5LOVB

Dz-2384 tubulin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
417
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title The synthetic diazonamide DZ-2384 has distinct effects on microtubule curvature and dynamics without neurotoxicity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 165
structure length 417
sequence length 426
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lovB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lovB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lovB01
2BTQA 4WBNB 4LNUB 1TVKB 3E22B 3V3TA 1RQ7A 4WBNA 5LA6B 4IHJB 1W5FA 4O4IB 5JCOC 1TVKA 4TV8A 3E22A 4U3JB 2RHJA 3JASA 5LA6A 3WGNA 4O4IA 1FFXB 4O4JB 4M8IA 5KMGB 5MN6A 4HNAB 2R751 5KMGA 4ZI7B 4HNAA 1TUBA 3RYIB 4ZI7A 5LOVB 5IJ9A 3RYIA 3N2GA 4O4LB 5LOVA 3JAWA 4X1IB 4O4LA 3M89A 5CA1B 2R6R1 3VOBA 5CA1A 4EI9A 5LP6C 5EIBC 4X20B 3VO9A 5ITZB 5JCOA 3UT5B 4X20A 5M7EA 1W5EA 3WGMA 1W59A 4LNUA 4YJ3B 1RLUA 4FFBB 1W581 4IHJA 4YJ3A 4U3JA 4E6EA 3HKCB 4FFBA 2RHOA 3WGLA 4I4TB 1FFXA 4O4JA 2XKAA 4EB6B 5LYJB 5JVDB 4O2AB 4XCQA 4I4TA 4EB6A 4O2AA 2Q1YA 3WGJA 3VOAA 1RQ2A 3JATB 5FNVB 3HKBB 5LP6B 3JALB 3HKBA 5FNVA 4I55B 3HKDB 4O2BB 5LP6A 2RHHA 4U39A 4X1IA 3RB8A 1JFFB 3HKDA 1W5AA 5MN5A 2VAWA 2XKBA 2VAMA 1JFFA 4EI8A 4KWEA 3CB2A 5C8YB 1SA0B 4TUYB 3VO8A 5ITZA 3UT5A 5IYZB 1SA0A 4TUYA 3RYFB 3M8KA 1W5BA 4ZOLB 4I50B 4X1KB 5IYZA 3RYFA 4X1KA 3JARB 3HKCA 5CA0B 1FSZA 3RYCB 5LYJA 4TV9B 5JVDA 5CA0A 4B45A 3HKEB 3JAKB 3RYCA 3R4VA 5LXTB 5GONB 3HKEA 1Z5WA 5JH7B 5LXTA 5EZYB 2VAPA 5J2UB 3JATA 3C8LA 5EZYA 5J2UA 4DXDA 3ZBPA 5EYPB 4DRXB 3JALA 4TV8B 2VXYA 4I55A 4O2BA 3JASB 2GVIA 3N2KB 5EYPA 4DRXA 3VPAA 4YJ2B 1OFUA 5BMVB 3N2KA 4O4HB 5IJ0B 5J2TB 2Q1XA 4EI7A 2BTOA 4YJ2A 5BMVA 4O4HA 5C8YA 5IJ0A 5J2TA 5CB4B 3ZIDA 1TUBB 4IIJB 4B46A 4X1YB 5CB4A 3RYHB 4IIJA 5IJ9B 4ZOLA 4I50A 4X1YA 3N2GB 3RYHA 3JAWB 3JARA 5EIBD 2RHLA 3ZBQA 3WGKA 5KX5A 5JQGB 5MN4A 4TV9A 4F6RB 5KX5B 3JAKA 4ZHQB 1Z5VA 5JQGA 5GONA 4F6RA 2BTQB 5JH7A 4ZHQA
chains in the Genus database with same CATH superfamily
2JEYA 3LTEA 5D3QA 1AXRA 1RC1A 3KX2A 1CDEA 3C0KA 3QU5A 4J16C 4R3NA 1RPJA 3IILA 2M6YA 2F2TA 1COWG 5IEJA 2ZI6A 5JJEB 4QNRA 1QZZA 5GANK 1UT8A 4JI4B 1RYMA 5KEIA 1WZ2A 1TTTA 3CR3C 3TRJA 2XUFA 3GNQA 4Y6SA 1J5XA 3JALB 3MMXA 1HNZO 1CK2A 1XJWA 5FPSA 2FF5A 1QHXA 4ARVA 1IIRA 5K1ZA 1G42A 2VQFB 4MWOA 3ZK9A 4XGQA 4D9HA 4LYFA 3W8EA 1D2NA 3MCZA 4WY2A 1YQGA 4XKJA 2HF2A 2XKJE 2PZLA 2CF6A 4YAJA 2NR5A 2O8BA 2W6CX 3VZSA 1B14A 2HJVA 4BNZA 4V39A 3LZDA 2OESA 3ZPXA 5JW6A 3UJDA 1M8KA 2P62A 2Z4SA 4PCUA 4M54A 1QLJA 2Z2JA 5KB3A 4CV0A 4C81A 1F4NA 1SHUX 1KY5A 1DHTA 1X9HA 4CG3A 3H2SA 4PSCA 5DISB 4ER3A 3DVSX 2X5OA 3VTKA 4NOLA 4NOJA 3OLQA 5ESDA 2W6OA 4JJFA 4B3IA 1R8XA 4XX0A 3W3AD 2OCIA 5EUBA 3AFGA 3PUWA 4ZI5A 1ISHA 5H83A 3STUA 5FHRA 3RGGA 4KVZA 3NEPX 1SQGA 4ZHSA 3PV0A 5H5NA 2QMOA 3AIOA 4Q3BA 4HGOA 2I7CA 1QE3A 1GSHA 2AEMA 3O2QB 1PM9A 1Z15A 5KA6A 3D6TB 4N0DA 2QD2A 1CW2B 2QTMA 1C8KA 1NSTA 4EUKA 3EH1A 4CM8A 3WZMA 4FGWA 4WJKB 1J2RA 2WUGA 1WRBA 3RYCA 1VKOA 2CXHA 2GJKA 3IAXA 4Y0AA 4C7KA 5EJ5A 2VDUE 4P84A 4K46A 5JALA 2HI0A 2J4CA 1JILA 3QX8A 3OJ0A 2OFPA 5HKOA 1IE3A 4KLNA 1KDTA 5GAJA 4KR2A 1DIGA 2GTSA 1WJGA 4ZT2A 1H7MA 1ZRSA 5EJGA 1T0HB 1YD7A 3CBGA 4RTPA 1VBNA 1ANKA 3JVEA 1QCEA 3E61A 3DOUA 1LLDA 5ALZA 3TFOA 2YNMC 4K9RA 4MB0A 1JEYA 1UJ6A 5AVMA 2X3UA 2WIFA 2QAGA 5KSWB 3FIUA 1S2MA 2GD6A 3C41J 4DPMA 2JCYA 1B16A 1ONNA 2Z3VA 2K5UA 2GKSA 3IQEA 1VP3A 4ZRDA 2QORA 4FKZA 3L05A 2OV1A 4OQDA 3ZE7A 4JZ2A 4KL1A 1N36O 4TL9A 2XAUA 1RYNA 4YRMA 1KJ8A 2AOTB 2EX1A 1N57A 4EZIA 1JJFA 3WK8A 4Z4GA 1UOQA 3A26A 1JCHA 4REOA 3JQPA 2JDIG 3SNHA 3L7BA 3J7AC 3O94A 4PLHA 1JVSA 2KG7B 3H5RA 5KS2A 4O4IA 1TEXA 4EPWA 1P18A 5JJ5A 2WSIA 1PTJC 5L8VA 2PRSA 4U1RA 4K1XA 5ALGA 2OMKA 3WLQA 1B0ZA 1WXFA 2V98A 3WGLA 3CCVF 4G8BA 3BMOA 1C3OB 3X43A 2QTFA 4FEEA 2DSTA 4LDPA 3QKTA 2YIBA 5EXSA 3GCGA 3R75A 2KX7A 3KDSE 3I8OA 5LLTA 4PWTA 1KMIZ 3PNBA 2ZKLA 2AG6A 5DWDA 4BVLA 2R1VA 2IYYA 1AF4A 2NSDA 3HLYA 2CY0A 5IWAO 2I5PO 1V6CA 5LCXA 3AWDA 4K2AA 4WJZA 4ZHYB 4C6RA 3WJAA 5B30A 3TMKA 1CF2O 3DDUA 4C22A 1ZWLA 4WY5A 1WV1A 4RPJA 3F6PA 1UPFA 5LJIA 1YQXA 3LVBA 2QDOA 4OUDB 3U19A 4KZPA 4LY3A 2G9RA 4TZKA 1ZOSA 3EGXA 1KXZA 1OCRC 1ISIA 4C8EA 1W9MA 1M1XB 5EINA 1H9BA 2EIMC 3RF7A 2TMKA 5CGQB 3KQSA 2B4KA 1G66A 4XSHA 1G0OA 4LJ4A 2GN4A 4Q4JA 2LGJA 3M4JA 1ML3A 4R2HA 2H29A 3GARA 2QD5A 3ENNA 1TU0A 1PP9H 5JY6A 2HLDG 2ZJAA 2PYJA 1PN3A 1XDGA 3F8TA 3KU1A 2EFJA 3EULA 3K0EA 4A82A 1EQAA 5CDHA 1E0JA 3MCWA 3GJ5A 4HXFB 2HHJA 2ZF8A 1YZYA 1DIBA 4GUAA 1KJZA 3W6NA 2WG1A 4DV6O 3OU7A 3B89A 4CKXA 2E7ZA 2X0DA 2WD8A 4F5DA 3P4EA 1QG4A 3EXAA 4Z3OA 2OFWA 2B20A 4K9PA 4IIVA 4MPPA 1CZHA 3WR5A 3C8MA 2WJ6A 1B6TA 3ZJ4A 2XWQA 4CS4A 1M5TA 1R0CA 4X71A 3EWIA 2YICA 1C80A 4XOIA 2FEKA 3RW0A 1FFAA 4QFDA 3VQXA 2W22A 3ZQUA 2ETXA 4N39A 3C6XA 4NARA 3DLBA 1UQUA 1USKA 3IEXA 3QFRA 1QFYA 2ZWVA 3RYFB 1P5FA 2B1GA 2YH2A 5K9ZA 3OEWA 1K88A 4YP0A 2DN9A 3N5CA 2VNKA 1XIVA 3IO5A 3PDWA 3P9QA 1SBZA 1JQ5A 1RZVA 3PN1A 4QBTA 1B6QA 5I47A 2FJUA 3MF4A 2CUGA 1NSFA 2REXB 1EZ1A 4FXOA 5I48A 1HKHA 1S8AA 4EY5A 1G63A 3C45A 1GGKA 3S7TA 1X13A 4C8IA 1E79G 3L5OA 1V8DA 2Y0PA 2Y27A 3NVAA 3UM7A 1FLNA 2JJ8A 3ID6C 2MYTA 1K86A 5C7YA 2XAQA 2XQJA 4JKYA 5GZ6A 4UNNA 2R8PA 1PGNA 4DLAA 1PW5A 2IXBA 4Z51A 4B8WA 4OHKA 4HVAA 4CDRA 2R8EA 4R7CA 2PUGA 2AXEA 1OILA 4PLFA 1W0JA 3IFSA 3FMOB 3RTEA 1I3LA 3NORA 3WRYC 2Z09A 3QHQA 1VGVA 3K06A 2AFIE 5K0EA 1DOHA 4MQBA 2F1JA 3L8MA 5AM4A 3DV0B 5CDUA 1U7HA 5LD2C 2C9CA 4RL6A 1F0PA 1GIAA 2H9AA 3DHWC 2WM3A 1QV9A 2W37A 1WU7A 4KI7A 3L1IA 1YS7A 4KHPB 1IN6A 3FSEA 3ZGYA 4FPXA 4P22A 3W8DA 4DIBA 4RKYA 4MKRA 1BXRB 3NVKI 5M34A 5JXGA 3OGCC 1M83A 3OM1A 5LQAA 1L4KA 2NZYA 5EMKA 4LISA 3Q7EA 2GDZA 2PKYX 4Y0NA 4CKEA 4DLZA 1JPJA 2IA5A 4G4YA 3I2YX 4AU1A 4UTXA 1LSJA 4WCFB 3N1UA 3NK6A 1YHQF 2R7AA 1U1IA 5FNVA 5AW5A 1HI9A 4L15A 1BQ4A 1FLDA 3OAAG 4GEKA 2GVNA 4GSLA 4LNHA 1KFKB 2ZJ1A 5AJYA 4BRWA 3VA7A 4P4TA 3ZY5A 2TRSB 5K4GA 1OC4A 3PUZA 5KOHB 5JI2E 3B6NA 3Q0TA 2OHOA 3CN9A 3VZBA 4PX3A 4QELA 5HUQA 3OQIA 2HDHA 2Z9CA 1TYEB 4FLMA 2BMAA 5C8YA 3EGWA 3P9RA 5A7HA 2WLTA 5JVDF 2ZWPA 3NBKA 3WLIA 2R6FA 4MVMA 3RA6A 1CKEA 4IJMA 4HYOA 2EFHB 1T3LA 2XASA 2XZPA 2BEJA 2RB4A 4UTNA 3ZLUA 1Y9AA 4NDAA 3K5IA 3T7KA 1ACLA 3VI4B 3GL9A 2YV4A 1CLEA 1IMOA 1Z0AA 3UJ3X 1JQKA 3VYTB 4HH3C 2GZRA 1GKIA 4MROA 1X8LA 1AHIA 3NH9A 5HZGA 3EXHC 4YWJA 5IDXA 1PS9A 10MHA 2WALA 3D6VA 1ZKMA 3NEJA 1KS9A 2ZIWB 4EB6B 2ZRMA 4NJMB 5L95A 4RQTA 1AZLA 4ZVRA 2P3OA 4OQNA 5HGJA 4LH6A 1V35A 2NACA 3LMEA 1C3JA 5TJHA 3RC7A 3WWPA 1HT1E 2FFQA 4R0MA 1VQ8V 2PPLA 1MTZA 3PP8A 1R3DA 2R8RA 1Z6YA 5SY9A 3OE7A 3ABSB 3RRJA 2ISSD 2YR0A 1ITZA 3KQPA 3B82A 4W6QA 1WVGA 1ODLA 3STZC 1Z4KA 4I1SA 3FAKA 4Z0TA 3LCUA 3NHLA 4IGIA 3G8AA 3MCUA 2OFOA 3LFTA 2R72A 3KEQA 1YDHA 4KFCA 1B6GA 4YT5A 3TLKA 4EFEA 2DLDA 4Y2YA 4ZQCB 3MJDA 2HDOA 3UMJA 3CNLA 1NZFA 1N0WA 2X15A 2NUTB 3KQVA 3CPEA 2FKNA 5H4HA 2JIZA 1ZITA 3WL4A 2HS0A 3O65A 3SJCA 4D74A 1YF3A 4TMZA 1W87A 1YK1A 3X1YA 1W88B 4OLHA 4IDFA 3AP2A 1G17A 4W9NC 5AK5A 4Z3DA 1Y4DE 2DQ4A 2BEWA 1XQWA 1Y8QB 1Y98A 3FAVB 4E2WA 4KPUB 1M10A 3BTVA 5DTRA 2IIVA 4ZIRA 1ZUD1 1KEZA 4INJA 3CX5F 3PQFA 4EA9A 1XUQA 4EHNA 1ZY2A 2C94A 1S9DA 3CO0S 3A4MA 5SV2A 3K5HA 1IB6A 3VR5D 2V3VA 2FQQA 3HL4A 1IJFA 5AJTA 1SCUB 3B1FA 3T7AA 1QH8B 3J7AR 1NBMG 1GPWB 1ODIA 2E4WA 3QVJA 2QA4V 4RAOA 1HY3A 3CH4B 1P0PA 4UDOA 1FTGA 2UZHA 1CQXA 2KLHA 1UXJA 4LOIA 1W42A 2JHCA 2Z30A 1T3SA 1N2CB 4LJAA 1C9MA 3LE8A 5ALXA 4PSUA 5HZKA 3KRTA 3ZRXA 4HVTA 4ILEA 2JS5A 4XWKA 1P0CA 5CVCA 4B3FX 3G0BA 4NXMO 4PYIA 4RV5A 2R60A 1FMFA 1A82A 1J2UA 4B3HA 2WWGA 1YZQA 3P9NA 2YXPX 2D3TA 3LRXA 2YQZA 3HKEA 3ZDEA 4RHUA 2YASA 1KR2A 1XU4A 3ZKWA 1PQWA 1MOSA 4EHBA 1RU3A 4G97A 3GRFA 1LEHA 2G9ZA 2ASVA 4E5NA 5E2AA 3L0PA 1Q22A 1H2AS 4MINA 1DADA 1CE8A 4C43A 2ZOSA 1MGOA 3OHMA 1CY2A 3WLEA 5AOAA 1ECCA 2D3WA 1BHAA 3A37A 2QRNA 1E20A 2Z83A 3ABLC 3A3PA 4MVYA 1I6WA 2VBFA 3KHTA 1NJIW 3FYTA 1RC8A 1NQWA 3E9ZA 1W35A 4M2LA 2WIBA 1KYOF 3WGYA 1ZK3A 4DUGD 3Q3GE 2PXAA 3VH3A 3CMMA 5JOQA 3KD2A 3IB6A 3GRVA 1G9SA 1E9RA 1QQAA 2AKAB 5JHGB 3HVKA 1FAFA 4L27A 3MJEA 8AT1A 2QNRA 4NONA 3A2KA 4OK3A 3QFHA 3SWWA 1Z5WA 2AZXA 3GDOA 1BCRA 3EZFA 2MOKA 4DLKA 3GEBA 2VDRB 3A6FA 2QTAA 3LXXA 4WFJA 4ZCMA 3H86A 2FB9A 2Z1TA 3ZCPA 1QYCA 1RM0A 3RYHA 2QDKA 4DV5B 2ZSKA 3FG9A 3RHSA 5EQFA 2G83A 1XTSA 1BS3A 4MS3A 1GFZA 3VMMA 4WBNB 3NNNA 4DK0A 3AFNA 1T4CA 1OBCA 4JCOA 3T34A 2R751 2G08A 3M4YA 2X9LA 1P7PA 3LWBA 1KAHA 4PGAA 5DGDA 1XBIA 1FSGA 3APQA 4X91A 1I51A 3IAS6 1C9DB 3SF8B 1IWOA 3FCEA 1OX4B 3CCRF 2X19A 4F8YA 3FHCB 1H8HG 4YONB 3FN4A 1Y76B 4KQ1A 1EFUA 1A4RA 2FA9A 4KXUA 1K6IA 2WJ3A 1ZESA 2MINA 3GW8A 3PL5A 5L3FA 4X3MA 2H7CA 1VE3A 3NTRA 3QUTA 3RC3A 4K28A 1FMCA 5K8CA 3RG8A 3ZX6A 1RI3A 5CX1A 3QU2A 4AICA 4W1SA 3CR8A 2F9ZC 4FI3F 3PD1A 3O4VA 4QGPA 1SEVA 1JDZA 3MUEA 1GN8A 5TY0A 4C3UA 4ZQBA 1VRCA 4CMGA 3UXHA 4KXLA 1GILA 5J4VA 1CK4A 5M3BA 3R9IA 3H1AA 3KWJA 1YH3A 3OUUA 3ESRA 3INGA 4LOLA 3AEYA 3ZDQA 1DP4A 3LQRA 1YTLA 4K6HA 2A0XA 1N3IA 1ESMA 4EJMA 5ALVA 4KK4A 2WHPB 4MHSA 3Q8HA 2XNDA 2J30A 1UZAA 2PQ2A 3F90A 3DQZA 1BG6A 4LYDA 3FD8A 3PE4A 1OKKD 1K8AW 4PRKA 3NALA 2ZAOA 2AUNA 3K92A 4I8XA 3AFOA 1GTVA 4WKOA 1RCFA 1NVWQ 2VDNB 3AF0A 1NPDA 4YLEA 5KPJA 4JL5A 3II6X 4F4DA 1S7CA 1I80A 3B7GA 5DVZA 4HDKA 4XWTA 3T3HA 2V8OA 5LP6F 2AWOA 1DAIA 1GU7A 3ZLVA 2PCJA 1AB5A 1MMFB 5IT9A 1Z56C 1ZNXA 3TZBA 3EISA 2P6PA 4PSKA 3S70A 1E3QA 1EKXA 4FYPA 4ARZB 3X2EA 3HPQA 5CLJA 1JAHA 4G2KA 1BD3A 4EYSA 4F9FA 2X8WA 2J3QA 4LVUA 1NR1A 4BHTA 4MW9A 4TKMA 3ZP4A 4X6UA 5CEEA 2QR3A 2ZSFA 5ILGA 1PL8A 1ZGGA 4TTRA 4LGMA 1RXIA 2O19A 3FPJA 2PD3A 2OWOA 2GV9A 4RF4A 3K8YA 1AX9A 3LLCA 2W58A 3HQ4O 2AT1A 4DHEA 2H31A 4OPHA 3B9PA 1Y48E 2JLUA 2B35A 1XCOA 3EZNA 4E03A 2ILTA 5GJCA 3UT5A 3WNCA 3ESAA 2MSEB 2QU7A 1TGYA 3E8FA 1YHYA 2DBVO 1LW7A 4YR7A 4TLBA 4INZA 3B38A 2FCAA 2WAXA 4QT4A 3U9SA 3FHOA 3ZIDA 4MYCA 3WGIA 4HSGA 4LHEA 4IVPA 5T64A 1R6UA 5CLHA 4MW0A 2PRYA 3TL3A 2P2NA 1X15A 2AN9A 4MUGA 4A5UB 4WESA 2CMKA 5E1MA 5IT9N 5EHGA 1F5SA 4BFVA 3UMSA 1ZMBA 3N2IA 3PKIA 5DGIA 5BOVA 3CZPA 4UFZA 2WZCA 1RNLA 5KX5F 1G8YA 1P8JA 5KNBH 3SLKA 4QUGA 2JI9A 1KYTA 4QDTA 4YJ3A 5CLQA 4A16A 1DJMA 3IUEA 3KEMA 3GLKA 1QFZA 2ETVA 4DQKA 4C88A 5JC8A 3CG4A 1MC4A 2A9VA 3W7TA 2IFTA 2JAUA 2Y4OA 4D9FA 2H11A 5TIIA 2C4KA 3MXOA 2YQ4A 3DKPA 4DG8A 1U7UA 3AVVA 1PD0A 4GOMD 2IQQA 1E4VA 4KTVE 5CBFA 1GOTA 4P4NA 2JNWA 1F8XA 3LECA 2IYPA 1OFVA 4R69A 1XJ0A 3H2IA 4DSTA 2XTMA 5BV1A 2H4HA 1AKRA 4G28B 3UG6A 4BO0A 4BP9A 3FUWA 4KIFA 1JDTA 1UBCA 1ZM2A 2H85A 1YJWV 4MYSA 2P4HX 2ZSHA 1X42A 3UTCA 1CJCA 1E3WA 1TW3A 4CM9D 3AKYA 1X7ZA 2YI8A 3AVPA 1YVRA 3TQCA 4IVNA 4A8JB 4Q21A 3EQ7A 3PHGA 3L9WA 2Z6UA 1Z8DA 3BSWA 1MC8A 3GRZA 2O8EA 2AXTZ 5FAXA 2HCFA 1F7VA 1ZH6A 5EMHA 2V55B 5L3SB 2IYEA 1GVHA 4BCCA 2QRZA 2O06A 4M1MA 3AR8A 4PBTA 3UT6A 4DPKA 3H8WA 5HK8A 1VPWA 1S2NA 3ZS8C 5C5IA 1IX9A 3CB2A 5T8KC 1DTSA 2C20A 2RB9A 5KKAA 4E94A 5HNKA 3KXDA 4AJJA 4V3BA 2QPAA 1B43A 4Q1DA 2E5FA 3I2JA 3CNBA 2ECPA 3JQFA 2HWWA 1HNXB 2YIAA 4PO1A 4RETA 4MQMA 4QHTA 5C8YF 3ZVMA 4DBVO 2EYUA 2IEBA 3VR0A 2HK8A 5DECA 2BKEA 5B1SA 1UPGA 1L7MA 1O3YA 4CRWB 3GP5A 1NKVA 2Y4NA 1TPZA 1NPTO 1Z3IX 4JYAB 4RXUA 1XQ1A 4NS4A 4QASA 3GRYA 4BT2A 2YN4A 2GCOB 2ORWA 1FQKA 2P65A 3KYCB 3EVNA 2JGMA 4PRZA 2XAGA 1JH8A 2GRUA 5AOBA 4A6DA 1VJ1A 2RE8A 1RJ9A 3DFMA 3OTIA 3ADKA 2GN6A 2EZPA 2O1EA 3DYIA 3GO4A 2EIHA 3M6FA 4RHFA 3SVZA 2BSQA 1U28A 3W4JA 3H1GA 1ZIDA 1VMIA 4TLEA 4YNBA 8LDHA 4II2A 2ZQ5A 5L9AA 3K2XA 4ZAZA 5TVGA 3DAOA 2CVPA 1NX6A 3OIFA 3TBHA 3W6PA 2DHDA 1QG2A 4EVIA 5BR8O 721PA 2JLBA 1N0JA 4XX1A 1H4QA 2ZGVA 3HDTA 3ZQ4A 2AH5A 1A8QA 3I61A 4ZEWA 1AR4A 3SFVA 2A4MA 4AY2A 2FW7A 2Y69C 4NV3A 1XSEA 3LZ6A 4HGRA 5LBTA 3E8GA 3BJEA 3GQBA 1N1EA 2IYWA 4J1TA 1OCZC 1J2EA 2KS6A 4ZOAA 5JYEA 2CBXA 2CGNA 2DCUA 1I2ZA 4ESOA 1LNSA 3HWRA 3HM9A 1JUDA 4LWOA 3ZTWA 3CF2A 1ODSA 2EFYA 1M2GA 2ENUA 1D2DA 2BFDA 3I58A 1ECLA 1V54B 2BH2A 1WPXA 1ZH8A 4K88A 4Y9TA 4X8AA 4H3SA 5SYNA 1IHXA 1BGWA 2AK2A 1NE7A 4OXIA 2ZSBA 3GNSA 3OM0A 3D3NA 1CEQA 1KFCB 1AF7A 4G0VA 1PGOA 4IUBS 3I64A 4JK3A 5ALDA 4HDSB 2UAGA 1LXCA 3W1EA 3HJTA 5TX7A 4OGKA 4U63A 1SXPA 3UHAA 3RQIA 1BQEA 1TO6A 3JY6A 2EP5A 4D9KA 3OFNG 3VYUC 2E75B 3RSZA 3KE1A 4DCUA 1C2TA 4DK1A 2LDXA 5TPWB 1JZTA 2IY7A 4YIOA 4YQYA 3U3XA 5KMGA 4JBGA 3I5YA 4HNAA 3UCSC 4A5OA 2JFNA 4YMGA 5B1NA 1H1DA 5C7OO 4J91A 4CDNA 1RZRA 2IZ7A 4PLTA 1ZI6A 5C1BA 1TCUA 2NSJA 1WOMA 3H3XA 2VP5A 4ZD6A 4DYVA 4Z7OB 3PENA 4BKRA 3A8TA 3GLIA 3ZD7A 3BUSA 3QUQA 1T0UA 4TQ9A 1C8VB 4J9UE 2YQ5A 3WAKA 3O9MA 4HVCA 2ZWOA 2Y67A 5GJBA 3UAXA 5H3LA 1G1XB 5HY0A 2PQ6A 4TRRA 3AJEA 2WLNA 3T1HO 4U7GA 4J7ZA 4NBRA 2Z04A 3PDIA 1PJLA 3GEHA 4B4KA 5B1OA 1D09A 1OHHD 2BFFB 5B3AA 3UXYA 4RHEA 3EPHA 3SHVA 2EWVA 4WPGA 1W2BU 2CLDX 1NVVQ 2DC1A 1US8B 4MPTA 4TRJA 4QLBA 3EXIA 3HPLC 4RK5A 2FH5B 4F6RB 2NZJA 2AJDA 3EVZA 4OQYA 3LPMA 2WKQA 1IBCA 4CH5A 2BGIA 3TTWA 3K9AA 4R1TA 4QTTB 1BHJA 5GIOC 2J5BA 3I30X 4Q4HB 1T6BY 1WNFA 1Z6TA 1T0IA 2OOKA 2FRDC 3R3YA 3M3PA 1V1RB 3K09C 4GCZA 2AQKA 4ZV7A 2P9JA 3BCUA 3A1NA 3WGJA 1U8UA 1OZGA 2I67A 2FJ0A 4INPA 2W2LD 3VVCA 4X61A 4PNEA 4L75A 2X5JO 4AKSA 1VQMF 3DEHA 2V58A 2WF6A 1DBPA 2P9CA 1YR8A 2IPMA 1Z13A 4M7WA 1I0HA 3FX7A 1R4AA 4CDGA 5BVHB 3K3WA 3PHLA 4RFSA 4IFEA 1V4BA 3DTNA 2QT1A 3FR7A 4CV1A 3LLMA 4AJ9A 1WP9A 3IBSA 1I3NA 2VA9A 3DV9A 1M34B 1F20A 4ALIA 3WGTA 1YIJF 1Z37A 5I4BA 2W6JG 2HWYA 3CPHA 4WI1A 2HQOA 1W46A 4D3XA 1NJ1A 3GDFA 4XM1A 4RABA 4ALNA 1Z18A 1NBME 3AW8A 1KFEB 4V2UA 2OZVA 5IBCA 4YIHA 1QANA 2RK6A 1UAGA 2FW1A 1TYAE 1G5RA 3OEED 5I7UA 3COSA 1S8FA 4LTMA 1BEEA 2EZTA 4B4WA 1CJBA 4LFBB 3PHBE 4WFIA 4XUGB 1LX6A 3ITKA 5KYGA 1E3IA 2AFHA 3KZOA 4F84A 1W55A 1P4SA 3WIOA 3ZV5A 3BFRA 5DN6A 1YI2F 5TR9A 5AWFC 1QD9A 2XUDA 2BFCA 1G5PA 4JZGA 2EIXA 1A5TA 5BSFA 1FDOA 1C4XA 1MB2A 1TRKA 5FR2A 3O4JA 3WWCA 2F66C 3LX8A 4F4CA 4FGUA 1ZRMA 2SKDA 2JGKA 3RVJA 1K9VF 2LWIA 4UBMA 1DZ3A 1M4UA 4JCCA 3QG1A 1OXUA 1UAAA 2IXTA 4V3CA 4RYDA 4ZI7B 3GH1A 4OHUA 1UANA 4JASB 3D8BA 3W34A 2HR1A 3P20A 4K3VA 1LR1A 3OLZA 3UHPA 1DAKA 4IDCA 4UQPA 1XZ8A 4O2AB 4RHCA 1W44A 1A8PA 3CHXA 2WFAA 2HNBA 4FFPA 2A0FA 3WC4A 3SPHA 4FLEA 2HV8A 3I1YA 3C4JA 2Q7EA 4WCEV 2GBLC 1VJTA 1ZXBA 4NHOA 2E1RA 4GZRB 2DKOA 3WOHA 5A0FA 3MJSA 2PNFA 5ICSA 1R0KA 3E9QA 3ZJVA 3CH5A 4FP9A 3KVVA 3HMQA 3W2TA 2P27A 3U3JA 4UATA 2F1OA 5AVJA 5EMLA 1CY8A 4F0JA 2AMYA 4NAUA 2C2MA 2G3YA 1ICIA 2XCOA 2WLIA 1U7DA 1LBHA 1IBKO 1DU4A 5IX8A 1KYVA 1D0VA 3V6LA 3FPKA 1H4VB 4BMXA 3D8HA 2ES4A 4EZBA 3U4HA 1ESCA 5AM1A 1DDOA 2V7VA 1MNAA 2EW1A 3OTOB 2H0AA 2I3BA 1R74A 4TVBA 5C2JB 2X58A 3CLTC 2H2AA 5ECDA 2IU6A 1M2WA 4QU8A 3G68A 4RVGA 2IYRA 1DZIA 1NW3A 5IJAA 1R6BX 1WCXA 1SBCA 5TPZA 4LCUC 3P9SA 4OGGA 3O1JC 1UMDB 3M9WA 2IW3A 1NX9A 2W11A 4IXDA 2BTOA 2ZS7A 5IZCC 4KDCA 1T5EA 2CZWA 2D13A 3BGDA 1C3VA 4XJVA 4F3CA 3UPTA 2ZBRA 3KG2A 6AT1A 1MX5A 2YJ5A 2BGLA 1TAGA 3QMMA 2ZT5A 1E0AA 3AK4A 2PIAA 4GP9A 4GPZA 3CUTA 4JLOA 3LTNC 3CLHA 1YJAA 3GRPA 5DSXA 5H02A 2RK3A 1J9EA 2E87A 4C4OA 3E8HA 1G7SA 1REQA 5IKPA 2V4ZA 2UUBB 4MP8A 4JJ4A 1NQUA 2CNOA 4AJ1A 1T1IA 1DEOA 1P33A 4MQEB 3QEBZ 2NXWA 2QL9A 2V3CC 4EQ6B 3FOAA 1ZO8A 2AE2A 3D4OA 3B6MA 4YGXB 4QODA 2QJWA 4E7PA 3AJDA 1FRNA 4B3SO 1TC2A 3LBIA 1AD2A 1USVA 3B8NA 4KNVA 2Q7HA 1Q74A 5KSYA 2I4RA 3VDXA 1UH5A 4NH0A 2XGMA 1KEWA 3M4NA 1GA4A 2ZUCA 4HQOA 4DCVA 3K6SB 3WPXA 1LZKA 2EW8A 4G0YA 1HK7A 4C4PA 2NU6A 4IIEA 3AETB 1U0RA 1UOOA 1WD7A 3L7DA 1UBLS 5KOYA 4DJFC 1NI3A 3FVTA 3NTLA 4X84A 5EJIA 2ZT7A 3SK0A 4DIFA 2MWMA 2VBIA 3EA5A 3THOA 3AW9A 1SHJA 4FWBA 4EJ0A 3OA2A 3KZVA 2EERA 1K5DA 4YXWA 3H17A 3WAJA 1JL3A 3PE3A 3O4FA 1XV5A 1W93A 3K0DA 5GY7A 3V7NA 5IE9A 2ZTHA 3R7SA 1COZA 4WY8A 2CB0A 4XYGA 1DKLA 3ACDA 1Z16A 4GNRA 1T2AA 3IVAA 3MT7A 4QYSA 2I9KA 1ETUA 2XKAA 2LQTA 3PXXA 1Y81A 2FZLA 2X8AA 4P7BA 3BAZA 4HYEA 4BV2A 2J9FB 1VQ1A 3A4YA 4UMFA 2R4TA 2BWJA 3MS2A 3EF1A 2J4FA 3C1OA 1DKUA 4RLHA 2C5SA 3QVVA 1QV7A 5E8RA 5CHEA 1O58A 1N9ZA 4HDRA 1MV5A 5JVDA 3QNUA 4JL8A 4DW8A 1KEEA 4US1R 2R66A 3D5TA 4JLKA 3W7BA 1CJMA 3ERNA 2NYAA 2YIVX 3LPAA 2UYCA 3L01A 2IELA 2ZRDA 3TR0A 4E14A 1GM7A 2G07A 2C04A 1OTHA 1O08A 4AX4A 2D00A 4XYLA 3PRYA 2FKXA 4OVKA 3U48A 4AI6A 1CUCA 1JTFA 1YB6A 5EE5B 4WF9V 4AT1A 4FFKA 5NLLA 4YC7A 3T2MA 1GTRA 5HTKA 3W9YA 4K0RA 2PTHA 4RKRA 5T57A 1MO3A 3HUTA 1O0BA 4QWMA 1RWQA 5BNZA 1WXGA 3TOVA 4B9EA 1E32A 1Z4QA 5AQEA 4JY7A 4E70A 1GL7A 2PU7A 3ELBA 1T2NA 2PR2A 3OCJA 4BMVA 2H00A 1SCBA 3SQLA 4AL4A 4DEXA 1DUIA 2VAMA 2QVXX 1S3FA 1BSMA 4F2GA 1RMQA 4UE2A 1SETA 3ET4A 5AKJA 3HLKA 3RS4A 1H2SB 2IZ6A 5HCNA 1CUEA 5JO0A 1XTJA 4GWKA 4M55A 4G01B 3TRFA 1PWXA 3O2SB 4MEJA 1JBQA 3K9QO 4J49A 3V33A 1XPOA 4LJYA 4EGJA 4P7KA 1QYWA 4GICA 4B40A 3R8FA 3U7JA 5B5SA 2FCRA 3DR3A 2OBYA 4XE5A 1Y1KE 1U8TA 2HRUA 1HTBA 4LRXA 4DLRA 1MH9A 2BHRA 3U3OA 4F5ZA 3U09A 2QTSA 1MR3F 5KYWB 5CBGA 3IX7A 3OLWA 1T26A 4M1ZA 2IJKA 8ATCA 3BILA 5AKYA 2HSJA 2E18A 3ABRB 2X5KO 3PFGA 3AF1A 3SIWA 4HGQA 1BZYA 2FWAA 1R5NA 5IWCA 1AA6A 1G8JA 1AJNA 2D74A 2AGAA 3O4RA 1U11A 4PNZA 1K89A 4U2BA 3FFBA 3PC3A 3VH2A 4RD2A 5B8FA 3ZGNA 4LDZA 3RVZA 3Q41A 2PXHA 2RC5A 2X6BA 1V9SA 1EX7A 4WAUA 4OAQA 5LGNA 1J06A 1KPHA 1G8PA 4IDEA 1YJBA 1EX6A 4DA6A 3CX7A 2PYLA 4QBFA 4WXMA 1PYOA 3BD8A 4CPDA 1K7CA 4UZFA 1WDMA 4RPKA 3ZO8A 3CT4A 1UIRA 2OVFA 3G67A 3G4SF 4PGMA 2BCEA 3FTDA 4FDMA 4LBYA 1BGYH 5AUPB 2QLMA 5DBGA 1QHHA 3C3WA 2IGBA 1XVLA 3HYNA 5T3UA 4C30A 3WMWA 4EJSC 5F5XA 4IICA 1QF6A 3SZOA 2I3ZA 3NTXA 1YQNA 1EEHA 5AP9A 3E22B 5F52A 4UE6A 1IPFA 3PNPA 4O63O 1T43A 1FDWA 1GUZA 4NU5A 1HNNA 1RLIA 1GARA 2WICA 3AF6A 5JZVA 4FMDB 3I28A 3WGQA 4DW0A 1YB7A 2XTAA 4GPBA 3LLVA 3V4SA 1EM8B 1V6SA 2B1JA 3NQ41 4JLVA 2PYDA 1F2UB 3CZ9A 4YRJA 1GN2A 4M0FA 1DCKA 3QSGA 2ZJ2A 1EWQA 2JS7A 1O95A 3SBXA 3IVMA 4H4DA 3WLOA 2RGXA 4R5HA 1OFTA 1Y9JA 5IC5A 3U26A 1P7BA 3NC1C 4CVNA 5IAEA 5ALWA 2D1SA 4L5IA 2C42A 2GAFA 4EA8A 4Q48A 1J24A 3GFTA 4ZZIA 1TJYA 3FDZA 1X1DA 2PH3A 4TT3G 1LPBB 1NKSA 3CLUD 2ZBGA 3U39A 3K4PA 1O5OA 2W2KA 3SOZA 4G3XA 5K09A 4MV0A 1NVKA 4UBNA 3MWYW 1N6NA 3IUJA 2UZ1B 3S55A 2FTKA 2N0SA 3V7FA 4ZHQF 3MQFA 2DLNA 3MT8A 2A88A 1VKJA 4WLVA 4EFBA 3U7QA 3QEKA 4FZ3A 5J4YA 4IW3B 1AGRA 2ZR3A 5DIFA 5C4IA 3CNEA 2FSVC 4OSEA 2XCQA 1TF5A 3PICA 4I5IA 3QXXA 4C08A 2HO4A 2J5QA 5AK0A 1GO0A 4RUKA 3PC8A 2Y2VA 2XMQA 4TYYA 2VO1A 1SGWA 4DNFA 5L3CA 4UVHA 4JI6O 5EI5A 5L53A 2FP4A 2FZKA 4Z3KA 2H9IA 3JWJA 3VC1A 2ZJ8A 3OR6C 5F7XA 4YJ2B 4IJWA 2QI9C 3KXLA 3MOSA 3GEPA 2XB6A 1D2CA 4KO4S 3WYBA 4EG0A 1I33A 2VTKA 3H9UA 3Q9SA 1NULA 1F8FA 1GRVA 1K2WA 2Y05A 4KP7A 1A88A 1HGXA 4D41A 2ZLBA 5IJ9A 4C7MA 3W2EA 2HSWA 4K9SA 3IOMA 1L1QA 1QAMA 2NMVA 3ZWMA 4IMPA 2QUZA 1IPEA 1XL0A 4ZJYA 3GDGA 4G36A 2PBZA 3CXCU 3MTAA 2G28A 2QNBA 1CZKA 2IF0A 5DBOA 1YWGO 2QW0X 2X8JA 3AH8A 3CBQA 4Q1CA 1CUAA 4YAOA 1GUFA 3W6UA 3FTEA 4ITRC 1MOQA 2ZBUA 3I5AA 3RTCA 3OQPA 1DQPA 4DR3B 4FT2A 3WIUA 1Q8IA 2VYVD 3H05A 2D7DA 2AJLI 3TOXA 2R9VA 5AI9A 3EEIA 4LWSB 2PGGA 2K7ZA 1C29B 3GV0A 2IEIA 3FDFA 2XADA 1VMKA 5BMVF 2JPDA 3GAFA 4MTXA 4AUEA 3BK2A 2I2XB 4KHZA 3O5AA 3ED5A 3RD5A 4B3TO 2YIBD 3IKLA 2C5LA 3LCVB 2AX3A 3N0XA 4B85A 1P2BA 3WE7A 4E4TA 1I6MA 1OB5A 5SYAA 4AUKA 3F6CA 3AEKB 3ASOB 1QAHA 5I51A 4LXUA 3DVLA 3K53A 4OQXA 3NATA 4ZA2A 4DIMA 3MHHC 4OYHA 5LP6A 4I55B 2GYWA 1RKXA 4ND1A 3CD6V 2BELA 1IJEA 3KJXA 2JA2A 2JRLA 5IBRA 4OK6A 1LUWA 4GE0A 4JVSB 2FPPB 4JYZA 4RC9A 3QXSA 1E1YA 1M8JA 4WSOA 3IHWA 4Y6OA 2EHDA 2PV0A 4Q7JB 2ECQA 2VRBA 4YDQA 3IDAA 2F4NA 1PT8A 1OCOB 4L2IA 3IV6A 2N46A 2OTJV 4MV9A 5EOVA 4F72A 4HUTA 2ZI9A 2OENG 4LJLA 3UTDA 2NZWA 5DCVA 4EVSA 2R87A 4UM7A 4M49A 1R9NA 5E4TA 1XJCA 4NAHA 4KC0A 2OO5A 2IV3A 1MAHA 1MRNA 3S5JA 3FB7C 1TA4A 4TS4A 1XZCA 5B3LA 5BY2A 4MW1A 4EHDA 3HB1A 2Q2QA 1D5AA 4O2BB 1QYDA 2V03A 3RAFC 3ZY2A 3HSKA 1GK9A 4O8ZA 1DBRA 1JLKA 1LZLA 2E4UA 5B2FA 2HHHB 3R0JA 1GAXA 1CVLA 3IIMA 1H8EA 1S89A 1DBQA 1AQLA 4ZTUB 2BR4A 4XVQA 1CN7A 3W77A 2N04A 1CR1A 4HZGA 3IKTA 2HREA 2YFQA 3BF8A 3VI6A 3AHIA 5EEHA 1PD1A 3DUFB 5KX5A 2KMLA 5GV8A 4FLFA 1WW8A 3OESA 5JCOC 4L5YA 5EP3A 2X22A 2DLCX 4KACA 3I56F 4B08A 5A3RA 4LV6A 2ZPUA 1WPRA 2AOWA 4YGYA 2OSBA 1PZNA 4QDZA 2W93A 3BVOA 5KOIA 1MT0A 1ZEMA 2P5OA 1Q7CA 4NS1A 2JLSA 4ERNA 4DC9A 1VQPV 4YV7A 1KSGA 4AY3A 3E53A 2XXBA 4Y2PA 4X3LA 2B5UA 1I24A 3VH4A 3VM6A 4P9PA 4KE7A 1N2CE 4QVIA 1HPLA 4K6OA 3DLPX 4RKQA 1DKQA 3PEWA 4B6OA 1OASA 2VT3A 1G1MA 2C7BA 4DMGA 4YJFA 2MT9A 4LMBA 3RDPA 3WXMB 4UTOA 3GGDA 4K0KO 2PJDA 1NJIH 1GZ5A 2BFBB 2R5NA 2HLHA 3NEAA 3T1OA 4GGMX 4BW0B 5KDDA 1VB3A 4WADA 1T5IA 3D1VA 1XHFA 5LDGA 3SGLA 1R27A 1AC5A 4QPZA 4JI5B 5E4FA 3RT9A 2GM4A 3TSZA 3R09A 2YWXA 1M2VB 4M7PA 1LUAA 3CSSA 1ZAKA 3G6BA 3A58B 3PXUA 5LP1A 4YBZA 3HMKA 1AP6A 1VCNA 5AVTA 3ABZA 4QGSA 4OMCA 2WHYA 4G0QA 2GTHA 4AY6A 1KEKA 2CZQA 3RSQA 2OBNA 3DDSA 3ZUPA 5K3OA 1AOXA 2SCUA 1Y8CA 5FBWB 1SQ6A 4B73A 1GAQA 1W0JD 3IQIX 2W4MA 1OYWA 3WK7A 4QC2A 4EW3A 1DOZA 2W8ZA 4E5YA 2EZ9A 4KXFB 2IXEA 4G27B 3NJRA 1SOAA 1J8MF 3VYSC 4X1IA 3FAZA 1EN4A 1P4JA 3DZGA 3A10A 2Q6KA 2C7GA 3BA9A 5KNBA 1I5XA 4MRMA 2ZRFA 1RAHA 1ZU4A 4Q34A 3WNZA 1RPNA 2X2OA 2PA3A 4QHYA 2Q07A 4EM6A 4J6FA 3LVRE 1GGEA 1BKDR 2WF8A 1SBQA 2DYSB 3GMIA 2FZ5A 4F97A 4PR0A 3SKYA 3B53X 2RJ3A 1Q7BA 3QA9A 4EF6A 4IIHA 1L7VC 2VK8A 5IXJA 1E7RA 5EHNA 3IUQA 4UXHA 1WBJB 3A6LA 3ZVNA 5IT0A 2VUSA 3RVQA 1YF2A 3AG4B 3WBJA 4EI9A 1M0WA 4KLCA 3GROA 5IARA 4GVPA 1G2QA 3IFXA 3NANA 2XH8A 3AOEC 1H2WA 4NY1A 2NLOA 1CFZA 4UNIA 2H7YA 3O0TA 4HAYA 4NFYA 2B9VA 3UB3A 1ZKDA 1XBLA 4X1KB 5D85A 1C30A 3U56A 4JUIA 2G72A 1K8AH 3AV3A 1JJBA 5EHIA 4HB4A 4HP8A 5GV7A 2Q45A 5CG1A 1G2OA 4QM7A 5AM2A 1J9GA 3W8FA 4D99A 3JU3A 4MGKR 4B47A 2PT9A 5L51A 1RFYA 1XZPA 2GHTA 3LSUA 2ZG6A 3KCQA 4L5BA 4BFTA 1GTSA 4BY9E 5AHRA 1A9YA 3OLCX 4GI1A 3KE8A 3C3CA 1C9EA 4DV7B 5LNK6 4CZ2A 4GU5A 2R6R1 2W6PA 4FW9A 1EFRD 1AMUA 3GXBA 4J7CA 2CLOB 4S1WA 1JG2A 1NUPA 3ZXXA 2ZIZA 4W1QA 3NAGA 4X6XA 4OHVA 1NN5A 5F5LA 2AW5A 4AUMA 4XIFA 3AM5A 1QRTA 1XA3A 1E1QG 4FYMA 3OE7D 1XELA 4ZZ2A 2P8JA 4NPHA 2COKA 6REQA 1CJSA 5H6RA 4D8YA 3O1LA 2BEUB 4ESVA 1CR0A 3ORSA 1LRJA 4OB6A 4CM7A 2UXDO 3ETQA 2ZETA 1IUPA 4BN4A 3L0BA 4UE3S 4YCJA 2D54A 2VWQA 1LPPA 3ASVA 1ODKA 3QMVA 2HWXA 4JBIA 4ZVOA 2W2QA 3JZDA 3RAJA 4GOXA 3LF2A 2JIZD 3DYVA 1TMYA 2EC5A 1GCUA 4HJRA 4YMHA 2W2OA 1SB8A 4L1KA 1A8IA 5IW8A 5DM2A 2QTRA 4MEAA 5IMBA 3KFXA 2FFJA 2N1BA 4HZIA 4M1EA 2XTZA 4JXXA 3VV2A 3F49S 3KIPA 2QJTA 1UM8A 4LZJA 1IHOA 4BVHA 1M8FA 3VNVA 1P2SA 4IMJB 1C9YA 3BMCB 2Q5QA 1K4CC 1V45E 3AUAA 2RAPA 1X1EA 1DNPA 2AHRA 4PDRA 2AYXA 2MYPA 1TADA 4ENUA 1M5UA 4ABYA 3N76A 3HUEA 1SIWA 3ETCA 2MMCA 1B73A 3QY9A 1AB3A 2JHGA 4BAZA 1HDYA 3TD4A 2R11A 1N33B 4L9RA 2D1TA 1J7JA 1XDBA 4EMBA 4ZV9A 5FXMA 1OUMA 3P0ZA 2FMLA 4P4SA 3T3DA 2QVGA 4A73A 5ELLA 2JFOA 1JDBB 4C89A 5C8ZA 2ON6A 3IRUA 3DWEX 1VQOV 1W47A 2CN1A 3NDIA 1BW9A 4TYQA 1VQ7V 2FSFA 1A5ZA 4TTJA 3IQWA 2JVIA 5A5VA 2ECOA 5ALEA 2NXCA 5EJMA 4KAXA 1UBKS 3K1AB 3TFWA 4H3VA 5EAIA 4P9OA 2CHSA 2EIJC 2GZSA 2O2GA 1Z36A 1IG3A 4IKEA 2EXXA 4MV7A 3ONFA 1CTQA 1XZKA 2Z8XA 5D3KA 3WHPA 2FMIA 2NSHA 4EBFA 4AJ4A 2FFBA 3M70A 2PZBA 4IXNA 3MUNA 3CG6A 2F55A 3COJA 2Q4TA 1D2AA 3DDOA 1KO8A 1AI5A 3ZVRA 2H8CA 4TS1A 4AZSA 3Q72A 4H17A 4GC9A 3D4PA 3MINA 5CB8A 4O5AA 2RNBA 3H0EA 2AEJA 2E5LO 4NIMA 1QNMA 3R5TA 2A59A 3QBJA 4MV1A 1GRCA 3LCMA 4DUYB 5LGUA 1PYDA 3DZDA 3ORYA 4UB8Z 4LI0A 2G6TA 4S1NA 4UCFA 3TUIC 1IHPA 3R44A 2W0XA 4F45A 3QX7A 2GZDA 3DPUA 4QE7A 3AL0C 3OO1A 3AOGA 4J2HA 1DWUA 1N6PA 3SDLA 2BBWA 3IA7A 4JFRA 2BYTA 1QS0B 4PC2A 2PLWA 3UQYS 1RVDA 1Y74B 1W5BA 2NSYA 2ARHA 4OB8A 3UMRA 4QE3A 7MHTA 1ZVMA 2CEAA 4RZ2A 3LBYA 4DMMA 4TYWA 3E84A 4Q3LA 2R1TB 1WMFA 4MUMA 3KVOA 4HTAA 3G6KA 3FJOA 2F9LA 4I1VA 2XUKA 2J9XB 3GJ4A 3W78A 3AZQA 1TKAA 3IEQA 2Q0XA 2Y1XA 3ER9A 1SMKA 2JCVA 4UCSA 3L0DA 4DXHA 1GNVA 4U0JA 2QB5A 1QRUA 2RGDA 3ROQA 3DFKA 1V6AA 4OJKA 3FPIA 2ZXFA 3B51X 3C85A 1NOJA 3A1UA 2DZDA 1FDUA 3DMRA 3RCBA 3ZGLA 2G06A 4CLHA 3K12A 2XQKA 3ZU6A 3BRSA 5ICCA 1M1NA 1JMVA 4OFXA 3CY6A 1E1LA 4AFNA 3DFIA 4CEIA 4CM4A 1XHLA 3HR8A 1AKWA 1ZUQA 4RGQA 4DA0A 2PUWA 3W4KA 3VNBA 3FBAA 2QM7A 4QU5A 2PZSA 4PG6A 4CLRB 3AINA 2PUVA 1E3SA 5GM2A 4ZGWA 4QGGA 5DOVA 3OHSX 2VDPB 2DB3A 1XYYA 4WZZA 4PVDA 3BH0A 3AK1A 5FTLA 2B2XA 2XNDD 4RDHA 4FM9A 3EXFB 1XWWA 1B42A 4LSZA 5JXJA 1D2HA 2PGLA 3JWIA 1NXPA 1RE1A 4EO4A 3IV7A 3QA3E 1Y1RA 3H1EA 4A8HA 2A0WA 1ESNA 2E74B 2G38A 1DBSA 2FP3A 3ESQA 1WZIA 1R3KC 2ISQA 5F3WB 1HSZA 2UKDA 2HCJB 4XCXA 2RGRA 3THSA 5EEGA 2OGZA 2HU7A 3ZXIA 3BXOA 1P5RA 2PX0A 4NXMB 2GD2A 1OD6A 3RUAA 2BKXA 5KC9A 1HORA 3ZIAG 2P06A 2YBDA 1QM5A 5T4FA 4MS4B 3QBVA 1JEDA 1SULA 3S2EA 1U6KA 2FLKA 1OGJA 3IP8A 4RTLA 3EAGA 3EGIA 2HN9A 4FN5A 3OZTA 4Y3UA 2Y1FA 4MV8A 3ABMC 4TL7A 3T7CA 4J75A 4WBSA 1AUVA 2P35A 4LE0A 2LVBA 2Q3MA 5AW3A 5AO9A 2ZM6O 3KWFA 3E83A 3E9CA 1DIRA 4QO8A 4MICA 2WEKA 2GHIA 1MH1A 4MUFA 5BSGA 4DJDC 1SWVA 3T1NA 4IFIA 3U6BA 2FDXA 4BVTA 1X1TA 1TUGA 1T8WA 1ND5A 2AR0A 4TN1A 4KAFA 5B3SC 2DQKA 1N4CA 3HC7A 2Q99A 1AS2A 2L6LA 3CRCA 1XLWA 3DGEA 1W1IA 2JRIA 4HDQB 1XPRA 3TVDA 4UHJA 4HNRA 5JZBA 4BEJA 4BQEA 1L5OA 3JARB 1AIPA 3ESZA 5EA2A 2JGDB 5EVJA 2I4MA 2GERA 2Z6QA 5BN4B 3VPAA 2NVUB 3HB4X 4J0CA 3P19A 3BGVA 3D36C 3E5RA 2CD7A 5E6RA 4KK3A 4WUVA 2HJHA 1ZGBA 5G02A 3TAXA 3MPOA 2TSYB 3WGNA 2IYXA 5C53B 5CB4F 3PEFA 3GJRA 4EWLA 3NW9A 1KD1W 3QQ5A 3WJ1A 4LBWA 4EMSA 2M98A 4PV1B 1U4NA 4XIGS 1VL8A 3F3SA 3NBXX 4Y1FA 4LH7A 1GTZA 1ORHA 1Q0PA 1ZMXA 3OTGA 3H42B 2YTZA 4OL9A 4U39A 2A1TS 3U10A 2N75A 4A0RA 4UJ5A 3V4FA 4H6WA 4RGBA 3DB1A 4A2WA 1CUYA 4B8YA 3JQQA 4I36A 1SCKA 1TT5B 2VF2A 3ZS9A 1SOUA 3H83A 3VV3A 3PJRA 4V38A 3AR5A 4PYMA 2A30A 2Y48A 1YDXA 1QO7A 3NHWA 2V6IA 4QHSA 1FA9A 3CRW1 2YWGA 4EG4A 1RD4A 3GVIA 1A2OA 3JAKA 2HDWA 1YDMA 1JIUA 5GTIZ 1R0XA 3FETA 4HXEB 3GCDA 2GLZA 4GSKA 5FBZA 3IAAA 4KUGA 4U6SA 1N34B 3M4SA 3EEYA 1M34E 5CLLA 5LB4A 5AHWA 2ATIA 1T36A 4LGCA 3LOUA 1K9MW 3G3EA 3ENWA 2C1ZA 1G20B 1SKBA 3K16A 5AXAA 2IZOA 1YNSA 5IUKC 3QPCA 2ERCA 3I53A 3LPLA 5F3DA 2LCFA 5EBWC 2HEGA 1XQ6A 2B4RO 3VX3A 5K3FB 1YV9A 4J9YB 1UBTS 2QG6A 5C1DA 3NYWA 5A1JA 3L79A 1MO5A 4LF6B 2ZIAA 4NOKA 2AOUA 4PM4A 4P31A 2W8BB 4D6YA 3RADC 3F6YA 1YTFB 5L3QB 3A1CA 3O82A 3OPYB 5HDBB 2UZAA 1V25A 4MR8B 1RT9A 2HZBA 3C39A 1G3RA 3C6MA 2WZBA 1A3CA 3SSOA 4MRSA 3RK1A 1J8QA 4WFEA 4OB7A 3IAS1 4RX1A 4UEQA 3W5DA 3SPCA 2EYQA 4B5LA 2JLQA 2H2GA 1SVKA 1L1EA 2Q5LA 5IPFA 1R6KA 2QJ1A 3WADA 1QZXA 2Y2UA 2UYNA 2Z5GA 1RXSA 4BC0A 1E3LA 3GUVA 1Y8RB 1Y1QA 2RH5A 2HPAA 3VISA 3PCRB 2D1QA 3P2JA 1NWCA 4K2HA 3JQEA 3ISVA 4TS3A 4ZCLA 3E2EA 5JD4A 3MA0A 4ZPXA 4G09A 3ZHUA 2DOSA 2XQGA 1F17A 3HGQA 2EIMB 1QZTA 3P9KA 3LDHA 1U3CA 2K6GA 1G41A 1LBSA 4C4XA 1VZ2A 2RJZA 3T61A 5HK9A 2QKSA 1AXGA 3QOWA 1N32B 1IATA 5KHJA 1FJHA 1SPBS 1QNFA 1M74A 3GLRA 2LPMA 3U0OA 1PV2A 2IYOA 4OXSA 3O8OB 4PPQA 4BMDA 2WFZA 1W5SA 1QTQA 3HJGA 1MO2A 2Q2OA 1XN4A 1OBHA 4ZYTA 1M3SA 4B0PA 1Q1EA 2XBMA 2QSJA 2DFLA 2R9IA 1I7LA 3EORA 3K4HA 2FLVA 1I7QB 1UFKA 3GUUA 4XIYA 1BFUA 4CF4A 1DS6A 3PBKA 3DE6X 4P5PA 1E2JA 2WMOB 5MN5A 4KN5A 2A0KA 2CLCX 1M2OB 3OLVA 3QO7A 5AM3A 1SA0A 1F0NA 2RAFA 3CX8A 5TF4A 1HLDA 3BXHA 1T6XA 2DFTA 4PA4A 4MQFB 4C0XA 5T4HA 5CJPA 4YP6A 2YW2A 1ZAYA 5IBPA 3QO5A 4ZMRA 4WCDA 3PGXA 3TJRA 3ROPA 1PG0A 1R6VA 2WT8A 4AQYO 4F8JA 5AHKA 1LX7A 3H0KA 2J67A 3FMVA 4EGFA 2RHLA 2FPWA 5JYCA 1RZRD 2P2ZA 5JASA 4ZHQA 3EFEA 2OE2A 2N3ZA 1UPBA 1FCJA 3AR6A 4WOPA 3N4ZA 2GPJA 3PRJA 3DCIA 2QUAA 4DV3B 4XB1A 3JXEA 4JR0A 1RBYA 5TV2A 4MYRA 4BR6A 3NC4A 1T13A 4QPNA 3Q40A 3OEHD 1FS5A 2RBKA 5SICE 4QEKA 2ZAGA 1JLLB 3TAHA 2YFYA 2Q3DA 3KVRA 3O7MA 4L8YA 4N7JA 3AR7A 1MPTA 3BFVA 1QE5A 2D5LA 3A6EA 4ZOCA 4KQHA 4HAOA 3WPWA 2FWIA 4PA3A 3HB5X 3SE7A 3WLTA 5ITZA 1H0RA 3DTVB 4JMPA 1LSSA 2ZRGA 4PIPA 2JFFA 2PXXA 2YC4C 3JQ8A 1Z08A 4JWKA 3R8CA 1XD2A 3DL0A 4Q0MA 5EYPB 4ZVUA 2ZAUA 2CYAA 1M6VB 1CWUA 4AJ2A 3N74A 1WN7A 4RCYA 1F1BA 1XX6A 1GM5A 5IG2A 1TIPA 5B1IA 2JIOA 4RSHA 5LD2B 1Y1LA 2UYPA 2DUUA 1TVKB 5JCJD 4OYLA 3VAAA 3ETNA 4LK2A 3SDBA 1II9A 4OLAA 1U40A 3BH6A 1X4TA 4AG3A 3EQ9A 4GX0A 4BNJA 2PZKA 1IC6A 2Z98A 4NVPA 1KDOA 1XQVA 1JQJC 2YVQA 1Z6ZA 5FO0A 3FPBA 1NN1A 4CTNA 2P9BA 5KYXB 4C7VA 4JI2O 3C70A 2ENWA 4BJHB 2YDEA 1GG8A 5DHUA 4WIAA 4HQ0A 1XOUA 4C0BA 6YASA 1RHMA 1NU6A 2YVLA 3VJKA 4F4JA 2QDXA 4EZEA 2ZVZA 5FH9A 2VCEA 3S3XA 2RK4A 3KZCA 3IQHX 2YS6A 4BFUA 5KTPA 1KTIA 5IF9A 2QKCA 1DELA 4LY6A 5KHOC 3EQ2A 1XHOA 4IJ5A 3GEDA 5G3ZA 4NBWA 4Q16A 3EYWA 4YB8A 1JSZA 2H5LA 4KAAA 5BMVA 2XHZA 3PGJA 1OX6A 2O50A 2VA8A 3HUUA 4MTFA 2DBRA 1J8DA 1Z0UA 4I9UA 3EDQA 3GI1A 2QTCA 2QE6A 3O95A 5A9SA 1WXQA 4ZMSA 5ITSA 4Z6KA 3IC5A 1X7WB 1MX3A 4UASA 1PVOA 5CT4A 1EFKA 2IHNA 1E4EA 2EEPA 3IEUA 4Z7JA 2H4JA 4ZOEA 5B4UA 2E0IA 1OXXK 1B1AA 4X7RA 1IOWA 2IE8A 4ME6A 1KDZA 4M9RA 4JF3A 3A7DA 4TXJA 5DN6D 3LC0A 1J5PA 4MTOA 2HCRA 2NADA 3EXHB 2XA1A 1MOZA 3SZRA 4XYMA 4CQLA 1E3JA 3U5TA 1XLVA 7AT1A 3I45A 3FSRA 4RS3A 3AUTA 4QNNA 2XF2A 2JI8A 2PV7A 2HCBA 2CMGA 2ZUTA 5EZYB 4G5HA 1JR3E 3IL2A 5HTOA 4MARA 4BIZA 1TAHA 2Q41A 3OIUA 2NU7B 2D5BA 4EH1A 5FJIA 5K7SA 4NCBA 1EUCA 3PGKA 2OZBA 2CSXA 1U9IC 1G18A 1OV6A 4G23A 4F92B 3KE9A 1P7WA 3CVUA 3QYAA 3FYUA 3SYOA 2VRCD 4E5VA 3I2KA 3K0GA 1APBA 1JHOA 4F60A 5CDFE 3CRQA 4AY5A 4H7HA 3K0AB 3AHJA 4R51A 4B4DA 2YFKA 4TV8F 2FR8C 1W2GA 1A9XB 2DP4E 5JPDA 2Q69A 2ORVA 1Z4IA 1TK3A 2CFOA 4PANA 3UOGA 2FEAA 3NGXA 4OJNA 4Y1RA 3V8NA 1QMGA 5IH3A 3LWPC 3AEIA 1S01A 3CGGA 4OREX 4I50B 6ADHA 3PWTA 1X6VA 1NBOA 2XDYA 2ZCVA 3OIGA 1OJLA 3A9RA 1Q2UA 3T5AA 3ZEAA 1YZFA 3L7YA 2VDOB 4PPNA 3DHNA 1BVYF 4GYJA 3UWOA 1KZ9A 3B9RA 3ZLBA 1EA5A 5JWOA 1OXVA 2YUTA 1GPH1 1BO6A 1Y9ZA 4GNKA 4BNMA 3ZRSA 1Z2EA 5IT9M 1BD4A 3R7AA 1M7BA 1L2TA 3DVAB 3W7WA 3BD7A 3N87A 1Z6QA 2VJYA 1KKMA 4PHZA 2OB1A 2QSAA 1G8SA 4FMCF 3QV1A 3GGJA 3UK6A 1EEXB 3D6UA 3KHSA 5DI3B 3P9CA 3HA5A 4EY3A 4WACA 1TJ3A 2EJBA 4H1WA 1IBLB 2AJTA 3KUXA 3C43A 5TPZD 1INLA 4MGEA 3O8BA 4ENWA 5HQTA 4I1PA 4XLTA 1GCAA 4Q03A 4NQ3A 3VFDA 5IXSA 2O6HA 1BH2A 3TTYA 4AECA 1CS0B 3JSNA 5FFFA 3BHIA 2VXYA 2IS2A 2FX3A 2BHLA 1Q57A 2V9PA 1SM4A 1KO1A 2WM9B 1T6YA 1C1DA 3QLUC 2CNKA 4BO9A 3LDGA 4LRUA 4QBHA 3MCAA 4TGLA 2PI5A 1RPRA 4X88A 4PTZA 5DM0A 1OY1A 4UZEA 2XOKG 1PKXA 1ZU5A 4X62O 3BG5A 5BY1A 2IS6A 2PT5A 5EIOA 3L75H 5BN5A 2YOHA 3W79A 1Q1ZA 1XNQB 1JVBA 4QUIA 4JX9A 2WP8J 3SYKA 3F0DA 3OZRA 3CMAV 3CF4A 4I6EA 3KUUA 3W05A 4P81A 2C99A 1KFJB 5CFLA 1JIXA 2BLNA 3CCFA 3CEIA 1VH8A 4YN3A 3HS3A 3VZPA 1IIBA 3AY3A 2Z3WA 2PO7A 4EA7A 1NVEA 2W2XA 4O0LA 4NECA 4ER7A 2H16A 5LMNB 3HU3A 1DTEA 3LT1A 1LLQA 3PQ2A 3AU9A 1KAEA 4AUNA 3BWYA 1UBEA 5E1DA 3PXDA 2HP3A 3WXBA 2QQGA 5FOQA 4YXWD 2Q1TA 4B3RO 2UXNA 1BEZA 5C9ZA 4XPIA 2CH7B 1R6AA 1EP9A 4KSBA 4PU0A 4FDAA 2O0JA 4F6EA 4NMLA 5ERGB 4HB3A 1UBRS 1A4IA 4DIEA 1LB1B 1VHAA 2PMKA 2QTWB 2X0KA 3OVMA 5CPFA 4C4YA 3JAWA 3QWIA 1SUSA 1EGQA 2FZGA 3THWB 3B1VA 3OE5A 4JJKA 5U1PA 1KI7A 3SEFA 2HFEC 3DXYA 4L5CA 1L4MA 5ALIA 5JJLA 4YRCA 4MS1A 1WDLA 1GZ6A 2Z5VA 4QVGA 5IYBO 5JAQA 2I2DA 3AFHA 3CC4F 2NXNA 5FL3A 4M6WB 4G1MB 2PUCA 3ME5A 5LQMA 1NF3A 3OX1A 5H70A 2H65A 1YONA 1PR1A 1XV2A 1Q3EA 2ZUUA 1Y37A 4OX9B 2NO9A 2HIGA 5T67A 2QLFA 1LC3A 1Y6JA 1PR5A 4A10A 3PR2B 1L5RA 3CRRA 1E2HA 3VKWA 1IVSA 1RKUA 1LF5A 4MWDA 3GF4A 1Y63A 5A3QA 1XMQO 3T99A 3CCUV 2H1SA 4I3HA 5LM3A 5FPRA 4GI5A 5GPBA 1XREA 1VBMA 2QW1A 4RIIA 3WQBA 2A3QA 1RLMA 3DFUA 2GCGA 2D4HA 4PFQA 3D7LA 2WM8A 1FXSA 2VWGA 1QTRA 2H4ZA 3NI2A 3U3RA 5LYJB 1EP3B 3H01A 3JRNA 3L8GA 1N4AA 2O7RA 3K9FC 5KTNA 4N7RA 5DGXA 1XJQA 2OIEA 4XRRA 3LYHA 1ULBA 2RGNC 3K2EA 1C3XA 4GZMA 1A9ZA 4HBNA 3KDAA 4GOND 2KQUA 1XTBA 1HL7A 1TLTA 1OZHA 4HRAA 1Y3IA 3OU6A 5B7QA 1R7RA 4IDBA 3P2MA 1R0RE 2YIDA 3O4HA 4QYIB 3OPVA 5CYFA 2FW6A 3KP1A 3CA8A 5TQ0B 5HVNA 4W5TA 5LMUB 2WUFA 3GB9A 4D9MA 4H60A 3A6JA 3CPSA 4ZYYA 3GEEA 2ZWAA 1XRJA 3C9RA 2XECA 3PTLA 4ABTA 1JYFA 2PUEA 4NCIA 1XYGA 9MHTA 2OHJA 4IGGA 3TW6A 1YQDA 2X6RA 2AKEA 2ZUWA 4P80A 1JFFB 3HKDA 3U1TA 4IUDS 2DY0A 4ARAA 4G67A 1Y3HA 4MQ6A 1GSAA 1OLOA 4TKLA 2ZJ5A 4JI7B 1NI4A 3I7TA 4H7JA 4ZANA 1Y5RA 2BKLA 3TG2A 4ITUA 2Q2VA 4BFLA 1VCHA 1VGRA 5IDWA 3AKZA 4FGKA 3CLRD 5JT1A 3THYB 1QK5A 4R9NA 1QVWA 2RGGA 1Q1BA 1Q0TA 2BGWA 1YXBA 4OIMA 3DG9A 3QTYA 1ND6A 3L82B 3HXTA 3VPHA 4D81A 3S7ZA 2YHAA 1ZD5A 1PEKE 2VQEO 3AG3C 2FZEA 4DDWA 2HA2A 4EYQA 1GG2A 1X52A 1O95D 4X63A 4H0NA 3BOSA 3PR3A 5FBKA 5HCIA 2D5CA 3PX2A 4FFOA 1BCSB 1AKEA 4PNPA 1BXZA 4KWCA 4LJSA 4RCVA 2NV6A 3MSXA 4QTYA 1LDYA 1C81A 3MWDB 2UXBO 4JVOA 3D0QA 2M2IA 1OGIA 2W6QA 4RAQA 1PWEA 1K8QA 4PYLA 5CMUA 1A2BA 5DHFA 5BNWA 1ZJ5A 1FU4A 5ALJA 1QNLA 4C7UA 5FBRB 3IE0A 2JFPA 5DHQA 2AMFA 1QGYA 1Y1PA 3RYTC 1GEGA 4RIEA 3RHZA 4MO9A 3MOIA 2FSPA 2FLWA 4Z4HA 1H2LA 5IJXA 5IS2A 4Z0HO 2C2GA 5LC1A 4PHTA 2JVDA 3OMAB 3L8CA 4FOTA 3I05A 2Y1CA 3B8EA 3OO0A 3ZWXA 2H1RA 1CF9A 3WI7A 3BTOA 1IBMO 4BLPA 2XIQA 5IM4F 1Z4JA 4LXQA 2DFDA 3Q7TA 1QYIA 3R0IA 3UQ8A 2I8LA 1SXQA 3NYRA 4LXGA 3GJTA 2B21A 4KJXA 3E89A 1PNOA 2X9VA 3N59A 3PLNA 3QUCA 2C2XA 4LX8A 5AH0A 3CC8A 1WPQA 4FLXA 2VSYA 5EKTA 4GXNA 2VJBA 1HDRA 2ECFA 4HEHA 5JC1A 1GU1A 2UZ4A 4E51A 4MI3A 1Q12A 3OF3A 1JFSA 4G0PA 4BUJA 1IONA 3CM0A 4HEA6 1P9OA 8OHMA 3J81k 3WK5A 3OJOA 4UD2A 1KGSA 4MIOA 2ZI7A 1NMXA 4DR5O 5A4FS 5HP8A 2I2AA 3I0NA 3EGDB 3KJJA 3UWPA 3RUHA 1RP1A 3KJZA 3DZKA 1C3LA 1HYQA 1XLTC 2XGGA 5KTRA 1ZR4A 1UDCA 2QMZA 1Q7RA 3B3AA 2GWRA 1HNZB 1E77A 1EUZA 4YJHA 4EFMA 3AL2A 1N9GB 1T8PA 1JG6A 2VPXA 3ROEA 1ZNWA 3CEAA 4HWPA 3M49A 1LWNA 2NX2A 1XU9A 4FNOA 3GLGB 3ICVA 3RSGA 3ZWKA 3RIMA 3GBPA 4DJEC 2WPDA 2EGGA 1QBZA 5LOVF 2XJ9A 1QQ6A 1VQ4F 1XBTA 4M1TA 821PA 4LE1A 4KE8A 3ASYA 2AZ4A 4QQFA 4WXRA 4OH1A 1YJ9F 2I7DA 3TL2A 5DM70 2RAVA 4KVAA 3F0TA 3Q0EA 5TMPA 4OYRA 1RM5A 1LPNA 3S40A 1V9LA 4LA4A 2XUPA 3V80A 1KK3A 2WLKA 1B8PA 2G4VA 1LPAB 3D0RA 5F2OA 3MD9A 3CWZA 3C3JA 3AVXA 2ILMA 1U8CB 2NN4A 2I80A 3MNFA 3H1TA 1U2DA 3CF0A 4B3MO 4NPAA 4HI0E 3KXIA 4B4OA 3BRCA 2EV9A 1KNQA 2EOAA 4E33A 5KAPA 4FHDA 2VPWA 3KLOA 2C7RA 3F6RA 4OHRA 2A06H 1Z0IA 4NE2A 1GZDA 2WA1A 3CZMA 5M5BA 1GNPA 4OO3A 3G49A 4JQZA 4RVNA 1X9IA 1PGQA 1GM9A 1L5ZA 1NYRA 1GYRA 2Z9BA 2VBGA 3SEZA 5G1OA 3UKOA 3MBOA 3AG1C 1ODFA 4QARA 3W8NA 1ML4A 2JLYA 3FYHA 2WKWA 1YOVA 3K5PA 1BZKA 1KWKA 4LRYA 4XDGA 1FUKA 1ILEA 5TQ2B 4AYXA 1WB4A 3ZHBA 4QAJA 3X1DA 4BB9A 2WKPA 4WN3A 1OI3A 1M1ZA 3V6MA 1E6EA 1R18A 4S0XA 5KKCA 4TRNA 3C7TA 1LJ8A 2FG5A 2JIQA 3AEXA 6CHYA 2PWAA 3VYUB 4DLSA 3ZHYA 3O83A 1E2KA 4K7JA 2QP4A 4Z99A 1CP9A 4ODIA 4WL0A 5K0GA 4F5WA 2GNOA 3P7MA 5FT9A 3GIWA 1YAJA 4PXAA 1J0CA 1N36B 1AURA 5IH7A 1C7EA 4I0XA 1JSLA 4P3OA 2O7NA 2NG1A 3RT3C 5E38A 4YR9A 1H8ED 4OXKA 3K8OE 1L0LH 4F5EA 1L4GA 1R8JA 1VLMA 3R9KA 5AW4A 4Q18A 1P73A 4B79A 4KFTA 4X65O 3CXUA 1O5IA 2QENA 2WJGA 4AIIA 5J9FA 3CQ9A 2ZIVB 3PCXA 4RSMA 4HYTA 5EUQB 1FX0B 3MXTA 1J70A 3TE7A 2ZM5A 4FZ1A 4INOA 2HYDA 3NAQA 1DL5A 3VH1A 2XT0A 1A96A 3BXEA 2W71A 3N2KB 4L57A 3ML0A 1FYEA 5DLPA 2GHQA 4JXKA 1XA4A 5CB4A 2DYYA 2G8NA 4Q9DA 1P8AA 3G2QA 2ZIOA 2BOVA 2P3QA 1WB9A 5J2UF 1H5UA 2FZ4A 1T24A 4YO8A 2C4WA 3F3MA 2FWMX 1JFRA 2BHNA 4KQGA 3DMHA 3M2PA 5AD1A 5B55A 1UEIA 4BX0A 1N78A 1VF6C 4MVJG 1EWYA 2R8OA 4QDOA 2GTPA 4MDFA 3A36A 3VO9A 4M0CA 3HCRA 2A1UA 4HDMB 2VS0A 1FJXA 1RRVA 4CU5A 2PH7A 2G1KA 3EZXA 2XDAA 3PD7A 5IWAB 5CDYA 2J32A 2QVBA 5A1TA 2C83A 1L7OA 3ENZA 1YVPA 4JLPA 2HD4A 3DEZA 1GXSB 2R7LA 3CH6A 1TO1E 1F2TA 2DY1A 2CXOA 1FU8A 5LU9A 4HMQA 4JD5A 4TTIA 2BMVA 2V0NA 1JEAA 2BUAA 1T9GR 4TMFA 4M76B 1CQPA 1R00A 1MKYA 3D4LA 4F4FA 5IY5C 3KKPA 1JG4A 3KAPA 3VHXB 4CBCA 2IXDA 3KPJA 5IBQA 4DRYA 3ZR4B 2XCSB 1U8XX 1R4MB 4DA9A 4IEEA 4G5SA 1OIVA 1L1FA 4NZ9A 4MT8A 5EK0A 5CVJA 2Z8YA 1X7OA 2VNIA 4KR7A 1JSRA 1XFAA 4RNCA 2WLSA 1YR1A 1ZVQA 3ESCA 1PL4A 2WVJA 5EERA 2UYOA 1ADBA 1RCTE 3SAJA 4AB1A 1OAOA 3DEYX 2WJAA 5L3GA 2H1IA 1SVWA 5KNBD 1RWNA 1XAJA 4WZAB 1GEEA 4Z4IA 4MWTA 2Q1YA 5HM6A 4FHGA 4NWIA 4MRRA 1D6NA 1UMBB 4IO0A 1P5ZB 4CLDA 5T41A 3L8EA 3N7TA 4QJ5A 4DV6B 2ZU6A 5B3KA 1EJ6A 1B41A 2ZT8A 3TLXA 3ZV6A 5LMCA 3ND9A 1YRAA 5D6NA 4OSPA 3K32A 1DX9A 5HKAA 2DGDA 2R9RB 3OUTA 2WWVD 1H6AA 1VQLV 1UMCB 3VR3A 4J11A 3C6BA 4NULA 2OWEA 3BWDD 1OC2A 3HAXD 1H47A 3G7UA 5E3JA 5FQNA 2ZVPX 4PS1A 1ENYA 3UMBA 2DUJA 1HL3A 2ZCUA 3IQXA 1GADO 4DREA 3VSEA 3QKRA 2C9YA 4FLVA 2CKMA 2YJZA 3CLUC 1P74A 4G4SP 1G6UA 4ZAGA 1EVJA 5HJ2A 3GU3A 3TZEA 3P0RA 4N3GA 1VRWA 2N42A 2ZRKA 2E4ZA 1I0ZA 4PO8A 1A2QA 3H2KA 4D8WA 3E20B 2C2BA 2C9BA 3UOWA 4DR4O 4UM9B 2MMGA 1CFJA 2HW8A 4KX3A 2EKZA 5AKGA 4RZUA 4OXXA 1H5NA 5JSYA 5K3AA 1FMJA 2C0PA 4D57A 4EVQA 1SKQA 2C3OA 4BNVA 3B4SA 1O95C 1KMHA 1TVEA 1LLFA 2BC9A 3TD3A 5TT1A 1Y3DE 5LZ7A 4ERXA 1YOBA 1SEPA 1Q21A 1ZWKA 3VVMA 3EN0A 1DQZA 5JS8A 2QUJA 4EMTA 3LQ4A 1VSVA 1T4DA 4K8OA 4ZVMA 3Q3CA 4LDNA 2LE0A 2WB4A 1P6UA 4RZXA 4MVJP 2GETA 1XEQA 1FSFA 5IAAA 1UM9A 1BE8A 4B3BA 3FD6A 1TIBA 4HUQB 1ZONA 3K94A 4L8JA 1N5LA 2QAGC 1N8KA 2V5AA 4AKIA 3IHTA 2HAEA 5F98A 1ZHFA 5HIIA 4RSGA 4P7GA 5CFQA 4OQPA 1EHYA 3EZ9A 4WN9A 4UCRA 3FKQA 4YV2A 5TS3A 4NENB 2CEKA 1ZZEA 2QMEA 1ZBQA 1J4AA 2HGZA 5D7NA 4TRMA 3NM6B 4EG8A 2V9YA 2IUYA 4FR0A 2DYRC 4J4BA 1U99A 1N2IA 4G9BA 4J0HA 1E61A 4CEHA 1N3LA 4QG7A 3ZHSA 2H8KA 1LNQA 1CUXA 3E5HA 3QOYA 1ZW6A 5IAOA 2CNBA 1U0NA 5KJFA 2H8EA 3H65A 4X95A 1NT2B 3U3MA 4KH0A 4CJXA 3FOBA 2C82A 1A76A 4GLXA 1S2LA 1RIIA 1JLMA 3SN6A 4MR7B 4R8LA 5AVVA 4HG2A 3VO1A 2ID7A 1ZXXA 1K8ZB 5CCDA 2EVWX 1NOKA 2YS8A 2CMFA 5KQMA 2RCYA 1X14A 1DGQA 1VG8A 1N7HA 4N1AA 4QGAA 3CZQA 3GA7A 1E98A 2ZW9A 1BDHA 4IYIA 3ICEA 4G5XA 5KOJA 3HZZA 4IZOA 2EATA 1BU8A 1GKYA 4QXMA 1UDWA 1N6OA 3ZWNA 3JCZA 4PFJA 2QJFA 2HOQA 3E7WA 3ELYA 4L7VA 5KNLA 4C7XA 1S2GA 1QVRA 3G1TA 4YUZA 4XCQA 1VE5A 3IP7A 1NOIA 1XDZA 1ORWA 2FPIB 2P4UA 3WLNA 1F6BA 1Y67A 1KD1H 3QE0A 3RVPA 3FWKA 3CCMF 1AI6A 2YIMA 4BX8A 3D7RA 1O77A 3D6FA 3G80A 2NO7A 4BV3A 3AIKA 4OFZA 2C2YA 2AXNA 4DM7A 2V3WA 2F9FA 2FEOA 3RG2A 1S5LZ 4CT4B 1G4AE 1ABEA 1IZ0A 1ADFA 4RD1A 5LYYA 1R0ZA 3L0YA 3LT2A 1I01A 4KR3A 5H4GA 2BP7A 1KQGA 4Y1EA 3TLYA 3Q5GA 1UBOS 5F7JA 2BGJA 1H2MA 3BULA 4DDKA 1N3BA 3ASUA 4DV4O 1G6KA 4CKBB 3IPRA 1YUBA 4CBVA 3KC2A 3MT9A 4DWJA 1O54A 2J07A 3G2LA 4J3FA 2N48A 5JZMA 5F76A 2RAUA 3NTUA 5LB2A 1IXMA 3U7FB 1WB6A 4UEWA 3LPNA 1XI2A 2Z1DA 4CC5A 2H92A 2RARA 1RJDA 1KR5A 3QHDA 4NABA 3ESDA 3ZNQA 5ALOA 1CVRA 4CL3A 4D92A 1E1CA 1HE2A 1K7EB 2FDCA 1QZ3A 2CYBA 4YFVA 1BRMA 3MRVA 2P4QA 1K9MH 2UVQA 4H7KA 1N8TA 4B3GA 5L3BA 2PUAA 1SXJA 4FSXA 4YRDA 2HRRA 4DGSA 3WP0A 4FFWA 4TWAA 2FC3A 3RIGA 5IUNC 2JJYA 6NULA 1PJ2A 2CDRA 4DJTA 2XVYA 3FPLA 3H5IA 2W2VA 3GUYA 2BMJA 4MR9A 4AYWA 4FNMA 4PY2A 3DBRB 2CK3A 4LF7O 1PJRA 4E13A 5HHTA 5A6SA 1KI6A 2G36A 2CHEA 2Q0QA 2AEFA 1V3QE 2RBGA 1ZMOA 4FYWA 3KUDA 3ZTYA 4D4JA 2YXHA 1WQ4A 1E3DA 3DZHA 3DT8A 5EG5A 5JU6A 4DNQA 4IDOA 2QJOA 4CM1A 2IC5A 1G20E 4KWEA 4MLPA 4ROTA 1WVMA 3CCLV 1BDIA 4XZ3A 1PJ8A 4NG5A 1P6XA 4G8CA 3UJBA 3W6ZA 2IM9A 3RS2A 3MSCA 1NYQA 1GITA 3PUHA 2V7BA 1YBMA 4EPTA 3VUFA 3SM9A 4KSCA 3IERA 1RAGA 4C4WC 1KI3A 4A5SA 3FPCA 1T1GA 4BQQA 1JPXA 1SIUA 2C78A 3GMTA 4IRMA 1C1XA 1UAYA 3HN6A 4TV8A 3GHZA 1SCDA 3PDJA 4CW7A 4WLFA 2IEZA 3O74A 4N5LA 4AI8A 1IQUA 1A97A 1ODEA 2F7SA 4C5AA 1DIOB 1Y7HA 4YRLA 4NV1A 4RVFA 2ZTUA 2HEIA 3P4XA 5EO3A 1I5RA 2GBPA 1WQ3A 4JU9A 2NP6A 4FLYA 1EB9A 4RH1A 5JRDS 2FPKA 3FKJA 1HDJA 3H8JA 2NLJC 1X1CA 2NU9A 4FZRA 4IHAA 5B58T 1CHNA 4WK6A 3I9JA 2PI4A 3O31A 2EZUA 5K99A 5IYDO 3FFQA 2JGIA 1QUEA 1VKZA 2CDNA 3UFBA 4ZT4A 3BWXA 2WFLB 421PA 3V7QA 1PDOA 3EC7A 1Q7YW 3L02A 4Z49A 4DADA 2PSHA 2G40A 4CF6A 1AJQA 2YWFA 4OBBA 1MO6A 1CXZB 4UVAA 5LNK1 1YJ8A 1NYTA 2GEFA 3AGPA 2QI2A 5CXXA 1USIA 4MRPA 3PLAC 4Y8VA 3U7IA 3HUDA 1GJRA 4RAIA 2PUJA 4NZPA 4EJSB 5SZKB 1RSOB 3CYOA 4K3UA 1E18A 2ZCEA 5ALHA 4JJ8A 5EJ4A 3GLSA 5JS2A 4BASA 1V5FA 4DY6A 3TD6A 4RS4A 3GK3A 1GG5A 1GX1A 1O5TA 2ZRQA 1GNRA 4QOJA 2QZ9A 3ZCVA 2XXAA 1UODA 4CETA 2PXCA 1R1BA 3ZCTA 3KJFA 4B2IA 1B74A 3FVVA 4Q05A 4J2TA 2GT1A 1LCIA 4TMTA 5SY6A 3F1KA 4EEKA 2AW9A 2CXPA 3KHKA 2YYAA 2YXBA 2QEXV 1ISFA 4YK7A 5B64A 5CA0F 2R00A 3J7TA 3H5NA 3CUWA 5LBUA 1CUIA 2I6XA 1TM1E 5KSOA 1R88A 4BW5A 3GOHA 1ZIYA 4QJBA 2O8CB 4C0LA 4IO1A 2VJMB 3V00A 2EBWA 2VZ8A 3PF8A 2X2EA 4BO3A 2IJGX 5CA1B 1Q7GA 4E30A 3CUSA 3K2QA 3GB7C 1YC5A 4URUR 4EP1A 1CU1A 4M83A 2WIDA 1NDUA 1H9AA 4AKTA 2J0UA 3U13A 4I4TB 4RSRA 1TYCA 4UCWA 2QL7A 2ZJ6A 2A78A 4YREA 4ERHA 4DJ5X 2I7VA 2DR3A 2CJWB 4JEUA 3F6MA 2JH3A 3R66A 3M6MD 4Q4AA 3JATA 1YL6A 4X66O 3EIUA 4IV8A 5D01A 2AS0A 4GOLD 4WQMA 4N9QA 5J9PC 1YZLA 5T6BA 2GBIA 2KB0A 1A4UA 3ZWAA 2UYQA 1GYQA 1F23A 2E49A 1L4LA 3AESB 4UTVA 1NURA 1Q15A 1XNHA 3OF2A 1I4WA 3PYXA 4BAYA 2DSNA 2WHQA 2GYVA 4JB8A 4CQMA 2VG8A 2HRQA 3TDMA 4DHWA 4X20B 1JHVA 4AF7A 3SJCC 4IDPA 5A0VA 3LQFA 1XMJA 3L0CA 4P4GA 4C03A 2RD2A 3U3DA 4ND8A 1YRWA 4DV0O 2J3IA 3GLFB 1HE8B 4LYAA 1OYVA 3JYCA 1OZFA 5LQJA 4GYYA 3H9EO 1YBHA 3WMXA 1RPZA 1VFNA 5ADVA 1MOFA 5C37A 5JDCA 3KJHA 1E8NA 1UI9A 2BBTA 3ZZMA 4EFKA 3ZY3A 2PPVA 5FF9A 4G8JA 4NZMA 3L1HA 3ZDAA 3LNTA 5NULA 4X1YB 1YB2A 4TROA 5JNLA 1TQ2A 1W2BF 1Z74A 3LH5A 1ZSNA 4HDNB 1W34A 2H54A 4UHHA 4DMHA 3ROTA 3TIFA 3QUBA 5ALNA 1UJBA 2QM3A 3BFJA 4DCNA 3PZRA 3K03A 2A9RA 4IGAA 4P9NA 1E5QA 1KMCA 1RABA 3EIOA 1NATA 4PZAA 3K96A 1OCRB 1KJWA 3EEQA 4LKRA 1M7HA 3RSCA 4DG9A 3NMUC 2Z5LA 4A91A 5JS6A 1GTMA 2HSGA 5DXAA 4CCAA 5ARCA 4QFMA 1X92A 3LYBA 5L45A 3IAHA 1J5EO 1E3MA