5LOVB

Dz-2384 tubulin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
417
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The synthetic diazonamide DZ-2384 has distinct effects on microtubule curvature and dynamics without neurotoxicity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 417
sequence length 426
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lovB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lovB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lovB01
1SA0B 3JARB 3JAWB 2R751 5LP6B 3VOAA 2Q1XA 5IYZB 4X1KB 5EZYB 4O2AA 3HKDA 3UT5A 2VXYA 5CB4A 1TVKB 5GONA 5LA6B 4FFBA 5LOVA 4O4JA 5CA0A 4EI7A 3RYFB 1JFFA 3N2KB 1RLUA 4LNUA 5EIBD 4ZHQB 3JARA 3JAWA 4X1YA 1SA0A 1W581 1RQ2A 3RYIB 5JH7A 4M8IA 5IYZA 4O2AB 3JALA 4X1KA 4EI9A 4FFBB 5LOVB 1W5EA 1TVKA 5GONB 3WGKA 5MN6A 3R4VA 5M7EA 5ITZA 3JATA 2RHJA 2XKBA 3HKCB 5LXTA 3N2GB 4WBNB 4ZHQA 4X20B 4O4LA 3RYIA 5JH7B 3RYHB 3E22A 4O4HB 2RHOA 4YJ3A 2RHLA 3RYCA 4HNAA 1W5AA 5FNVA 1FFXA 5LYJB 5EZYA 1W59A 2GVIA 1Z5VA 4TV9B 4ZI7A 5ITZB 3VO8A 5J2UA 5IJ0B 4IIJA 5KX5B 3M89A 5MN4A 4TUYA 4EB6B 3M8KA 4YJ3B 3VOBA 4O4HA 2VAMA 3ZIDA 5FNVB 1FFXB 5LYJA 5KMGB 4X1IB 4ZOLB 4U39A 4IIJB 3JATB 5KX5A 3HKBA 4I50A 3V3TA 4O4LB 4EB6A 4TUYB 1W5BA 4O4IA 5LP6A 4B46A 4IHJB 4DXDA 5EYPB 2RHHA 3ZBQA 2XKAA 5KMGA 1FSZA 5CB4B 5LA6A 3HKDB 1JFFB 4TV9A 4ZI7B 4EI8A 5CA0B 2BTQB 5IJ0A 2R6R1 3HKBB 3JASA 4TV8A 5JVDA 5JQGA 4X1YB 3JAKB 4IHJA 3WGJA 5EYPA 4O4IB 4U3JA 2VAPA 5LP6C 2BTOA 3C8LA 3JALB 4I55B 3VO9A 4B45A 4X1IA 4ZOLA 2BTQA 5LXTB 3HKCA 5CA1A 4WBNA 4I50B 4X20A 4TV8B 3JASB 4I4TA 3JAKA 5JQGB 3E22B 3RYHA 1Z5WA 3HKEB 5C8YA 4DRXB 1OFUA 4U3JB 4HNAB 4XCQA 5BMVB 3RYCB 1TUBB 4I55A 4O2BA 5IJ9B 4YJ2B 4E6EA 3CB2A 5J2UB 3RYFA 4F6RA 5CA1B 3WGLA 5MN5A 5J2TA 5JVDB 4I4TB 3VPAA 5JCOC 1W5FA 4DRXA 3RB8A 3HKEA 5C8YB 1RQ7A 4KWEA 5JCOA 5BMVA 3ZBPA 1TUBA 3UT5B 4YJ2A 4O2BB 5IJ9A 3WGMA 4O4JB 2Q1YA 4F6RB 3WGNA 4LNUB 3N2KA 3N2GA 5J2TB 2VAWA 5EIBC
chains in the Genus database with same CATH superfamily
1K9VF 3MILA 1AA9A 3T1HO 1ISGA 5LP6B 2Z2ZA 1BT8A 4PRZA 4TWRA 1YJBA 4GZMA 1HZZC 4IXWA 5CLLA 3RTGA 4B6JA 3BABA 1VLLA 4BNFA 2IZ5A 2Y69C 3CG0A 4M1EA 2A88A 2GT1A 4KAJA 4DR2O 4KQMA 2GZ2A 3COWA 2CE4A 3OKFA 2AGVA 1J0BA 2IKQA 1LFAA 2PH1A 1JQJC 2XBUA 2Q4RA 4DA8A 4EG0A 4BKPA 2HT1A 1NFFA 1QVZA 4FK8A 3A3NA 4RZ2A 4PG8A 4ZN6A 5GVRA 2JNWA 1RPNA 2RD2A 4Y2HA 1D8AA 1K27A 3SGIA 1VMKA 3ZOZA 4DDVA 2E82A 4MUHA 1FMCA 2D54A 4NPCA 5JAQA 1CK4A 2OIEA 5CR9A 5C46F 1PHRA 3D6JA 3UKDA 1SQGA 3GWZA 3P9KA 4BFZA 5KOHB 4YRJA 4N48A 3PFNA 1L7XA 2W2MA 3WKEA 5H83A 4MJ7A 6CHYA 4U02A 2GZAA 3K03A 3IR9A 3FFTA 2BUAA 3K5MA 1H8EG 1UK6A 1UOEA 3HHPA 3JQBA 3UQYS 3I0NA 3V55A 4ECAA 5HW0A 1BHO1 3I0ZA 2WU3A 2ZAIA 2PUFA 1VRVA 1SPXA 4UQPA 3CSSA 4JLSA 4HWGA 4F7DA 2NTNA 3VYTC 2FWMX 3QO8A 4HK4A 4WOCA 2FUCA 4KHZA 4D81A 2CFTA 3SQMA 4K8XA 2W83A 4DSNA 3FD9A 4QO8A 4L0QA 2E4AA 1ONNA 4F4CA 4RHFA 4DLPA 2R1TB 3DKPA 3KT3A 1YS2X 4OLFA 3GO4A 1RI4A 1ZXLA 1JEDA 2CKDA 1PGOA 5DHSA 3BB4A 4FPPA 2I2DA 3LGXA 5CDGA 2UUBO 1LI4A 3CE2A 1EAYA 1LTHR 1DFIA 5KX5A 1N25A 2HMWA 3D7MA 3G02A 3PHIA 5F35A 2I6TA 3QNEA 4KO1S 1EUQA 2J9GA 2PRYA 4DLXA 1I94B 3STUA 4G0WA 4O0MA 5ALXA 4WH0A 2VQDA 4PZAA 1Z62A 1VQLV 3M9WA 2PZKA 3HBMA 2ZJYA 2YJGA 1RWXA 1NT2A 1TXGA 3FNRA 3MPOA 2BC9A 4J4HA 5E1OA 4R16A 5FLXA 3FTCA 3RJMA 4XPZA 5TISZ 3CCBA 4U00A 1T4CA 1IB6A 3GK3A 2PXCA 4MPRA 3V6MA 4M2LA 4EFEA 1GGEA 2ZJ8A 3P27A 2QWRB 1FNCA 5EQFA 3UB2A 2H2WA 2ZRQA 3FPIA 2GCGA 2C77A 2YJ5A 4MVWA 2AOXA 4RWEA 4NOLA 2J32A 4C0SA 5JMTA 4AIIA 3UJPA 3G68A 4OOFA 1KAQA 1TFUA 2W42A 1T6BY 2WTMA 2Q9UA 1HE5A 3I1IA 1MJGA 2PRSA 2QVCA 2XDAA 2F1JA 3L7OA 4ABMA 1HGXA 1HZZA 1SRQA 3BCHA 4L4XA 3OHSX 5F4BA 1T3LA 1ZVVA 4EG5A 4N5MA 1C3EA 2YMMA 2YW2A 3H3JA 4E08A 2IOFA 2JBAB 1M1YE 1JR2A 2QRGA 3TPFA 1P7VA 3V4LA 4D0RA 1Y7IA 3FWHA 2P9EA 3OMIB 1PGJA 2HPHA 4EPWA 5B1SA 3K06A 2ID4A 3P0RA 3ZS8C 2JZOA 3L79A 2KSDA 2A0YA 3CWZA 3E9QA 4L08A 4EPTA 2QE7A 1SIOA 3SFZA 3NTOA 1BH2A 5BMVA 1YD7A 4XUCA 2RI1A 1H47A 2XCTB 4CQLB 4DCTA 3EPLA 3K1AB 4B34A 1G5QA 3V97A 1W2BF 4I1RA 5ADVA 4P4UA 5FF9A 1CEQA 1CZLA 1PR3A 1RA4A 3KTAB 1XKLA 1N33B 5EQDA 4FOLA 4AMZA 2AF3C 2COEA 1M8GA 2NAFA 5JZVA 3OZ7A 2AI2A 1YIAA 2J5QA 2WWHA 3IOMA 3ITDA 3QE9Y 1CBUA 1SBYA 4LS3A 3V42A 2BUBA 2I99A 2JHPA 2A7WA 1WNTA 3KXKA 5FTMA 3RTEA 2C0CA 5LQDA 1LBQA 3K0HA 2BCCH 2E37A 2F7SA 1RPJA 2HHLA 3WE7A 3DE7X 2XQVA 3RC8A 1LX6A 4JSTA 2P22C 3E9YA 4KWHA 3TTTA 2OCDA 3L82B 4NARA 4UULA 3U9SA 5KYYA 2ZXWC 3KOYA 3PC6A 3EZFA 1C2TA 3KQLA 1AQ6A 3F6BX 4NHEA 4A5UB 1B6GA 2UV8A 4HWTA 4RYLA 2LO1A 4FM0A 3W5SA 4CDNA 1NXOA 3V4PB 3I1JA 3CCJV 1BKDR 3HNRA 3TTXA 4C6TB 2QZ9A 1KIFA 2J3DA 3OONA 2B2NA 3MF4A 4NYJQ 3VDNB 1AO0A 1JQ0A 4V0OA 1HG1A 1FNBA 1MRSA 4OFZA 1FB5A 3FOEC 5E95A 4B6FA 3DKVA 1Z6QA 5A5FA 2XCIA 1P1RA 3D3WB 3H99A 2Q27A 5DT2A 5GJVC 1ECCA 1GKIA 2PO5A 2QDKA 1CERA 3SPHA 4YRRA 3SGLA 2M98A 3GGCA 2D3OW 1UXKA 3QMMA 1H2XA 1NI5A 3ZXSA 4H2DA 4US1R 5EWJA 1KEZA 1H94A 1PFGA 1R0SA 3HPQA 3KHSA 4DXHA 1PK8A 2XOEA 3FKSD 4RY8A 4BV8A 3AUUA 2A94A 2SKDA 3F1LA 5KSPA 2JLSA 4YRFA 4JH0A 4DT1B 1RSOA 2IELA 5EQTA 3K79A 3ZCSA 4EHNA 2G83A 3PHLA 2GBPA 4Y2SA 4AJEA 1PUXA 3K5PA 3G67A 4GPZA 3KKOA 1LDEA 2GRJA 2VUHB 1YIOA 1EGMB 1D2CA 3U31A 1NRJB 1NI8A 1T8RA 2FHPA 4O4LB 3QVKA 4FEEA 3KKQA 4OFBA 5LP6A 3EZXA 3TLGA 1OREA 2B61A 4B7ZA 3DE2X 2FMKA 2FV8A 1UK8A 2UZ0A 3WJAA 2BPOA 1KJYA 1KOFA 4CS3A 1U7UA 2W8BB 3RVZA 1HE2A 4OHXA 4CKXA 3AWIA 4B9EA 4CMKA 4NC9A 1M8FA 1BG6A 3SHWA 5F64A 1VI6A 3DDOA 3ML1A 3NTUA 3OF3A 4GYYA 4NE2A 4RH1A 4CR7A 5D86A 1D2DA 4KWIA 1EE2A 4LOIA 4ZOEA 3FOZA 4F3TA 4MVRA 2NZWA 4J91A 4OHFA 1AGYA 2C5AA 1XZGA 3M1IA 3RC7A 1QRUA 1F4MA 5KVSA 3PC3A 3DE1X 5JD6A 3EEFA 3OIUA 3QUBA 4H1UA 3DC7A 2UXBB 3FDFA 3HUDA 3GD5A 4UNIA 3VZRA 1VP3A 1RRCA 1TI7A 1O94C 1ADYA 4GMHA 5KOHA 4QO7A 2G1UA 2I3BA 3SC4A 1I4EB 4D3YA 1PKXA 1DXOA 3HS3A 3JD1A 2JAQA 3OJCA 3BVPA 4EUFA 1EWKA 3DOFA 3EA5A 4CH5A 3FCYA 4B7AA 3QIAA 4TT3G 3UJ7A 2X2PA 4EHJA 3U19A 2HCTA 4PELA 2WQ6A 2NO4A 2REOA 2PRJA 4DOMA 1V0JA 3QA9A 1YI1A 1MOFA 1DKMA 2OO5A 1Y76A 3AUJB 3E2IA 3UWKA 4IRMA 4IDOA 1QE0A 3P0HA 2QGZA 1X25A 2IPLA 2IJIA 2NXEA 2H7YA 1QTRA 3LE8A 1CUGA 2CLDX 1O6GA 3IJPA 3OE7D 4R9VA 3G79A 2CSXA 4JT8A 3W7SA 3CC7V 2QX9A 3J81k 1P9NA 2F2TA 4C1NA 3GEDA 4QE9A 4PU0A 2Y71A 2YMPA 4IGGA 1PE0A 1YU9A 3DONA 1IMOA 2NW6A 3IAXA 3UH0A 3WG9A 4O3MA 2ES4A 2IXDA 1GGMA 3JCMM 1BZYA 3ZV7A 2VWQA 3WSVA 2VQ3A 5AKGA 1QG6A 1DUVG 2ZP1A 4AO7A 3DMPA 2B5WA 3LOUA 3SJZA 3IA7A 4RHUA 5JEDA 2QVXX 1G8HA 3F46A 4CMAA 1E58A 2NADA 4V1CI 4FYJA 4CIBA 5KNBA 4K9DA 3OP4A 4C7VA 3OH8A 5JUWA 2JFXA 3BL5A 1GLNA 5EXDA 3L7JA 4MQEB 5EJ7A 2IBSA 1RLUA 5BNFA 1CR6A 8LDHA 4QRDA 3TX2A 2ZWOA 2O8BA 1IXSB 3VYUB 2VHXA 3MINA 2CKMA 1KETA 3UPDA 1RW4A 4IO1A 4HDOB 4LPKA 3LDEA 4RK6A 4F45A 4C4TA 4RE5A 3P0EA 4NZ9A 3SVTA 3VAZA 4JVOA 3JWGA 5LIRA 3E81A 2GA8A 5TMBA 3F5SA 3DFMA 4UVAA 3AK1A 1CIJA 2QZSA 3HJHA 3JRWA 5KJ6A 3UCFA 2AFIE 4XA8A 3EXHB 1HFJA 3WAGA 2KKWA 1KFKB 4AG5A 2JD2A 1GEEA 3F6SA 1G3IA 4LDAA 2FMLA 3BA1A 1N6LA 1ZVQA 2AH5A 4YP5A 4FQ5A 4QEZA 4FZVA 1ULZA 3A36A 2H65A 3P2OA 2WJIA 3LDUA 3MJVA 4JR0A 2A06H 2NU8A 5BWLA 1K86A 5BQOA 1N7HA 4FYXA 4G07A 1VGQA 4R68A 3WKBA 1M5TA 3ZG6A 2DZDA 2IQ5A 5ED0A 3VBCA 3ODGA 2V54A 2RJ3A 3MWEB 1GNTA 2WP0A 4IXTA 5IDJA 2V0NA 2P3OA 2ZUSA 5JC8A 4AP5A 1NA5A 4DV0O 3SBOA 5F7ZA 2QQFA 1ZGAA 3E20B 1SQ6A 1PDOA 3GJ7A 3K53A 3SZ3A 3VSAA 4EG6A 1H1LA 2GHIA 2VF7A 4JC4A 1E1RD 1ZCBA 3UCEA 1NJ2A 4RWUA 1FAFA 3LUGA 3DNMA 5BWMA 2CFIA 4G1UC 3HVUA 5DTIA 2YZ2A 4LY6A 2XE8A 2R6JA 2WYWA 4WFBV 3WL6A 4QKQA 1LV8A 3Q40A 3ETCA 4R7CA 5D00A 3PA8A 2GN1A 5I3ZA 4YJFA 1A2KC 5E4FA 4NLLA 4YDQA 1R73A 3Q7SA 3DMHA 3M3HA 1SULA 4Z4EA 5B3KA 2P5YA 2IY7A 1ZC4A 3DVAA 1DBVO 3KOMA 4F4UA 2CUGA 1NR1A 3QTYA 4ME6A 3RSOA 1P62B 1U3LA 1QOPB 4M22A 1BHJA 1AX9A 1V5EA 4P3XA 3NYIA 3HNOA 3DD5A 2XECA 3E8HA 1DEXA 1P4JA 2NUBA 5AJWA 4AJJA 1YBMA 3ESZA 3T1OA 1VQNV 1Z6GA 4JVSB 2HS3A 4CODB 1DJLA 3NFRA 3NP9A 1JTFA 5JS6A 3L49A 3SMVA 1SB9A 4MDHA 4ZV7A 5TQ2A 1OAKA 2ZJ7A 4QYIB 2BFCA 3FOBA 1KVSA 2GBIA 4TKMA 4CF7A 5JZMA 3ISJA 4PHTA 2BBTA 5EWJB 5KKAA 1ZN7A 4KB5A 1A8HA 3SIUA 1ENVA 3COPA 4Q7QA 2QE7G 1DOHA 4YPOA 2E75B 2HSEA 1T25A 2Q1TA 2PEZA 1TF7A 3IEPA 3WGIA 4WFQA 4EFLA 2XEDA 4MS1B 3RABA 2X6AA 1YRYE 3HJCA 2H9YA 5AUQA 4C3UA 3ASZA 4CJXA 3KDSE 1RLOA 1T8UA 1QIIA 4UM8B 3USZA 2WVHA 4I1UA 5C9ZA 3WB0A 1YJ9V 1H2BA 4GX5A 2VHWA 5LQJA 4WD3A 1XVUA 2F8TA 2QD4A 2RB9A 1H8ED 1C8BA 2VYFA 2Z30A 2H4FA 4H9GA 1YJNV 1GSHA 2DBQA 3VR6A 5EHZA 1CUAA 3AG7A 4LQDA 6Q21A 4PG4A 5HY0A 4FFBA 3U6BA 2EJWA 1RPOA 2B69A 4IDDA 1VQKV 4KMOA 4CKZA 1OI4A 2QZZA 4OK5A 3D8TA 3EBPA 3QYAA 3PEYA 4M6WB 5AP9A 3G3EA 3IEKA 3IC7A 1I33A 2PWBA 4F8EA 1O6CA 2LKCA 1XVVA 1B04A 1YJQA 1MLDA 2UYCA 3ZCXA 4LEIA 5A2QN 1CY0A 1G20B 1ZXBA 2FP3A 4PFJA 5CH8A 4QE7A 4KR7A 1C3OA 3F5MA 3R3VA 3DEKA 4WK0B 3LQQA 1JE1A 4V03A 3FDIA 3VYVA 1UPXA 4ZHQA 2VVTA 2X4IA 3C8HA 3DEAA 2QS9A 1CKEA 2ZBQA 1VLZA 4GUAA 1VKHA 4FFPA 2GETA 2QB5A 3KT6A 3BIXA 4YMIA 3AEZA 5EIOA 3V4OA 2B8JA 4QSHA 1NN3A 4WUTA 4OIMA 1ACLA 4NTWA 1FYEA 3THOA 1NXWA 2GF0A 3D02A 3VO8A 2PL3A 3G89A 3KSUA 3V1UA 3U5TA 3CMAV 3QVTA 2Z6UA 2J33A 1DC6A 4KH0A 1TZJA 3LQYA 3RUFA 5KAMA 1AKNA 5IHXA 3FTDA 3HDYA 5GMOA 3V4VB 1NUSA 2GOYA 2ZT6A 4LFBO 4MW0A 2ZE8A 4BNWA 4ZI5A 1T9GR 3T35A 1X92A 4CM8B 2YICA 3L7DA 2QMQA 4R51A 4BC1A 1FMJA 3O8RA 5CW2A 2VP5A 3ZX4A 1Q0LA 2HLDA 3LOQA 4LMPA 4RV9A 2I91A 1RJDA 5L7TA 1A9TA 1D6MA 4K26A 1BXKA 3H6HA 4N54A 4I2VA 1DLBA 4MPDA 2ZVZA 3O9MA 1Q6YA 1YQUA 2IV7A 1W5BA 4O4IA 3UTCA 5TQVA 5LLSA 1FSGA 2V7PA 2CSUA 2ZOSA 3WMGA 5FP0A 4EHHA 3HKDB 1P0MA 4YP1A 4EPXA 3FVRA 1EFRD 1L8QA 3S3XA 2X0LA 2ZBDA 3B8EA 4MYHA 4QUDA 3WFZA 4D9IA 1L5FA 2HLNA 1GK9A 4OK6A 5KVQA 1J6UA 1YHZA 2CNLA 4H1TA 1YB7A 3I2HA 4ARZB 4ISBA 1TLTA 4JI3O 2OORC 3H1EA 2F9ZC 3EXEB 4PBRA 1NVPD 1H2LA 3WGJA 3REGA 8OHMA 2D7DA 4X3MA 2CXOA 1IDN1 2GN4A 2FFQA 4X00A 2G5PA 1CQWA 1NW6A 2VRCD 4GR9A 2IH3C 5B5EZ 3N4ZA 1NBOA 1SKBA 3OBIA 3QUTA 3HVKA 5DF1A 4EFMA 3BE8A 1NBWB 2LDXA 2IEDA 3ZZMA 1PZGA 1C9KA 2MR6A 1Y4MA 3BTOA 1Q0PA 5H80A 2XZDA 3S2SA 1U0FA 3UHAA 1GD1O 1GMGA 4TT3A 3S2IA 3QXJA 4BPRA 5AHOA 3HKEB 2M6SA 4JR2A 4LN1A 3NTVA 2X8WA 4CL0A 2F1OA 3EVNA 1YOVA 3RWMB 5IJ9B 5REQA 4AYTA 2F3TA 3RANA 2R86A 1Q1ZA 1ZONA 2GERA 5CLJA 2EIMC 3U4CA 2XUOA 2AFVA 4WOJA 2PAAA 3QF4A 2FRDC 4QX6A 4RD6A 3LT5A 4ZAGA 2IU0A 3IHKA 2Q67A 1U3TA 1N6PA 5ICFA 4OXKA 5IF9A 3O4JA 3FYUA 1C1YA 5IUJC 4WWHA 1DQPA 1DCKA 1SCKA 2ZBPA 3D8BA 1VQ5V 1WF6A 1XTBA 3EXFB 4WK2B 1Q90D 1QK4A 4IS2A 5HA5A 1J1ZA 1QRRA 2CNBA 2IF2A 2X41A 1SY7A 4ZVNA 5SZIA 1B3BA 1IWOA 5DM60 2QM0A 5DXJA 3SJQC 1H2MA 1F7VA 1DE0A 1TZBA 4NZMA 3MD0A 3C2QA 3RQSA 1VQ4V 1ZYUA 2IL1A 4H7EA 5JAOA 1OCCC 1IQPA 1VCIA 1YVRA 3AVPA 2EWMA 2GAIA 1RZUA 4J9ZB 3GP5A 3A4LA 3ZCPA 4ZAZA 1IPHA 4B48A 4CLOB 5KOJB 4TXMA 2W70A 4O2BF 5AOBA 5A3VA 3RYFB 3LW7A 2ETXA 4G1CA 4XFDA 2HU2A 3ZZ0A 1OU4A 1SQVH 2DU8A 4IT5A 2E4VA 2G70A 3K96A 3LK7A 5AFSA 1YKFA 2ODPA 2IYWA 3SLGA 3ZZUA 3QFSA 1CQPA 3DBLB 4HH4A 1U8CB 2HMUA 4KIUA 2R1ZA 4MA4A 2OSVA 3CN9A 2VPIA 4R1TA 1ZH4A 2YCBA 4D4JA 1ODEA 5CGQB 3T4EA 3GLGB 3AY7A 1GKYA 2XRYA 1O08A 2O23A 3D4OA 4KO4S 4MW6A 5CYOA 1TTQB 3VR0A 4TVBA 4IICA 3H01A 1VCMA 1AUOA 1NLYA 2HWUA 3FYUC 3N07A 2OTMA 2ZE6A 1H4TA 2PX6A 4U6SA 3UEOA 2IS1A 1JDNA 2C2MA 4Q21A 1GCGA 1EK5A 2GAJA 3IALA 3KZCA 1KK1A 4JJIA 4JTDB 2VHQA 1JPJA 1TM2A 2FPSA 2V1XA 3F96A 3IIKA 1X7YB 5FBHA 5JSKA 3I8SA 4Y1RA 3R6GA 4GZLA 3HJRA 2P6JA 1JEEA 5AT1A 4N12A 3OUSA 1QQTA 2PY6A 3BSFA 3OG9A 1T8PA 2EW2A 3ILHA 1TW3A 2I4LA 1CRZA 3PD7A 3RV4A 4BO9A 2BHNA 4F4IA 4I7ZB 3MQ4A 2XXBA 1JDVA 3HPLC 4P83A 5K6RA 3R9XB 1NBAA 1I4LD 4O6VA 1MO6A 2EX3A 1QORA 2O0KA 2VP9A 3HWUA 3PNBA 1FFXB 4NTZA 4Z51A 3HCBA 1KY2A 2G4VA 1SCIA 2GQ0A 4DR3O 2CLOB 1E9BA 2N0SA 4JQSA 4YMWA 3QPUA 3TD6A 5JFTA 5ETJA 3EGVA 1V54B 4WZAB 4RYDA 2ZAYA 2FA9A 3HNPA 1QGOA 1RYBA 2C5LA 3IUPA 2OESA 3N86A 4M7PA 1TLFA 4MRVA 2RMKB 3INRA 2PUWA 5E1MA 1U2GC 2HPZA 3H5IA 3LHKA 1O6BA 4ZMBA 3PQCA 4KYUA 4CMGA 4L0MA 2QTVA 3JQDA 4L72A 4KQ9A 1NL3A 2VHJA 5IT5A 1CWUA 1XDUA 1M8JA 3H7IA 5T67A 2ECPA 1MZEA 4JYYA 4BVBA 1VMAA 1FMLA 2PGXA 2PKYX 2Y6UA 2J41A 4UHJA 4YC7A 4YBZA 3KKKA 2DH6A 1T0KB 1RBYA 4NTXA 3KJNA 3QWIA 1OFUX 1IN6A 1DBSA 5DISB 1RWPA 2H5IA 1UQTA 2QROA 2YV2A 3MN1A 4G5QA 1VMGA 1PIWA 2W6QA 2Z4SA 4Z1MG 5HCNA 4OJYA 3MFQA 3OA2A 3KE1A 4PVCA 4RJKA 1P72A 3PJRA 2HGZA 2GUZA 1VSQA 2XNHA 3JV7A 3RG2A 1PT9A 3L8CA 3CLTD 1ZJZA 3VHXB 4V0NA 3P7MA 5FI5A 1Z5NA 5YASA 4YMSA 4ERNA 2EZUA 4JBHA 4KVZA 3RFTA 1FDVA 5AJZA 1XHEA 2M1XA 4KE8A 4X3CA 2W37A 5HCUA 2OWDA 3OQMA 2ITDC 3H1JH 2HBRA 3AZPA 3H7AA 3CNEA 3KEGA 4I55A 3LX8A 1Z7EA 4HO1X 1WUIS 3K57A 4W6ZA 3E5HA 3G1UA 3TXQA 2H48A 1Y1LA 5AW9A 2SKEA 1PR2A 4R0MA 3OLWA 4OHRA 4QU8A 3GNTA 3CR7A 4Q9IA 1D4FA 1R9GA 1H93A 3K6RA 1ZK1A 1ELOA 3NGXA 3RS2A 5KNCH 3FAVA 1L8XA 4CR6A 2BAGA 2PAFA 1DMSA 3LWOC 2LGJA 4CM8A 4GI5A 4D4IA 4YRAA 4Z49A 1KQPA 2P06A 1BWPA 1A7KA 3I9MA 2Q5ZA 3K09A 3DC6A 3IUNA 5DDIP 5FPTA 1YVWA 3EHEA 4HAYA 1K2WA 4M76B 1EPUA 1O94A 4BT3A 2I4MA 5KA5A 2VF8A 3CNNA 3OBBA 4Q9JA 4MEAA 4BV2A 1S8AA 3MJCA 4KXQA 4EY3A 2PGGA 2HCRA 2Q99A 4XD7D 1QZTA 4D9EA 1Q14A 4EFKA 4G0UA 2P5UA 1A50B 3DOIA 2HQSC 3L43A 2L26A 3IIIA 2NZ2A 4EW1A 1KUQA 2BEUB 3IMKA 1Z22A 3KR2A 4IS3A 5I3CA 4XIJA 1XRNA 2D13A 2XD4A 4GSLA 4FOSA 1C8KA 4PLGA 2GJKA 1YCDA 2GPTA 8ATCA 1NZ6A 1FP2A 3BORA 3D3JA 3K14A 5PNTA 5GAJA 4D82A 4E4YA 1VJCA 3WY9A 4F8JA 2XCSB 2I1LA 3L70H 3BAAA 3VR1A 2VGNA 1QAQA 2PKCA 1XEQA 1EE1A 2WA4A 3KCYA 4ZKIA 1QQCA 5EE9A 2C4UA 3MT7A 1Z6ZA 1PL7A 2ADPA 5G41A 4R40A 4NCAA 2GEDA 1HFEL 5JR3A 3DE3X 4FEGA 3OFJA 3BXGA 2PDAA 1NM5A 2KBEA 4X90A 1JIKA 3TIGA 1E79A 4N8SA 3RYIA 4AUKA 1XU7A 5CNMA 3ZDZB 4NBKA 1Y9JA 5JZSA 1NP6A 3HDQA 4AWBA 3PEWA 3AIMA 5FNVA 4QG3A 1SCJA 3OD5A 3WPWA 2G08A 3IP6A 4B3MO 4Z54A 2OCKA 3A1SA 3KJIA 3OT5A 4OJMX 1WQ3A 3LP6A 3NCTA 2PX5A 1VRWA 5I6DA 3DV0A 3DVSX 2WYIA 4HJXA 3UVEA 1W36D 1KEVA 3DJYA 1CP3A 5CYPA 4IWNA 1SUSA 4ECEA 3OX3A 1W4ZA 1YZKA 2O0MA 5TPWB 2ZQZA 4KE7A 5KQRA 4CDMA 4RTPA 1PDWA 2H3HA 3ONVA 3DLBA 2WDZA 3E9CA 3V5NA 5K4AA 1C4KA 4IIFA 1RAEA 4B0PA 4BFXA 4LA4A 1WPGA 4EEXA 1OCRC 1VQMF 1CY2A 2GA9A 4KTTE 1D4ZA 1HC7A 3FSEA 4MVYA 5JD5A 2F1MA 1U2DC 4O1MA 3LDCA 1JDUA 1R8JA 2BM0A 3GH1A 1ILWA 4IKPA 4OQEA 1S4QA 3ZHXA 3UMMA 4MW3A 4J49A 1X2BA 4UBJA 1HKHA 4G8DA 2BTQB 3IFXA 4EENA 3RIMA 3DUFA 1JYEA 3D0QA 3DEYX 3JQPA 4WZAE 4EABA 4JYCA 5LZ4A 3HGTA 5LGTA 1OVMA 1VE3A 3CURA 2P8JA 1EEXB 3HCOA 4MWDA 1U40A 1KDPA 2I4OA 5HIKA 4P92A 3R7WA 5UKDA 2UYNB 4K9MA 5EXTA 5F5LA 4B8ZA 2WLLB 3BFPA 1ZUWA 3LDHA 4B4OA 5KNBD 2FPKA 2YZNA 3PJSK 1H48A 4BJ1A 4EYSA 4MWOA 1LW7A 1LLQA 2QTNA 3DVRX 1XZMA 2XITA 4M7OA 1HBJA 4YCLA 4RM2A 4LJRA 3VH3A 2W9XA 4GWLA 3LLVA 3QY9A 2GESA 2XMGA 3D2AA 4TYMA 2JFFA 1W25A 3STTA 2NUTB 3VKUA 2Z2IA 1BGXT 3WRXA 4PA6A 4LRYA 1GZ5A 3JD3A 1RADA 3DWIA 2YL2A 3NYWA 4W82A 3RTCA 2RG7A 4FKZA 3CINA 4R7GA 5ARDA 5G40A 4AFNA 221PA 2F59A 4DJDC 2O6LA 3R3XA 4LQLA 4D3DA 4A15A 3I6IA 3Q87B 4PO8A 1IDOA 1HYGA 3LMEA 1PW5A 3HY6A 4LJSA 2AEFA 3GW8A 1WAZA 4W1SA 1JUDA 3ZNOA 4CI0B 4JXZA 2VP2A 4WFIA 1QF7A 3RPEA 4I0XA 1IHXA 3CMCO 2NLJC 2ZYDA 3KPJA 4DNOA 3NBXX 1MB0A 1JS1X 4G0XA 1CDEA 3CRQA 1ENYA 1MMFB 3DBOB 4PWZA 3COVA 5EZ6B 4R7TA 1N5JA 2AKEA 1M6VA 1X7WB 4MW4A 5H2FZ 4IRUB 4URUR 1GLGA 2R85A 3LSYA 4TSRA 4MGIR 4YAJA 5BRAA 2D7JA 4GAEA 1H0RA 1EN6A 3R5SA 5JS7A 4B80A 4B75A 3O8QA 3HZRA 3FMOB 4UAJA 5AG2A 4MVJA 4UZFA 1YH3A 2AX3A 4MARA 3VTZA 1W581 2NSHA 3QRWA 4GPEA 4IVRA 4A0SA 4DIOA 3DDZX 1V3TA 5T4FA 4A9AA 2IHTA 4RKFA 1K7DA 2C00A 2YCLA 5HPYB 2IHVA 1ZCAA 2IUYA 3UXEA 4OGKA 6YASA 2X6CA 4F4LA 1D1QA 1UDRA 5E1AC 1HTTA 2CWDA 3J80N 3QMVA 4K9NA 1HR0B 1IPFA 3CZ5A 3NVDA 4I81A 4QVKA 1I7QB 2A8YA 2GNPA 2WG1A 4M60A 2GBCA 2QRHA 1PWEA 3DL4A 1MOPA 4R83A 2I8LA 3KAJA 3W78A 2IOYA 1HPLA 5KHAA 2P91A 4H18A 821PA 3TJTA 1Q82H 1J99A 1P4GA 421PA 2PUDA 4RNCA 3WVNA 3WK5A 3TECE 2HMTA 4Z7QB 1AXGA 1E2QA 2WD9A 4KWTA 4RABA 3WDMA 3X43A 1Z7YA 3QVXA 5KX5B 2QDXA 4DLRA 3TLAA 1S76D 2VF2A 3DZIA 3BFVA 1VI2A 3ZKAA 2IVFA 3OIFA 4N18A 4QRIA 1EUDA 3ZY4A 4PW0A 2G4LA 2ZQYA 4EF6A 5BUCA 3S03A 3NX4A 2HM7A 1NH2B 2EERA 2H63A 3GCDA 1Z0ZA 2AG6A 3HRIA 4YMUA 5K99A 2ONKA 4F93B 4KL8S 2DFDA 1EDDA 2IQIA 2I71A 2C9OA 5LQMA 2D5IA 4U39A 4YB8A 3Q1LA 2IEYA 2DHEA 4I50A 1FP4A 1SOAA 2HMYB 2OK7A 2NYAA 3KJGA 4LYDA 3T0IA 3QVLA 4Y6QA 5L3ZA 3ULKA 5ICMA 2Z6QA 1OWNA 1TAHA 1OW3B 1PR1A 2C9CA 3OLXA 4JLMA 3GCGA 4ZANA 1QGED 2XYQA 2XBMA 1IXZA 5JWPA 4AK9A 1JEQB 5A9GA 4URYR 3LUHA 1U99A 2H08A 1UAYA 3KJKA 2JJ8A 5L3DA 2WUWE 2X8JA 3H05A 4MJXA 5J63A 3TW6A 5KSOA 4LBWA 2EV9A 3IA2A 1G0NA 3L06A 4DAOA 1W30A 4PIVA 4PDRA 1XCJA 5E79Z 2XE4A 2Z5FA 4MEJA 4N82A 2HS0A 5KZMB 1W36B 5CP8A 1G66A 3E7FA 4TVSA 4DV3B 2XA9A 3GY0A 4UMVA 3MUFA 2GFHA 2UUBB 2I34A 2LCIA 3AHCA 4R40B 3R5XA 5ENVA 3WMXA 3J80A 4IO0A 3RVMA 2GNAA 1G1AA 1U7XA 1ITZA 1P6QA 1UBEA 3Q2OA 5H6QA 4HFNA 3WYGA 4DQVA 3TGPA 2N48A 1Q7EA 4OPHA 2DT5A 4RZXA 2VQEO 3GD7A 5FYQA 5IY5B 1ZA2A 4EQ6A 1LBEA 1T2AA 4J0FA 3IKTA 5DP2A 3UT0A 3ZJZA 2BFEA 2P4QA 3OM1A 3PX7A 1N2HA 1OIXA 2P6NA 3DLIA 1RZVA 3O92A 2VQFO 4N5IX 4L15A 1XLTA 5EMNA 2NXWA 1U8FO 3K1AA 1N5MA 1KXZA 3CIOA 5EIAA 3T1NA 3I1YA 5FWAA 3P9QA 1CF9A 4I2NA 4OHKA 4PGAA 2WUFA 1Q0ZA 4ETWA 4YUZA 1HE4A 1UZUA 2PS1A 3N6RA 4XQGA 1I01A 4PX2A 4YRIA 1VE9A 1P7BA 2ZUCA 3E7XA 3PDWA 5AM5A 4UE3S 4R6XA 3ZI0A 1YZQA 1JA9A 1ISFA 1DB3A 1ESEA 1SEVA 3ZWWA 4QPJC 3SPJA 4R8MA 1C9JA 4HGQA 3MBKA 4Z8XA 3KJHA 4QQRA 2VCHA 3TD5A 3DYVA 4XASA 3EGEA 5DSZA 5F2KA 2FQYA 2XCQA 3ZWYA 1QBGA 3A6JA 1Z7GA 3K16A 1YBHA 1RHQA 3I3FA 4AZVA 1WEKA 3TGLA 2OVFA 4BWVA 3N3BC 4ZAYA 2A0KA 1GFZA 5K2MA 4LSWA 3T94A 4GKBA 3EZ2A 1EQ2A 1C8VB 4D5GA 5K45A 2P6UA 4O4JA 1PS0A 3NKLA 3IAM1 3SQWA 3QOWA 4XWTA 2Q8PA 5ALUA 1XILA 4D41A 1JFFA 3MLBA 2G7ZA 2ET6A 1RQNA 3JARA 2EGUA 3FWZA 2X15A 4LYEA 4TWKA 3D36C 3NIGB 4LF9B 4XDGA 4DNFA 2W6ID 2XSZD 3MGGA 5IYZA 4NMHA 4LISA 4QXOA 2PUCA 2QAGA 3ZBHA 4R98A 4KGZA 4RVUA 1GNLA 3OCYA 4ND4A 3A4TA 1Z38A 3LL4A 5SYMA 1NQ3A 3QSYA 1C30B 1QFZA 4G0QA 1W41A 1J97A 3UNXA 2X23A 3DFKA 5FOVA 3AGQA 5ILOA 2R7MA 1IWPB 1GXSA 3NHFA 4BNUA 3UMFA 4AF8A 3PUYA 5K3BA 1QQAA 1XL6A 3WJRA 3KB6A 4O4HB 3GOHA 4GG1A 3EA4A 4TLLB 5FB3A 4DT1A 4DREA 3PBKA 1UXIA 2X42A 2LFSA 1GZ7A 1AR1B 1NLZA 3PD0A 2HDWA 1WQ4A 5ITZB 2OY0A 2J67A 2PMKA 3RS0A 5CFRA 1TZ2A 4C82A 1CF2O 1CXZA 1Q16A 3F5DA 1AKUA 5CT4A 1YUMA 1MA1A 5HGJA 3UIEA 1JHYA 1P0QA 1SBZA 2EDAA 1FRZA 2PUJA 3RCBA 1P31A 4DNQA 4F84A 3TWOA 2VRNA 2Z4TA 3R0PA 1B73A 3MIZA 3GFTA 4IJWA 1E1CA 1CEXA 3BTUA 3DTYA 4OKIA 5E7QA 1K5QA 3BGWA 1GP2A 1PR4A 5CX1A 1MUUA 1QJCA 1YDWA 3NC0C 1T5HX 4WCFC 3NATA 1A27A 4N0PA 4Y2QA 1W0KG 2OB1A 3CNLA 1HDCA 3ZLBA 2D8MA 1QP0A 1EVEA 4W4KA 1E5XA 1K88A 2Q9BA 3NK6A 3BMNA 1IVNA 3EXAA 3GFRA 4IGAA 2ZDIA 2XKAA 4IIDA 1L7BA 3BCCH 5I01A 2Y0IA 1BFUA 3BE5A 3HACA 1NUHA 3QFHA 4S3MA 3RHSA 4EUHA 4EY4A 1WAMA 4L73A 3L8MA 1RR6A 3Q8MA 1K9MH 1QIGA 1VZ3A 1U0RA 1K75A 2QRUA 1DV1A 2VS1A 3N75A 4H7DA 1F38A 1UJ5A 1EX1A 2VWHA 1XMXA 3B1ZA 4N6OA 4Q5IA 4UVGA 3ZQJA 3JAKB 2OHGA 3ZW7A 3CE6A 1AQJA 1ENOA 1Y4AE 2GMWA 2VWJA 2FWBA 5HG0A 2IHYA 3GLFB 4DW0A 4QLAA 2CZQA 3O9OA 1GTL1 2DBVO 2GF9A 4GVLA 3L41A 4QT4A 4CIXA 4I4LA 1L6IA 4IOKA 1AUVA 2EJRA 1Q21A 1JAYA 1Y8ZA 3CC4V 3K2XA 3ABMC 1XNGA 2A84A 1J95A 1JXOA 1IUPA 1W19A 2FPLA 2IE8A 3A1CA 2FW7A 3IOYA 5CDFE 1ZA1A 1QH8B 5IE9A 3KQVA 3CRNA 3MMXA 1TB4A 2KX7A 2N04A 5BT9A 3USES 5LNK6 2WPDG 4WN9B 4O2RA 2IJKA 2P1DA 3ASYA 4LF5B 1C3JA 5FUBA 1IFXA 4R1SA 3SJCC 3QLVA 3Q3VA 3ROFA 2O2IA 2SCUB 4HEA1 4RWZA 1N8RW 1OBOA 5JJBA 3C87A 4OHCA 1VCHA 2I2XB 3DT9A 2RCNA 3W9SA 2HSZA 3KQNA 2VSXA 2R84A 2EZOA 1FL9A 1QIDA 2VDWB 3BSWA 1YR9A 1WD5A 1QWOA 1XROA 2REQB 3GBPA 3JU3A 4G26A 4Z9BA 4F60A 4UQOA 2Y0CA 4UNRA 2F6RA 2HJSA 2ZVDA 3AOEC 4QPDA 4TS3A 4WZBE 1VEWA 2EQBA 1Z6TA 2PBRA 2W2LA 4A91A 2VZEA 1RJ9B 1P5HA 2DQ4A 2IW3A 1DGSA 4BLTA 2RQ6A 3NWBA 3BYQA 1Q22A 1PO7A 5I47A 2W6JA 4EGSA 2WIKA 4DY4A 3EPJA 4FD3A 1D6JA 1QHSA 4BU0A 3LBAA 2GEFA 4KDFA 5SICE 3VOUA 1DMRA 2QJWA 4Q0MA 4DADA 1U1DA 5SV2A 1Q7GA 1LPOA 1XB2A 2XA2A 4KQ6A 4Q3KA 4I99A 2B21A 5FXMA 2FZWA 3D4BA 2BO1A 1E3IA 4HLUA 3ZVKA 5HJ5A 4PFQA 1OOEA 1IM5A 1DKQA 4RY9A 2EFCB 4ZEWA 1F0YA 3WLPA 4BZPA 2WC1A 1XMJA 3WLEA 3H11B 5A4IS 1G7TA 1VG0B 1LBIA 1QHHA 2O7RA 2PZ8A 4TV8F 1M5UA 1EJBA 3FIUA 5HF8A 4Z5XA 3FETA 2QDOA 1BAPA 2Q6TA 3VSEA 1XLWA 3FLBA 1TEVA 4BHTA 1E3WA 4MUBA 2UVPA 5JZOA 4XWYA 3B3QA 2OHFA 3CT4A 4QXMA 1Q81W 3CCRV 1DRVA 1UOOA 3ABOB 3SU8A 3N53A 4H60A 1YJXA 2QPAA 3ILXA 4FSDA 3TJZA 3RAFC 4JXJA 3VKGA 2ODBA 4DMFA 4Z9XA 5IWAO 2DCMA 1IVYA 1HV8A 3HSYA 1BHAA 2WSSG 4IMPA 5KDDA 3HJAA 3O8OA 3RK1A 4JTCB 2AN4A 3ABLB 3KYCA 3FZGA 3MK31 1TT5A 2HEGA 2VJMB 1IZ8A 4M9QA 4RFSB 5IMBA 5TDHA 2PRZA 4BRSA 4LJ4A 2RAFA 4DSZA 5A9SA 3A0BZ 1H3EA 1M10A 3CNHA 3MGKA 3KYBA 2BMFA 5JE8A 4I1YA 2EX0A 1VQ4F 4E15A 3ZHQA 2RGDA 4JT2A 2X8AA 3CBQA 4MIEA 5IS2A 5KO2A 1EIWA 3QXHA 4BFYA 3TLCA 1Y80A 4QOEA 3CVVA 1V7QA 1KZGB 2E87A 4EGQA 4M0KA 4FHGA 3AUAA 1FLVA 2F8LA 5B1OA 5HOEA 4S24A 5FUMA 2BGWA 4IH4A 3UM7A 2QUAA 3LKBA 2ORWA 1Y6JA 4KIJA 3E3AA 4QOFA 5D3ZA 2R68A 1KZ7B 2DTXA 2GS9A 5IUNC 2Q5HA 4Q3OA 2GILA 1T2UA 2ILVA 4DV7B 1K97A 2WYOA 4TOIA 3MA0A 4G0NA 3HL4A 3HCEA 4K9RA 3PC8A 4OO3A 3AHIA 1EHCA 2O3SA 4D0NA 3K70D 1SZTA 3ZKWB 3VJKA 4Z7JA 1YS1X 2GD6A 3ONNA 3AHHA 4X3PA 4BW5A 2AW9A 4JGSA 2Z1FA 1A95A 4DUYO 2X1HA 4J8PA 1NOKA 4M3NA 4MICA 3WK9A 4B33A 1KTIA 1V3UA 2VC2B 2W93A 4FDUA 5JYDA 5TNXA 2BM1A 1YR8A 1AO3A 3AXTA 4JX8A 1YJ9F 2Q6IA 5AXAA 2PRKA 1LBTA 1W85A 4MTXA 2O8FA 1H23A 3DWEX 1X87A 4B6PA 4PA9A 3K4PA 1FPQA 4MS3A 1BRTA 3HBAA 4NIMA 3PNLA 1EM8A 1CQXA 2CFOA 5CEJA 5KUTA 3NRCA 3HA5A 3AUFA 1S3IA 4DLYA 4MQ5A 3IDAA 5IXSA 1P3Y1 1YQGA 3GLFE 3A2MA 2G0NA 2PKRA 1X0VA 3GB9A 5EGSA 2IOQA 3FNBA 3K5OA 1V11B 1CS0B 2D0PB 2FI1A 2JEZA 2ZG6A 3GYQA 3ETNA 2W2KB 1U2RA 2EFYA 4P7FA 1JU9A 1K3TA 1XN4A 4OG2A 4TS1A 2NPIA 2XE6A 3SZUA 3ON1A 3D1LA 3N9IA 3A6ZA 4G97A 1PR5A 4C2AA 2FX3A 4JP2A 3RIXA 1NQUA 2VAWA 5D5HA 1K4YA 4B9AA 1JHMA 5ALRA 3JAWB 1ZISA 1M2HA 4II2A 2DBZA 2PWPA 2V6IA 1BX0A 1KC8W 3UUGA 3Q7IA 3PTAA 2BSKB 5FBQB 1I0HA 1ZZGA 3I4FA 1O0BA 2XMSA 4HEJA 3TO5A 3RBZA 1ZLXA 3WBFA 4FIZA 2GWHA 1L5WA 1Q92A 2PSHA 2YVUA 3NASA 4POAA 3AR2A 4ZI2A 3R0ZA 1KEWA 3IIMA 5FTJA 4M8IA 3B6IA 4DDKA 4Y98A 2Q69A 3AHGA 1C9DB 1Z75A 4U5XA 1QRDA 1KDOA 2RGNC 4S1PA 4OKNA 4A0QA 1RQPA 1J56A 5JQGF 1GPWB 4FFBB 1LFDB 3UO8B 1UPUA 2VUIB 4FE4A 1P2FA 2OQVA 3IAHA 1UPGA 1UBFA 2XWSA 3B6MA 1BN6A 3OAAD 5JZ9A 5EPUA 5CLFA 3Q7RA 1FFYA 2EBWA 1T0JB 1WZEA 3SJAC 2I4TA 3HBFA 4IQGA 5B4VA 1G20A 2PPVA 1PV1A 3FWPA 5CFOA 1OY1A 2WUVA 1JEAA 2C83A 2YXZA 3M4ZA 3GROA 3K3WA 2ODNA 1X8KA 5JWOA 2AQIA 1LS1A 1Z5UA 3A70A 3EUWA 2RHTA 3ESXA 2P9GA 2ZUDA 1MZPA 1BS9A 5IW8A 2AJBA 5H16A 3DXZA 3I5YA 3N0XA 3LCJA 3FPHA 3ZMUA 4OP1A 5F3RA 3ZLJA 3IPCA 2KLBA 1C3LA 4UDXX 4B2YA 1ZK0A 4JASA 2Y4TA 3ZP7A 4V3CA 3E5NA 1L7VC 4V0KA 4MUMA 4HDMA 3H8VA 2BMWA 4IHAA 4P38A 4BMVA 2CCGA 2VJLA 4AP9A 2C9BA 3PICA 1W36C 1H0KA 2JGUA 1NN1A 1U7HA 4RTQA 4TLAA 2ZIFA 3HZZA 1HLPA 1OR8A 3LWVC 1G21E 2H51A 4MV9A 2HR3A 1T2VA 1F2TA 1M9NA 1DAGA 3KU4A 1C50A 4JLDA 3F47A 4LRUA 4M8KA 4MVJE 3AYXB 1RRMA 1KZ6A 4RKYA 4L75A 1Z36A 5FR1A 4X54A 2GLXA 3N7AA 4I5EA 3KSBC 2ZYUX 4HWOA 2PWAA 3IKVA 5KKCA 1XD9A 3LLSA 1EHIA 4ZRNA 4BL5A 4YMTA 3C8LA 3QOFA 4UE6A 1HDRA 2MJLA 2OEPA 4FP9A 4XR9A 3SIXA 5TJHA 4MVJF 1PF5A 1CP9A 2Y1EA 2YWBA 3AV3A 4Y67A 2Q8NA 3DB1A 2G17A 3HFRA 1W5TA 1GAXA 4TTIA 3WC4A 4NH0A 3WLOA 4CDGA 5FPPA 5EIEA 5CVCA 4ZGWA 2KB1A 1D07A 1DL5A 1LDMA 1RXEA 2EJTA 2PU7A 2V6MA 4G4JA 4HX2A 4PN7A 2JHFA 2H8GA 4EJSC 1QV9A 2OK8A 1GN2A 1UP7A 1E5TA 1IN8A 2JIDA 4QGAA 1FBNA 3M2TA 3WICA 3MS4A 4E5SA 4HB4A 4OXQA 1A2QA 5FOWA 4BNLA 3IHTA 1D0VA 2FFRA 4DCSA 4YXWD 4NFYA 4OY3A 3IO3A 4XLTA 2EC5A 2HFEC 2AZ2A 1N1MA 2XXAB 4G24A 3RGGA 1ND6A 1QKJA 4M1MA 1SB8A 3QJYA 2BFNA 4I46A 3WMFA 1XE3A 1X7DA 3LKZA 3EJ6A 1YBVA 4IINA 3G2IA 3TQFA 3CLUC 5H1YA 3ZBUA 1BDHA 1KAGA 2DHQA 4NS1A 3S2EA 2OLKA 4QODA 2KTVA 3ZWBA 3JPWA 3MHPA 5AW1A 4Q7KA 3CCCA 2W2XA 4Q37A 1SIBE 1WDKA 4BAYA 1FFWA 3BWMA 3LP8A 2CDRA 1QYCA 2EKBA 1H6CA 3FVTA 2Y1WA 4KRXA 4EWLA 4RTKA 3CU5A 2WQ7A 4UBMA 4K8RB 3G8DA 1LPBB 4B4WA 1X80A 3BA9A 2RH5A 1YE5A 2C3OA 2CF6A 4NESA 2P6YA 1YVUA 3C4JA 2E18A 1DKUA 2XZPA 3AHJA 3WMRA 1M33A 1SQSA 4HAXA 2GD0A 4I1VA 4N3CA 1RI1A 5JCJA 4EW6A 8ABPA 1YF3A 3ICEA 2ATKC 2V7BA 1TADA 3Q12A 1QU9A 1M6WA 2QP4A 3HLYA 3QYPA 4E3ZA 4HPWA 1I7DA 3IL2A 1UODA 4HN2A 3CX8A 4E30A 3E0XA 4CG2A 1E2KA 1VPEA 2PJRA 2WHRA 1HT1E 1JJFA 3EAQA 4M89A 3ABTA 1PQPA 4U7PB 1UBUS 4TKVA 3BH7A 5CN0A 3IQIX 1TTPB 3PNYA 3JSXA 4J2OA 4A92A 3OD1A 4ESHA 4YYEA 4LF5O 5JNSA 2M6RA 2YIAA 2AHZA 2YVLA 2ZT8A 3PXAA 3ETDA 4ES6A 2FPGB 4GO1A 4MX8A 4FCTA 1N5OX 3E70C 4FDMA 4P5DA 2OCIA 1VQPF 3SYAA 1DXHA 2C5GA 3B6KA 1ZRHA 1QG4A 1QV6A 2N47A 2WJ3A 1PNOA 3D3KA 4BLSA 4D2IA 1ORIA 3D4LA 4BIZA 1AS0A 3HCWA 3R77A 2FP4B 2QSYA 3BHJA 1KD1H 2JJ1A 4KXFB 5DBEX 1NXPA 1FJGB 2JHAA 2ZRMA 5LIPA 1US8A 1OI3A 2QXYA 5HFAA 2CEAA 2W2OA 4R3WA 3UMSA 3MCAB 3IJEB 4FSHA 3WNDA 3FSRA 3PCTA 1T5LA 3NC1C 3WWYA 3I32A 1BDJA 1WMSA 3G80A 4JAUA 1J90A 1Y5LA 3TD3A 1MGPA 2HIAA 3WQRA 2DKOA 4ZQBA 5KWJA 2XNDD 4N21A 5DCUA 3QWFA 4WXPA 1RVDA 2I29A 5BN3A 2RMKA 2UKDA 3C7DB 5BSGA 2D2EA 1PJRA 3OEHD 3L01A 2OP0A 4GPBA 1IG3A 1NZFA 3K3PA 4FFRA 5CHEA 5JLAA 3EFFK 4I55B 3CBGA 4OXRA 3B9RA 4QOSA 1PWXA 1BEEA 2ZTSA 3KTFA 1KKDA 3FUCA 1UDXA 3LBHA 1ZJYA 4M7RA 3VKFA 1G21B 1MVNA 4LTNA 5BVHA 4LIPD 4FE3A 5K0FA 1GUZA 2HO4A 3RW9A 4P0PB 1UM9B 2DFVA 1BVHA 4JI7B 1IN1A 1JLLA 1TUBB 3BH0A 3CLRC 2DR3A 1SG9A 2LGWA 4CH4A 1CVLA 3GNQA 3O3NB 2FMXA 4IVQA 3I58A 1WXHA 4LY3A 3AVOA 4S12A 3KS9A 2WM2A 3DCJA 4FR0A 4KMSA 3AYZB 3ORFA 4YO8A 2QSZA 4BTVA 4RGQA 7REQA 2BWJA 3PF9A 4D8TA 5FKJA 2R4TA 1ZUIA 2W4QA 3DO8A 1YE3A 3O1LA 3HXLA 1Q2UA 1CY7A 2XR1A 3AM4A 3WQSB 1DG3A 2B1QA 3NIBA 2VYNA 4UTNA 4B3GA 3AKYA 5IT9A 5GTDA 4EY5A 1LRJA 1P1IA 1H6BA 5SYAA 4C29A 2PH3A 4M98A 1SCBA 2H1LA 4YAIA 1B4DA 3RVOA 3SDLA 2ZRIA 1A7JA 2QVZX 3M6IA 4DLSA 5JCZA 1BHQ1 2O8CB 4DVGA 4HYYA 5JALA 1XZAA 2I6RA 1XMOB 5HFMA 1Y9ZA 2ABWA 2OMKA 1D2RA 3BKWA 2QWNB 3CTPA 2JZCA 3I2JA 4U7OA 2ODEA 3H42B 4OXYA 5H6RA 2V9PA 1QHGA 2FYUH 1NT2B 3HR0A 3BG5A 1EQAA 1UC5B 4WNAA 1YDHA 1Z8FA 2O1SA 3ZGVA 4L7VA 3IE1A 3EK2A 3QPWA 2CW4A 3MDSA 1E0DA 4IM7A 4CM9D 2IYSA 4MWZA 4UJ5A 3WXMA 1MORA 3WQBA 5IDQA 4CF5A 5GW7A 3D7KA 5HIAA 1VLMA 4REMA 1QLWA 1COMA 5KSZA 4KFCA 5DLQC 1W76A 3CSUA 2YWCA 4CV2A 2DUWA 5F51A 4LK2A 5JCPA 2JFBA 2HXYA 3GFBA 3RSSA 3QHDA 3PC7A 4PGGA 5THXA 3LW8A 1KNKA 5LB2A 2GHTA 3FYCA 1VYHA 4N41A 5LU8A 3MJ4A 3E22A 5KVAA 2FMTA 2C99A 4KFSA 5EJGA 4HNAA 5EGNA 1PFYA 2FK8A 2GBOA 4NCIA 5EZYA 1AF4A 2IZ7A 2IIVA 1MGOA 4RF3A 4R41A 4LYAA 3GZNB 1RAHA 2HX0A 5KC8A 4QGHA 3OMXA 1G8FA 4F1KA 3BSYA 1DC5A 3KJFA 3OTHA 5HKKA 1NF2A 3OVMA 3PXCX 1SRYA 4DS3A 3BRQA 2Q9LA 1DT9A 1NBIA 3D0OA 2D74A 4WVFA 3JYHA 1KYQA 1WL8A 3EZGA 1VJ1A 1NW3A 4KQKA 2B94A 4MVUA 5FT9A 1EAMA 1WPQA 1NF8A 3V1LA 2W7TA 5KYWA 2PV7A 4FS8A 3UHJA 3AGPA 2VZ8A 4Q4LA 4K8OA 5E6RA 2G9NA 3BXHA 4CHGA 1NVWQ 3UMGA 1PTJC 2PLAA 4CYMA 5IMSA 2C0QA 2JS3A 2RK3A 1GZ0A 2YXEA 3LDGA 4QLOA 2XQFA 4TXHA 3AI2A 5CNIA 5G3ZA 5ESDA 1TYDE 3M7IA 3P4EA 3ZQUA 3S06A 2QRJA 1R37A 2NU6A 4G67A 4H4DA 4ZAXA 5HF6A 3SCZA 4PRKA 3H18A 4FLVA 3NYRA 4J0GA 3FR8A 1YO6A 2K2QB 2OUIA 5HQJA 3X1MA 4NBVA 2GD1O 2ZI5A 3M6MD 3T2MA 4TT8A 3T15A 3VU9A 1KYIA 2RGAA 3KSDO 1XZHA 3CNBA 5EYPA 3ZE9A 4RHTA 4CGZA 1OH8A 1AT1A 4MAAA 1OV6A 3O1HB 1L0NH 4MS2A 1A88A 2QU8A 1MKYA 1L8DA 4G4XA 2AEMA 1PNKA 1R4MB 1RFLA 1LSUA 3KJXA 4UM9D 1L5NA 1FDIA 3PUKA 5AVOA 3H5AA 4D43A 4DMRA 1JILA 2RGGA 4MUAA 2H4HA 1KQSU 3VU0A 3P1JA 4PZEA 5CB0A 1KTVA 1X0XA 4INPA 1DGQA 4US2R 4JJGA 2G82A 1NJSA 3AF0A 4JEUA 3BILA 1KQNA 3U7IA 2A9PA 5JWHA 1JECA 1L1FA 3K5NA 4XCQA 4K6GA 1K8AW 1TMKA 5HFNA 1PSDA 1LDYA 1I5OA 1P19A 2WIBA 2G9UA 3RT9A 4NEHB 3R7WB 2GZLA 3LRPA 1BTOA 2R8OA 4Q9HA 3HP7A 3RW0A 2AOTB 4PLHA 4RESA 4CKWA 3HGQA 4BMYA 4NDNE 2IWHA 1C4OA 2HP0A 2YQ4A 5IABA 4Q9DA 1ROPA 2UXCO 1TDJA 3BIWA 3R5KA 4BNYA 4FONA 1GWNA 2J8ZA 1YU6A 4LZLA 4CUZA 1C1DA 4G8CA 1J33A 4WKGA 1QNMA 5GJBA 2EX1A 3M9XA 5CDSA 3C5VA 3GLTA 1W5AA 4G56A 3DKRA 3GT0A 3D7LA 4CLHA 1JQKA 3K20A 4BASA 5BXQC 4WCVA 1C14A 4YP6A 5EJEA 2C4KA 4MS1A 1HP8A 3ZU3A 3I1FA 1PJZA 5B53A 2Y1FA 3ZWPA 4J7JA 2Y1OA 3PQ6A 3ER9A 1Z73A 4XZ3A 1N8SA 4QPZA 4AHCA 4Q01A 4P8RA 1NI4B 1IJEA 1IOZA 1PJ3A 3T1YB 1P60A 1Y8QB 1BA2A 3F4LA 3PNQA 3CXCU 2GRAA 2QTHA 3AEUA 4AM8A 3FJYA 5E3JA 2NTJA 4RDXA 1KWKA 1Z2PX 3IXLA 3Q6MA 5KHHA 3K0GA 1OXSC 4LW8A 4IYHA 1ECFA 1N3LA 2B6NA 2F43A 2H1HA 1OA1A 2I67A 1KH2A 2ORED 4PZYA 4Y9RA 2Y67A 4WBNB 3MMSA 3UANA 1Z17A 3OQPA 8AT1A 2BHRA 3W06A 1U90A 1AE1A 4WFHA 1TYBE 2J3LA 4NWIA 2Q7OE 4BKMA 4DDWA 4WXMA 5BNIA 4UMDA 1JD1A 2CVPA 2BEKA 3DMRA 4PV1B 3T9FA 5KNCD 4K35A 2JRCA 5E9WA 1QRSA 1EZ4A 3DZGA 4WY2A 1GGKA 4JI5B 2AKAB 2ZVQX 3CCEV 2G5CA 1G63A 2JW5A 2YXDA 2X40A 1JJAA 1Z08A 4FUQA 4P4LA 2IH4A 3BVOA 1T8WA 1DG1G 3Q0TA 4EB6B 1SQPH 1IEXA 2GZ3A 2PBFA 4ZZIA 3EVDA 1VL5A 1KKLA 2HHAA 2PUBA 1OTXA 2J9RA 5E3IA 2PX2A 2WB2A 4M1TA 4JZ2A 4EKWA 2IUFA 2R5NA 4G5FA 2IY8A 3EG9B 4HCJA 1SU4A 4BX8A 1Y8RB 4KVAA 4DLAA 4M55A 1RKQA 1AJNA 2IJHA 3AI3A 1JSRA 3ZHZA 1VHQA 2AEJA 3MNFA 1BJTA 2PX0A 1KE1A 3GLIB 1W4BA 4LVCA 3MWLA 2DWUA 1Y3HA 5KEIA 1EUCA 5K01A 1DS6A 1NMXA 2QJRA 4L9SA 3LC7O 1RJWA 1A9YA 3T5PA 4KHPO 2ARKA 4IV5A 2XVMA 4EJSA 2IGTA 1R6UA 4FFMA 4LKRA 2IJGX 2X1VA 1DUIA 3O93A 4LXTA 1AZTA 4FHCA 4J0JA 1U4OA 5GGXA 5K4GA 2NNLD 4EQ6B 1SZCA 5JNVA 3FFXA 1UMDB 1KZYC 1MD9A 3GU3A 3OWHA 2YWRA 3BRWD 5HKOA 1PN3A 1XLUA 1BL8A 1IZ3A 4HZUB 1MP0A 3I28A 2LE0A 4YIPA 1X86B 3EW7A 3EFEA 3HPRA 2IJJA 1GUAA 2OWOA 1T9BA 2FFBA 4KVGA 4UU0A 1XEXB 4DTIA 1JJBA 1ZD9A 4WNYA 4DWVA 5A9RA 5FV4A 3QUCA 1QH9A 3RSHA 3SJBC 3RN4A 1N9GA 3L0PA 3LWNA 2OBXA 3A9SA 4AUMA 1Q3TA 4D7TA 1BC5A 5HFLA 2FSIA 1XAGA 1IBLO 2FZEA 2VTEA 3C8DA 5C53B 5FTKA 4EW3A 3RT7A 2EG9A 5GONF 4YGYA 1CK2A 2OCCC 1SVOA 1CY6A 1XKTA 1Z2DA 1RCTE 2BE7A 2BN4A 1T1EA 2HU5A 1ZD3A 1IBLB 2ZSKA 3G7SA 3P9CA 4I8XA 3H2SA 3PGLA 1ESCA 4M8LA 5BW8A 4A3SA 1FZQA 2YDYA 3PPVA 1SVKA 2GPSA 1P3DA 1EVKA 3K0AA 4KIWA 4ITUA 2FN9A 4GHWA 3ID6C 1UM8A 3HU1A 2EJ7A 3HY4A 4FN4A 5AHKA 3CP1A 3FRHA 4J7CA 2HCBA 3TQQA 4CMEC 3OZVA 4KUMA 2O52A 2DPMA 2LIVA 3IQEA 5I8ZA 2H4ZA 4BQPA 3APOA 3CZRA 2XOKG 1DJPA 1QDEA 1N0VC 3BGVA 2H2AA 5IYZB 2XODA 4H6PA 3UK1A 4RMGA 1UWCA 3ZI7A 3AQ4A 4XE5A 2QT1A 4NYIR 2O2JA 1E5VA 4TRJA 5FL7A 5EIXA 3B7PA 1IRXA 2Q3HA 5CEEA 1A0OA 1P80A 4PLFA 1B0PA 2WIDA 4EPYA 1I1NA 1N2EA 4QUEA 3GCXA 1I36A 1U7WA 2EP5A 2IPXA 1JIXA 2YN2A 3D3EA 3K94A 3TOCA 3VBEA 3Q88A 5A6VA 5C8YF 5IZCA 4WXYB 3EEOA 2WFLB 1RABA 1X42A 2OTCA 4YFVA 2CDBA 5FJIA 3WGKA 2LZ0A 3OCJA 1R4MA 5DRYA 2F4VB 5ITZA 2EBHX 2EZ4A 2YJ4A 1KARA 4UHBA 1VPVA 1YIJV 5IZ4A 2AFHE 1NKSA 1E9FA 2BJHA 2HF9A 4CT0A 1DF4A 1E20A 4KRYA 3OHPA 4K0KO 1IZ9A 2GBLA 3OBYA 1TW2A 4R2WA 1E1CB 3DR3A 5IXJA 2X4LA 1D5CA 4G1FA 4MP6A 3TLZA 5K3FB 1OVGA 2B92A 2VRCA 4H3KB 3WWDA 5ISMA 4R2KA 2AOTA 2JH9A 1YQNA 1R0XA 3N8HA 2C98A 2H31A 1M1YA 2HADA 3IO5A 3PJDA 4UUNA 3DDSA 4C7UA 1W40A 1GT91 3VMFB 2CHFA 3P2KA 3P2MA 5IJAA 1PW7A 2Y1LA 4BGEA 5K09A 1W49A 3AKDA 1NVXQ 2I80A 3VNAA 1MA0A 2OCAA 3V32A 5KMGB 4XI9A 1MX5A 5HYVA 2PR2A 1AOXA 3U7FB 1W2WB 1OZ0A 1EWTA 2RGXA 3JVIA 3HBJA 2C7RA 3EDQA 5B58T 2PL1A 3QI7A 1QE5A 1E0KA 1FYVA 3AB3A 1IZYA 5KHKA 2FMFA 4Q7EA 1A7AA 4G5GA 2D5BA 4GDMA 4B7EA 1I1HA 1OAOC 2L69A 3OEED 3SJBA 3VPDA 3KETA 4KUHA 1M0EA 5F2EA 4EHDA 2FW8A 2PUTA 4MDEA 3KJQA 1XYGA 4JZKA 4N3AA 1JSLA 2Z57A 3L46A 4NVRA 1L9KA 3IAM6 5D5PA 2VUUA 5KYVA 1R18A 4YRTA 1QJ4A 5COBA 4F46A 3RFXA 4EO7A 3K30A 3LSUA 2EKZA 3OTOB 1G3UA 3FI0A 3ZNNA 4RHYA 4PJ0Z 1C1XB 5HMMA 1MRZA 5DULA 1U7PA 2D0OB 2XUDA 4FNGA 4I9HA 1I32A 2OTLF 4QOIA 1Y48E 1OI7A 1IULA 3G4SV 2CN1A 1GNVA 4U7DA 3VC2A 2RIRA 3O2NA 4KX5A 4QYTA 2ZM5A 3UN1A 1QQ7A 3MS2A 5CX4A 4OHPA 3U81A 3FPLA 3WK6A 4Z3KA 5EA2A 1NR7A 4KQ1A 5TJ9A 1DT5A 2ZU0C 2CH7A 2MCFA 4X65O 1BRMA 4BKRA 2DYKA 3JD2A 3WWCA 4MWSA 2FEMA 3S2ZA 2J5KA 1AF7A 3FDZA 3PRYA 3CX5F 3VO2A 2FF5A 3S44A 2F3QA 2R6AA 3BMOB 1ULBA 2GYVA 4JIMA 1VSBA 5FO0A 4DV4O 4XR4A 3RLIA 3T5BA 3MWFA 1JKFA 4G36A 4RKQA 5KHGA 4AKHA 1GEGA 2RBGA 5BW5A 1YJ5A 3MTDA 4QNNA 4IFBA 4ZOLF 5FUXA 4ETMA 3O4VA 5D1NA 5H82A 3SR4A 3C9UA 5J4KA 5K03A 2YUAA 2QJTA 4KQXA 2BP7A 5JXIA 3EVFA 3D3IA 1WMEA 3QP9A 5AKHA 4X66B 3PC8C 3FI9A 2ZF8A 3HR8A 5KYXA 2Z2YA 2FH5B 3CX3A 2RHBA 1NYRA 2WKWA 4GM0A 4DYHA 1H9BA 1XZDA 3MAGA 2W90A 2C42A 3ONWA 3OQBA 3I39X 4HXEB 4MV8A 5EJ2A 4I55F 3WDLA 3L1UA 2HWWA 1PM9A 4O63O 3CW8X 2CUZA 4CC6A 1YI0A 2JCBA 3BPZA 1IV2A 1GZ3A 2HQ1A 4MS4B 3IJ4A 5DYYA 2QN9A 2ZBUA 5E7JA 3E7PA 1P1JA 3QV1A 1UKAA 3ITNA 4ZO7A 3DXXA 2R9AA 3TEMA 1US6A 5JAUA 3LYUA 3P9YA 1XEWX 2UYQA 2VSFA 3RHFA 2CLMB 3VKWA 5CD1A 3TPZA 2V7EA 5FBKA 3TD2A 1M0SA 2IYQA 5DMHA 3H1AA 3AR6A 4ETNA 5EFZA 5H7XA 1KK2A 4W9NA 1IBMO 4EA7A 1H8EA 1VSUA 1B26A 3EDYA 4KXWA 3ROKA 4HB3A 4YV2A 2EL9A 3OGCC 4IL5A 2OOKA 4R9UC 3AW9A 5IFKA 4TWZA 3CRCA 5HOQA 3RAPR 5CPBA 4BVQA 2JJYA 2NVUB 4AIRA 4ALNA 1JA1A 3PTLA 4NBTA 1G2PA 5FUWA 3KZ1E 3LJKA 4RKRA 2WAYA 4OFXA 5B2ZA 1R5BA 2ZYTX 4LF9O 1PL0A 1QD9A 2DY1A 1TM1E 1V5FA 3KM0A 2I2FA 2UZAA 3AF4A 3M6FA 4RGVA 2GM9A 1I6WA 4PHFA 3RQIA 4GI1A 3KTAA 5AVJA 4EHLA 5M34A 3WOHA 1M56C 1OD6A 1SG6A 1L5ZA 2HCFA 2JIPA 2DC1A 2ZIWB 3CH7A 3DG9A 3H6KA 3JQCA 3W5VA 5C5CA 1L4KA 4DXDA 4XPIB 3T4UA 3Q9SA 4YAUA 2I2AA 4KPGA 4CN9A 4OBXA 4C6HA 1ML3A 5IFLA 1RYFA 1JI3A 1N0HA 3WFVA 3H5NA 2K87A 4EHKA 3WIDA 4ENUA 1Y6GA 4G0YA 3J81A 2HR1A 4IPTA 5CH3A 2C29D 4M1ZA 3FTFA 3VJRA 4TQFA 1RRVA 4FSXA 3ZE1B 4BUJA 5KCMA 1IX9A 1TMYA 1FC0A 3KKEA 2WG2A 5K9ZA 3RGBA 1XU9A 2JF0A 3DP7A 4S2EA 5LXTF 5H5JA 5LMNO 4NFHA 2HU7A 2AOUB 4IFEA 3I3OA 4DLNA 4UPEA 4OGLA 3GARA 1N0UA 4UUPA 1TU3A 5KNDD 4R1NA 4P84A 1I7LA 5AYVA 3PRHA 4MV1A 2PRIA 1RFGE 3I5DA 5SYNA 3D3WA 3EDMA 3AEYA 1NN5A 1HNZO 2GK7A 4KZPA 1KMHB 1L8LA 3KEMA 5TARA 3RKUA 4ENVA 3BEDA 4WJLA 1NVPB 2CHVA 2PL5A 1S96A 2IX9A 3S2GA 5JDIA 5M04A 5C4MA 4KQWA 4MQLA 2IUTA 4FNAA 3WX0A 4EQZA 5CFPA 2ITCC 3HJFA 5IEBA 4FBMA 3RODA 3CX4A 4QUKA 4MUNA 2N46A 3STVA 1MC1A 2JAWA 2IWRA 4YI3A 3U2QA 1RQ7A 1QDLB 4B1FA 3WIUA 2HHJA 3BD8A 3HWX1 2ZRGA 4RKEA 4DC0A 2ZE5A 5HTKA 1VG9B 1HDJA 1ECLA 1YIDA 2W6ZA 2ZR0A 3IVRA 4NENA 3KSRA 4EGFA 5IU6A 4K86A 3LA6A 2C94A 4HVTA 4MVCA 4NQZA 1OILA 3Q6NA 4QELA 4EY8A 3B89A 3N7TA 4K2AA 1C0LA 1EG2A 3GGOA 2CFSA 5TX7A 3ZY2A 4D3XA 3I76A 2IPOA 4Z9YA 3KOOA 3LBYA 1N2SA 1XJCA 2YFHA 2V8OA 2WSBA 3D54D 4H6WA 2G1KA 4MQBA 4Q3AA 4DCJA 2BFMA 2V96A 4FR2A 4NJMA 4NJEB 2F93B 1SZQA 2OV3A 1VP7A 2H1OA 3JAWA 3VUEA 2B7BA 5AQ1A 1A8QA 2YHAA 2JEYA 2AI3A 3UJ9A 5L3SA 1XPUA 1V37A 1PV0A 3GHYA 2IYRA 2WDPA 3IAEA 4HPXB 4X1KA 2WA1A 3EASA 4G63A 4HLUC 3S5UA 1WHSB 4MTGA 1OKKD 4D74A 3MBIA 5C35A 5LGUA 1QONA 4J9YB 2V55B 2Y93A 1NBMD 2ZSIA 3M1AA 3L4JA 4DQ0A 3WO1A 1Q7RA 3LQ2A 5KDLA 2P6RA 3CKMA 3LMKA 2XTNA 1R00A 3G6KA 4I5DA 5H9VA 1M6YA 1ZM4A 1P1HA 1UKVY 4Y18A 3TR0A 2XT6A 3G2HA 3UJ6A 4ABYA 1F7UA 5K3CA 2B20A 3G2LA 4C7OB 3ZD6A 4MSWC 1W2GA 2V58A 3U44B 1RP7A 2C8VA 4GR4A 1GKUB 2QSUA 2QSJA 1BJKA 4R7ZA 4GLLA 3SDZA 3PB3A 3ZCUA 3EGXA 3IBSA 4BB0A 1BGWA 3L04A 4A16A 3FNFA 1DXYA 2JLRA 3CW2A 4OUDA 4WAUA 2Z1DA 1W0JD 1VK3A 2DRIA 1VSVA 2CJWB 4BMCA 2K1EA 1QS0B 3C3PA 1DIBA 3OM8A 3QO7A 1FVXA 3M4JA 3RRYA 5IPFA 5JSQA 2Y9MB 3C7CB 4P4TA 1JAZA 2IOFK 2YIVX 1RLTA 1UXHA 2PIDA 2LBTA 3BZBA 1RYDA 3QFCA 3SG0A 3WWEA 3UKMA 3F0DA 2A1UB 2V65A 4OQDA 2QWQB 2JD1A 3I6ZA 3L6UA 4DILA 1U4NA 1Y7HA 3ZZNA 1EUDB 3TTSA 3E9RA 5BVGB 4JBYA 1XNQB 1MIOB 2DCUA 3L9DA 2JPDA 2WWFA 3FGOA 2FEAA 5DU2A 2QT9A 5EMKA 2AUNA 3HUTA 1G6UA 1EBBA 2MMGA 5EZ5A 1CJSA 3K8QA 4FFWA 4M0MA 4ZVRA 1BMFA 1JT9A 5BYAA 3CX7A 3OOWA 3NIFB 4LV8B 1FQWA 3ZGZA 1CR1A 2O2HA 1NF3A 4JI2B 3V7EA 3EOBI 4X84A 2RN9A 3D2LA 1VBMA 5D84A 1WBJB 1W35A 1CUUA 3OPNA 1BVUA 2OFFA 3HEBA 1HYBA 4U7GA 2IHZA 4CL2A 2OZVA 4Y6PA 5G02A 3D6UA 3FBGA 3LUPA 2I2BA 2DXIA 1W4AA 3Q3CA 1JR9A 4B62A 1N3IA 1Z5WA 1XXHB 2RCYA 3A31A 3DNFA 4JIGA 1Q7YH 4PGMA 4HUJA 4WKNA 2OA0A 5I4IA 3ZCCA 1C1HA 3KZNA 3ICVA 5KQMA 4RCZA 3W2EA 3VPBA 4W8HA 4KBFA 4OSOA 5LZ8A 3CUKA 5GV8A 5ELMA 5DVZA 5DNVA 3MWJA 3L1HA 3QU9A 4U9IS 4G4IA 3D8SA 1MG5A 4RVHA 3T9AA 2BYTA 2K2WA 1JDBB 1V41E 2N1MA 5FUQA 2H85A 4FJ0A 1DJNA 4PX9A 4JHXA 1ZD2P 1AKWA 1NGSA 4JL6A 1OCEA 4EEQA 1KIMA 5AJXA 4NBSA 1J8YF 1HT2E 2OHIA 3HWWA 1J7JA 1TGOA 3JQ7A 4CMHA 1E96A 3DXRA 3AETA 4GBGA 4O08A 5CAEB 2WB4A 3MRXA 3IUSA 1P7GA 3WGHA 3N0RA 2AK2A 3WK8A 3KUUA 3ND8A 1GAEO 4JWTA 2RC6A 3O1IC 5AKIA 1BKYA 3MELA 1HT3A 5FA8A 2YZGA 3SDBA 4DDMA 5FDFA 1XPJA 3TLYA 4CIDA 2AOVA 1DWOA 2OCHA 2PO7A 4PG6A 5TVKA 1JGTA 2OYCA 3DDNA 5EMHA 2PGDA 1JHDA 5CLGA 2ZWAA 4DMKA 2VTBA 5FADA 1HDZA 4UU8A 4DUGA 5I7OA 1QNFA 4NI5A 3EYAA 3GP8A 1OZHA 4L5CA 3IQWA 4CMEA 4C4XA 1NURA 4HS4A 3RC3A 2QMHA 1E2PA 2V7UA 1FDWA 3OPYA 2HFKA 1W4RA 2O6HA 2ZU6A 3TZCA 1IHDA 3FW1A 4OQNA 3ZN2A 1LJLA 4CEJA 2Z9CA 3F1KA 1A8IA 4TZTA 2PE5A 4H0LB 3BK1A 3PCXA 3L93A 1Q0TA 1GCAA 1L1QA 3QM1A 4NEGA 2O9JA 3CF0A 4UASA 1L7MA 3ZVLA 1G8JA 2GZSA 1PSWA 4REQA 4BNKA 1D1SA 4QECA 1ZOOA 3ZNPA 1QUFA 3HM9A 3JQ9A 5LP6F 3CC8A 3AK2A 1D2HA 5LHIA 3GCZA 1NXXA 4G1VA 4IGFA 1QANA 3H1PA 2Q29A 2YOGA 4QA9A 4TMVA 5CIYA 2AVDA 1TLLA 3GYBA 3RT1A 3HUUA 1R0ZA 4JI6O 2ZSBA 4AF6A 2QUIA 1U6JA 1YTLA 1J8VA 1JG7A 3R0IA 3SIRA 5B1AC 4BWGA 2AIRA 1KNQA 3AP2A 2QR5A 5JW6A 3R3SA 4LV5B 1MNGA 3N6VA 1G55A 1UC8A 2A67A 3C3KA 1N57A 3L0DA 2I7CA 2Q3JA 2ZIVB 3SM3A 2Y4OA 1DWUA 3CF4A 3K5LA 3DULA 4NJEA 4NV1A 4Q48A 3WADA 1Y5RA 1E8DA 3CV3A 2BGUA 1VMDA 1QR2A 4S0ZA 3T7EA 2VS0A 4TM7A 1VXOA 1Z28A 5CB6A 3V8EA 2HVKC 3IJ5A 5MFZA 1RI5A 1ZGCA 1G17A 4D98A 2VSNA 1UEXC 1WCV1 4U9HS 1EX9A 1FP1D 4KO3S 4RHEA 1D5AA 1U3VA 1V5IA 2BI7A 2F67A 3WB1A 3LIPA 4H27A 2YC4C 2HPAA 2I7VA 4HLNA 3DAHA 2CXQA 2PCJA 4QSMA 4B73A 1QOQB 4ZIRA 2I4IA 2EXXA 2DTEA 2IV3A 1O0SA 1CUJA 1TM4E 1ZNXA 1K08A 4NECA 4ZMSA 2ILTA 1SHZA 5L3CA 1G9TA 4IP0A 3VKHA 4OGGA 1NTZH 1LPNA 3OR6C 3C45A 2G4CA 3WYNA 1QO0D 3ZJ4A 3U1VA 3R5HA 6ADHA 1IBMB 1SUDA 4E07A 1GARA 3VNSA 1AHNA 1JVSA 1Q6UA 3OO1A 4OA8A 3QEAZ 1M5RA 2HRBA 4KLNA 4MVJH 2R47A 1WB5A 4P2GA 1FEZA 3IP7A 4P22A 2VUSA 5DBOA 2FSVC 1XMQO 5HK8A 1E3EA 1UP4A 2QTTA 4EP1A 1JN1A 2BMJA 5BNTA 2NOAA 1JAHA 2J3JA 1CEYA 1C9YA 3WKCA 1EJ2A 1FQKA 3HVRA 1RHKA 2PZJA 2ST1A 2CLSA 3DZJA 4AAYA 3K9NA 2WYHA 3I12A 1VM6A 1WNSA 3OE7A 3BE4A 2ZJ4A 1VQKF 2YC2C 3FDJA 2EYQA 3FUXA 1WU7A 3GDOA 3IQGX 3T7KA 3TQIA 2B83A 1AK9A 3AERA 3CEMA 5HZKA 1WX1A 4FZJA 1Q57A 2WYUA 3C8UA 2Q5QA 2CY0A 3DYIA 3CO0S 3IX7A 1GM9A 4E1BA 3GJTA 3G23A 3BWYA 2QL5A 3J80M 3EVGA 2HA4A 3WIOA 2G8LA 1AH2A 2OM6A 2V0GA 7MDHA 5HQTA 5C52B 2YWXA 3L8DA 3CCFA 3OLVA 4Q4JA 4FGUA 1GL6A 1FPMA 2ZI7A 5EP1A 1WB8A 5G0TA 3ZR4B 4QZVA 1P73A 2JI8A 2WUGA 4CIVA 4ABTA 2WSIA 4TQAA 1KI7A 5LZ7A 3AR9A 2XTJA 1PP9H 3R2JA 4II7A 3WU2Z 2QVYX 3UOAB 1WA8B 1VDZA 2HJWA 3DZBA 4YGXB 1YZHA 1KMIY 3WL7A 1MJNA 4L3OA 5JS8A 1I80A 1QFYA 1P6UA 5FULA 2RHOA 3ZQKA 3QX7A 5IKXA 1VG1A 1A8PA 2D1YA 2P79A 2XMZA 1XDZA 3GLKA 4TLEA 3V6LA 2A9JA 1V1MB 5IUKC 3ZRSA 1LLUA 1YOVB 2E4XA 3O4HA 1X9IA 1RMYA 1GTOA 1FTGA 1H69A 3EIOA 4F96A 4LV6A 3OTGA 1CUZA 4E21A 3BRCA 3UAVA 5MN4A 2FDCA 5AVMA 1P1FA 2X0NA 3ZLVA 5F7XA 2H7XA 5L53A 1IBKO 1MHPA 2JVDA 4WY8A 4U7WA 4UMEA 4AJHA 2G9RA 4CCYB 1IXYA 1UINA 2JLWA 2W6JG 4JI4O 1QYDA 1LDNA 1Z4LA 3CYQA 3CD6F 2EBUA 4HBGA 2Z43A 4GKVA 4KLAA 3AESA 1NOJA 2OZLB 3I01M 4O2AF 4UHEA 2JKYA 1RQGA 4FGLA 4UFOA 3WPXA 5MHTA 4OX9O 3JAMM 1PWHA 1U1IA 3E82A 5EYPB 2RHHA 2IEZA 4HDNA 4RD4A 1KJNA 1WWKA 2DULA 3KC2A 3LY9A 4TTSA 5CB4B 3K5IA 5IC5A 5LJIA 1ES9A 2PZBA 5KTNA 2C9ZA 2BGIA 2FW0A 3IEXA 2LBXA 5KOJA 3L7IA 4K81B 3OC6A 2VHVA 5P21A 4C88A 4JYBA 5BV8A 3G0CA 4OU4A 1IB0A 2AXQA 4K9QA 2PEYA 3RU9A 3MW8A 5CFQA 1ULHA 1LC3A 2QMZA 4RKWA 3HB3B 1N7IA 3C3YA 1GTJ1 1U0TA 3PZRA 4UM7A 2QKCA 4UCVA 4FMCB 3MSXA 3PGXA 2NNWB 4FPXA 2I6FA 1XTVA 4HBZA 3ZGLA 3F0FA 1X1CA 2VH1A 4FXOA 2B9EA 2BOCC 2IYAA 3HCRA 3P9NA 3JASB 1CJBA 1S2LA 1UDAA 4DO2A 2R6DA 1G19A 2ZREA 3JXEA 3NALA 2OBMA 2PVPA 1Y4DE 3LVFO 4CL3A 2A4MA 4OBEA 4NG4A 4I66A 5KQLA 1LNSA 1KYYA 3QELB 3RIEA 3RWOA 4CLOA 1C1DB 3CIFA 5J47A 1E4EB 3CEIA 2ODAA 5J2TA 2QRVB 3GHZA 3MT0A 2NSDA 3TL2A 4L95C 1DBWA 1NP3A 1X13A 4XYMA 5FTNA 1DT3A 5HTOA 2AHYA 4TYPA 2DN9A 2Y1XA 2RARA 4JVMA 4BGUA 2IH5A 2ZRKA 1ZQ1A 3C70A 3NI2A 4ZEXA 3D54A 4WZAA 4LNUB 3BA8A 3WL8A 1QHXA 3F97A 1DFHA 3CVJA 1Z8HA 3G0BA 3QIVA 4MO2A 1Y8QA 5EHIA 4AF7A 3AKZA 2A9VA 3EZ7A 4DHEA 3GIDA 3WJ7A 1I4WA 1MQSA 5HKAA 3T06B 1C29B 4PA4A 1XTTA 3VU3A 4HXFB 4IQ0A 4QNMA 4XWGA 4A0RA 4BNTA 1DNPA 4KWCA 1J39A 5DM1A 2WU8A 3BJZA 4DZZA 1I4DD 3OQNA 4B3DA 4KXRA 2AF4C 4NV0A 1JHAA 4YIOA 1HDEA 1HDGO 2QG6A 3MJTA 2E85A 2OCBA 2VT3A 4NVPA 3B77A 3NEJA 4MRMA 2PCLA 1BEUB 4PPGA 1NQWA 3K6JA 1S3GA 3SXUA 3ZNQA 1QLJA 4L8YA 1NNSA 3QK7A 2P1ZA 4JEMA 1X1EA 4PCVA 4YT4A 3D6HA 3K0FB 4YXWA 1VHJA 3S8YA 1B2RA 1DEKA 1NMQA 5EIWA 4X85A 2ZINA 3WLSA 3DBRA 4E11A 4E13A 1YB1A 1IJKA 1Z0DA 4MULA 1NLMA 1PJ4A 5B4TA 1DEAA 5JMOA 1UZAA 1VJGA 3T1QA 1E79G 1K7FB 4MQFB 5GIOC 3SSNA 4ZYZA 2X5XA 1OH7A 4OMUA 2CTQA 2RKBA 3WISA 1RXYA 1VL0A 2GEKA 3DHWC 3RNOA 3WJ1A 3HB4X 2GF2A 2GAOA 2GYYA 5LL6P 1KECA 3D43A 3GWKC 4QIWF 3BK2A 4KJZA 2OCPA 1U3CA 1Q6ZA 2B9ZA 4PG7A 4PRYA 1K73H 4IDCA 4DQUA 5CB8A