 4GOND 5A2GA 4M1TA 3GARA 1P81A 2DQ4A 4OXKA 2XQKA 4UEJA 2LUOA 3G5AA 4NK5A 5AH0A 2PLWA 4C5CA 3K2IA 2ZBGA 2QRGA 1AX9A 5EHQA 3DZDA 2GBPA 2H11A 1XDCA 3I01M 2Q8VA 3CURA 3LGXA 4EY8A 3AU8A 2GEFA 1XI1A 1R9GA 1Q6UA 1QYVA 1HR0O 2IJGX 3WLMA 4BMVA 1FTSA 3MWEB 5TQJA 1I7FA 1I51A 3O8DA 5EKXA 2P4QA 2C99A 3PTAA 2ZTLA 1THZA 1U5BA 4C21A 3DMTA 3GJ0A 3BXHA 4UAVA 3CLUD 3OP4A 5DK6A 3L73H 2CF6A 3LG2A 3HJRA 1E1RA 2Q5CA 5TX7A 4LTDA 1R0BA 2CL5A 2A3RA 1AZSC 1OC2A 2IHUA 3C3DA 4UMDA 1SKQA 3ANNA 4MQEA 1T8RA 1WHTA 1ORWA 1DFGA 3DUFA 4OG2A 4XWKA 4HB0A 4S35A 4WADA 3LFOA 5CVJA 1QE5A 4YDSA 4BGDA 2B3DA 5A4KA 3CTMA 3PITA 4Q7MB 3KUDA 1KI3A 4HXEB 1PWXA 3ASVA 1H2LA 3U3RA 2WPDG 3BFVA 1T5HX 3OEHD 1YAHA 5FNZA 5EP2A 3CN7A 3N0WA 4UCRA 1MBZA 2XCRB 1Y9JA 2F43B 3JQ7B 4HOYA 1LQTA 3PJFA 3HY4A 5LMCA 3GUHA 1XZDA 5M3BA 1Q6ZA 1FSPA 2B82A 1G20A 1A27A 1N6PA 3KTAB 3K0TA 1SCIA 3O4FA 3OBIA 3WLQA 1ZBQA 2C2BA 3L7KA 1CZNA 3DTTA 1QORA 4BGVA 4MW0A 5BNTA 1YQEA 1C50A 1FYDA 3PFNA 1MX5A 4LV8B 3HNOA 2REBA 1E99A 4PU0A 2B5WA 4GNKA 3MT7A 1WXQA 2QA4V 2P9GA 4IFIA 1QIEA 2GXSA 2OCHA 4RJLA 2E3CA 1M1YA 3NEPX 1KGSA 3TZ6A 1MZPA 1SPBS 2QWRB 3CLRD 4AROA 2GKOA 1SUEA 2X40A 2IDJA 1CHNA 3SHOA 1Q5PA 3BRWA 3EVEA 3CB2A 1A9OA 4LE1A 3CQ9A 2OHOA 1O6BA 2KKWA 4EB3A 2H63A 4OBXA 1Z47A 4GXNA 1EZ4A 4GM1A 4K26A 5KWEA 2ZINA 4Q1CA 1XFAA 1ZOIA 4DJDC 4X8AA 4I1UA 4XUDA 4GI1A 2AXQA 2DYRC 5FOQA 4W8OA 5AESA 3JQ6A 4UM8B 1JAXA 3L1KA 5AOAA 4ZO7A 2GLZA 3I3FA 1MEJA 5TMDA 3LCCA 5JSYA 2J31A 4ENVA 5DLQC 1KERA 3DEYX 3ZP7A 1CY0A 5EGSA 2N75A 1MO6A 2PGJA 4NK4A 1ECJA 1T1GA 2A06H 1XEAA 1F9EA 5FV4A 3HUDA 4JGBA 1GFZA 1P39A 1P4SA 2QU8A 2ADOA 3QO8A 2XA2A 3LIIA 3UJ3X 2F3RA 4NMHA 2HP8A 4LWQA 4G4ZA 2AMVA 1JL3A 3X0DA 3S0JA 1CRLA 4WNYA 4EPRA 2Y1LA 4UE2A 5AJYA 3U7QA 4IIJF 4OQMA 2EVWX 3KYDA 4LYDA 1J8FA 2IYAA 3DHWC 4E31A 5D2CA 1EQUA 1KI9A 2VCYA 3EWAA 2CV1A 1ZKDA 1R0LA 3N6RA 3TW8B 3P9YA 5A3SA 1UPTA 4MIOA 1IEQA 1T0KB 2QSJA 4M0LA 3S06A 3SJQC 4Y1EA 4EHJA 1GPNA 2HVKC 1TI7A 3QPUA 4H17A 1P5RA 4R1MA 2OESA 1F38A 4D4GA 3GT7A 1XDWA 4O1MA 2PGOA 3QF4A 2Y9MB 4JV5B 5JXHA 1WPBA 2IZ6A 3MLAA 2QN6A 4BNFA 3EORA 2HEGA 4AMZA 2UXDB 1BE3H 4QTTB 1TQ6A 3ZCUA 1D7OA 5CT6A 1KO4A 4N65A 4WN3A 2V9ZA 4LXTA 5K0NA 1JPXA 3K5IA 4C3UA 4IQ0A 3WV5A 3BB3A 3MMPA 2WNIA 2PL5A 2EGUA 4DLBA 2HHLA 2PY5A 4P5EA 2P1ZA 3KLMX 5K03A 2EJRA 2VYQA 2X0JA 4AZ0A 4ZZ3A 4HGRA 4JAUA 1E9RA 2HADA 1NF8A 3F5WC 2QENA 4ZAZA 2YJGA 5DHUA 2IH1C 2NM0A 4X63A 1X7ZB 1O94A 3GUVA 2IUEA 2B0CA 2P2ZA 3VNRA 4C7UA 2JJMA 1GNRA 3IYLW 4DEXA 3SSOA 3GZ4A 3FSEA 4BVJA 3G5TA 3LVQE 1HMYA 3T80A 5EI5A 1O9HA 1UC8A 1KK0A 2HHJA 2EG9A 2PZJA 3KPYA 1KVUA 1PNTA 3FXAA 1GZ3A 1TB4A 4EFNA 4AN0A 2ODNA 3M82A 4TX1A 1OVMA 4ZOLB 3UEOA 2MR5A 4F0JA 4XM2A 3CEAA 2VHYA 1EP2B 5DB4A 3FKJA 3O65A 5KHKA 4NYIR 1P1KA 4WXPA 1ENZA 3D6MA 4GAEA 3HKCB 3DHYA 1C8KA 4G4XA 2WHQA 4BO9A 1RWBA 1VL8A 1YL7A 4KPGA 4GOJA 2ZRJA 4N0MA 1HE1C 1T0JB 1NQOA 4OUKX 4XGIA 4BCDA 5H3CA 1VYTA 3J81A 4ER3A 1ZVVA 2WMDA 3WHKA 1NXOA 4AJJA 2JPDA 2X0NA 3ZBUA 4PINA 4LF8O 3MC1A 2ONKA 2ACWA 5TMPA 1VCMA 3MRSA 1XMXA 4HXYA 1LUVA 1O5IA 1WXWA 1ZOLA 4R6ZA 4B9AA 1X80A 2EJTA 2VDKB 4RZIA 2GFHA 2GAJA 1QH9A 3DOJA 4CKEA 1UC9A 3IS3A 1JA8A 3D4BA 2BM1A 3Q8HA 1U7TA 4REQB 4GMHA 2OP1A 3K1YA 4RFLA 1IZZA 4HDRB 2Z5FA 4TROA 2QN1A 3VYWA 1KJJA 4QA9A 3VKFA 2YI9A 1YCFA 3T0FA 4B79A 3SXUA 4JYPA 1QQCA 5CTJA 3L8HA 1Q22A 4K5QA 1DAIA 3N2GB 3V48A 1N8SA 3WMWA 1X8XA 3LVBA 4XFJA 2O7SA 3ADDA 1Z13A 2GVNA 4CTKA 1BXRB 4GP7A 4H7HA 1WN7A 2NZWA 4UZFA 5LLDA 1VJGA 2HIAA 1YE8A 1W2GA 1NXSA 2IJIA 4ARIA 4R1QA 2W83A 1QGAA 3CMCO 2Z04A 2XYGA 4RACA 3L4SO 2ONZA 2GXUA 1HZJA 4QFBA 1V7PC 5BPFA 3WYEA 1XQ6A 5LWHA 3BGIA 3A4YA 4KXUA 3Q3IA 2WU3A 4JKOA 1JR2A 3SJAA 1AQIA 3P4EA 4TTSA 2CNOA 3WRVA 1CUJA 1E9BA 4JP8A 3FWPA 4LSWA 3SFZA 3WE7A 2V65A 3LC2O 4PYMA 3DOCA 4MDFA 3GFOA 4WIAA 2IYPA 3EAGA 4RF3A 3IPAA 3HV0A 3RD5A 4CT4B 4QG7A 3PEFA 4G25A 4U3JA 3TW4A 1YT5A 2GUZA 4YJ3A 4AC9A 1CR0A 3DVAB 3LQQA 5IHPA 1DB3A 2Y1OA 4ZWNA 2AWNA 5DHRA 3SF8A 3PIDA 1I24A 4Y67A 3K8QA 2WNHA 2WUWE 1EBBA 3GRCA 3X1MA 1PG2A 2F64A 2BOCC 2JRLA 4H37A 3M4YA 4F46A 5GQSA 1BHAA 1R3DA 2DYSC 2WIKA 5JSFA 4I4LA 2ADFA 4FX5A 3U5TA 1IMOA 3FMOB 3KJFA 3WLKX 3CRMA 1DKLA 3DP9A 4J7CA 3QNWA 2CNWD 3JZIA 4IEFB 2GZ3A 4D3ZA 4BP9A 4EG6A 4JXXA 5CDFE 1W44A 4P7JA 1SBNE 2HQRA 2Q28A 2W2KA 5LXTA 1QOPB 1JS1X 1HFWA 2CNKA 1KA9H 4WINA 5AUNB 1V41E 3B3FA 1UPCA 4PY2A 4H1UA 1D1QA 3J81N 1VPLA 1KQPA 2WJVA 2ODQA 2VT7A 2PXHA 2Z9CA 1OTYA 2XYRA 4UTXA 2O8BB 1CQJA 4G0QA 2FW9A 3VOTA 4ZOBA 2O2ZA 2CL7X 5L4LA 1WB5A 1KJIA 1SIUA 5E6SA 4ZC8A 4FW9A 3GY0A 3I55V 1M5IA 4TYMA 2YIJA 2Y4TA 4O1IA 1X4TA 4D3FA 2QE7A 3IQIX 1D03A 1XRMA 2HP3A 5L45A 2VNJA 2F8MA 3IE0A 2Y3IA 4KSBA 1M6HA 2JFZA 2HA3A 2YIAA 2HRCA 1XRPA 3E5HA 1XQ9A 1J39A 4G85A 3A4NA 3SLKA 2C42A 1NF2A 4YB8A 4DV0B 4HKTA 2V9YA 5DHSA 1Z2GA 3FCXA 3UNXA 1XMJA 4JOSA 1HL3A 3G71F 1SD2A 5TQ0B 3LWOC 4MV4A 4P9NA 4F2HA 2HMYB 4JQYA 1BS1A 4X92A 2BR5A 5FUMA 1Q8IA 3HCPA 1PWYE 1NXPA 1ZWKA 3WXMB 4R1OA 4OSOA 2GD0A 3CE2A 2R48A 1EP9A 4PLYA 1U6KA 1DNPA 3T4ZA 1S02A 2EKBA 3C74A 1JVNA 4TQFA 1G6UA 3O21A 4NCBA 5CFPA 1GPMA 4CF7A 2B2NA 4B34A 2QWOB 4DN6A 3R5TA 5E3JA 3LGSA 2WNSA 4AYTA 4JLKA 4KXWA 2P2LA 3EFBA 5DDIP 4LZAA 4PDLA 5BVGA 1F0KA 1KP2A 4CMBA 1HDCA 3GJ5A 2JJ2A 1I0ZA 3BG5A 3GJ4A 2E4XA 4JBLA 5DBOA 1MB2A 5CIYA 3SR2C 3EGCA 1JHDA 2DJIA 4YIOA 2OZLB 5MGNA 3NBKA 3D36C 2VZLA 2YXNA 3FTPA 4GM4A 2NO0A 4BB5A 3PLAE 2I3GA 2CMHA 4JB3A 1NVPD 2VDOB 3A1WA 3GFVA 4IWXA 1U65A 2PMDA 2B7CA 2EJUA 2J3LA 4XAQA 4CC6A 2I4NA 1MQSA 4AUMA 1VMGA 3LCUA 1NSYA 3GMSA 2PUBA 1FW8A 4J0DA 3NXKA 4GYJA 3L9WA 2J5BA 2MSWA 3EVBA 1KPGA 2VK1A 4MUAA 1NBMA 4CBVA 1B8VA 4IRXA 1KWGA 3M6FA 1GHTA 4DIUA 3U56A 3GLIB 3JYCA 2P35A 2PS0A 2L69A 1S3IA 3E2MA 4AHCA 4BWFB 5B1SA 3NNSA 2A9KA 3GGPA 4YP7A 1TO1E 1QAQA 4EPXA 1E2DA 4AMYA 1B2LA 3KCQA 2BMVA 1LX7A 2DPGA 5F4BA 2ZT7A 4KXXA 3PEEA 4OXYA 4LK3A 1Y4SA 2QN9A 3PD7A 2L17A 2NGRA 1T24A 2ZP1A 5FD8A 2WQ7A 4UNPA 2C2XA 2F55A 2A9RA 4YRTA 1KPHA 3RGGA 5A5VA 3K2QA 1UOPA 1Q6HA 3U3KA 4EEXA 1U2TA 2GZMA 1ONSA 4YMVA 1UMDA 5IDQA 4W5RA 4RD0A 4XLLA 4UNSA 3A6FA 5F12A 2NNLD 4M0MA 4MB6A 2O8DB 2I4RA 2H18A 1V47A 1NYQA 1XNRB 4OEHA 3MTIA 2MDTA 4QOSA 1OYYA 3AHFA 1CY8A 3OY2A 3HO6A 4E7PA 4F2WA 3GRZA 4FM9A 4LBZA 2CK3A 3K9LA 1SHJA 2Q5EA 2KQUA 4Z8YA<