5LOVB

Dz-2384 tubulin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
417
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The synthetic diazonamide DZ-2384 has distinct effects on microtubule curvature and dynamics without neurotoxicity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 417
sequence length 426
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lovB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lovB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lovB01
4O4JB 5JH7B 2RHOA 2XKBA 5EYPA 4TV8A 3RYCB 3JALA 3RYFA 1FSZA 4YJ2B 5J2UA 4ZHQA 3JATB 5FNVB 3ZBPA 4EI9A 3M8KA 4EI8A 1W581 4IIJA 1W5BA 5MN4A 3ZBQA 1TVKB 4O4LB 3V3TA 1FFXA 4X1KA 3M89A 3HKCA 5IYZB 5CA1A 4I55B 5KX5A 4LNUB 3WGKA 4M8IA 5MN5A 4O4JA 4ZI7A 5JH7A 4B46A 5JQGB 4B45A 3JAKB 4O2BA 4TUYA 4F6RB 2Q1YA 4X20A 4O4HB 5J2TB 3VO9A 5IJ9A 5JCOC 1SA0A 4O4IB 4EI7A 3E22B 5BMVA 4LNUA 4YJ3B 4ZOLA 4U39A 5KX5B 5MN6A 3ZIDA 4O4LA 1FFXB 4X1KB 2R6R1 1SA0B 4O4IA 3RYIA 2XKAA 3JATA 1JFFA 5FNVA 3VOBA 4XCQA 1W5FA 4ZI7B 1RLUA 3VO8A 3HKBA 2R751 2GVIA 3N2KB 2BTQB 5IJ0B 3RYCA 3RYFB 4EB6B 1W5EA 3E22A 5LP6B 1Z5VA 2VAMA 5JCOA 5JQGA 4O2AB 4TUYB 4O2BB 4I50B 4HNAB 4FFBB 3UT5A 2VXYA 4EB6A 3RYHB 5CA1B 5GONB 4U3JB 5BMVB 4X1YA 4IHJA 5CA0A 3HKBB 5ITZB 4O2AA 4I50A 3JAKA 3UT5B 4F6RA 4O4HA 3RYIB 5IJ9B 2Q1XA 4I4TA 1RQ2A 3JASA 3WGJA 1Z5WA 3N2GA 4X1YB 4YJ3A 4IHJB 5CA0B 1W59A 5EZYA 5EYPB 3HKDA 3CB2A 3N2KA 4WBNB 4FFBA 4HNAA 3HKEB 1OFUA 4I4TB 3JAWB 3JARA 5C8YA 3JASB 5LXTA 5LP6A 1W5AA 5KMGB 3VPAA 5JVDB 5ITZA 3HKDB 5LOVB 4WBNA 4TV8B 1TUBA 3HKEA 3JALB 2BTQA 5IJ0A 3RB8A 4YJ2A 3WGMA 3HKCB 5EIBD 5IYZA 3RYHA 4TV9B 1RQ7A 5LA6A 4DRXA 5M7EA 3N2GB 2RHLA 4IIJB 5KMGA 5JVDA 4DXDA 4X20B 5J2TA 5CB4A 4E6EA 5EIBC 5LYJB 3JAWA 3JARB 5J2UB 4TV9A 5C8YB 4ZHQB 5LA6B 4DRXB 5GONA 2VAPA 2RHHA 4U3JA 4ZOLB 4X1IA 5EZYB 2VAWA 3C8LA 3WGNA 5LOVA 1TVKA 1TUBB 2RHJA 5CB4B 3VOAA 5LYJA 5LP6C 3R4VA 3WGLA 1JFFB 4KWEA 5LXTB 4I55A 2BTOA 4X1IB
chains in the Genus database with same CATH superfamily
1JHUA 1BVRA 1P0QA 1Z17A 4KR6A 2FGJA 4NCNA 3BHIA 1Q3KA 2XUPA 2X4GA 4CHGA 3C3JA 3GLQA 3CTMA 1XMIA 2QEXV 4DARA 4OXRA 3CPHA 3D4BA 3E9ZA 1Z8FA 5FADA 4HDQB 4YPFA 1W7AA 3T99A 2LGWA 1FDUA 1PHRA 1UZAA 4PX9A 3ELCA 3IVCA 1JU4A 2AC4A 1NF2A 1M74A 3LUAA 4ZODA 3ZEAA 1UFRA 4CKZA 1JF8A 4ZAZA 5AVWA 3F96A 1RI3A 3QHPA 1NUHA 1VP9A 4MV7A 4OH7A 3M49A 5J5VA 3WGUA 3FSJX 4RVDA 3RG2A 4DUGD 3CVXA 3L79A 4J7JA 1TAHA 3K9WA 3VQXA 2O3TA 2OEPA 4AY2A 4X20A 1ZHHA 4MZXA 4R8LA 5LU9A 1XWIA 1YV9A 2PU7A 4AYXA 3EVDA 3F71A 2R9AA 1LBSA 1JR3E 2GM4A 2I7CA 3WGGA 1V9LA 1XLUA 1H2BA 1Y33E 1KYQA 1FDTA 3UZUA 5F7OA 5PGMA 1R8SA 5DASA 5TVGA 3QXCA 3ZQ6A 4A1FA 3KWFA 3BGWA 2WDPA 3A4VA 3DEIA 2XJ4A 4QG7A 4WK6A 1Q20A 5D7NA 2QJFA 3UFXB 2PSSA 5EJAA 5IPFA 1L4HA 4ESVA 4IYIA 5LHHA 1MG5A 3I62A 1PR9A 4YCSA 1BMFG 4PLYA 3WK4A 4FMPA 1C14A 1P0CA 5ARDA 2GNPA 1T6BY 4G0ZA 4UHKA 4CC5A 1PF7E 4ZVOA 1YR7A 4BIUA 2XVAA 3WE7A 1T0IA 4AJNA 3RG8A 5IRCD 4RANA 2BISA 2W2LD 4J03A 5LA6F 1KP3A 3GN2A 1J23A 4FOSA 4ZHYB 2FQWA 4AJHA 3L6CA 4K6HA 4ADSG 1X7XA 1C0EA 5FOSA 1SXJB 1XNRB 1D2HA 1Z39A 1VHDA 3EPLA 4YAUA 5I7AA 3GJSA 1HTTA 4LF7O 1JPJA 3AG6A 5C7OO 2RKWA 3H5TA 3KFLA 1UDAA 4MUMA 3U1TA 3WIDA 2RD2A 1JYFA 3ABRB 2CXOA 5DTIA 5TXGA 1RQ2A 3IOEA 2AKEA 1CK2A 2LCIA 2O9JA 5T5QA 1ZUQA 1QG2A 4B3CA 4WINA 3BD6A 3OJFA 4RXTA 2O52A 1JQDA 3EJ6A 1G1MA 1FP6A 1XQWA 1B00A 1F6DA 3T5GA 1M90W 3DVLA 5J23A 1VHJA 1ZPDA 4KLAA 2GA9A 5BQPA 2B4RO 1GNVA 2NUTA 4XD2A 2ORED 1NYRA 4MDYA 1Y3FE 3S2ZA 4DHWA 5CT8A 4HDNA 4C08A 2UXBB 1OFHA 4LFCB 2BL4A 3MRTA 1E3SA 5EIAA 2O7SA 5JJEB 4ZVLA 2JVDA 4I6EA 4GOOD 3SKYA 4KRGA 3AC0A 3X2EA 4DYDA 2IE0A 4GOKA 3OOHA 3S8EA 3F7OA 2RHGB 1ODIA 3OX2A 4PSCA 2ICAA 4ZO8A 2AOUA 1AZSC 1T4MA 3ZGLA 3WP0A 3AP2A 1S8FA 1Z73A 1QD9A 1CJCA 1W5TA 1YDFA 3LGAA 3O92A 1NHWA 3PC3A 4OGGA 5CDTA 5IUNC 1GTSA 3DZBA 3BB3A 1E0KA 2Q5IA 5JBNA 1WUYA 1XF1A 2G7MC 2ID7A 3FGZA 4N6GA 3OSZA 4LJ4A 3OTOB 4K9SA 4Y2PA 4EGQA 2WEKA 3LOUA 4TWRA 4YC7A 3ZDYB 3S3XA 1JOYA 2WLSA 4CT5A 4KWHA 2FA9A 3G4SV 3SF8B 3T7TA 3CEAA 1H7MA 1H0RA 2NPIA 4QC2A 1U2QA 3WYGA 4B4KA 4BC0A 1YR8A 3RUEA 4CKCA 3INNA 1NY6A 2YBEA 1QCEA 3GK3A 4TYPA 3C43A 4G97A 2GHYA 4G4WA 3IQXA 4IIJF 4MW0A 5AKKA 3RVOA 3CUVA 5UKDA 2DLDA 4IDNA 5HF8A 4JDUA 1SQSA 2C95A 3ETHA 3ZWPA 3ISVA 2Q1UA 3NTLA 5BYKA 4NP6A 3BF8A 3U7JA 3HYLA 2BWJA 3CF2A 2YJZA 1HA3A 3U81A 2OCGA 3U7QB 2DM6A 3SFTA 2XITA 3MOIA 1GPNA 3GD7A 1WU8A 1QHYA 3O73A 5DBFA 4EK9A 5FWDA 3KBOA 4JH0A 1QIHA 5B30A 3O85A 2GO7A 5FLXA 3DYIA 2IOYA 5A2QM 1YITF 1KGSA 1UXKA 4UVGA 3TO5A 3ZTWA 4S12A 2HJVA 3T9BA 4EECA 3HCOA 3ENVA 2VDOB 3QXJA 2R7NA 1F5NA 1TE2A 1QLJA 4Z4GA 3ETLA 2VRCD 3W7VA 3DGEC 3O3MB 1KB9F 1HYHA 1X1EA 2QN6A 3VRHA 1KBZA 2JFZA 2BEWB 1PLLA 4R01A 4JQYA 5JPDA 4B8ZA 4DW1A 3L7KA 2G63A 1YAJA 1WV0A 1KU0A 3DO6A 3QTBA 4EJSB 2GFQA 1P80A 3SZMA 5JZOA 3P1JA 2GSWA 4OQXA 4DCTA 1REQA 1P72A 1W5EA 4FYIA 4DEXA 5GIPE 2A84A 1J8QA 1VQLF 4JJKA 5IHPA 3LP5A 1M2VA 2Y1DA 3M5PA 2EXXA 3PCRB 4PRLA 4BFUA 3EOZA 3SE7A 1NH2B 1ABBA 2HIHA 5A3JA 1FF9A 3EORA 2DJ5A 2YJTD 2O7VA 1WDTA 5EJEA 5JHGB 2PZFA 4RYDA 4CG2A 4EVSA 4US0R 1Z88A 2IHBA 1Z4KA 3RT7A 1OOEA 4ZIRA 1IN5A 4X94A 3EEFA 4MI1A 1PEYA 4MMXB 4DA0A 3SQDA 3V2IA 5L95A 4O4HA 4RV4A 1K8ZB 1H8ED 1WD7A 2X0NA 3AZQA 3TEFA 4Z9AA 2XYGA 3CW8X 4DA9A 5ELMA 1JDSA 3LLSA 1DAIA 4F2GA 1YR2A 1VG0B 3KSMA 5HQ3A 3FKSG 1KQFA 1GGEA 1SURA 2HQOA 2YRFA 3IUJA 3AWIA 4TYNA 2KHZA 3TBHA 1EXVA 1DDGA 2ITCC 4PLTA 3TFQA 3VR5D 1Q7BA 3D81A 4LF6B 2RIRA 2ZSFA 4DMKA 3DBHA 3AVVA 2YI8A 4PR3A 1RD4A 3S06A 3W06A 2ZITA 2CNBA 1JFLA 1I13A 3KIPA 2NM0A 4EO4A 2J9FA 3W9UA 4OJNA 4TKZA 3T9DA 1ZRSA 3EZ9A 4ZK7A 4ZT2A 2Z9DA 4EJ6A 4US2R 2IP4A 1ZQ1A 3HRIA 3R5XA 4HTFA 3ZK8A 1Z0UA 3K2BA 4EUNA 3GYQA 1I2MA 1Q21A 1KEVA 1IHXA 2Q6TA 5CB4A 1N32B 4E6EA 1Z47A 3N6VA 3QW4B 3T7JA 4CNQA 1SVSA 3L0OA 3IR7A 3VI6A 1BDJA 2I6GA 4DXWA 3KWLA 4B0OA 2IPNA 1RW4A 3PP8A 1YZTA 2HVKC 3KJHA 4J0FA 5SICE 4CMEA 4Z6KA 5JNWA 4ND8A 1A8SA 2C97A 2HS0A 5CB4B 4OXQA 2AEFA 1UFQA 3PXBA 4I9WA 4QNHB 4LIPD 4RACA 3A27A 2FLKA 3LYHA 4DY4A 3P27A 3CIFA 5MDHA 1BE1A 2MT9A 2ANBA 3HBMA 1HGXA 2XKBA 1SXJC 4B2PA 1QPZA 3IUQA 2V59A 5C5DA 4YJ2B 4UFNA 5LQCA 4HH0A 2EBWA 2FCRA 4QRDA 3K1YA 2PQ0A 1ISGA 1LW7A 4F85A 4CG0A 5BPFA 1KE2A 5JBQA 4INZA 4LGVA 4B5CA 5KO2A 1VEWA 1PWHA 1EVIA 3BFRA 2CHGA 1EM6A 5JJJB 2NZYA 2P6PA 2F3PA 1N2CB 2PA3A 2Z5FA 3BWBA 3M7IA 4QECA 5GZ6A 2Z30A 5K0FA 5L9AA 4EHNA 3VU1A 3DFUA 4TUYA 1X59A 4Z1VA 1E9BA 3KYCA 4QQKA 2XGOA 3IEMA 4B73A 3C3KA 3GAFA 4HXYA 2K4MA 2BKVA 3E3AA 2FQ1A 1ZCFA 3STLC 1YB4A 1L7NA 3B7PA 3QKIA 4DEVA 5EMKA 2WYVA 3DV9A 5LQKA 3TGUH 3AUUA 1A32A 1TQ8A 2X0KA 2XLBA 3M6IA 2C2ZA 4JROA 4ZTUB 2N1MA 2PH1A 1YI2V 2QWXA 1O8BA 3KOMA 4IWNA 2Q73A 4K9LA 5LYYA 2B2NA 2B9VA 4WOJA 5TPWB 4ZJUA 5DNWA 3V97A 1V95A 1Y3HA 2XGJA 4GZRB 3BMOA 2FUCA 2PM8A 2OXTA 1W44A 4K1LA 2W6IG 4LFBB 1B42A 2OK7A 2QB5A 2VA8A 4G65A 3V9PA 4N1AA 3Q7TA 3ZWAA 4F3RA 2W2XA 4I14A 3QKTA 4KDFA 2AR9A 5KJEA 3SNKA 3ZD8A 4L85A 1TZ2A 2QLJA 4OSOA 5JBIA 3K70D 4FNOA 1Q6IA 1YCDA 2O0KA 1IC6A 4RW0A 3G9UA 1XV2A 2OCLA 1TM7E 2P2NA 4Y7CA 4WOPA 4TM8A 5CNKA 4M7OA 2OC4A 1Y81A 3Q6MA 5LMCA 1X0VA 1X2EA 2EJRA 3JZDA 4O2AF 1I1OA 4I3HA 4YPOA 5BWBA 3L49A 4LY6A 2CD9A 3LE8A 3J7AC 2YIBA 1FXVA 4UUPA 3ZWDA 1B3BA 2Q5JA 1L6IA 2C96A 1D5NA 3RCBA 2JIZA 2ZUDA 3AOEC 4FILA 3KVRA 3TXSA 3LSYA 4DNOA 1IBKO 3ZKAA 1CRPA 4OBXA 3RF6A 3KJKA 1G1AA 2R97A 4BB0A 1VPWA 1OTYA 2ZE6A 5AKZA 4L74A 4RDXA 3H1KH 2D1SA 4BVHA 3OEED 5BSGA 4PHHA 3TCUA 1Z06A 3NEAA 4HH1A 5DHRA 3I42A 2VR1A 4HGPA 3COPA 3V46A 1GGFA 2FTKA 2C03A 1LQ2A 4JOBA 4MW3A 3G1WA 3MVEA 5D6OA 4ZAVA 5D1NA 3T4EA 4BLTA 2JLWA 4BX3A 1G4AE 4O4JF 3QW2A 4G4JA 1NN3A 1E9CA 3PV0A 1CE8B 3RU9A 1LBEA 2PG3A 4EQZA 3U16A 2ZXUA 1CP9A 2VGMA 3I0MA 1QU7A 4F6EA 1T0JB 3A2FA 2OZVA 5ALEA 5AM0A 5CCXA 3KD3A 1I7FA 2FQQA 3B1YA 3DFZA 4HAIA 5IF9A 2K2QB 1ZNXA 4R8SA 1YSCA 1DKPA 4NPCA 2BKLA 1LTKA 4J7XA 1OH6A 3NMUC 4BN5A 3AY6A 2JJ8A 2Q4DA 3RE3A 1HL7A 3PC7A 4J7CA 4E7OA 1YJXA 4HK4A 3I4FA 4IX1A 4OLAA 4NJMB 3TD5A 1ZK3A 5TRTA 4K26A 1MZFA 2RQ6A 3CC4V 5DXJA 4Y6GB 4DPKA 4A82A 5AUOB 3FI9A 2IV3A 5HR5A 2WNIA 4BFCA 3NHWA 4IRXA 2HADA 5AJVB 2FRDA 5DI3B 1X19A 2IZ5A 3BK2A 1ZA1A 3GEBA 2LIPA 1K8QA 5K2OA 5KUTA 1J9ZA 2C4VA 1IM2A 4TL8A 4EM6A 4LXIA 3FWZA 2YVAA 2EGHA 3HLYA 1RHKA 1FJGO 1NPTO 2OCAA 3IS3A 3PC8A 4E46A 1K8YB 3I6ZA 4OYLA 2SKCA 3H8VA 1PNQA 2GPAA 2YVLA 4JJFA 4EJSA 3QUTA 3NHBA 1GPUA 1YQ9A 1Z5GA 2F8MA 1T1GA 4RUFA 3EG5A 1YI0A 3K96A 1WLYA 4N49A 3DVQX 1EBOA 4UXJA 4HOYA 3H16A 4QXQA 5L40A 5ECGC 2XB4A 3D7NA 5AYVA 4YXWD 5FV4A 2UXCO 4Z1OA 2Q27A 2VK4A 2HLDD 2J8ZA 1E8MA 4CQLB 3IAAA 3SBDA 2G80A 4EMTA 5LIRA 2IXDA 3C1UA 4X92A 5CX1B 1ODJA 1FJHA 3HL4A 4QDZA 2H3EA 4AJ9A 1H93A 4HJXA 5D3MB 3HYCA 5FL7D 4J3FA 2LPMA 3AHJA 4Y9UA 3ZJVA 4ZOBA 2J5QA 1TRHA 3EGCA 1JSXA 1FZQA 1JN0A 2ZUCA 3CY6A 1QBZA 2F6RA 5EZYF 1LCIA 1ZGCA 1YR6A 2X7JA 1HDOA 2AHOA 3ZX4A 1LV7A 1YAHA 2WMYA 2ANCA 4LH6A 1OXXK 1WULS 1ZG3A 4FEYA 2FYUH 2CMHA 2GVIA 1N9ZA 2VSFA 3B38A 1RKVA 2FFHA 3BJRA 4GLFA 2VF8A 1GR1A 1I30A 1R9MA 1U8XX 1CS0B 1OWMA 5E2AA 1QVGU 4BB5A 1XJWA 2UXXA 3ROPA 1TJ3A 3O8QB 1JCHA 2CB9A 4GUNA 3ZVMA 2G88A 3DBHB 4RGYA 2JKYA 2PGDA 2E18A 2OUIA 4QICA 2YNMD 3ZMSA 2ZE8A 4A23A 2OGUA 1ADBA 1G60A 3JWJA 1POXA 1XAJA 1K5PA 3RC1A 1ZNWA 4HNTA 2DWPA 5CA1B 5KA6A 5TQ2A 3TPCA 3SR2C 2PYJA 2QTVB 3KJZA 4OY3A 4F45A 1EKXA 2BR4A 1OA1A 1N57A 3QI7A 4DM7A 1FNKA 1FDIA 2RI0A 1SHLA 4YS6A 4BLOA 3W5AA 5DI9A 3ZZTA 3P2EA 4ZTZB 4EUSA 4WLUA 2WJWA 4WFQA 4FX5A 1ZJYA 5EUQB 2CXPA 5FPTA 3ZP7A 2GF2A 2NV2B 4WZBA 3JASA 3RIHA 4M1OA 1YVPA 1F2DA 2O8FA 3DMHA 5FORA 2JCYA 4YQFA 2YEVA 1FOEB 2NVWA 4L02A 2PH7A 1YZLA 4K1XA 4TTJA 3D3WB 3OCZA 5CK5A 4DK1A 4JI6B 1E7KA 1G0NA 3O6VA 4UM7A 1GZ0A 1Y67A 4O0LA 4DSAA 2GR9A 2IZOA 2WOJA 3E9DA 4GU5A 4DLRA 1IH8A 1IV3A 2AS0A 4S1NA 3I55V 1JH8A 1FTSA 2WHXA 1QORA 4FT4A 1W96A 4UREA 2XT6A 4KWTA 3N2GB 1BDIA 3SZGA 2JEXA 1R8QA 1Z16A 2KQXA 3TD3A 1AK2A 1TJYA 1ZMRA 2GEDA 2DX7A 3M6LA 3ONDA 4JYCA 1OH8A 2R9VA 3CVUA 4N03A 4JI2B 3HN2A 1RRFA 4QXRA 2HRUA 4TSRA 5B2EA 2X1VA 3AL2A 3JVIA 1D9XA 3IR9A 1C4KA 1CX9B 1ZUHA 4O1HA 1GTZA 4Y2QA 3BAAA 1QG0A 1GY8A 3INTA 5C52B 2QLTA 4RQTA 3F9RA 3PNPA 3KV3O 1O77A 4FFSA 5FL7G 1UI9A 2VTKA 4EYKA 1BXKA 3SNHA 3O4HA 1V9SA 1MNAA 1VSUA 2B1GA 1Y6QA 3NB0A 4M0PA 4R98A 5BYBA 3VR5A 3N6RA 1Y5IA 3DE3X 4IXWA 4EG5A 2JIBA 1JG7A 1JT2A 2CK3D 2G08A 3PB3A 3FB8C 1ICIA 1YBAA 1ZONA 4PX5A 4QUIA 3RVZA 2YHIB 4R83A 4RCYA 4UMDA 3EHBB 3Q9LA 4NPHA 3TSWA 4EAQA 4IIJA 5I5GA 3CJRA 3O2SB 4WBNF 5ALXA 1U0BB 1YVUA 2X8AA 2PXHA 3VJLA 1GA1A 2VDUE 1QVFU 1E79G 1KF0A 3H6KA 2BF4A 4RDHA 5F76A 1LNZA 1RQRA 3DMTA 3TVDA 2O2CA 3ICWA 4JGSA 5EP2A 3SHWA 5JNLA 5CT6A 1AB6A 2C4KA 3VX4A 4RTNA 1TW2A 2I6SA 3FFQA 1L8DA 3JCZA 3BGDA 4R7TA 3GNLA 1VMEA 3CN7A 2WALA 2AFHA 3GPIA 1Z62A 3AG5A 3KPYA 1C0KA 1L5VA 4R9UC 1XJ0A 4M8KA 3R23A 3QBEA 4TZ6A 1P5HA 5BURA 1ZD8A 3MFYA 4B9AA 7REQB 3CCCA 5M29A 3TCKA 3C6BA 3CH6A 1EFHA 4CC6A 3UHFA 4BLSA 3JU3A 1JHYA 4YRRA 4L1KA 4D8VA 4Q4HA 5G4VC 3W3ZB 1CY6A 2WF8A 3OFVA 5L7WA 2KG7B 3PI7A 5FNVA 1P4AA 2XT0A 1UMCB 3L8MA 4HMOA 4YCDA 2CDAA 3W2IA 3QENA 3L1VA 4FGLA 1NTKH 1X92A 2IH4A 5FTLA 4EYEA 1ZX1A 4YP0A 1RBYA 4CTMA 2AQKA 3CNQS 1JNXX 1ZN2A 5KNBH 4DDWA 4B09A 4J76A 5DDIP 2OSBA 2Q49A 1PV0A 2DKFA 3GGSA 4TSFD 4RX1A 3MTJA 4Z4HA 3HXQA 3FWPA 2G9IA 2BLLA 1X3LA 4FFBB 4R1QA 2W0FC 1E3IA 3L2OB 2W37A 5KS2A 5IANA 3ZQKA 4F3TA 3QYFA 1N6KA 1U3DA 2PGXA 4TQ9A 1QHHB 3Q1KA 4OX9B 4QBKA 3UK6A 2LO1A 5CA0A 5DBGA 4EAAA 4W9NC 3LL7A 5I9TA 1VXRA 1SKQA 1VQ1A 1EHYA 4EY3A 4K8OA 4DRYA 1N8KA 1PEAA 1TC1A 4QT0A 4XSVA 4LSWA 2QR5A 5AM5A 2VT2A 3IKMB 4G56A 1J5EB 4YRQA 3SIRA 3ICPA 4MRAA 4DJDC 4YY3O 1XMQO 4KXLA 2O05A 2BELA 2BMFA 5LP6F 1KC8W 3IAXA 5FQOA 2GUGA 1OLXA 4HBZA 4IZOA 1V7QA 3OHPA 2P9JA 4GI3A 3QF4B 4UHDA 1VJ5A 3H1PA 1WWKA 3VC7A 3UAWA 5IK2D 4XVHA 4RGQA 4N8SA 2I6XA 3OMIB 2HI0A 4N39A 2ONZA 4Q4AA 4G81A 2YN4A 4MCAA 4EX7A 1I2DA 1QHGA 5HTKA 4KPFC 3RM3A 1B4DA 4P2ZA 2ZVDA 1QHIA 3KRTA 5JY1A 3ZVNA 2L2QA 3RW0A 4J0KA 3SR4A 1NYQA 3D6NB 2Z6AA 4EZBA 1ZH2A 2VDJA 4OUKX 1ID1A 1OWOA 2VOJA 1NVMB 1S6YA 2P9BA 4TTTS 4Y18A 5EHZA 3UJNA 3ABLC 2JAQA 4EMUA 4WRRA 3GZNB 2WA4A 2OHOA 4PU0A 2QK4A 4X3OA 1LK5A 4U5XA 4RUKA 4A0GA 3HUEA 3HU2A 1OXSC 1OBVA 4OREX 4US1R 3ASYA 3FF1A 3H5VA 3UPUA 2N42A 2PZGA 3OPYI 4IIEA 5DHAA 4FZJA 5JFGA 2FFBA 4Y6LA 3KUDA 5ESWA 5JEEA 3JD3A 4I4LA 3EVKA 3BGSA 4QEKA 2VZEA 1E4VA 3TJMA 4CIAA 4FX2A 1PJTA 2G04A 1BC5A 3AK1A 4NDNE 3SQWA 3R3ZA 3AVYA 3L05A 4AUMA 2XUZA 1OIVA 1AK1A 2BKUA 2ZWOA 3I72A 3L4JA 3GPLA 3I5DA 3FVWA 1Z4OA 4XFKA 3VDMA 4L16A 4R84A 4RKYA 5ALFA 1WHTA 3E3OA 4JX9A 5EUMA 2GMWA 3OJ0A 4FYXA 4TXMA 3RVBA 1PI3A 2QD5A 1Y8CA 3AM3A 3GG2A 3HVJA 4W5TA 5CFZA 5TF4A 2OVBA 4JJ4A 3SKVA 4MGHA 3FZYA 4RA6A 5EWJA 2P7TC 2R44A 2ZTUA 2ZTLA 2W6QA 1JJ2U 3DTUB 1PNLA 2XSZD 1GPJA 2XWBF 1T3TA 2XAJA 5COAA 2P4HX 4UCXA 2WLLA 3M84A 4TPKA 3HU5A 1ES9A 1T3GA 4IQGA 1OPXA 1AQLA 1SXGA 1TYZA 3SJCC 2QRMA 3KSUA 1BWPA 4RF4A 4L8JA 5KTNA 3L4KA 3TNFA 5JZ9A 4OD0A 5CB4F 5MN6A 1R27A 3D7SA 2XUAA 4UVBA 3H6GA 3KTDA 3FDFA 1XHFA 4OJQA 1OXUA 2Y4TA 4DNPA 4JLNA 4P7KA 4KXUA 2EYUA 3HCRA 3QI2A 4ARIA 3QO5A 3D4IA 1UK8A 1YTUA 3WB2A 2ZIXB 1I3MA 2PGIA 4LP8A 5DLPA 3G0IA 4YHHB 4NV0A 1E9RA 4AKEA 2K1EA 1Q1GA 3KXKA 4B3IA 2XCRB 1D5CA 2CTPA 2GARA 2VHJA 1HDEA 1H2WA 3OQ1A 3P4UA 5KYVA 2WM8A 1QK3A 2GETA 3U44B 4DY6A 1QTNA 2P3QA 1U3GA 2VRCA 2ZRKA 4IDGA 3B3AA 3DKPA 1I01A 4KZKA 1GZ7A 1Y7TA 2CJWA 4LDZA 3B2QA 4A8JA 4JUBA 1XU4A 1A98A 3RVLA 3PG5A 4FIDA 3DLHA 1KRWA 4BGDA 2O8BA 1N9KA 3RUCA 3TDKA 3BEHA 1E0SA 1OC4A 3AW8A 5KHIA 1A5SB 1PR3A 1SU8A 3D3KA 4I5FA 4QO7A 5C1OA 2Q0SA 4FLMA 4UB8Z 2NN4A 1RYMA 2WIDA 4ERHA 4HAWA 4BX2A 1P3DA 2GN0A 3RJ9A 3HBFA 4GPD1 4QNRA 4TXJA 3KPJA 4CEIA 2V5VA 4LHZA 2YZGA 4E3WA 4B08A 1MIHA 2VG8A 4GKKB 1I3NA 2IDZA 3LF1A 1LZLA 1N1MA 2JFWA 4DMMA 5FDFA 4U2KA 1P3Y1 3DM9B 3DWFA 5EKSA 4NABA 4KQ6A 1AKNA 3UM9A 3W7AA 1DJOA 1QVZA 2NU7A 3K5IA 3MUNA 2AKAB 1WD5A 3SY8A 2XODA 1W2BU 3ZDBA 2Q6OA 3NGLA 1YO6A 1ZL0A 4P98A 5KSPA 2YHSA 1SXJE 2OE2A 3EG9B 1ZGAA 4BNJA 1CNEA 1F2VA 1SIBE 1X8KA 3QV1A 3ND9A 1XUQA 4KZPA 3I01M 2OAGA 5DYYA 1N5JA 2GBFA 3HMQA 3T2MA 3ZGOA 1ADFA 1QG4A 1KK2A 1QZXA 2AWNA 2Y4UA 2P6OA 4UBIA 4Y2XA 4B79A 2DQYA 2OQIA 5LOVA 3HJRA 1Z56C 2VH2A 4TMVA 1FP4B 1K7EB 5CR9A 3GB7C 1QDLB 1D3AA 4S24A 4GZ5A 2O06A 5LNK6 2BBTA 4X93A 3AIKA 2D5BA 5BNWA 2I3BA 4K46A 3OZVA 2VCHA 4CZZA 1W2WB 3I9NA 4AJ4A 4C4RA 4OK5A 1HNWO 4JSTA 4OHRA 4GLXA 2NUAA 4RWZA 3ZWQA 4H7JA 4W9MC 1PJCA 5C3MA 1EBUA 2Z5GA 1CEZA 3S3WA 2ERXA 1WNSA 1MP0A 2IOQA 1UZUA 3A2LA 3AIIA 4IKOA 3EC1A 4R6XA 3U5ZB 5IT5A 1VKOA 1PTKA 2JGIA 2ZKIA 4KRYA 5U4QA 3SQNA 1UAAA 4JASB 4EWLA 2IYVA 1PKXA 3V3TA 1J2RA 1W2GA 3G68A 5TJ9A 1KEKA 2GJSA 1IEWA 1ZD9A 2YV4A 3CJHB 5BV0A 1JTVA 3EXEB 4BDSA 2F3RA 3Q7RA 4EFNA 5KX5A 2XRMA 5DBEX 3CHYA 4O4JA 3E3MA 2FPXA 4UE3S 4E33A 1XJCA 2I2BA 3GTZA 1R18A 2WD7B 4XARA 4ZQCB 3B7WA 5L8VA 3VDXA 1RM3A 1ZISA 2IIQA 3HUFA 4HH4A 3ENWA 1G42A 5CVCA 4ATNA 2FR1A 3EDYA 5I47A 1VJ1A 3NBAA 4MQMA 2JGDB 4QGBA 3TOSA 3HSKA 1RXIA 1QBKC 2JNWA 3IPAA 4NATA 4PGFA 4BV3A 4DOMA 4OHPA 1JDJA 3IX7A 3BRWA 2EQBA 5LLTA 3M6VA 4Q9KA 1O54A 1YR9A 3TFWA 3ZZ1A 2GEJA 1ECCA 1VI6A 2OHIA 1D4ZA 2W11A 5DCYA 1RXEA 3O8QA 1FLNA 1R8YA 1VQVA 1Z4QA 4MK4A 4C0LA 3IVGA 3JTEA 3K4HA 4HEA6 1IOLA 3DOFA 2XDWA 4FZ5A 4P0PB 1KJJA 5CVVA 2J9GA 4BO3A 3PU6A 2ABWA 2BFEA 4R9SA 4DIKA 1EE2A 1DX6A 1MFZA 2RGCA 3BIJA 3DVSX 5BY1A 3DTVA 1N25A 4KHZA 1RAIA 1N2HA 4O2BB 1VLLA 4AQYO 3PNQA 3QELA 4L3VA 4XCVA 1E61A 2F17A 3ZY6A 4E2ZA 1FNBA 3BJEA 4IDDA 1RWMA 1NBAA 4WWHA 3FLMA 3VPHA 5ITZB 4WN3A 3X1WA 2AR7A 4PZYA 3JAKA 1URPA 2PX4A 1NM5A 5J9FA 2ZVZA 2X5KO 1SUEA 3C6MA 1QYIA 4MGIR 4O8CA 1E3MA 3BGVA 3WGJA 2WTUA 4PSVA 1EK1A 3QVUA 2ZAMA 4YAOA 3D6MA 3TW8A 2I2XB 1LH0A 1UEJA 3DPUA 3ZNNA 2QUKA 4JLOA 3QTTA 3I9V6 4OL9A 5C8YA 1C4XA 2PD4A 1UC8A 5LXTA 3BWYA 4MINA 4CL2A 1FSPA 3RVRA 4DQXA 2VPXA 1Z5OA 2WYWA 1LD3A 1TX4B 4HQOA 5DTJA 5K3CA 4KSBA 5TLSA 4PFJA 4PZ0A 5TPZA 2FZLA 2QV0A 2KBEA 3I34X 3KPUA 3WSVA 3KHSA 2HA6A 4IX9A 4P0QB 1YMQA 3ROZA 1UMBA 2EW2A 1X7OA 1WMFA 5IJAA 4KX5A 3FNBA 1FRZA 2OGWA 1KI3A 5BWMA 4LWZA 3V1MA 4QGHA 4ZOCA 4CGZA 2IPLA 2D54A 3T1TA 2IYNA 2A2ZA 2NTJA 3COWA 3UWKA 5I4BA 2D7DA 5GV7A 1MH1A 3CPWF 1JXQA 2J67A 1CUHA 3OY7A 3AU9A 3PUKA 2G71A 3TW6A 4DNQA 4JFAA 5DOZA 4D4MA 1PD3A 2R8RA 2XVMA 3LBIA 3A31A 4B40A 5L3EA 3ZZMA 3B6EA 5BN3B 3SX2A 1BSMA 4KFUA 4KBGA 4PLVA 4XZ3A 2XCTB 1I80A 5G41A 1NMUB 2WSIA 3WKBA 4D9GA 3CCJF 1QJCA 2VJMA 4RJLA 3OA0A 1E2QA 3FCSB 1FLAA 3PXGA 1EUYA 3JPYA 1W85A 2IVZA 5DO9A 1IOVA 1RKXA 2Z2KA 5JS6A 1CXZB 3PRHA 3LSSA 1QH9A 3S8MA 1J1IA 1FMFA 3M8KA 3ZHYA 1S72F 1UINA 1M10A 1N6HA 3KUKA 4HFNA 4RLHA 4YPVA 2NMVA 4K0RA 2PLFA 4R9NA 1J90A 2ETXA 1YRLA 3H2HA 4XLLA 3TIIA 1QQCA 1NE2A 4TVOA 2OL4A 3HFRA 3UJ8A 2AMFA 1OREA 2ZRJA 3M5DA 3OPNA 1SC3A 3QQPA 1YJ9V 3EB9A 4XW2A 3TZCA 2C00A 5BUSA 3BL8A 1ZLXA 1DBFA 3UC5A 1E9EA 5EOVA 3I3OA 4RL4A 4ACBA 1GGVA 3G7UA 2Y1GA 3E5NA 3LOPA 2FZCA 1G8PA 2YQ5A 3BBPA 4G01B 4TYMA 2I6FA 2RHRA 4GH5A 4RPGA 4KGDA 2E85A 1ISPA 3A1DA 3UWMA 1Y4MA 2W22A 5ALQA 1JE1A 1S0UA 4U63A 3WI7A 4JBXA 4R0MA 5CNJA 3O7MA 3ORFA 5BSWA 2PJZA 2QYHA 3DHYA 2Q7DA 5B66Z 3TNLA 1F06A 1BFKA 2Z4TA 3VUEA 2V6JA 3M2TA 3JYQA 4ZGGA 2X23A 2VJOA 3IDAA 2I22A 1KSHA 1PLJA 1RRVA 1KEEA 5KTRA 4A5SA 2QJRA 4W5WA 3ZD9A 1H8HD 2BGIA 1HY3A 3U7RA 4DQKA 4Z5XA 5C5EA 1NHGA 1ORIA 4LXHA 3H9EO 1KE1A 2C3UA 2W93A 1NJIH 2C77A 2FDXA 5BW4A 2ZRLA 3RRYA 4ZGBA 1GPWB 2DB3A 1E60A 1B73A 4CLEA 4F97A 4MW5A 2R1UA 2WM2A 2G25A 2HNAA 1R1BA 1XK6A 4PC1A 5JXGA 1MDBA 3GUUA 2A3RA 1TMKA 4LZAA 1G6KA 2OO7A 5DX1A 4MP3A 3ZHVA 3TN7A 5EA2A 2EJCA 1T36B 1W87A 4Q0MA 2E74B 2UV8A 2TRSB 1Z8NA 3Q6IA 3ZHZA 4P0TA 4GM1A 4A0FA 1JJOA 2F3SA 5I7SA 4KTVE 4DLXA 2HWUA 2V7TA 5KAIZ 4KXMA 4UJ5A 4FDUA 4L8VA 4A73A 1BROA 4IDQA 5JU6A 2UYQA 4JVOA 5T4BA 1TTPB 2GEVA 3CONA 4QFBA 3WRVA 3H1JH 4BVLA 1SQXH 4H44B 3GCDA 5JCZA 3TOXA 3DXRB 1J7KA 4HDAA 1LPPA 4Q00A 5F2NA 2VF5X 3EASA 2V7BA 2C1EA 5EXPA 5AVJA 4DC9A 5T8KA 1XXHA 2MMGA 1WB8A 5LP6A 2R5NA 1PJRA 3A32A 1PFWA 1SVNA 3HGMA 2XAAA 3O93A 4UBMA 3RWMB 4RV5A 3AINA 1IE3A 1QPBA 2O6LA 4N5DA 1I7QB 1UDRA 5IMBA 1MQ8B 1THZA 3G2MA 5IM4F 4H60A 2OYRA 2IGTA 4LN1A 1DEHA 4MS1A 4L5JA 1U1FA 1SXIA 3IXLA 3NWOA 3ON5A 4IM7A 4Q12A 4U2CA 4HUJA 3TAHA 3EQZA 4F4FA 1PXWA 1YULA 3A6KA 2YWHA 3CJQA 4G0VA 4XDYA 5AVRA 5GZ1A 2Q6LA 3O2QB 1MNGA 4AO8A 2A92A 4C8EA 1L5HB 2F2TA 2XUOA 1VKHA 3VZSA 4Q82A 3L8HA 5IKXA 3OIVA 2XSZA 4QU5A 1FP7A 2JJ1A 5TMBA 4AY3A 1MN6A 4QTTB 4CF3A 3A1EA 4MO2A 1M7GA 3SF8A 3SFZA 3UTCA 4A5OA 4TWZA 2BHLA 4DV7B 5DTEA 4EY8A 1U3CA 1SETA 4BKRA 2WTXA 3KSAC 3PFFA 5A7HA 1V54C 5GW7A 1XRNA 1FDSA 1UK7A 3AI2A 4DPLA 3UBTA 3AR6A 3THWA 4CYMA 5LDDC 3E18A 4F4LA 2C9ZA 5SYAA 3TIGA 3UKJA 2Q8VA 4D0LB 3B1JA 1UKBA 2OV8A 2IWHA 1HEUA 4ARSA 3LP8A 3SM3A 1WCIB 2WWTA 1LW6E 2ZIFA 2ZVPX 4IOLA 2ZS8A 3BGOS 2GILA 3G9QA 4WJZA 3PDCA 2O2XA 2CV1A 1H2NA 2HTFA 3ABZA 3BULA 3R0PA 3VISA 4FINA 5HRUA 2X8JB 1GO3F 1R4MB 4NDZA 4BZWA 1VG1A 3QFTA 1JDPA 2ID9A 2NTVA 5LIPA 4A6EA 1AKVA 4Q16A 16PKA 1NF8A 1GFIA 4WNCA 3C48A 4Q6WA 3VO9A 4WD3A 1TO2E 1UBSB 5C8XA 2P90A 2FMLA 4X54A 5IC6A 3L06A 1GPKA 2FWAA 3GFTA 3FJYA 3T38A 1A9TA 3EGDB 3EULA 3FVRA 3MPOA 4AJKA 2QTSA 1ZBDA 3T1HB 2X8BA 3EVNA 1FFEA 4BPRA 2QP3A 5C46F 4X1KB 2YC4C 1DJLA 4AKSA 4LF9B 3TL3A 1XEXB 2B99A 4IS2A 1B1CA 2A3NA 2IX9A 3ZS8A 3G2LA 3O9ZA 5HKBA 5TIIA 3CZ4A 4GCZA 3OHSX 3TSCA 3O38A 5KTSA 2QRKA 2J3MA 5SZJA 2A79B 4EYOA 2XEDA 1T5TA 4OKSA 3W6ZA 2ZU6A 3WMFA 4RTRA 4XTCS 9GPBA 4R2MA 4EJFA 1U31A 5L3FA 1NFQA 4PGGA 3KJIA 3CX5F 1ZSYA 4YDSA 4CM4B 1RFGE 1E18A 1I3LA 4XPIB 1X7WB 4R1UA 2AEJA 2JK5C 2W2QA 1L4YA 3U61B 1PUXA 3Q0EA 3F8WA 4EA7A 1OA0A 4AJIA 5EHQA 4DUYB 2X6QA 1RZUA 4Q34A 1LX7A 1Y9JA 1Q92A 2VDKB 2BGKA 3OBBA 2PFKA 2DWQA 2AXPA 3K73O 4UCFA 1PTJC 2JEZA 2XOEA 3H2JA 1SVKA 4KAJA 2H4YA 4MIYA 2WC1A 4ZOAA 1QB7A 4M9QA 1JQEA 3A9CA 5LL6Y 1B74A 3DOCA 4OQEA 1JDNA 4PQRA 1V3UA 4U5QA 4V2UA 4X7PA 5DHFA 5TARA 5JANA 5CLJA 5AJTA 2ZANA 1PZFA 3KXLA 2PJDA 1ECLA 3PCTA 2JFGA 3PGA1 5F33A 4ZU3A 3FKSA 3VPDA 4A0RA 1SC4A 3KHNA 5K9ZA 3PDHA 2CT8A 1HZZC 2HX1A 3H5LA 4N0PA 5EJ8A 5IS2A 4B31A 3OBWA 1RTKA 4X8MA 1F48A 2GHTA 2GPNA 4YAWA 5EE9A 1IVSA 1M1ZA 1QU3A 2NSDA 3WGVA 1BJRE 1ENPA 1FMTA 4PYMA 5DYTA 5CB0A 5JAZA 4Y1FA 3GRAA 5JVDB 1DC6A 4XWAA 4NB5A 3P19A 5CTJA 3STXA 5G4UC 1VB5A 4FDAA 5C4MA 4EEZA 3J80M 3BREA 4K87A 3U7GA 1VTKA 3GB9A 5F2VO 3SJQC 3LCJA 3ZR4B 1LLCA 2H1FA 2VTVA 5E95A 4RABA 1ULTA 5AW3A 3HEBA 3GT0A 1ULSA 1SZJG 3I53A 4M4SA 3L7NA 3MB8A 5G4KA 4O2RA 4BX8A 5J2TA 1YJWF 2CK3G 3B36A 4JLWA 5K0TA 4MGEA 1G38A 1DLJA 5DTMA 2WRZA 3BCCH 1VQ9F 3CX6A 1PP9H 2FN4A 1S3JA 3LDGA 2I4RA 4G5GA 3KXIA 2FF5A 5FPSA 4M88A 5A1TA 3K16A 2CYAA 2A3QA 1JIJA 5K3OA 3KZNA 4YI5A 2ZJZA 3H9QA 1TVKA 3D59A 4EKWA 3TCXB 4IINA 1E79D 4WBXC 3P8ZA 3KE1A 4HCJA 5L3CA 2GHIA 2WIFA 4WN9B 2Q5CA 3U2QA 3MLEA 1V5IA 3PJEA 3WLLA 1Q7GA 2BKAA 2Y76A 4XEHA 1M1KW 3QWAA 1MV8A 2GASA 4PI0A 3DJYA 4PDVA 1Z4PX 2UXDO 1FXWA 1DFGA 4FBMA 2FEPA 1IBLB 2YZNA 1DV1A 2YFYA 4H18A 5G02A 2DETA 3G6EV 4EI8A 4OVKA 4P7BA 3WL8A 2ID8A 1D09A 1Z0DA 4B3MB 1UC9A 2R84A 1P7PA 3SZRA 4ALIA 3PWKA 3G2JA 3QITA 3IDOA 3FSRA 2JRIA 2W8BB 4WSOA 4WF9V 2NSLA 3FX7A 1E69A 3NT4A 2YXPX 3FKJA 5DGXA 1VGVA 4NFSA 3P94A 3PYMA 4KHPB 3AXSA 1NQVA 3T7KA 4UBOA 4UMVA 5FUWA 5JQGB 2QN7A 2AGVA 5D6NA 1AOXA 1SBIA 1W34A 3K1ZA 4JHXA 4RIEA 1J39A 1QYVA 4B6GA 3R3WA 1XRPA 4W1QA 2GXAA 3DAOA 2IX3A 5CXQA 1D04A 4YJ3B 1KFEB 1YCIA 1KR5A 1EFUA 3I6QA 5FTMA 4D3YA 3JZIA 2I5PO 3GHZA 3JYCA 2GN1A 3K9HA 1QQ5A 1VBMA 5K0NA 4QTYA 1L7XA 3UO2A 1DO0A 1E2LA 4C0QC 2NZWA 3FX2A 4QM6A 2XUKA 4YO8A 1JFFA 4BR6A 5JAHA 4D3ZA 3WQRA 4Q9IA 3J80A 3IP8A 1UR5A 3FB7C 5CX4A 3WJQA 4YYZA 2BH2A 4GDMA 4F3NA 2AN9A 2BTQB 1P9WA 5IDQA 4B84A 2XCOA 5F5XA 4RFLA 1Z34A 1J9GA 3LZDA 3R7BA 1JSZA 5LC1A 2OGSA 4Z8YA 3VMMA 2QZJA 4CKEB 4K8XA 1O94C 1GTL1 1TQ2A 5CVUA 4KQHA 4TSKA 2WM3A 2XBLA 1ZXBA 3T06B 2HW8A 1TGYA 1T9DA 2HA4A 3GWGA 1DLBA 1QH1B 2ZRCA 3HABA 3T3HA 1JHAA 1Z7YA 3K6SB 4ZVQA 4BFLA 4AI6A 2PPLA 2RH5A 4DV6O 1J33A 3REGA 3P9SA 1B8UA 3RYTC 4TRMA 3TNYA 2B78A 3WGHA 3SVTA 3G8DA 4J16C 3OTFA 1XD2B 4L51A 2LZ0A 4L8LA 5HMMA 4GSKA 3CSXA 1QZZA 3NC1C 1XRJA 1RPOA 1YDXA 5LMNO 5EQJB 3AWDA 5IJ9B 3E05A 5AHXA 4NZYA 1PYGA 4B8YA 1U4NA 4ND2A 4BE9A 4GMGA 4F7DA 4X41A 4FWTA 1I33A 1N5IA 3G79A 2R1VB 3BWMA 1XN1A 5CA0B 3C4JA 4ITVA 1EX7A 1R88A 4NJEB 1NZFA 1O3YA 4A0HA 1U0LA 2VHYA 3HXLA 2IYRA 2CE2X 1SZPA 3LVFO 3X44A 2Q0HA 3RARA 2IIVA 3JARA 2JD1A 2YV3A 3GOQA 3LZCA 4Q7EA 3TR0A 4EA9A 1AB5A 3TI9A 2OTLV 2QAJA 4WGFA 2GKOA 4Q7LA 1V43A 2WIJA 3AB8A 3Q0TA 4OOEA 2WSYB 2Z1NA 1RPNA 1HQCA 2KB1A 4PGAA 4G5YA 4YEDA 3ROXA 1PR4A 3D2AA 1YJ5A 2MR5A 4D56A 4IL6Z 4PZEA 1IXMA 4RVFA 2RH8A 2V74B 3B2EE 4NYJR 2UYGA 3ESQA 4UNSA 4RE5A 3BG5A 2VP2A 1KERA 5JD4A 3GIDA 2XZLA 1GADO 4P58A 2DC1A 3C3XA 4L4SA 4JJ6A 2QTPA 5CPFA 1GL9B 4FE7A 3W5JA 4JAVA 4BLVA 1N2CE 3PKJA 2V65A 1IATA 2AL7A 2JIZD 1J97A 2OCIA 3I1JA 4OXKA 1SKMA 3PXAA 4I9HA 2UZ0A 4MW8A 4AMUA 2PVPA 2VHUA 4X3MA 1VIVA 1J0AA 1WSWA 2ETVA 4GLJA 5IAJA 1C2TA 1A50B 3CLKA 4YXWA 3WNQA 3OZRA 4RYLA 5TX7A 4AL4A 5JFOA 5ELXA 2Y1OA 1ZL8A 1T9ZA 2FN8A 2PS9A 3QUBA 1M1XB 2EF0A 1VF6A 1TJ5A 2H9YA 3VXKA 3CLHA 5E79Z 1IPEA 1RJGA 3DKKA 3RWBA 2A33A 3GI1A 1OHHD 1YZQA 4QQNA 3TQCA 1EA5A 1Q77A 5FWYB 2JK1A 4M55A 3FMVA 1K88A 1I7SB 5FNVB 2AN3A 2EQAA 2Q6VA 3NHFA 4JI6O 4AURA 1KVRA 2DQSA 3K5OA 1EA7A 1T9HA 1RQNA 1ZSNA 2VJBA 3CLUC 3CQ9A 2APJA 3E3LA 3GAAA 3I2KA 3RSOA 2BHTA 5DLEA 2P6RA 4KW7A 3NTRA 3UV7A 1NP3A 1UZNA 3M3PA 5JMWA 4JEUA 1CRQA 1Y6FA 2H31A 4UW9A 1R0RE 1OWLA 4FKMA 4F56A 1BCCH 3THXA 2H85A 1LPSA 4TSFG 3ZHCA 4M0UA 5JMOA 1GZUA 4DB2A 2P4VA 5G0UA 4YRKA 2IJGX 3VAZA 2HEIA 4BBAA 3R0VA 4J43A 3GG9A 3N3AC 3BSFA 3G0HA 1Q0PA 4GI2A 3TUIC 1E9FA 1X4TA 4NAUA 4HQRA 4HATA 1UJ6A 4Q3CA 2MYPA 3ZIDA 2V6BA 3GH3A 1CUFA 3L8GA 3LY9A 1KYWA 4JL6A 2GLXA 1NKTA 1UIMA 1VXOA 3NIGB 1O5OA 3GQVA 3NV7A 4FSXA 4XLTA 5AK0A 5IT0A 2YHIA 2MYUA 2HP8A 3T3IA 3NATA 2IEGA 1G6OA 5TMEA 1I5YA 4A5UB 1IDSA 2A0KA 5AW0A 1NKSA 2RGYA 3F2IA 4N5IX 3VMFA 1H8EA 1WF3A 2C78A 4XJSA 2VP5A 3H3XA 3N8KA 2DECA 1KAOA 1ZGZA 2HM7A 2WJHA 4NEHB 4WFIA 2XW6A 4ZEWA 5JTUA 1M2OB 3CBQA 5A6VA 2G77B 3X1XA 1EWVA 4Z7QB 2HMSA 1YL7A 2IS4A 3SIVA 4BVRA 4PTYA 4PSUA 1L5YA 2G0TA 4XDHA 4XJXA 2GAJA 4E2WA 3NYRA 3QX3A 3VYVA 1KWKA 3LRPA 5GOZA 1HSOA 3BMNA 1IAQA 2YEVB 3LIPA 4XFJA 3W7WA 1EI9A 4C4XA 3UT5B 2RI6A 4AY4A 2GDSA 4I0XA 4BFWA 2C0QA 3LI2A 3J81N 3OLYA 5D87A 2B8EA 4PA9A 2GK7A 4D9CA 3CCEV 1NC1A 1M8JA 3DMRA 3G5UA 1Z7WA 1XDGA 5E1MA 1W4CA 1G5PA 1TYCA 2JVIA 3AFHA 3CG0A 3PUYA 4HYYA 4D9JA 4ESEA 1HW7A 4AT1A 2Q29A 4KO2S 2IKSA 2Z0AA 3GLUA 4YREA 2OY0A 3ZLTA 4AIRA 1QXSA 5BRNA 1THGA 1T1SA 2MK3A 1NNI1 1XDWA 3L07A 1XNGA 4C5BA 1XMVA 4JI3B 2JH9A 4HDKB 5DVZA 2JHAA 3Q6NA 5HDBB 3CCLF 5KOJB 4I8IA 2WG2A 2EWCA 2ZM6B 2O4UX 3AZPA 4QNMA 2GZAA 5EPOA 2IHKA 1O95A 1UDCA 3OBIA 4MVWA 2J0QA 4NCBA 1XPUA 3DV0A 4P4UA 4L6AA 2FEAA 1YBHA 5EMMA 3T0GA 2YOHA 4C4OA 4DV3B 1U8CB 4C7KA 4OGWA 4NNOA 4OBWA 5EFOA 4P22A 3AT1A 4LF8B 3N8IA 4D8UA 4YAIA 1LPOA 2D8MA 1XTTA 3JAWA 1P49A 4GX0A 1GPH1 3FHCB 2ARKA 5FUBA 2JA2A 4QX6A 2RG7A 2R5FA 2GAAA 3VNQA 1LDEA 4OM7A 2FMFA 1K73W 5IZCC 3USZA 4L5AA 2D2IA 2AUMA 2E55A 3L6OO 1QP4A 4YACA 3ORRA 4ZKDA 2WTEA 3A6FA 1LBQA 3DD1A 1WPGA 2W2KB 3I37X 3AEKA 3UBMA 2QKCA 3UQZA 5A9SB 2JLSA 2OV4A 3OE7A 3IBFA 5ADHA 2HHHB 5PNTA 3R9XA 3FAZA 3LY5A 4GI7A 1QHEA 3PUVA 5CDGA 3NDJA 1SY7A 4HQFA 3OT1B 5KHJA 4MVRA 2P22C 1Y6ZA 2FP4B 3GBSA 4XQEA 3SJAA 4CMAA 2I9KA 3DYBA 2O50A 1Z6AA 2XUJA 4MXDA 4XPIA 3MA0A 3M1IA 1JKJB 3PKIA 4FFDA 4HVAA 3WWEA 1L1QA 2DG2A 2X6BA 4JS0A 2Q4OA 2QENA 2LXNA 1ESNA 2Q50A 4H4DA 1DCFA 3KUXA 2XNSA 3LNTA 3UXMA 4BP1A 2I29A 2I55A 2J0EA 3DFMA 4RNDB 5LBIA 3ZZ0A 3AOGA 4PPFA 4PX3A 4JAUA 3CX7A 2UKDA 3T7RA 5B3JC 5ES4B 2DT5A 2O23A 1O96A 3KFVA 1NVPB 1E6UA 2QTOA 1T5OA 1TECE 3KQQA 2EBUA 1CB0A 1JKMA 2XDQB 4NXMB 1NXXA 5AI0A 3ZEIA 3DMGA 2Y1LA 1B1AA 3ADDA 3NORA 4YIOA 3I5UA 2PPVA 4E2YA 1LDMA 2A88A 2X1MA 3GRZA 2XKJE 4NV1A 3WYCA 5HKKD 4AO7A 5KYWB 3LVQE 2H2HA 3VJRA 3FYEB 2E21A 3DWEX 1BGYH 3F6RA 1RRMA 2RGDA 4JBLA 4XH9B 1K27A 2GZ1A 4LECA 2QP4A 2REBA 4M98A 2YJ6A 4JEMA 1K08A 4G26A 4B7ZA 5C2JB 5I3CA 3WK9A 1HDJA 3HKBA 2R751 1KJYA 2VPPA 3TB6A 3N2KB 5CYOA 1KI2A 3EPRA 4EGFA 2FPLA 1QH8A 2HJHA 3VU3A 3L0DA 4MW9A 5J4KA 2E76B 4CQMB 2WJ4A 4ROSA 4FOTA 4L3WA 3UUWA 3AEUA 2ATKC 2GT1A 2R8OA 2AFIB 2HUNA 4GXRA 3GC6A 1X9IA 1P1FA 3I9V1 1AB3A 3O0TA 1WZNA 2Z3YA 4X91A 4BQEA 3FHTA 1YXMA 3U10A 1RHUA 1UKZA 3I0ZA 1PBTA 2D5AA 1DEOA 1V25A 2PZJA 3I8OA 2BZSA 3HRHA 4R1LA 1T29A 1C50A 3ILYA 5K1ZA 1G8GA 4I5DA 1J5XA 4B71A 2OTCA 2Q9LA 1ZLZA 1V3VA 2V5AA 1VH8A 2X5NA 3M81A 1A0OA 1EBFA 1PG5A 2W6JG 2GA8A 3E8SA 3CJTA 1N4DA 4C7UA 2O0JA 5CU7A 5DFAA 2FMIA 2WI8A 1YNSA 2ONKA 2ZU0C 3PRKE 5DN6A 5LQRA 3WNDA 1GTVA 2ZJFA 3H2IA 4MOWA 4HZUA 4D8YA 2IY9A 2PRKA 4UCQA 3I8XA 1ZMBA 3QFCA 5LJLA 1A1VA 4PRZA 1CEYA 5D51S 1PG0A 2NAPA 4WKPA 2J0UB 4IOMA 3BDIA 4KSYA 1D2DA 3F98A 1NLZA 1KMMA 4IV8A 3R7AA 2ZCUA 5KMGB 2IZ0A 4JZYA 1KARA 4FLEA 1YB7A 2VFAA 4F9EA 3CYFA 4MA5A 3E82A 3RC7A 4MCJA 3WRXC 4YWHA 3AG4C 3ONFA 3VQWA 3LCVB 5TGTA 5CFPA 3TL2A 3PSHA 3K5HA 5CA3A 3DBOB 3N1UA 5B1DA 4B2LA 1QBGA 1N7IA 2R00A 3UJ7A 1DRJA 3R2JA 3SU8A 3VZQA 4YI3A 2DXIA 5FLXN 3JX9A 1TM4E 3CNOA 2JFBA 3UY4A 2CDCA 3ZVLA 4ND6A 4CWAA 4OP1A 5SYNA 4YVFA 2B4TO 5E6SB 4BCDA 5JSHA 2GPSA 1TIBA 2NACA 3MWEB 1DGSA 1MBZA 3WRYA 4AQ7A 3KAJA 3L0BA 3U1VA 3X1JA 2HMYB 2DHCA 1MRSA 2YIDA 3C8UA 2ERCA 2IKQA 3FPSA 4R6ZA 1NSYA 5B4VA 5BNIA 5AVZA 4XQ9A 5JATA 4AKTA 4JKIA 4PW0A 1CP2A 1XB2A 4MTFA 2PLNA 2ZWMA 4G4SO 4MSWC 1J70A 3DT8A 4H0FA 4LJKA 1UFOA 2IHVA 3UPDA 3V1NA 1Q86H 2GPYA 1JY8A 4IGIA 3EF3A 5DEIA 3C14C 2RSLA 2WFLB 3R9IA 1QYDA 1R4MA 1KRHA 1YZUA 1U28C 3QLVA 4R1PA 1RM1B 2XQKA 2GGSA 2CNNA 2QD2A 4BFYA 3PK0A 4QUHA 4HV4A 2GD2A 4G0PA 3IRUA 4L8YA 4ZAXA 2I2FA 1P1RA 2EWVA 2NOAA 4RLFA 2P5SA 2NT3A 4TWKA 4RDIA 2UU9B 2I9PA 3D0QA 1NQWA 2PH5A 3K0KA 2WSSG 1AKQA 4PQYA 3AB7A 4EUKA 3CVWA 4TYYA 1QV6A 3JWGA 4NZOA 3IMPA 3I6YA 2DQKA 2YTZA 4JQSA 2UUCB 3EC2A 3PEUA 1I5OA 5CIQA 3MC1A 5TF0A 4BNHA 5BSHA 5KTKA 1W29A 2QEQA 4B62A 4OQZA 3MJTA 4FDVA 4HDMB 4R2JA 2QN8A 3NONA 4M76B 3UW1A 1WW2A 3V34A 3W2HA 4B81A 5HS4A 2QKSA 3HA2A 1W30A 1ZI8A 2XOKA 3N2IA 5A5VA 4RVOA 3OEHA 1Y6GA 4BT7A 4MEBA 1CBUA 5A03A 2CE7A 3RYIA 4BVTA 2RBGA 3BJZA 2PD3A 3JR7A 4MMYB 1APBA 1EK6A 2OZPA 1D0SA 2WABA 2BIFA 1ZU4A 2V7WA 5EP4A 4CM5A 2UYKA 1VQKV 2F43B 3HZHA 3RYCA 4ZO7A 1IUKA 3OJWA 1E1CB 3LPLA 4BYMA 3M8AA 5F7JA 3VTIC 2D3WA 1IZ3A 3IKFA 2IIBA 2W98A 4J1TC 4W5HA 3VU9B 5KNDD 1JHZA 2FEOA 4YYEA 3IEVA 3O9VA 3IP5A 3PRJA 4QGGA 4G5FA 5EFZA 5BWOA 3FNFA 3K9QO 5FWNA 8MHTA 1HM5A 4F12A 1ZUIA 3CC2V 1R9JA 4IRUB 2P2CA 3KO8A 2WJ3A 3L6DA 2CVPA 4GNRA 3OGIB 1J42A 1DXQA 4IUBS 3W05A 3ELUA 5HWSA 2IHNA 3HDQA 3IHWA 3UPTA 4RY8A 4RAQA 3ANXA 1YS4A 4U7JA 4DQVA 1VRVA 2A0WA 2BDTA 2PKEA 4LJLA 4FC6A 1JDVA 3H0EA 2AZ4A 1CRLA 3KCNA 3KLBA 5CFRA 4C3OB 1HFKA 1HH4A 3IHKA 4W8GA 2PL9A 2Z3WA 3W9SA 1NT2A 1E7MA 3HU3A 1U3TA 5BSUA 3TRHA 3TM5A 4TQDA 1NVAA 2JLRA 3QM1A 3ZE1B 4OM8A 4QDJA 3RA6A 3CX4A 5LJIA 3VR4H 3RA5A 1P39A 2P75A 2QAIA 2YHUA 1FFDA 3BCRA 4MKRA 1KFBB 6REQA 1V8BA 3HFJA 1KAMA 3AV0B 3N58A 3UMGA 1QSGA 4TV8B 2PKRA 1FUEA 4KX3A 1H2EA 4Z9YA 3LAWA 4CODB 3AHFA 1E66A 5B58T 2GJ4A 4LHVA 4DJEC 2QRHA 1G0OA 4TTQA 2YDXA 5CUQA 3QPVA 3K4PA 2NUTB 3AYZB 3DPSA 3H97A 1ZO8A 1Q14A 5ITSA 4RZHA 4LPSA 4B7EA 4QEZA 3N8HA 1CKEA 2V6MA 1MPXA 3GLRA 5CLLA 2FSUA 4D4IA 1DAKA 3L43A 3S1AB 3UYKA 2BE9A 1B93A 2WNSA 1E9AA 5FF9A 4QYIB 1U3LA 3ESXA 2X0RA 3CRRA 3S5UA 4ZV9A 4ZYUA 5JHHB 1RRGA 3G5LA 2P8JA 1T43A 1CD5A 2BUAA 5LM3A 3QKSB 4BVKA 4AKHA 2CC2A 4WZ6A 4F4DA 1XCGB 5J47A 2LE0A 4TS9A 1OB2A 3K71B 5IVKA 4Q15A 3V4SA 1T9GS 2AG6A 1DK1A 2OWDA 1U8AA 3G2OA 1X7ZA 2WHPA 2J5RA 4J6FA 2P9YA 4KQIA 3INGA 3RD5A 4AS2A 1H0HA 1G21A 2J3EA 1ETUA 3D7KA 1U02A 4DSZA 1IAVA 4ZZIA 4YUVA 1XRMA 2WUDA 3C5HA 3HI4A 4MS4A 5EAIA 1YS6A 3AYXB 3ABMB 1OX6A 4D9BA 3SGIA 3IH5A 4JHLA 4P80A 3K9GA 3OUSA 2Y4OA 4N76A 3ZYZA 5FUXA 3VOSA 3FUVA 2PWAA 2WZBA 4LISA 1E2GA 1DKOA 1NLUA 4E1BA 1CUZA 1KYVA 4BMOB 2GNOA 3KT8A 1YQXA 3FPBA 4NZNA 1JQAA 3B1WA 4JC4A 1KI6B 3UNXA 4CM9D 1BU5A 1W46A 1A27A 1TADA 5EP1A 2ZDIC 2AIFA 4WZAA 4IJ6A 4C0XA 1XI2A 2GXSA 2Q8QA 3EWAA 1HNNA 1X38A 1XZCA 3N28A 1LWNA 1JR2A 3OPXA 2FZVA 4DIBA 4RHAA 2IELA 1JB1A 3R3JA 3L4BC 2NO7A 5T64A 1YQQA 5KREA 1XWFA 2YQZA 2AR0A 1UKCA 3HAXD 4XWOA 1T2VA 1JJBA 3L7QA 1Q90D 1E0JA 1Y5MA 1IN6A 1BGXT 2PANA 4UM5A 3B9RA 4BLWA 1INLA 1RRKA 1CIPA 4TN1A 1YGPA 4CIYA 1TF2A 1VECA 2AFVA 3WA6A 1VLHA 2D2XA 3SYMA 3BD8A 2ZW9A 2B34A 5DGCA 3ZWXA 3AIOA 1OSNA 1P0IA 4N01A 2OLKA 2ZR2A 3WRYC 2DTDA 3ZW9A 10MHA 4OLHA 2L17A 2JI4A 4QYXA 2Q3JA 1XVIA 4KPGA 4BEJA 2V45A 4PLHA 3GJRA 3K1JA 1HLDA 1F38A 1KZ4A 2AE1A 1ZKDA 1K8XB 2G5TA 3GZTB 4HXGA 3DZ8A 2QN1A 3ASNB 1TVEA 1JMVA 5G1OA 3E1SA 1IXSB 2XCUA 4U4AA 3DDCA 5BY2A 4GM0A 2QVBA 1U3VA 3R74A 3VBBA 1PJLA 5G1PA 4Q37A 1R3JC 4ZOQI 3RS4A 1I7DA 5CJPA 1K6JA 4NVPA 2WTMA 2ZRNA 5CLHA 1Y4DE 1IHOA 3OM0A 3WZMA 3IUNA 4DMFA 4JUCA 3W8RA 1ZEMA 3GU3A 1OZ0A 4QPKA 3VYTC 1EUDB 1L4EA 5A4MS 3AF0A 1TUBA 1G20B 1CWUA 4QJBA 1OILA 1GUZA 1H2YA 1M6EX 4K9MA 4NXNO 4N6OA 4WFHA 3SPGA 1JNYA 1X2BA 5DLQC 3RSFA 1V8PA 5JSKA 3DZIA 4GYKA 1EFPA 2VJPA 1U2SA 2EP8A 4DIDA 3PVSA 5EVJA 4TMZA 4YO7A 4G9BA 1B8NA 1XMJA 3L7DA 2Z01A 1J7HA 3F5DA 4G1MB 3C6KA 4UDYX 2UUBB 5FFMA 4DG5A 2OG1A 3UK7A 4E03A 2ZWPA 2AT1A 3PLNA 3N8DA 3LFHA 3U9SA 4YFVA 5GAJA 3I64A 1CZLA 4I5GA 2RHJA 4Q21A 2ZAUA 4FEEA 2ZB7A 4X44A 5B1OA 1ZVVA 3FBGA 4QTUB 2F9ZC 2VYVD 5B12A 1BRTA 3STZC 3AGPA 1E7YA 3AR4A 3QWHA 1OI4A 2ZT9B 4O4JB 3DF7A 1YR1A 4MV6A 4XYLA 4OHWA 1BX0A 3BFPA 4F1KA 2Y48A 4NH0A 1VCOA 3UJBA 4WXRA 4RIGA 3U39A 3WJAA 5CJ2A 4MR9B 2Z09A 1PGPA 5BV7A 3PFNA 1OASA 5FPRA 1SGWA 1ZM2A 5FOXA 3V5NA 4QEDA 4FN5A 1OGIA 1OTHA 3R6DA 3HPQA 2BEUA 4WADA 1UBJS 4F5YA 1X0XA 1DIAA 1KYZA 3PPXA 1MB2A 1SBQA 2ZYWX 3LT2A 3RSCA 2HMVA 2VPQA 3S3TA 3ZE0B 1ODTC 4RPKA 3C8ZA 1H5UA 4AFNA 1FNNA 1V8FA 3H8SA 4B2YA 3OO1A 3E83A 5HFLA 1XKQA 4IVNA 4JDPA 3WJ1A 1CY7A 2XGSA 2DOKA 1N2IA 3D31A 4J7ZA 1JSCA 4I19A 2PCJA 3EMVA 3R6WA 1WXDA 2JKZA 2QU7A 3FA2A 3SXUB 5L3SB 1CERA 3K32A 1X80A 2WLLB 1GV1A 1F8YA 4Q66C 2FKAA 3ABKB 3N0TA 3PQ3A 4TQGA 3ZV7A 4Z4FA 4D0SA 5BN4B 1YNOA 3SJAC 5JZSA 2ENWA 4PLCA 3M4ZA 4ZT4A 3RS7A 1VKNA 1ZUNB 1KY4A 3KQWA 2BR5A 5IJ0B 2LBWA 1GG8A 5CEJA 3DEJA 3G2QA 1ONOA 5JAQA 3QTYA 3NWEA 4JLSA 4BYGA 2O4CA 1IJEA 5J4LA 1NDUA 1UC5B 5KZMB 3S27A 1JPNA 2WIGA 4IDBA 1KD1W 1YJ9F 3CINA 1JX6A 3K5NA 2H11A 3KLNA 4JMPA 4MV4A 4XFDA 4TGLA 4R7ZA 2CE4A 1RQLA 4GOXA 4HAUA 5EXTA 3ML0A 1O95D 3C4VA 3PNOA 4JV5O 2C20A 3AUSA 4GR4A 3UMCA 4GSYA 4ZV7A 1YRAA 4CFZA 2WK1A 5KQGA 3DKIA 1MJFA 1RJEA 4C2TA 1B26A 3IIJA 5A5GA 1R8XA 3U3KA 3LO5A 2CL0X 1JVNA 2LIVA 2QKAA 2ZEJA 4HQLA 4RHCA 1VJCA 3ZQJA 2JCGA 2WFZA 2Q1XA 3UFXA 3LBYA 4PFQA 3MFQA 2FE4A 3BE8A 3PUIA 2GS9A 5AVVA 1TEZA 1D07A 1H1LB 1SQPH 4KMOA 2V7QG 1CZNA 1O57A 3U80A 4ZYYA 4TS1A 4R8RA 1V9PA 3T1HO 1ZH4A 3AJEA 3GRCA 1L2TA 2MSNA 5BT8A 3JQAB 1VSVA 4I2VA 1JFSA 2W2VA 1EDBA 1CJMA 1JA9A 1EFTA 3T35A 1YUBA 1N6NA 3WL5A 4DGSA 3LQ1A 5JD3A 2AW9A 2QJWA 2XXAA 1HEYA 4CUZA 5C9ZA 3D9QX 4CMJA 1ZFNA 1DVRA 1QZ3A 5EB1B 2D7CA 1O8CA 2CJPA 4ILKA 2AG1A 3ZDDA 3KR9A 1I0LA 4Q39A 1VCMA 2VI5A 1JFVA 2R96A 1U80A 1PV1A 3VTFA 1H4SA 3MUFA 2HUPA 3DEAA 3GGPA 3RKRA 3TLCA 3VR4D 1UPBA 2E87A 4ZPJA 3DQPA 3ELWA 3HVHA 4LTMA 4MICA 2JEOA 1QAHA 2RJZA 5KYGA 3I5YA 2DF8A 3THYA 1NRXA 3K2QA 5B1HA 1UBFA 4F06A 4WDRA 1M2HA 2WUFA 1M2EA 5LP6C 2ALEA 4W6ZA 2YXDA 3VH1A 3WGLA 3NIDB 3S2GA 3SHTA 2FAXA 2GUZA 2DBZA 3FHOA 2PE5A 2QL6A 5JJ5A 3AR8A 4ONEA 3MF4A 3OQJA 1H3FA 2XTNA 3DL0A 2FGKA 4Y2VA 1BS9A 1LSOA 1GLNA 2CCGA 2EJVA 3OT4A 1FSZA 2KI5A 3RO7A 4ZQEA 3EGVA 2FPPB 4IW3B 4RD1A 3UXYA 1GFSA 1UZMA 2R2AA 4FFNA 3L92A 3K53A 3P9PA 4FOOA 3M82A 3MUEA 3O3CA 1TUEA 1GKYA 3VH4A 4BNDB 1U4SA 4BVSA 1IXYA 1NMXA 5HCIA 1PFYA 2NU9A 2YIAA 1B2LA 4D4HA 4HS4A 1AS2A 3KXDA 3WBJA 2DY0A 4B34A 2HX0A 4N5NA 4F7WA 3AR3A 4YMTA 1K8AH 1YB6A 1S9DA 4B3FX 3HY3A 4MUKA 1T3HA 1DWQA 3LX8A 3BVPA 5HE8A 2RDMA 1RYDA 2KG4A 1YQDA 3IPXA 4IHAA 1CUUA 1SA0A 2YMPA 4Q4HB 2Q5QA 2L0XA 1QKKA 3H5WA 3KVOA 1P2TA 4HFJA 5SY4A 3D8CA 3TTSA 5BMVA 3DTVD 5IKPA 2WJIA 1N78A 3EK2A 3H0KA 4QVKA 1XTSA 1SHUX 2IODA 4IZ6A 5THQA 3SQLA 2RHWA 5JS1A 3CXCU 4ALJA 4XX0A 2XQVA 3KZMA 3P9XA 4ALLA 4CM6A 1C8LA 3ROKA 3KIZA 3DUFB 1NZDA 2PEYA 2XY4A 5FOUA 4F5WA 1SRYA 4Y6SA 2DQ0A 5LKAA 2QIOA 3B09A 1HE3A 1X77A 2VP0A 5L3DA 3GJXC 4FOPA 4MJ3A 5B3LA 2I6DA 1T3SA 1RI2A 4URZR 3TQHA 8GPBA 2DQ3A 3UMYA 3SQXA 4KO3S 1R6BX 4GBED 5EZQA 1T8WA 4HNQA 3P52A 4ICGA 1I94O 4I9NA 2QDKA 1MIOA 2H54A 2PR7A 4RA9B 3RFCA 1H05A 2ZYTX 5E7IA 4D3SA 2W8ZA 3VKHA 5DW0A 4EB6A 1NBMA 5FYQA 4B47A 3VFDA 5HZMA 1G59A 1H9AA 4OBEA 1IY8A 4DLVA 3RS9A 5K51A 2HSZA 2AK3A 3LYUA 1B7GO 1OB5A 4OP3A 3ZLBA 3RNOA 1L6RA 3H2KA 2PJRA 2ZPUA 2OZLA 3SIUA 1Q1QA 1D0VA 1H2XA 1R6UA 1IQRA 1USWA 2RJ3A 4MULA 4Q01A 4WHMA 4D9MA 4E12A 1C9YA 4Y2SA 1P62B 5AXAA 2JIZG 5IVIA 3Q72A 3RR2A 1U3PA 3RAPR 1JS1X 3F0DA 3CZPA 4LBZA 1CRWG 1GPMA 3AY0A 2NZUG 4XDZA 4GYCB 3JASB 5CW2A 5AW4A 4XOUA 1TLTA 2P9GA 1L4MA 1XQ1A 2F1HA 3SS9X 1FPOA 2G4VA 2JH8A 3LPCA 3HCFA 4LOIA 5E1OA 1ZHOA 2A6PA 4UBKA 4WI1A 1TUIA 5J4VA 1AR1B 3Q8KA 1YDGA 5E7QA 4QYTA 2Q3BA 1RKBA 4N23A 1PX0A 3NANA 3F9CA 1RWVA 1QS0B 4JLAA 3E70C 4D6PA 4ER3A 2UVPA 1PVOA 1SKBA 1TM3E 3RBXA 1JDBB 1BSVA 2GF0A 2C3PA 4CDGA 4RXMA 3H1BA 4WKOA 3QYPA 4WK0B 5AI8A 1M5RA 3A4LA 2FFQA 2YMLA 5EMNA 5F21A 2B36A 1N0JA 1VP3A 5EZYB 2BOBC 3C8LA 3CCSF 1PJAA 1H94A 1PSWA 4CM8A 4BQFA 1IJFA 3D4LA 3RRMA 1BEEA 5CK4A 1VG8A 3OGCC 1WU7A 3CYPB 2BRUC 5C31A 5JFTA 1JFFB 3A4IA 4MIEA 1NJ5A 1CDDA 4JXXA 2XT9A 4QVGA 1AY0A 3OOEA 4Q05A 2I78A 2ZIVB 4IF6A 3FZQA 5F9MA 1DG1G 3JYHA 2X2FA 1SULA 4N3CA 2D4AA 2OR3A 3FM9A 5FI1B 4G5OA 1HT0A 3T41A 3TJTA 3BICA 4DANA 4I1UA 2QM4A 4GKBA 1W5BA 4TMWA 4RQEA 3ZGVA 1F5SA 4GXNA 3UWPA 1R0KA 2J3JA 3F47A 1J2TA 2Y1XA 1QUFA 4RZSA 4NBRA 3TZLA 4GEGA 5AW7A 3KQPA 2BF7A 1DI0A 2D5IA 4HRXA 5DCVA 1FP1D 2H92A 5E0OA 5F7ZA 4CF6A 3E8GA 2ZBQA 1NUAA 2B1JA 1QFJA 2R4TA 1WA5A 4DUPA 2YC2C 2ID4A 1U9IA 3GLKA 3OESA 5AHOA 2ZRAA 5BWCA 2CLKB 3NALA 1YJCA 4ZRDA 3ITNA 1B76A 3HA3A 5HM6A 3LPMA 3A36A 1IQPA 3BE6A 1V16A 3FCOA 3EVBA 3B12A 1CY8A 2HT6A 3P20A 1B41A 3HXPA 4MRNA 5B1SA 5A3RA 3GDHA 2WHRA 4ESOA 3AP1A 5BUZA 1X8XA 4QJ3A 1KEUA 3WK6A 1C1XA 2ZRBA 4DT1B 5BXYA 4L22A 4DWJA 4ZI7B 1RLUA 4HWGA 2KGWA 1I1QB 2HDOA 4MR7A 4Q18A 2P68A 1PNMA 4KQFA 3EY9A 1JDUA 5I5EA 4NTWA 2Q0AA 2WPDA 1HL3A 2WJVA 4TYWA 1JEYB 1ECBA 4MV3A 2W6JD 4DM3A 2CMDA 3KAQA 3E23A 4DR3O 5AM3A 1BQ3A 4DLNA 1E0DA 4P4SB 3EF0A 4D4JA 1ADJA 2H5LA 3CZCA 1H69A 4ZT6A 4CMIA 2PJUA 4CMKA 3I9LA 4LJ5A 1I2CA 1PQPA 5A5FA 3K6KA 4OGFA 2IEZA 2A9VA 3ASUA 1AR4A 5B8FA 2A7QA 2NUPB 2I87A 4HWTA 3HWWA 3LDCA 1EBBA 3AEUB 1FFAA 3DAFA 4QIHA 5KTTA 2NV0A 4CV2A 5H5NA 2AD1A 1MZPA 2RJNA 1SB9A 4EJMA 2REXB 2KLBA 3BRWD 3RV4A 3IP7A 4DDVA 3I6BA 3KOOA 1Y0BA 4S1PA 1TMGE 1XJQA 1UANA 2A9OA 1F17A 1JEQB 3C3EA 4QBTA 4X7BA 4YMSA 5BXQC 1X1QA 4AZ3A 4X6UA 1WUHS 4ZBMA 4YRAA 3TD4A 3LH5A 1HNXB 2AUNA 3W3AA 4ZEXA 3L7OA 3ESDA 1DWUA 3NOQA 1EVZA 1NUQA 1XAGA 4NFHA 5I7UA 2J31A 3ESBA 2P4QA 1PVDA 4DMRA 1VL1A 3VPAA 3GNSA 2CLCX 1FAFA 2CGOA 1VCHA 1FDVA 2VDWA 4H1TA 4E5UA 4RVNA 5LKRA 1MT0A 2JAXA 4JBWA 3ZC3A 4ES6A 4OI4A 3IR5A 3NVAA 3UJ9A 4R1SA 4JITA 4FS8A 1CQPA 1WDLA 1ZEJA 1OX5A 3SZ3A 1OFUX 1ZGJA 3E8BA 2QP9X 3G88A 4BATA 2GCPA 4BVAA 4QGFA 2E82A 2WWHA 5KAPA 2NP7A 4HL6A 1JP7A 2G09A 3KQVA 4P2BA 1JJFA 5E1DA 3MDOA 3Q0IA 2CHTA 1IHPA 2PSHA 1O5TA 3DHEA 3MQFA 3H84A 2MSCB 4G86A 1PL7A 1TU3A 1L5SA 4GVLA 1KA9H 3RVQA 4P82A 1DC7A 5KTMA 3LQYA 3NBUA 2ZROA 1GFWA 4YV7A 3IIMA 3D6AA 3D3NA 4OQFA 2MOKA 4MAFA 3V8QA 1XRSB 3UQYS 5JDIA 3ZG6A 2Y05A 5AO9A 4TN5A 5B3AA 1DKNA 2MYNA 1DBSA 4AD8A 3SYOA 1NN0A 1U1CA 1YL6A 2ZFUA 3K4QA 1Z13A 5TS3A 1TXGA 4JZGA 3OKAA 1J5EO 3DE2X 1VJRA 4N0MA 3VDNB 3WMRA 4A8TA 5HOEA 1I2ZA 1FNSA 1WG8A 4NBKA 2H0QA 2DWDC 2IDKA 3QMWA 2IQQA 2PA0A 2POQX 2HK9A 1B16A 4PQEA 2PKXA 4R8VA 1VQ7V 1E5TA 1JR9A 3ZS8C 1QGYA 2QRJA 2ZI6A 3AETA 3IQDB 3URMA 4KG7A 1MRZA 1ZSPA 3EXAA 4JBYA 4LW8A 4ZVNA 5REQB 3VHLB 1RIFA 3JQPA 3UK1A 5KWJA 3NK6A 1KDPA 3CPQA 4FMDF 2OWOA 5GMOA 3DWGA 2M9MA 4JA2A 4RVGA 1WE2A 3SG0A 1YQWA 2QR3A 1V8OA 1EGMB 1IY9A 4XJTA 2ASVA 1G9TA 2JHFA 2PAFA 5LD2B 4N3BA 2Q7XA 4IUYA 1GRVA 2JRLA 4Y9TA 2KSDA 2HWWA 3GYBA 1KP9A 2ADFA 2YWEA 1UMDA 2BN4A 2WZCA 3H4TA 3EIEA 2COKA 4BS9A 4GKJB 2C98A 3K1TA 1XQ8A 4Z2YA 3H4IA 4AWBA 4EELA 1OW3B 4CMCA 3B9QA 2CLDX 4DG8A 2VPTA 2IYPA 4NYIQ 3ZXYA 1MW8X 2CNLA 3Q7IA 1OXTA 4PRYA 4JXJA 1STOA 2AOXA 4YP1A 1Y3CE 1PNOA 2ODPA 3G23A 4IFIA 2R47A 3CR8A 1FVXA 1KO5A 1R15A 1ONNA 1J49A 2O0MA 1P9OA 2XD9A 1CE8A 3C74A 3EYAA 3BQ9A 3G1UA 3EGWA 3PITA 3WNBA 4RFSB 3RVMA 4DSNA 1V47A 4RQFA 1GT91 2J30A 4EO7A 5IEJA 4YMIA 1I24A 5KSZA 3LA6A 1JG3A 3BAZA 4TLLB 4BUJA 2FF7A 1QIIA 4YBRA 1PJ2A 1WKVA 1NUTA 4MS1B 4MSUA 5KYUA 1GUBA 3QVSA 1RXYA 5DHQA 3TK1A 4HEJA 4HG2A 4X8AA 4KUMA 1KQGA 3OEHD 1Q1BA 1XZNA 1ZGGA 2PX2A 3E6AA 3ESAA 3IO5A 5A9SA 4QE7A 1Y1RA 3HWUA 2ZUVA 3CXRA 4C1BA 5C8DA 3HH8A 5JCJA 1NVBA 4LKRA 1ZR2A 3RC9A 1YDEA 3GFOA 3AESA 3JR3A 3I9MA 4P36A 1F0PA 2XYPA 3UMSA 2ZQYA 1KGDA 3D6VA 5I4KA 1ML3A 1Q6YA 3KCQA 1N36O 1KQOA 2IT1A 3N8GA 1DJMA 2NU6A 4PGMA 2X9VA 1Q7RA 2Z6VA 2VJAA 4D3DA 1HDIA 2PUEA 5JNTA 1T1EA 2V1DA 3P0FA 4G0XA 4KR9A 2KTUA 2V9PA 4K03A 3ZIUA 1YRHA 3A2NA 3FH0A 2RGRA 3Q98A 3RQSA 4ZCMA 3HPLC 1NS1A 4D8TA 3G59A 4FLUA 1GRJA 2HQ1A 3VR2D 1P2DA 3L8EA 1R8JA 3REOA 1B8OA 4EYQA 3U49A 1FX0A 4CIVA 3CVVA 2GD1O 4EEXA 2AHZA 1DMSA 2HNBA 2J3HA 3W4IA 4K2HA 3P9KA 1XP5A 5HF5A 1PJZA 3HYNA 1DG9A 1QMPA 4IHKA 4AMZA 1DUSA 1E3LA 4PWYA 3SSOA 3ETGA 4PAOA 4WFEA 1YBVA 2AEEA 2AOUB 1RM1C 5DNUA 1QRUA 1R6NA 2VNJA 2WVHA 3D8NA 4NMWA 4PV7A 5A62A 4LF4O 1GU7A 4V1CI 2X15A 1C30B 3EGXB 1BE8A 4H1HA 5ADWA 2P9ZA 4YDHB 5KTOA 1O4WA 1X3SA 3SC2B 3JALA 4BNDA 1R66A 1QTQA 5IVPA 3WTCA 3RC8A 2DUWA 4IHQA 1H6DA 1WO8A 3ADCA 2FB5A 1I6MA 2I7DA 4WNYA 2EULA 2WV7A 1NURA 3HVIA 4PHFA 3E2MA 5DTRA 1TYAE 2ZR9A 1E1NA 3GJ3A 2QUHA 2GTIA 2IHUA 4NCJA 2I3GA 4LUCA 1JEYA 1HMPA 1NVTA 3FOEC 1F1BA 2N05A 1UP4A 2Y77A 1NOKA 4XWYA 4OI1A 3L9XA 2PXAA 4HGRA 1S2DA 5FLYA 2Q1TA 4RIHA 1VLJA 3LQ4A 1BE0A 1OU4A 3PTAA 3HNPA 3T3OA 2IOHA 3F78A 3JSLA 1JALA 4HVTA 5KQRA 3ER6A 1HK7A 2QT0A 4QELA 5FPHA 2Q7OE 1N2EA 3ASOB 1TK3A 1G7RA 1KPHA 1ZA2A 1QLEC 4H37A 1LV8A 1OAKA 2WWGA 3LD9A 3PC2A 3ICVA 4GRAA 1EP1B 1HQKA 3GVIA 4HADA 4LCEA 4I66A 4AJJA 1YDHA 4I9UA 3OFNG 5CFLA 1TFUA 2J3IA 4K88A 3TXAA 2NZ2A 4KXYA 2FMXA 2GJKA 2ZS9A 4KUHA 1HRDA 3LY7A 1GPBA 1Z82A 4JCCA 4JENA 4CIDA 5FA6A 4Y2UA 4BW0B 4UM9B 1HNWB 2IZZA 1N7JA 2JHGA 1US8A 1ZNZA 2XMSA 1H66A 3L6RA 3ZCRA 5L6LB 5AHKA 1BHBA 4IDHA 3PYXA 1Y8RB 3EODA 4DO2A 1BOFA 1UXJA 3MQWA 4MWDA 3VR0A 1NVKA 3PI6A 1V54B 1DL5A 3FPFA 4UTXA 2HHJA 3JCMM 4FBLA 4FONA 5KQMA 3GFSA 2R7MA 2IXBA 3UJPA 3MILA 3UO3A 1MEEA 2IIPA 5HP8A 3M4NA 4ZVUA 2P41A 2CDRA 3G0GA 4XR4A 4ARVA 5AQ1A 2PMFA 4JP8A 1FTWA 3MMSA 4NCXA 2OCCC 4FD3A 3I6MA 3WKDA 2IDMA 4YECA 4CCYB 2F55A 1E59A 4I3GA 4OGKA 4MS3A 2O8EB 2HR1A 2EG9A 1V6CA 2XLCA 2XHZA 2X0DA 2C3YA 1VPLA 4JOSA 2GESA 4TT3A 5K05A 2AG8A 4DWOA