5LOVB

Dz-2384 tubulin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
417
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title The synthetic diazonamide DZ-2384 has distinct effects on microtubule curvature and dynamics without neurotoxicity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 165
structure length 417
sequence length 426
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lovB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lovB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lovB01
4I4TA 3RYFB 3JARA 4X1YA 2Q1YA 1FFXB 5LXTB 4X1KB 1TUBB 4U3JA 3M8KA 3E22B 4O4JB 4O4IB 2VAMA 1W5FA 4I4TB 3HKDA 3JARB 5JQGA 4X1YB 1FSZA 3RYHA 1RQ7A 1RQ2A 3WGKA 4O4HA 5KX5A 4U3JB 2RHJA 1TVKA 4HNAA 4ZI7A 3WGJA 3N2GA 3RYFA 4ZOLB 3VPAA 5FNVA 4IHJB 3HKDB 4YJ2A 5JQGB 3RYHB 4KWEA 4EI9A 1SA0A 4EI7A 4O4HB 4IIJA 5KX5B 2VAWA 4HNAB 1TVKB 4ZI7B 2RHOA 2RHHA 3ZBQA 3N2GB 5LP6C 5MN5A 5ITZA 5FNVB 4YJ2B 3M89A 5J2TA 4TV8A 4XCQA 5JH7A 5KMGA 3RYCA 1SA0B 3JATA 4IIJB 5EYPA 4ZOLA 3VOAA 4IHJA 5EIBD 3C8LA 5IJ0A 5ITZB 5JVDA 5MN4A 5J2TB 4TV8B 5M7EA 5JH7B 5KMGB 3RYCB 2XKAA 3JATB 1W5EA 5EYPB 4E6EA 2BTQA 3HKEA 5IYZA 5EZYA 5LYJA 5IJ0B 4O2AA 4LNUA 5CB4A 2R751 5J2UA 5JVDB 5EIBC 5JCOC 1W581 2R6R1 3HKCA 5LP6A 2RHLA 3ZBPA 5MN6A 5CA0A 5CA1A 2VAPA 2BTQB 3HKEB 4I50A 5IYZB 5EZYB 5LYJB 1Z5VA 2Q1XA 4DRXA 3WGMA 4EB6A 4EI8A 4O2AB 4LNUB 3N2KA 3UT5A 4O4LB 5C8YA 5CB4B 5J2UB 1Z5WA 3HKCB 5LP6B 3V3TA 4B46A 5CA0B 5CA1B 4I50B 2XKBA 3JASA 4YJ3A 4DRXB 4EB6B 4WBNA 3JALA 3N2KB 3UT5B 5C8YB 5BMVA 1W5AA 4I55A 4F6RA 3HKBA 2BTOA 4U39A 4X1IA 3JASB 4YJ3B 3VOBA 4O2BA 4O4LA 5JCOA 3JAKB 4WBNB 3JALB 1W5BA 2VXYA 3RB8A 1OFUA 5BMVB 4DXDA 4I55B 4F6RB 3HKBB 4M8IA 5LOVA 1W59A 3WGNA 3JAWA 5LA6A 4X1IB 3VO9A 4FFBA 4ZHQA 5IJ9A 4X20A 3CB2A 4O2BB 3RYIA 4TV9A 3ZIDA 3VO8A 5GONA 1JFFA 4TUYA 3R4VA 3WGLA 5LOVB 3JAWB 1FFXA 5LA6B 5LXTA 4B45A 4X1KA 4FFBB 4ZHQB 3JAKA 4X20B 5IJ9B 1TUBA 3RYIB 4TV9B 2GVIA 3E22A 1RLUA 4O4JA 5GONB 4O4IA 1JFFB 4TUYB
chains in the Genus database with same CATH superfamily
4GM4A 3PC4A 3Q4GA 1X15A 1JNXX 1GZVA 4PYJA 1G55A 2I2WA 4DV5B 4MI9A 4QUHA 4UCSA 1HYQA 4ZCPA 3GJSA 3MEQA 1GKFA 1ZR4A 4FBLA 1ZVQA 2WU1A 1B0UA 3IHTA 2DFDA 1NLFA 2NT3A 4A7PA 2X2OA 1RSOA 3KNZA 5H6QA 3KQMA 3DG9A 2R8PA 2ZU6A 4LOAA 4NOLA 2Y77A 4XTRA 3ME5A 4RPLA 3U39A 3M4ZA 5B1BC 1U94A 3HR7A 3DCNA 5CB4A 1SU6A 4C07A 2VYND 5B7PA 1WM1A 2O8NA 2XOXA 5KQGA 3GLFE 4NEGA 4XPZA 3VGPA 1JHAA 1Y9AA 2IUEA 3WA7A 3N2KB 3UJ7A 3TLKA 1JLLB 4PNEA 3VOBA 4KYUA 1NBIA 5TEVA 1BXGA 2AXNA 2NSHA 5BSFA 4OHVA 3D3KA 2FW8A 3U40A 1D0IA 1U3VA 3EISA 4DDKA 1PGQA 2JAQA 4G25A 1IVYA 2ZIUB 3R74A 1XLTC 3MFYA 4E5DA 2ZUEA 1VQ7V 3ABIA 1IOWA 3GIWA 2WUEA 3ZHXA 3UFXB 3UVEA 3D54D 4OX9Y 3MCUA 1HDJA 1C5KA 3QX3A 4WFFA 1KZYC 3IPCA 2W00A 4DLUA 4MVJH 1NJIW 4QNHB 1A9YA 3D64A 3K5NA 1NVUQ 1CCWA 1D04A 3KCXA 3ZP7A 2P11A 1D2NA 3Q7TA 1GIAA 2JGFA 1H2XA 2UDPA 3NHUA 1VQMF 3LUFA 3DMRA 3PDCA 3IV7A 4CMCA 2QG4A 1XMIA 5DGTA 2EFDB 3EORA 3DT6A 1AQLA 3IJRA 1RHQA 2R2AA 3TINA 2HHHB 2VA9A 5GONA 1WUJS 1DQYA 5ERXA 3SXPA 2BEJA 4M49A 2GUZA 1W42A 3EWNA 1D0VA 2CHFA 3B78A 3H99A 5DX8A 1K7YA 4JWTA 3N6VA 2JAWA 3RG2A 3QRWA 3MJHA 5HY4A 3C3CA 2JKZA 5FR1A 3RUCA 5IH3A 2P6NA 1YWGO 1L6RA 3CCUF 5FI5A 2QTTA 3CMMA 5B1OA 4H6VA 1ZWLA 1J0AA 1G4YB 3ZK7A 1N3YA 3AI3A 4WADA 5LGNA 3GYBA 5H8WA 1CQZA 3EWIA 2LBXA 1L5OA 5A4KA 3JD1A 3HTNA 2I29A 1XJ0A 3QE9Y 4C7XA 2KSDA 4OA5A 4PGAA 3M6VA 4BO3A 2CW5A 2YOGA 3C9RA 2C1XA 2YNMA 5B58T 2PS1A 3R0JA 4QJ5A 4WBNB 5JW6A 1KK0A 4ZZ2A 4LTDA 3JAWA 1J5EB 2PH5A 4C1BA 1SCQA 3H4IA 3K8YA 4LCJA 1LQUA 2GCNA 3WGOA 3CGWA 2HHJA 3CEJA 3DBOB 5DM2A 3ROXA 2AN5A 1QHEA 5CURA 4TXMA 3OWHA 3JRNA 5LIPA 3R2JA 1PVDA 2P0AA 2ONZA 2PD3A 1UUFA 3IMEA 4XOUA 3LDCA 5FPPA 2QJWA 3FRJA 1PFYA 3ICQB 3NVMB 4DR2B 2VHWA 5CYGA 1A2BA 3AEQB 4XDYA 4HX5A 2WZQA 3MOGA 3V4LA 4YGXB 4L3OA 2IHZA 1GAWA 4KG7A 4GKVA 3BA9A 4KE8A 3NK7A 1DBWA 2GD6A 1VLJA 1KSHA 1NBEA 3T54A 2ZYSA 4TT3D 5ITWA 1ZJ4A 4DILA 1V55B 4N4AA 2Y9PB 1G5RA 4OBXA 1ZY2A 4F5WA 5CDGA 1UBHS 3EGWA 3K71B 2DJIA 4MR8B 4MB6A 3VZSA 2V65A 1C7JA 1VIBA 3IS3A 2WHPB 1WUYA 1B0ZA 2Q3FA 4QQRA 3MRVA 4PCVA 4I1IA 3RUFA 3ITEA 2VBIA 2V59A 4XFDA 3WMGA 4P7KA 2HQSC 2V6FA 2NOAA 2C1EA 3OE1A 2CNLA 4PIMA 2CXPA 3EF3A 2G08A 2ZCVA 3A6DA 4GMXA 2ZJ5A 5JS8A 1WKCA 3ZHQA 4PZAA 3R9XA 5F77A 1AZTA 1FQKA 4P80A 4RZ3A 3W9YA 4IM7A 1II8A 2JGJA 5LFAA 1E3EA 3VTZA 4TLAA 4TWKA 1TM4E 1V25A 5B4VA 4B6FA 4I55A 2GMWA 1EGQA 5A7GA 1SVIA 4AKSA 3BXFA 1T25A 1FSFA 3CYPB 1QZ3A 3DFUA 1K7FB 1GRJA 3RBZA 4LA4A 4CIDA 2WD8A 4TKVA 2PUTA 2QBYB 2MW2B 3DEFA 4US2R 2IYSA 4TTPA 2GF0A 4F4FA 4ZV4A 1C7IA 1E2QA 1JDBB 3QYJA 3V55A 2C7BA 3KYCA 4DUYB 4WK6A 1ZH6A 5EE1A 4IHJB 2HVYD 1VE9A 1JHOA 3X2EA 2X9NA 1K73W 5K0LA 2YYZA 4TTVA 4U9UA 1QYIA 1JG3A 1E9EA 4Q1CA 2A5JA 1ULZA 3A4NA 2ABWA 2XQIA 4JK3A 2B4TO 5JEDA 3HP1A 3VR3A 2J8ZA 8GPBA 2Q5FA 4Y0AA 1QO0A 3ZVNA 4CT5A 3M0EA 3WQSB 5K99A 4R16A 4MKFA 1K4MA 1LW7A 1C1HA 3ZHOA 1O95A 5ALTA 3I0MA 3M34A 4LRUA 2HGSA 2UXDB 4ZAXA 4RCZA 3SR3A 2Z4TA 1L7XA 2ZDHA 3W8NA 4KNYA 3JQRA 3FSRA 1PTKA 2H8CA 4Y6RA 3A0BZ 3ZQ6A 2VK1A 3ER9A 1GEEA 3AXTA 3L9WA 5EXEA 1DRUA 2OORA 1CFZA 2GRJA 4V1CB 1T0PA 5EHZA 3CWBH 4RWEA 3I9JA 3B6ZA 4WN3A 1RJ9B 1DLJA 4WDRA 3SPCA 1XC7A 1CU1A 3PQ3A 4FGSA 4CTJA 4A6PA 5T8KA 3VYSC 1CS0B 3PFNA 3QSGA 4UBNA 2VLBA 4DMUB 4B75A 2AOTB 3LPNA 1SF9A 4ER3A 2WF6A 1WNSA 3IAXA 4O8ZA 4ND3A 1BXRA 2OY0A 2NUAA 4FCVA 3QENA 3KC2A 2VF7A 3NOXA 1U3LA 2AUMA 1B74A 4FR2A 2EC5A 1M73E 5J1TB 1G2QA 5KJCA 2PBRA 2K1SA 3K0DA 2HF7A 2FUCA 2VN8A 4BJ1A 1OY1A 4CCSA 3CCRF 2XJ4A 2Q29A 1DCMA 5JY1A 2NU9A 3WK4A 3M70A 5IABA 2KGWA 1YZLA 1GPBA 3UM9A 3N76A 2EHDA 1CERA 4HNTA 3OTOO 4NBNA 3Q10A 1RRVA 3E9YA 5L6MB 1Q0ZA 4NDZA 2ZVQX 2OBNA 3CRQA 4W5OA 4GKJO 3NAGA 1PAUA 3GA5A 2FZCA 1QTQA 2X4DA 4NBUA 2VP6A 1U7HA 5K51A 2YY5A 1Z0DA 7MDHA 3MCTA 1K6MA 1C30B 1W48A 4HTFB 5AKYA 1NLYA 1B1CA 2WIAA 4OQMA 2X0EA 3TZQA 4GGMX 5ITSA 1SUEA 3ZLTA 2JHAA 3N2GB 4XTCS 4CDGA 3F0GA 1N92A 4UJ5A 2WV7A 2ZDIC 1T6ZA 2JL1A 1SH7A 3TKYA 2Y4TA 3DLCA 3ZVRA 1NP6A 1KI8A 2C4WA 4L8FA 1Q95A 4ENVA 3DL2A 4D9MA 1C1DA 4TQ9A 1FC0A 2VLIA 3NEJA 3T2MA 2CGEA 1EQUA 2YVLA 1NUQA 1KU9A 5FLEX 2WSBA 3Q88A 2NMUA 3ZH2A 4KL8S 3GNQA 4OOEA 4NICA 2O8FA 4QPZA 3HKBB 3D3NA 4MVZA 4X1IB 3V7QA 3IV6A 1U2DC 5FBWB 3SJ7A 1ESZA 3CCQF 2AI3A 1GOTA 3UQYS 3UJNA 3LW7A 5EQFA 9MHTA 1RQNA 3DLTA 3HYTA 1NRWA 2CJXA 4LCEA 3EZNA 2B2NA 4MQ6A 1H05A 5DXJA 1EA5A 1TU3A 2AQKA 2ZCJA 1RAEA 1G1AA 3CR3C 1U9JA 3RVZA 1B3BA 3E27A 4JBWA 2DUUA 1Y4UA 4IJWA 5AVUA 5NLLA 3TD9A 1PP9H 1YVRA 4DSNA 1O2DA 2BCGY 3A70A 1NW3A 2BGJA 3KAQA 3ABZA 4L87A 1H42A 1KL7A 4IJMA 2WSSA 3FCSB 4ZHQF 1GV0A 3LQFA 1UXHA 3VH2A 4DL9A 1H2KA 1HQCA 3QUWA 1KI6A 2IHNA 4HS4A 1Z8HA 4OXIA 1E3TA 3G5TA 5LDGA 2REBA 2VYFA 5A2QM 1T3SA 4C5AA 1X59A 5IF3A 4XIJA 3ET5A 1UH5A 1EDBA 3U56A 3KETA 4EGSA 3D1VA 3PUVA 4F46A 5JISA 3CP1A 4HVTA 3H6KA 2CDYA 2O2HA 3LWZA 4K28A 4Q4HA 1TYAE 3TM5A 1GMGA 2IUYA 3OX4A 3HB0A 4DQLA 1M8FA 5HOEA 2VDJA 1E2DA 4LHWA 5IH7A 2XLCA 5AM5A 1QHHA 4PNHA 3ETEA 2XF2A 1J23A 1QC5B 4KVFA 2PXHA 1DRWA 3HFGA 4CMHA 1H22A 4B4WA 1E5QA 1T4BA 3NBXX 2OIGA 3QLEA 1QTRA 1G6HA 4PCAA 5JYDA 1WB8A 3EPRA 4F06A 4WZZA 3RQSA 1TLTA 5AKHA 2XMGA 2P9JA 3SE0A 1TIPA 5T4FA 3GG2A 4XARA 1NVDA 3NUGA 4D7SA 3FKQA 1GNPA 3NWBA 4TT3G 1G4AE 2QVCA 4BU1A 4DRXB 3FNRA 2V58A 1BDMA 5AKLA 4YMLA 3FOAA 1TEHA 3ZDXB 3HA7A 2WSIA 2D59A 1H23A 5ARCA 3VZDA 4K0KB 2BD0A 4JTAB 3CLVA 4RMIA 3VR6D 1F51E 1LUAA 2F90A 4XLTA 1QR9A 5A62A 3GEIA 3O6VA 4O63O 1OV9A 4KOEC 1SB8A 3A06A 2X1VA 1H7MA 2V7XA 4L02A 2Q1YA 1ZJ6A 2A3QA 4BN4A 2OLEA 1UFIA 4UCRA 4X1YB 1AK1A 1RQ7A 1XWWA 4RQBA 3I6ZA 2NZWA 2ZBGA 4HRAA 3DMFA 5F1KA 1KVSA 4JAUA 2BV3A 3ZE9A 4H37A 4ARSA 5MGNA 4OLHA 4PCLA 3PT5A 4JVLA 5G40A 2OHJA 3IMPA 5D86A 1G4HA 3L6BA 1M6WA 3V46A 4MVSA 4EKGA 5JCPA 3C87A 4CZ2A 2C9OA 3GLQA 4NYIR 3DNFA 1FSPA 1H9AA 2JASA 2VRCD 5FWAA 1DRJA 1JXOA 2XAJA 2Q0XA 2VPPA 1AKNA 3CWQA 5AM0A 1KD1W 1SU4A 3OMIB 4PV7A 1X7WA 2D4AA 1PP4A 1CUWA 2R1ZA 4D6PA 3ZWKA 3QW2A 3FKJA 3DMPA 3GLGB 1XVTA 4OAOA 4YAJA 2HLDA 4F3YA 3IKLA 4ZIRA 4HWPA 4F9TA 1ZNZA 1UXGA 3C1TA 3P9IA 2FWPA 1PJAA 3ITDA 4FW9A 5J4VA 2WHYA 2NVUA 2C20A 4OI4A 1Q2UA 1L4NA 3I1IA 5EXSA 2HCBA 2P0YA 2VYNA 4UZFA 2O3UA 3T3DA 3LOQA 2XLBA 4G3XA 3IR6A 2PY6A 2WZDA 3CXRA 3FSJX 1DNPA 1ZA2A 3OVMA 1PZHA 4B4DA 3MB8A 5HZMA 3EAFA 2NP6A 1I4EB 3IBGA 1LDNA 3DBHA 1A5SB 4N18A 1C4WA 1TEXA 3TMAA 4BE9A 4EFKA 4PO9A 1J7KA 1UR5A 4PQFA 1KSFX 1EINA 4KH1A 1TUEB 3PHCA 3SC2A 2X6CA 1FS0G 3E8BA 4DCVA 3HCDA 1MAAA 4W5HA 3GWGA 3PC2A 3W9BA 4K87A 2XQJA 4B7ZA 5IMBA 2WVAA 3DBLA 4GLBA 1IHOA 3IDFA 2HJVA 3MBOA 1GXSB 1OBFO 4FDLA 1NA5A 4EG8A 1MR3F 2HQOA 3D54A 1ORQC 1WB5A 5L40A 1O9HA 4HDQB 4OV6B 2Z2KA 1JQLB 1QGED 5TGZA 1PVOA 2QYHA 1MDBA 3OHSX 2WLNA 3L7CA 3I2GA 1UJ5A 2ZJBA 1NH2D 3JQBA 2Q7DA 4HG2A 5HM6A 1IU9A 2AHZA 3GFVA 2AUNA 1UDXA 4FJ0A 1FQJA 2IYZA 5JZMA 5EIFA 3OZGA 3CLTD 5ALJA 2GF2A 2Q3EA 1OFGA 4CL2A 2D74A 3ANMA 4OLFA 3AJEA 3CRCA 2VCYA 4AJ1A 3K1JA 4G8JA 4C4WC 3PCXA 2ZT8A 3MJ4A 3IBCA 5HYVA 4K9SA 3RTAA 3CB2A 5AUQA 5LYYA 1ZK2A 2P68A 3WL3A 1VQ9V 3KJKA 2XWBF 2XQFA 1PUIA 1MH9A 4TUYB 4JELA 2FMIA 1CXZA 1Z35A 4TPKA 5LN1A 2WG0A 2N74A 3RYHA 1S77D 2P77A 2G72A 3D6HA 1XTTA 1AXGA 3G9TA 2RDCA 5FLXA 2RGAA 1RYBA 1XUOA 1LVGA 5JSFA 4OAPA 1OTYA 2E37A 4Z8XA 4DXAA 4MICA 4L28A 3UMJA 1IK4A 1FDTA 1L5GB 4DNPA 5E1OA 3KZMA 4DY4A 1SC3A 5U1PA 2HBYA 2GEUA 2WFLB 3JQCA 4CKZA 3I55F 4J9ZB 2PUWA 4EEQA 2FFJA 5HW0A 5FPKA 3OETA 2E55A 4RLFA 1NFQA 2EERA 4BFXA 3LDHA 3PCRB 1U6JA 1KJIA 1CUSA 3LWOC 1J0EA 1F4PA 1XKQA 1HLPA 5AW7A 4BLSA 3FJOA 4K7JA 1J00A 3P0JA 1WPGA 3FWKA 3KEQA 4J07A 3RW9A 3GT4A 4C76A 2P3OA 3NBMA 2AFHE 3FF4A 4PY2A 2WFZA 3SLKA 4KRFA 1VPEA 1U1EA 5JDIA 1TZJA 4IGEA 3SCZA 3LHFA 1DAIA 3P9NA 4QJ3A 5BVGB 4BFZA 1CVIA 3Q11A 2F43B 4K1LA 2W4QA 1QRDA 1EVZA 3EE6A 4FZJA 1Y9ZA 3NHWA 1W36B 3BSWA 2MYUA 3GAFA 3QLTA 2GZ2A 2SKEA 2RAFA 1DQPA 2IZ1A 5CXUA 4JQCA 1SBCA 4C5CA 4RKYA 4XJTA 1DQRA 2OV6A 3IC7A 2JK0A 2IV2X 1JZQA 3KJIA 3TJRA 3FMGA 3AW8A 5GV8A 2O9JA 1SQBH 2QA4F 1AUPA 3L72H 3T4ZA 4LK2A 2GZMA 2JDID 5K0ZA 2D6FA 5IAGA 4Y2YA 4FPPA 2PF4E 3H1IH 4M86A 4B6RA 4B45A 1ZEMA 3HJGA 2G07A 4DJFC 1IPHA 5CFRA 5BUSA 421PA 1HE5A 4R84A 1ZU4A 5KTRA 1HT0A 5EJ7A 5EE3A 1N4AA 4H7EA 2W2NA 1YHQF 2JCSA 3OQPA 4FLEA 3W5SA 2RH4A 3CC4F 2BR4A 4WY8A 5GJCA 2OL4A 1NIPA 5C8ZA 1PJTA 4FC7A 4G5QA 4UTXA 3PDWA 3E9RA 4G0MA 4GDMA 5I4KA 4NAUA 1UANA 2WJGA 1FEZA 4W7IA 5HXUA 1WEKA 2VBGA 1GKYA 3E5NA 4KP7A 1GPLA 1G9SA 3K9CA 4JUDX 4YP7A 5A5EA 5AVOA 1XMQO 1YHYA 2UZ1A 1DQNA 1GTJ1 2J4CA 3VOSA 5AT1A 2A8YA 1LY1A 4XGRA 3GEPA 4DLNA 2OV1A 1X9GA 3FOZA 3OJWA 2PZLA 3C1UA 4NE2A 4IV5A 1M6EX 4WX2B 1Z36A 3N3AC 2DRIA 4P86A 2AC2A 4IDBA 4LRSB 1KQPA 2YY7A 3AU8A 6NULA 4J0HA 1ZONA 4D7TA 1B2LA 2G0AA 1IB0A 4W5JA 1EX1A 3JYHA 3N39C 4YX9A 4MLCA 2O8CB 3FNEA 2Q3CA 4TROA 2CXQA 3HXMA 1VPTA 3HE3A 3D81A 4GM1A 2ETXA 1AUXA 1ACMA 1AKRA 3M2PA 5J59A 4W5QA 3AP3A 4QULA 2Q1WA 3HVRA 2YIMA 1NZFA 2EIHA 1WHTA 2J3IA 2ZNIA 1GWNA 2Q8QA 5LMZA 3EC1A 2ZI4A 3GY0A 2QY9A 4KI7A 3GQVA 1K75A 2R00A 1YJNV 3CW9A 2JKVA 2YMPA 3ZWOA 4TZZA 3OT1B 2HHCA 3IUEA 4FMCB 2INGX 4DLPA 5ICGA 5BSUA 2CNOA 4J3FA 2H7YA 5KTOA 3KL4A 2JIMA 3PSAA 3SLRA 1CY8A 3K5PA 5EO3A 4HQFA 2MSNA 1R4NA 3H87A 3Q7EA 3FYIB 3ZHUA 4KQFA 4O4JB 3U13A 4EFMA 2YXDA 3CUWA 2AI1A 3W2HA 3A10A 4IOLA 3UFBA 4A9AA 3CPHA 4U00A 3GFSA 2UZ0A 4EHKA 3R3UA 3JR3A 3O85A 2QEXF 5CLGA 1MABA 2DLNA 4O2BF 1MA0A 3Q3GE 4Q4DA 3WWPA 4ACBA 4L5BA 3KYJB 2ZETA 1E3MA 3HXKA 3OSUA 5DB4A 3FHCB 1U2QA 4ME6A 1DKOA 3RT3C 1TD1A 5F3RA 1DO2A 4MW3A 4EFLA 2ZI3A 1FP4B 4JGIA 3BSSA 3O90A 1QORA 3SEQA 4RD2A 1U7OA 4JHLA 3KIPA 2JBWA 1DAGA 3KOUA 2HJSA 2FLWA 3M6XA 3PTLA 4QLBA 2Z5VA 4Z6KA 4A0QA 3I0NA 1VE6A 2IX9A 3QTLA 3V2GA 1CRWG 1Q15A 3CKKA 1XLWA 4MLZA 4ML3A 4MQBA 1Z68A 4LBYA 3EJWA 3L0DA 2CXXA 2VUTA 1XR3A 5I7VA 1T1JA 3ECCA 2Y1WA 4CE6A 3F0EA 1WMEA 4UUQA 5DBOA 1F7UA 4OX9O 5LJIA 3SJBA 3I2HA 1WSDA 4IICA 1U80A 1T9AA 1M2NA 1AY0A 2ARKA 2CEAA 3SF0A 2YMLA 1A77A 1HNZB 2XGGA 2R79A 4CTMA 3HWUA 4K8RB 2HK8A 1SC1A 4J42A 2C98A 5CEEA 2NZUG 1FJHA 2Y0EA 3F6PA 4HT3B 4HYEA 4B09A 1MEOA 3MD0A 1P9LA 2XAFA 3TGUH 2PL5A 3MMSA 4LVOA 2V7VA 1Q2XA 3I6YA 2A1UB 3CX6A 3L73H 5FAXA 1YRBA 2VKQA 1WA8A 5EXPA 2D5LA 4B71A 1HP8A 4A0HA 2IYRA 4C0HA 5G4UC 2MSKA 4IOMA 3LXRA 4W9NA 2IHTA 2ATKC 4G9BA 1G20B 1YXBA 3JR7A 1DG9A 3S7ZA 2FWJA 3FYSA 2BYTA 2G17A 1RQRA 1DC5A 3ZWXA 4UW9A 3ORQA 1BXZA 1DAMA 2RFLA 2V7BA 3FYUC 2IXDA 1VMAA 2FG7C 1TYEB 1XNJA 1XZIA 5B5SA 3T7IA 3EGXA 3PYXA 1BJKA 5ARBA 5L4NA 1JKXA 4RIEA 4F60A 4TL6A 3IMKA 1UIMA 2DHCA 1EUDA 1Q7BA 4O2AB 3P2MA 5EP1A 4RVGA 2VZLA 4RXUA 4B08A 4TYNA 3U3MA 2JCXA 5CDYA 3QEJA 2J87A 2P0EA 4N76A 1OCRB 3H5AA 3WRVA 3E3LA 4RACA 4ZRDA 4DR7B 4G5RA 2R5WA 3G49A 1EI9A 4DAEA 4M1EA 2XEDA 3ETCA 4DMMA 4JJ7A 1HG1A 1KAOA 2WT4A 3CE6A 3MMZA 5E1DA 5CP8A 3OTGA 3M4YA 2WA4A 4IG9A 2Q67A 1N0UA 1HKUA 4B6JA 3QWBA 2X6QA 3V8QA 1RHMA 4M1SA 4NCAA 3BE8A 2E4UA 3FUVA 3T5PA 1F4LA 1QTNA 4F84A 5ES3A 1MX5A 2Q6IA 3CVWA 3BULA 2WD7B 3A4VA 1R15A 3SYOA 4HLQB 4CG1A 5K8CA 3VR6A 1H6AA 2YJ3A 1NXWA 4LOIA 3VDNB 4CKWB 3R5HA 1V4NA 4J0KA 2K4MA 3LO8A 3FOEC 1O0CA 4L7QA 3KQHA 4RGYA 3UKMA 2PL9A 1G9TA 2TMYA 4X0EA 4P4SA 2XE4A 5H68A 3CVXA 1UT6A 3AKZA 1NRXA 1SKYE 4P6VF 3RKUA 3WOVA 3KPYA 3CJQA 5FBRB 2VJYA 1C3XA 2Z9BA 1TEVA 4DSOA 1QVFU 4DJ5X 4HKTA 3DKVA 5FV4A 1GU7A 5IBCA 4E46A 1Q7YW 4C0JA 1YQQA 2GLTA 1EWRA 2XF8A 4D4JA 1UFVA 2WTNA 3SYTA 2A9OA 2K1EA 4C7JA 3WFIA 1UBRS 2BFFA 2XZDA 1NUSA 3FCYA 1JDPA 1V8DA 2VRCA 4WCFB 3K35A 2WU4A 2QD5A 4HBGA 1YQTA 3FDJA 3KKYA 5KNDD 3A9VA 1L1FA 1GLVA 5HKKA 2GTHA 3BB4A 2HP0B 3OJCA 1TK3A 4LRYA 4RHCA 3GZTB 2B25A 3ZHCA 3IP6A 5A0TA 3SIPA 1M6HA 1V3UA 2R7LA 4COOA 2EZ8A 3FX2A 3HCBA 4XQCA 1M7HA 4PSDA 4JJKA 2DAPA 1NBHA 4O1IA 2ZAYA 5BOSB 1RYHA 4RMGA 3LT0A 3Q8MA 2E18A 1QFJA 3VCZA 1SGWA 3WQRA 4JNCA 2XVMA 3HWSA 2BOCC 3TI9A 3EPLA 1GZ6A 5KUKA 5FOQA 1OHHD 5AKZA 5DWDA 4DF3A 1Q6ZA 4U0JA 4ZAVA 1RM1B 4K5QA 4D3SA 3NGMA 3R5XA 2ADQB 2AC7A 4PO8A 4IIUA 4UUOA 3KQSA 1LX6A 2GUGA 1W75A 4FE7A 4UULA 3NR7A 2WLIB 2BFOA 2Q3MA 1GAQA 2E4XA 3V32A 3GFBA 2JJ2A 2WPDG 1PXWA 1B6SA 3ASYA 2XJ9A 2BFEB 3HKEA 2FJ0A 2W0FC 4HBNA 4EHJA 4PLHA 2YHUA 1BEEA 4A8PA 3T12A 3V00A 3PLNA 4PTZA 4Q9KA 4BW0B 1R12A 1KDYA 5G3ZA 1PT5A 3HH8A 3FRIA 3EWSA 3D6VA 5KSPA 2ZPAA 2FPIA 4KN6A 4IDNA 2Y1GA 4JI6B 2P5OA 4LZPA 3B53X 2PMDA 4CL3A 4N9WA 3D02A 1DXHA 1RC0A 4IINA 1RWOA 1M8PA 1SZQA 3RHTA 1ZSNA 1YTUA 2I6DA 3EZFA 4Z9XA 4LKRA 4AZWA 3EPJA 1N2XA 3CMCO 1VE5A 3II6X 1K88A 1A76A 1CB7A 3KDSE 2HJDA 3MWKA 2P1ZA 3AFHA 1KJNA 4TLEA 3D7SA 2H5JA 4TTIA 1J5PA 5FX2A 5IE9A 1Y4AE 3ROQA 4BFYA 5DHSA 3HGTA 2H4YA 3OLCX 3HM2A 1IJEA 2WE8A 1RRMA 3BAZA 2QQFA 2L6LA 1WPQA 3FPAA 1SVLA 1FW8A 1UMCA 4G26A 2C31A 2H9AA 1Z6QA 3RPEA 3KXKA 3CF0A 2J6BA 2H9IA 3N2IA 1OA0A 2VPQA 3S7TA 1BNCA 2NTVA 2MHCA 4U9IS 5CLFA 3QMPA 5IZ4A 3TD2A 1K98A 2AX4A 4QWWA 3WWCA 1GQYA 2Q0HA 5EB0A 4OHMA 2DTXA 3VM6A 4HNQA 3S70A 4GOOD 3HK2A 1X38A 1KDVA 1L7DA 3IOCA 3G5MA 1PV4A 4JJIA 2AEFA 3M99B 3QLUC 3A3OA 3QFRA 3DB2A 3LFOA 5D3KA 3E8SA 3QM1A 4MQ4A 2GXSA 5JZOA 5DHQA 3ONVA 2I2BA 2YS7A 3D3IA 5DWQA 2VHUA 2AI2A 2ZWOA 5JNLA 2H54A 2C7PA 5ALQA 1VJ0A 1JJOA 1RYFA 1GLNA 4PXYA 5IZCA 4OL0A 1JFVA 4NPAA 1RWBA 4EPXA 3NUZA 3PQDA 3NNNA 2XBMA 4OA8A 3DVAA 1YS2X 4HEHA 3UGJA 3SE7A 1N5DA 3ZDQA 3H18A 521PA 2ZSAA 1Q0QA 3LVBA 2HA7A 5EC1C 1SQ5A 2OPBA 3ZMUA 3IBTA 3VDXA 3HY3A 4YAIA 4I1YA 4NKRA 1JKFA 3CMEV 3PUWA 2ZWVA 2GHRA 5EUBA 2AWNA 3AB7A 4O4LA 1FS5A 2FMHA 3OZSA 2WQ6A 3OIDA 4BLOA 5LA6A 1WPRA 1PZEA 1QGUA 1L9KA 2IJKA 4F4UA 1U3DA 3TLYA 4RIIA 3W7UA 3VKVA 1FX1A 3EXFB 4B3XA 1QIKA 4RULA 3KXLA 5FEUA 5HZGA 1PNMA 4JJ4A 2B4YA 1L4GA 2CL7X 4JN6B 4FSXA 2Y27A 2X3YA 5JY6A 4FHCA 2PT5A 3LFUA 3B89A 2NQ8A 2VDWA 3LIIA 5BV8A 3GZJA 1NVPB 1NQ3A 2XAGA 1YR8A 4H08A 5DTMA 4C2UA 5JVDB 1UAAA 4JZKA 4LWSB 2JDIA 5TLSA 3PXCX 4MWTA 2XCLA 5F33A 1FU4A 3EMKA 5IVIA 4ROSA 2Q9AA 4KMRA 1I3OA 2J07A 1K7XB 1GZ4A 1N7GA 1U0OC 2BW0A 1JHDA 3DOEA 3DDOA 4P7BA 2DM6A 2ZKLA 4MITA 1KNQA 4BO1A 4HDRB 5DISB 2JH3A 1Y67A 2X8JB 3T7SA 4F3TA 3SS8A 1HLGA 3AV0B 4ZYUA 3AG7A 3Q6IA 4IJ5A 3LUAA 2ERYA 3RVPA 4RY8A 5EWLB 1TGOA 2LGWA 3K0CC 4U6QA 1BCSB 2XBUA 3RS7A 3GUVA 1V3QE 1LD3A 1SD5A 1COZA 2JFBA 2EYQA 5D01A 3LFTA 2EYUA 3QO7A 2GK7A 4EG6A 1G3QA 1L5ZA 4D6TH 3WG7B 2CUTA 1G7TA 3AVYA 4L9SA 3EQ2A 5FBKA 4C43A 1X7ZB 3S1AA 4D41A 1RPNA 2IEGA 3BK1A 3H3FA 4G5OA 3K5IA 3PXGA 5E6UA 1WZIA 1YDEA 3HPQA 1QNMA 1UFKA 3IILA 3FZYA 5AW3A 1HETA 1BGYH 4ZQFA 2PLAA 3IL2A 2PRIA 3IIIA 1PL0A 4WBSA 1NPDA 2CFCA 3KHNA 2B0JA 4YO8A 1MO5A 3INRA 2JGAA 1KIMA 3Q12A 4Y2GA 3V1TC 5AKEA 4U2FA 3NTXA 4B33A 2EZ9A 2VWPA 2HJWA 2QN9A 2G9ZA 1OLXA 2C2BA 1XU4A 2ODAA 1T5IA 2BBSA 3ZEAA 4K6FA 4EATA 3I2YX 3H4TA 4LRQA 2JGRA 2J9FA 4CM6A 1Z2GA 1SC9A 4OQZA 3U44B 2GSWA 2R70A 3OFNA 2QRUA 3PJRA 3THXB 5EJ4A 1YIOA 2QGFA 4QNMA 5DW0A 1H3FA 1KXJA 3O2JA 3SG0A 1EZVH 3HMKA 5IJWA 4TOIA 1O5OA 5DBFA 1QIGA 3B1JA 1XSEA 3GUZA 1W1WA 1EDDA 4D1YA 3OWOA 1SUPA 4N0DA 1NHWA 3UN1A 2NNLD 1XRQA 3MUEA 4LW8A 1GADO 3OCVA 1P45A 4BXOB 3CBQA 1GZHB 3KFLA 4R31A 2OCGA 3PS9A 2RGUA 2YEVA 3ON5A 1A9SA 1KZ6A 1V43A 2EDAA 1U5BB 1BWRA 1M6VA 1FDWA 1VQKF 4OQPA 4N40A 1BDJA 1OHHG 4XDKA 1L1QA 5KA5A 3L7NA 3CEIA 2PCLA 1M56C 1B3RA 5F9FA 1HFJA 1BMTA 3FPFA 1RI2A 2TSYB 3PDUA 1KKCA 3WWYA 3MINB 4TL7A 5CUQA 4L72A 2EBWA 3LUPA 5J2TA 2OP0A 3PE4A 4YDSA 3LKBA 1RPRA 3MYYA 4AUKA 1EM8A 2ECQA 5KIAA 3R9WA 1BS2A 5G1PA 4YRKA 4AWBA 4QC2A 2NTJA 5C3MA 4LOLA 1LQTA 3HLTA 1QYCA 3RV4A 4MP3A 3EUFA 3Q7RA 2ZVDA 1KFCB 4FW8A 5CB6A 4CKEA 3D0QA 2UYNA 3DCYA 1PZMA 2NU7B 1UBEA 2R6JA 5DGCA 1VBFA 3D4NA 1FXUA 2N75A 5GGXA 1PL7A 4QQ8A 5BWOA 4ZMBA 2P6JA 4BVRA 1SEVA 4WOBA 1GLGA 3OCZA 2O1WA 1ZN2A 1MG0A 5ALWA 2W0MA 2QI2A 3QHDA 4QD3A 5JH7F 4ZAGA 3EIUA 1U0GA 2QL9A 2ZUVA 4Q6WA 2E9SA 3ZJ5A 3PNPA 2H57A 1JECA 3A6JA 3JARA 5LGUA 3SPHA 1ZUNA 2ZXUA 2HWUA 1YRYE 2OLJA 5LMUB 2JHFA 1YO6A 5ALNA 4TWJA 5FD8A 4RWUA 3LMKA 4HPXB 1FTYA 1R0RE 4D3YA 3AR8A 1C8KA 3K4QA 4BT5A 4B3MB 1E0DA 3AHDA 1Y4SA 5FR2A 3CWZA 5EIBD 1RHUA 3APQA 4E2FA 5ITZB 1K0UA 4IJKA 4PRYA 4Q7KA 4QHYA 5D6OA 4BWAA 1XXLA 1IBMB 3G1UA 5TQJA 3K2XA 4H7FA 2QD2A 5FA8A 4N12A 3CXHF 1BE8A 4UCFA 1N77A 4FQ8A 1ZZGA 4AI8A 4NH4A 2VDRB 2I6GA 5D3ZA 3KJJA 1CRZA 3NRCA 4K03A 4XGKA 1ODFA 2O8BA 2PR7A 3OPQA 3GEBA 2YWBA 2G77B 3E86A 3WGNA 1WZEA 2IS2A 4CS3A 4BW9A 1NVVR 3ETQA 5KB3A 1LX7A 2F3TA 5IARA 4KQMA 2FC3A 4R5HA 1GGVA 1W6RA 5A4FS 2XYGA 3T1QA 1NS1A 1Z2CA 2CNWD 3PC6A 4GXRA 3ZDBA 1LPSA 3QE0A 4KQXA 5LMCA 3H8SA 1C9YA 3V7WA 1ONSA 3KSBC 4X9QA 1SBHA 4P84A 3L1JA 5CU7A 3CINA 4BVTA 4JJGA 3BSFA 3NOOA 5TC4A 5KNCD 1H4QA 1G8GA 2GILA 2JFFA 3EQ6A 1LRLA 3LT2A 1VJTA 3ZK8A 1Z8FA 1QDUA 2P6MA 4MS2A 3AW9A 1ES9A 3I4LA 5B7NA 3ZWQA 2KG7A 1E7KA 4TMXA 1U97A 2QTHA 2VDLB 4RVHA 2OD2A 4Z49A 4NZZA 4TV9A 4DM3A 1CE8A 6ABPA 4TQDA 4QSMA 1E9BA 5ADVA 2D4HA 5HG0A 5JJ5A 3KZ1E 3IOBA 4CXMA 2C9MA 4PM4A 1OV4A 1WA5A 1GN8A 4B34A 2GZ3A 2Q4RA 3F4KA 3FPBA 2RNBA 1CHNA 3GAMA 1SQ0A 1TZKA 3H13A 2AJTA 1VC2A 4D56A 1QAMA 3BHNA 2VWJA 4F7WA 2CLIB 4OH7A 2H3EA 4RO2A 4R1UA 1WIWA 3HJBA 3TF5A 3LT1A 3L18A 1XEWX 2QE7D 1GR0A 2XVXA 3A11A 2QRLA 3NJ8A 1I7NA 5K0SA 3SMVA 2AFHB 3HCOA 2R6ZA 1CUAA 3D1LA 4HWGA 2ASEA 2D0DA 1ZGZA 3DYVA 4CNBA 4MS4A 4PICA 3GPLA 2B8WA 2OBFA 3L06A 5IKXA 2ONCA 5FL7D 1UK9A 2B3DA 5GW7A 2XNDD 1IHUA 2BTUA 2P27A 3NDBB 3HO1A 2DBYA 2P9TA 4YRGA 4OQ4A 5DT2A 5FTKA 5JNVA 4TMWA 2ZRPA 1RXVA 3EOBI 2KG4A 4EP1A 3FZEA 1EBFA 2F62A 3EXEB 1SWWA 4GPD1 3CZPA 2CH7B 1PFVA 2ZUWA 4LOKA 2NU6B 3G8DA 5I8WA 2POQX 3VPBA 1Z6XA 3CYOA 2FYTA 4YHHB 1EK1A 1ZAUA 1AKWA 2IUTA 5KNDA 1SHTX 3CSDA 1GL9B 3MQ4A 3NDPA 2WJYA 1COWG 3CLSD 2XUGA 4JI4B 4E07A 1PZFA 3QIVA 1H65A 1TPZA 5M3BA 1IG0A 5JJEB 3KQNA 3OQIB 2G0TA 3FMIA 4UMDA 4BMSA 5LUBA 1OILA 2ZE6A 3SP1A 2G4LA 4L9AA 3CZMA 3BFKA 3KCYA 3IAYA 4RHEA 1L6IA 1FXKB 4CM7A 3H19A 4PA7A 5JECA 4B7KA 1JG4A 1OHHA 1AI4A 3NHPA 3PC7A 1OLOA 1QYDA 5HWSA 1T3TA 2HIHA 4TS1A 5SY4A 1TZCA 2ODTX 3QFFA 5KWEA 2II6A 4BZPA 4X1KA 4Y2XA 1EDEA 2E3JA 2ZF8A 1HZZA 3AFIA 2QTCA 1L5NA 3IEWA 1F0KA 2P40A 4II3A 3P30A 4NZNA 4NCJA 1KJZA 2FW0A 1AMNA 4QTXA 2X0RA 1LUWA 2XDYA 4LYEA 5G0TA 3BL5A 1XRRA 3I76A 1T29A 3ZE0B 4PPNA 1GT6A 2ZFUA 2DHRA 1KK2A 3KOMA 4RSRA 2ZSHA 3VHXB 1K2WA 2M6KA 3TOSA 3FUUA 2PSSA 2HA5A 3P0ZA 5BSGA 4OQXA 4YCMA 5EWMB 3MOSA 4PPYA 2YV1A 1KBZA 4PPGA 3MDOA 2NAFA 1EM1A 2IXAA 1WMAA 1L5LA 3BXZA 3O73A 4CMEA 2HQ1A 3O4VA 2AOWA 1PNOA 4XWYA 1IV1A 5ELXA 4LJKA 1CJBA 4BKQA 1CQWA 3DONA 2ZPUA 3K30A 1OX6A 4DBVO 1LVUA 1C50A 3I61A 1T8TA 4DDTA 1RVDA 1XPJA 2O48X 2ACVA 4FGUA 3RWOA 4TTTS 3HI6A 4H3SA 4B3TO 4ID3A 3A4YA 4OFWA 1IBKB 2ZYDA 3MM4A 2QUJA 3OF3A 2PQ0A 1D4ZA 3ILHA 1SBZA 3U1VA 3ORRA 3NC1C 2WLMA 1Z7GA 3E8GA 3ICEA 2Y99A 2WIBA 4PC3A 3G0OA 4CGYA 4XVUA 3K1AB 1PGOA 3NFYA 4ZAWA 2OC9A 1EHIA 3CRW1 1G19A 2HCTA 5JJNB 1RLMA 2IBTA 1F4MA 1I9CA 2DR0A 1JLMA 4Y1GA 3ESAA 4EYKA 3SR4A 5TJ9A 2DFNA 5JCOA 4MZXA 2GJ9A 3B8MA 3T6KA 2ALEA 1K6JA 3A7EA 2VCHA 2QI9F 3FPCA 5KDLA 4F97A 1YITV 3BHMA 2WG1A 4B2LA 2YWHA 4AX4A 3OJLA 3JVHA 5INTA 2XSZD 3KPUA 4P3YA 3K4HA 1N9GA 4KQEA 4RH1A 5H1YA 3BS4A 3LC2O 4RA6B 3G02A 2EF1A 1WNTA 2PYLA 1S2MA 5DYNA 5FI1B 4D97A 1WBJB 4O59O 4M7PA 1EQ2A 2X8AA 4FEEA 5K0EA 1YDHA 2XAHA 2WJIA 3GP5A 4I9FA 1OVMA 3EZ6A 4JJFA 2R4QA 4UZSA 1KK3A 1GSIA 3ENZA 3DZBA 1CEXA 4PDVA 4EI8A 3U3XA 4WOPA 4DDMA 4DPMA 2XGSA 5I5GA 3RFCA 1C3LA 1V4VA 3VU9A 2V7UA 4FGWA 2P78A 5SZIA 1IAVA 2WNSA 3DYIA 2GJ8A 1SQQH 1J8YF 1CF9A 4S2EA 2ZJ3A 5DHUA 3O21A 5GVRA 1J2JA 5C5CA 2D2FA 3EASA 3BICA 1JLHA 1W5SA 1FF9A 4DRZA 4B17A 3P2YA 3MN1A 5U9CA 2GNAA 3A6PC 3PFCA 2RH8A 1MFPA 2B92A 3L0SA 2LKCA 2P5YA 3I12A 4KDRA 4PYRA 1S5JA 4JMLA 4Q93A 3NTOA 2QRMA 5KLVH 4HDMA 3L7AA 4D92A 4BMXA 2QLJA 3SXUB 1UPBA 5FUXA 3CKLA 5TGTA 1Z12A 5KMGB 1E0JA 2CJYA 4F9GA 3H9CA 1UPAA 5AHOA 1Z2EA 5FUYA 4LN1A 2WDPA 4F1KA 4AJIA 3QPAA 5KO2A 4WEOA 2X0KA 3F5SA 3AHCA 4P2ZA 5C8YB 2C5HA 5AM3A 1HDCA 3LF1A 5D85A 1FW6A 4N01A 2ZOVA 3VTIC 4FYXA 4IZOA 1FRNA 4RS3A 3FPSA 3DAHA 2LFSA 4Q7MB 4BAYA 5MGBA 3NETA 1P2TA 4W82A 3KTAB 2ZIVB 3G4SF 1MGOA 1BD4A 1YR2A 1SUDA 1U28A 3CX3A 4XD7D 2BRUC 2CD7A 4YWHA 1GDTA 1WP8A 5IDVA 5I3ZA 2AD5A 2QE7G 3OTWA 4LR3A 2ZIEA 4Q48A 3EXHA 4G0OA 4PLTA 1EG2A 1I4TD 4UC0A 4I1VA 3UWPA 4D9HA 1PJSA 5MFZA 4K8XA 2D5BA 3F6YA 1W46A 2H31A 2IK8A 5FL7G 3F96A 1C0PA 4C01A 1PYGA 2XNDG 5KUMA 3O1JC 4X63A 2B9ZA 5K0FA 3HCAA 4BEWA 1OBHA 3VQWA 1ZBQA 3QNMA 4NATA 1S3SA 4HMOA 5BMVB 1NTRA 2QRZA 4FLTA 1UAYA 1BVYF 5EKSA 1OLUA 4LEIA 1NOKA 4YFYA 2Y4UA 4DCTA 3T15A 4TWZA 3WXMB 1MVNA 4YACA 2XNHA 3ANSA 2B0CA 1XAHA 2ZUUA 1IQRA 2RGYA 3THYA 3IBFA 4YP6A 1KUQA 2QHXA 2PPLA 3G5UA 3KWJA 4FMDB 4MPDA 3M6LA 4TLMB 1DGSA 4LSWA 3NV9A 1TQ8A 5IBPA 1SKYB 1P18A 3LGXA 5KAMA 5DN6D 3HLYA 3CT4A 3ZEDA 4U7HA 5AIAA 1IZ7A 1SXJB 5T6MA 3BE6A 2CTWA 4U4AA 1XA3A 4EQ6B 3DOUA 4W8HA 1OE0A 3DFFA 3BDVA 4X7PA 3BRWD 3LWQC 4WKNA 3CCJV 2XV1A 5CBGA 4EJFA 3SX4A 4IIGA 1QU7A 2JEXA 1QU3A 4J4BA 3I39X 3IEUA 2HRZA 1U90A 4NMMA 4UM7A 3H6HA 3B2NA 2AZ0A 3BORA 4M22A 5DWVA 2REQA 1X8XA 4OB6A 1Y3DE 3F0TA 1DOZA 4WN9A 1NYQA 4R2LA 1UJ6A 2DERA 1W85B 4YJ3F 4GOKA 2HA0A 5CAEB 1WOYA 2A0KA 2Z56A 3EDCA 2XB8A 2V6BA 2OLKA 4KFCA 2CBZA 1CKEA 4ND7A 2GJ4A 3FJYA 1FP1D 4MRRA 3ESDA 5M5BA 1JAYA 4M36A 3JATA 5GIPE 5EINA 2JJMA 2P62A 1FJXA 4Q1AA 1JYEA 2Z1MA 2PS0A 4ARBA 2O54A 4ARIA 1LBTA 1THZA 1LH0A 4C9BA 3HJFA 4JF3A 3WJ2A 1IOZA 4AJNA 4U63A 1YQUA 4MULA 4UQOA 3AG4C 2VT6A 3PHLA 4CRWB 3BX1A 1CBUA 1XDUA 1UCFA 3DQQA 4UM9B 1T34A 1DJMA 1SKMA 1V7ZA 4HATA 3GPBA 4CH6A 2GCIA 1GM9A 3WGUA 3W7VA 3SY8A 1LB1B 1GO0A 2NU8B 3RF6A 1K6EA 1IBLB 2ITCC 3IALA 3OA2A 1VQ5F 1RYDA 1GN9A 1W88A 2RGDA 4YONB 1BQ0A 4UHKA 5DNYB 4IIJB 2OQRA 1UADA 4A8HA 3H86A 3VR0A 2PL1A 3TQCA 1OJ7A 2BMEA 4GSYA 4EKEA 4ER5A 1VQ6V 2O3SA 1G98A 1L8OA 2F1OA 4RSHA 1U7UA 4BLUA 4C81A 1X1DA 2V6GA 2UUBB 1PV0A 3S1LA 2JF0A 4LBVA 4UFZA 4E09A 4GECA 4S35A 2ZANA 3UXHA 5JYEA 2G0NA 2OKCA 4AMUA 4JI2O 2UYJA 5BV7A 1W29A 2BGIA 1L8QA 1NMSA 3A7DA 1WW8A 1WN7A 4O4IA 4MUEA 4M0LA 3WK6A 3DH0A 2FGYA 2OCAA 3OE5A 1LI4A 5KYYB 5KNCA 4TT3A 4MOWA 1L1RA 3VV2A 1NDQA 3TLAA 3ED1A 5BN5B 3A1SA 2ZJAA 4DDVA 1O94C 2UAGA 3O7MA 1KDOA 3KQYA 2L42A 5CBPA 3FCXA 4UBKA 1NZJA 2JNWA 1C8VB 2BZGA 1OH8A 3QVNA 1JHZA 2BFBA 3OIGA 5BSHA 2RHLA 1HNWB 4REQB 5FPQA 5B3SC 2UYCA 2CBXA 2DKOA 1Z37A 1YS1X 4KUMA 2HU7A 1K97A 3E48A 1N32B 4JPRA 3INYA 1EK5A 3MHTA 2OFFA 3IKEA 5HCIA 1U1IA 4Y6PA 1LZKA 1U0TA 1JA9A 3WB1A 4DN6A 2I80A 4L8LA 1QCYA 1E64A 2ONYA 5HKBA 4W1QA 4EG1A 2PZKA 2L69A 3IA7A 3TTTA 4A6EA 4IDEA 4D74A 4HRVA 3IQDB 1QYVA 4BIOA 5B3JC 5TF4A 2HVJC 1Q6IA 2V9ZA 4MVJM 2B33A 1ULHA 1T6YA 3IDOA 4I0XA 3U62A 4PDMA 4L0QA 5FL7A 4AY3A 3GP8A 2XNDA 3TETA 1KAHA 4L4ZA 3RTGA 4PA9A 3TDMA 5HUHA 1PU2A 1Z0KA 2OT3B 2Q5ZA 5BSEA 2X7HA 5A3JA 1IL0A 1NRJB 3L4BA 3TJZA 2QWNB 4FGLA 1XL0A 3T41A 4ZOQI 1UMDA 3K9BA 4L08A 1GM8A 3IXLA 2FXIA 1PNQA 1KOFA 1E18A 2XD4A 1C14A 2GTSA 4HCJA 4HTAA 1WLEA 4YCJA 4G0XA 2OXCA 2E4AA 1EWQA 3PNYA 3UYKA 4EO7A 1KO8A 3GMDA 3JYNA 3M81A 1W40A 5AK0A 4CFSA 2VQFO 3KFXA 3RSQA 4NJEA 4XIGS 4X92A 5L3RA 4BQOA 2WFMA 3BK2A 3G13A 5EUMA 1JAXA 1EXNA 3QA3E 4UVDA 2K87A 3ROPA 3MMNA 2RHHA 1T8WA 4M99A 1UPCA 4MAMA 5CITA 2WPDD 3EGDA 4LBZA 2O2ZA 2DYRB 2PQ6A 2NN3C 4NAHA 3TXAA 4DQVA 1T1GA 5DRTA 2FAXA 4Z2WA 1LTKA 1KO4A 3BTSA 2XMQA 2QWPB 1W73A 2XHBA 3WLFA 3TZCA 4Z4HA 1GT91 3ETLA 2QTNA 5K0BA 1XMOO 1GX1A 1Y6QA 3NTVA 3EFFK 4CF6A 2OO7A 4YJFB 1JDTA 4EYEA 1N2SA 1H4SA 1I4OA 4HFNA 3TDKA 2PBLA 2GNPA 1BW9A 3BFXA 4K1XA 2H2WA 1JTFA 3AOEC 1KNKA 3Q5DA 1E98A 2ZROA 3U48A 4E0BA 1PZNA 3VR5D 5GANK 1ZW6A 3ABLC 1G7CA 4C0LA 2D8AA 3G0CA 2PYDA 2IDZA 4Q02A 1GG2A 1IK6A 3O31A 4H6XA 1W6UA 2ODNA 2FN7A 3I9LA 2A06H 4MVWA 1AF7A 3VQVA 1SCJA 2C84A 1W47A 5DN6G 2O6LA 1CUXA 3P9RA 4P5DA 2R7AA 1J8QA 1JKIA 3WDKA 2A1IA 3RIXA 1UBNA 5EHGA 5JEEA 1IEWA 3CUUA 3VSBA 1V54B 4JVMA 4N5IX 4JV5O 1TM2A 4JWKA 5JC8A 2PO5A 3AUYA 1F8UA 4ZALA 3FUTA 4DR3O 4OG2A 2IUSA 4MH0R 4FOTA 3V3TA 4DNOA 2O2SA 3DVLA 3W90A 4BATA 3KO8A 1TZ2A 3KXPA 3GLFB 2Y48A 1XZMA 3OT4A 5C1PA 2VP3A 4W9RA 4QM7A 1PZGA 1OF1A 1JWLA 3JALB 4YAWA 3UWOA 4YJ2F 1ZRMA 3MMPA 3APOA 3AG2B 3PD7A 2ZZNA 2JK5C 2JGDB 2PD6A 3T9FA 2HU2A 2JI7A 3SJAA 2YXLA 4I1UA 1DT3A 4WK0B 2QWRB 3F5TA 2HIMA 2FR8A 1T5OA 1NNSA 3O8CA 4RY2A 3UMSA 1J95A 1M8GA 3R40A 3NRBA 4QWMA 1WQ4A 5CEFA 1PEKE 1S1CA 5JQGB 1FLAA 2HT1A 1U7PA 3BGOS 1BRMA 4PN7A 2W6QA 3ITNA 3A04A 1BH2A 4A8JC 4BPBA 1VSQA 4X66B 2RJNA 3LC7O 3SZOA 1E4EA 1QH8B 3R8FA 3SLGA 1B8UA 5J4LA 1RJFA 4DIOA 3NHJA 1M54A 4QOJA 4Z0NA 5BYAA 3CCVF 4QGFA 3VKGA 4JX9A 1ZMRA 2RJZA 3ESQA 4QU5A 5FXMA 1J42A 1ESDA 2O5VA 2EIMC 3KZCA 2IZ7A 1NW8A 3ZU5A 1TQ2A 2OCCC 4P7GA 4XDJA 3OZ7A 1EUYA 1C0LA 2OAGA 2FG5A 4MEAA 5FJIA 2IW5A 3K92A 1AROP 3DW3X 4A03A 4R1TA 2HBQA 1C1XA 4FNAA 3NBFA 1KBQA 1F9EA 2C2YA 1YR9A 4QYSA 4A2QA 1US6A 4R2XA 2RGRA 5BN4B 5EWRA 4K2AA 4EITA 3N3BC 4LYAA 5JBNA 2R9RB 3O4HA 4R7ZA 2GM3A 4HEQA 5AVSA 3KDAA 3M3PA 4ZVLA 1SVKA 3K70B 3EMVA 1JSCA 2I2CA 5KOJA 1Y7TA 3I09A 2WAYA 3BA1A 2XPCA 4PINA 4MW2A 2WHEA 3AFOA 4DMFA 3WYNA 5H3LA 2GNOA 4LYHA 3RJMA 3RA6A 5EZYB 1G4UR 1U6IA 3B3AA 2X0IA 1WXEA 3PHJA 3V8EA 1Y8QB 4WXPA 3C15C 4XDZA 2Z5LA 4U2DA 2RGWA 3DAYA 4NI5A 1ZJWA 3L5OA 1OCOB 4CDRA 5ALXA 4S2UA 1YUNA 4EMTA 5H0IA 1K4KA 3PZRA 4DDWA 3V48A 4ZZ1A 2KHZA 3F7MA 1V1RA 1NMQA 3FPLA 2YN2A 5B1EA 1K1EA 1TNDA 2BWJA 3EZXA 4OI0A 3VC7A 1DTOA 5KNBH 3UCEA 5LQRA 3HACA 4IDAA 2YFKA 5D2CA 2MMCA 3CVOA 4CVNA 4R0VA 2R3SA 3ZCVA 1IMJA 1XEXB 3B85A 1JIJA 2QL7A 3LA8A 4MA4A 4B2YA 4A5UB 1W8IA 1V8OA 3N1UA 3OP4A 4NWOB 3KBBA 1GG8A 3RJ5A 3TLBA 4JSTA 4MHTA 3IURA 1E9AA 4GZRB 4UHEA 4UNNA 5LDDC 5G4KA 3USES 1VYVA 1NW6A 1UODA 2QMZA 3K32A 1OYOA 3I9OA 4IJVA 3PEYA 4XD7A 1Q0UA 1JDVA 1H9CA 4A91A 1FU8A 3GEMA 4D79A 2PZFA 1C3VA 5DX1A 1C7ZA 2ZYGA 3NBYC 1YZ3A 3S99A 4Y6GB 4FJ2A 4H4EA 4KSYA 3SEZA 2EKZA 1WMBA 1E92A 3I1JA 5LYJF 4S0ZA 4C3VA 4U7TB 5F7XA 2ZINA 1IN8A 3VZRA 2M2IA 3PE3A 1WF3A 1YOVA 1UMBB 2RN9A 1JHXA 4HAIA 5CH3A 3FHLA 5FNVB 2WMYA 1XGKA 1JAIA 3E89A 1CY0A 4CIXA 8ADHA 3D36A 3ESYA 3SC4A 3ZWVA 3DEJA 4J7ZA 2C9ZA 3RWMB 1OXUA 4LHZA 1ORIA 4F2HA 4AWAA 3I5DA 2X58A 2O2IA 3H11A 5L3DA 3BZWA 2CCGA 4JA0A 1WCYA 2JANA 2B8NA 1Y3FE 4L85A 4DLXA 2ZB3A 2Q2NA 3GRYA 5JO9A 1CR2A 4HWRA 5DN6A 3QXSA 2VP4A 2ZJYA 3NAZA 3COSA 1PQUA 1XQ9A 3KJQA 2OCKA 4PX2A 4IRUB 2IXEA 1ZUQA 2VJNA 1P61B 3BRWA 3B6EA 1G8SA 3NVKI 1HEYA 2WPNA 3QVLA 5HQ3A 2AMVA 1DPGA 2B69A 4O4HB 4MVYA 1RJEA 4OYRA 3VC2A 4G88A 1YACA 6LDHA 1E3JA 5CGZA 1JFRA 2P2YA 4F12A 3WDSA 2VATA 4DV0B 3WNVA 5KVSA 4HGYA 1VI6A 2UZ3A 5AG2A 1VE1A 3BXPA 2V4ZA 1YASA 2VSQA 2HOQA 2YHSA 1KFJB 2X0LA 4TWRA 4BB9A 1AI6A 5C51B 2FUG6 3PQ6A 5G0VA 4R40B 1SQFA 2CAZC 3AZQA 4DLTA 4JXJA 3G6WA 2ZPTX 4IH9A 2GKOA 1XBIA 3ORHA 1AJNA 2R84A 3COYA 3LS2A 4OHWA 1PV1A 3LHSA 4AK9A 2OOKA 2X40A 4X8AA 1F8YA 2WF7A 1WVGA 5L3ZA 1UZUA 2EFCB 1DK1A 1LDEA 2E75B 3ETGA 2J6HA 2JATA 3IUJA 4EHHA 3DD5A 3NIDB 4HH0A 4HZIA 2FSVC 4QELA 1M2HA 4NX2A 5CB0A 1LRJA 1J70A 3BJEA 4RY0A 2CL6X 2IDKA 5MDHA 3IIEA 2GAIA 1XRMA 4IO0A 2VPTA 4C7KA 4LF9B 2FUEA 5HMLA 2WOJA 1R64A 5AJTA 4FOOA 4DV2B 2ODQA 2HS4A 5AW5A 1QLEB 1NTMH 1Z83A 1N5OX 3UPTA 1IZ0A 4N0QA 4C8GA 5C7OO 5JHHB 4WFIA 3IHLA 5P8WA 4RFSA 2BFCA 3EFOB 3CH5A 1V11A 4TTJA 3ZO8A 3I8OA 1P9NA 5BWCA 4HUQB 4OSOA 2VJDA 3R6GA 5B1NA 3GNLA 3UJAA 1L5WA 3JSXA 1TPYA 5T41A 4ZP1A 1ABFA 3RVSA 2F23A 1E2KA 2WVJA 2GYYA 2RAVA 3GHZA 1JALA 1S4QA 3MT9A 2BC9A 2X0JA 1CY7A 2OB1A 1AKQA 2BSKA 5IAOA 1VRWA 3NKFA 2BSXA 4N5MA 1VHLA 3HWRA 4KRYA 1TVEA 4AMGA 4N6NA 1WJGA 1B43A 2ZREA 3P0RA 5BSVA 4PYIA 1JV2B 1IV3A 5TDHA 1E1KA 3C8LA 2I4TA 1JIUA 3GJRA 1OGIA 4DLYA 4ND5A 1VHWA 3RVRA 1Z8DA 2RD2A 5EMJA 3H2HA 3VKFA 5FBVB 3ZXXA 5IEBA 4QECA 1KS9A 1HO3A 5D1HA 4ZC1A 5AYVA 3PJEA 3BH7A 5CA0B 3B1WA 4WI1A 1HDRA 1OBCA 1NX9A 4ZOLF 1DHTA 1QK5A 1MNGA 3BMNB 4CH4A 1NVWQ 3DOFA 3Q3IA 3HXTA 3FTEA 4MYTA 3WICA 2Y6UA 1JX9A 1JOYA 4EG5A 3L6EA 4BNMA 3BQ9A 4N3BA 5DF1A 5AXCA 2RHBA 2GK3A 1R9MA 2OFPA 4DV3O 4U2KA 2EBHX 3SJZA 3LY9A 3MSXA 4YT5A 5JTTA 4XYEA 1X7YA 3CC8A 4CKYA 1ANKA 3LU1A 2GPNA 3IBYA 1YBFA 4HEA6 3DQZA 1VOTA 4GVLA 4YY3B 4OXNA 3P0IA 4LWQA 1Y81A 1Q1BA 3WWDA 2XZPA 3JW8A 5KJEA 1JYSA 1XHLA 2DMRA 2D1TA 3TM4A 2EWCA 3VPHA 3EG9B 2OHXA 2CDNA 4CIVA 4KHPO 4WY5A 1VKNA 4Y1RB 3DTVB 5TISZ 1KEWA 4FHEA 4V0KA 3LNMB 4UMEA 3NOQA 4KL1A 1H2BA 4ZVNA 5EC8A 2DQYA 3P2IA 5LBUA 2JLZA 2GEDA 1XILA 2IS4A 1K68A 5BQPA 5L9AA 1BCCH 2F9FA 3LCVB 3AI7A 5JG7A 2H85A 3GWOA 4BNGA 2AYYA 3BE4A 4I81A 5C1IA 2Z2IA 1U3GA 2Y66A 4LFAO 3CSSA 1E6KA 1C8BA 4CLEA 4ZMSA 4RSMA 5TIIA 4GX2A 3W3AD 2LE0A 3D4OA 1AK9A 1COWD 3MERA 1ZMXA 4YP9A 2Y67A 4KSBA 2HRRA 4X93A 1V4BA 2QN6A 1MO4A 4X9XA 4F72A 2LIPA 2Q7HA 1R16A 5KPDA 2FPMA 2GHYA 2AIFA 2DQ3A 1KY2A 4CF5A 3I56V 3T1VA 3DTTA 3B7GA 1AI5A 5L3FA 4Z4FA 2OTLV 3DO5A 5EYPB 3VSEA 5IYZA 4L6AA 4YYZA 4X41A 1JEYB 1AVMA 1SIUA 3GVIA 2F4VB 3C5EA 1EX6A 1VIMA 3BMOB 3AYXB 3BFPA 2ZRDA 4EGQA 3PPWA 4RVFA 2GH1A 4LVUA 5A02A 1DFIA 3Q2KA 1PR5A 4QX6A 5CGQB 3U49A 2ZJ8A 1K34A 3NHSA 4JAVC 3FVTA 1SUFA 2QLTA 3K16A 4Z0HO 1U8CB 3G8AA 4QGHA 4J16C 1ZL2A 1GQSA 4IXMA 2DN9A 1NI4B 2NX2A 2K7FA 2WPDA 5HBGA 2OD9A 1CF4A 2XQVA 2MIIA 1IUNA 2KTUA 4LWPA 3WLNA 3RR2A 2YMQA 4Q9IA 5CB4F 4TXHA 1JJ2U 1U8TA 3UO3A 4BJ6A 1IN5A 2ZYWX 4P2GA 5F7ZA 3JAMA 3NHBA 4H1UA 1PQWA 4GIBA 1YDWA 1OB5A 2FMTA 1JHYA 2OC4A 5IWAO 4DCCA 3AHFA 1GFWA 1JWAB 1KOGA 4FX2A 1CDZA 3QITA 3I9NA 1J2RA 3G71F 2R7MA 3HFJA 5JAPA 3TW0A 3VR5A 1D6SA 1TTHA 3V7UA 2P1DA 1DAKA 3R7FA 1ZFNA 1RQPA 1OMOA 2YMMA 3A32A 2AQIA 2BPOA 2Q28A 3PR2B 1UKBA 4OQFA 1PT8A 2IDMA 4R8KA 1TM1E 3OZUA 4Q05A 4ZVPA 5DULA 5SV2A 3UEOA 5FB3A 1QAHA 5JI2E 5AP9A 3ZMZA 3GLIE 5IT9N 2GN9A 1I2AA 4KAXA 1PLJA 4FLWA 2KSQA 1UC5B 2Z1NA 4YMHA 2YS8A 4EUFA 1RMTA 5AOCA 3PQCA 2JFUA 5H4HA 1ENVA 4UMVA 1CNEA 3U6BA 4HWKA 1GCIA 4YRQA 1AP6A 1N2BA 3S8MA 1LU9A 3RHSA 3FOWA 1NUTA 2OFXA 1TE2A 4MRPA 2E0IA 1MQAA 2WHRA 2XE7A 4XW2A 1CK2A 4NJMB 2YTZA 2ZBVA 1CP3A 1PJLA 4TRJA 3ENKA 2FW7A 3FFQA 4OJYA 3HJHA 4AXXA 5B6PA 4IH1A 4C4YA 5GONF 1KZ9A 2IIVA 3KPVA 2GA9A 5JSYA 4UPVA 3WLPA 1G6KA 1NI5A 4M83A 1YTFB 3DE5X 3ZGOA 3SICE 4CR8A 3ZLBA 3WKBA 3OUTA 4DJTA 1SHJA 1UKYA 3DO6A 1JFSA 2RDMA 3TPFA 2P6PA 2XDWA 4J11A 2FPKA 3FOBA 4RPJA 4PZDA 1XEAA 3GMIA 1M5IA 4IF6A 4DKXA 1BS1A 1SZTA 4GUNA 3STZC 3ZLJA 4K6CA 4OKIA 4HOYA 1ZOOA 1SURA 2ZRGA 4XPIA 4ZT7A 5IG2A 4ZQGA 1Q82H 1G6UA 2UXBB 2UVQA 5FA5A 4YJHA 3PUHA 3WFVA 1VG1A 1FMJA 3PQ8A 2QUBA 2CLKB 4DEVA 3O84A 5ED4A 2Q27A 4MUGA 3STHA 1MOFA 2UU9O 3M7MX 2QL5A 2HREA 3LUGA 3IJ4A 1XPRA 3OUFA 3UUGA 2PG3A 4MWOA 4KITB 3LNNA 3FE2A 1Y63A 1B14A 3FDZA 4QGPA 1QVVA 3B60A 4K9NA 2LCAA 4QDUA 4FM2A 1MMFB 1V5FA 5BQ5A 1D2GA 3GFTA 1T9HA 3HRKA 5B7GA 1R74A 2OXEA 3HI4A 5LP6B 5JLAA 3CUVA 4MV0A 2PRKA 3ZMSA 2HJHA 3K0FA 4UXNA 3YASA 4XB1A 1YZFA 5HGJA 2Q6OA 3UW1A 4UE3S 1AXEA 3BK7A 2Q9BA 3SN6A 1S4MA 3FF1A 4IIEA 1JHPA 2M1XA 1HF3A 4KO3S 1NE2A 4RFLA 1SOWA 4E21A 4BQEA 2ZR0A 2C0QA 2OCXA 2QI9C 3T4PA 3K09A 2JFVA 1ORTA 1ZKMA 3IFXA 3WGKA 4CHTA 5CXSA 4RHXA 4DSTA 3BT7A 3LBIA 3I58A 3R5FA 1MAWA 4ACAA 4B6GA 5HX7A 2M6YA 3F1KA 1OCZC 1RNLA 2JLAA 1MQ8B 2QWQB 3PKIA 4BNDB 3W5BA 4FLFA 4CM1A 3LXXA 4B6QA 2NUTA 2X6TA 4J7CA 1ZN7A 1SULA 3LZDA 4I9UA 2Q4EA 3D0OA 2FTKA 1NKSA 1OBOA 3GGSA 2MU1A 1SR8A 5E9WA 4OXRA 4ES6A 2OQIA 4F0JA 5G1NA 3O8QA 1T91A 1FYXA 1YXMA 3IC5A 4G0WA 3O82A 2QEQA 3EJ6A 4HAMA 2RHCA 2AMFA 2AW9A 4M0EA 3NM4A 4QXAA 1KO1A 2HDWA 2KTVA 4M9ZA 4F2PA 4J7UA 1ZD2P 2R97A 1WXHA 4NKGB 4PAOA 8OHMA 2GYVA 2WA2A 1XI2A 2R1VA 1ZVVA 4COKA 1DX6A 2BSQA 3KVRA 3QLJA 1AQJA 4I55F 2OYQA 4J43A 5G53C 2RIPA 1SCKA 2QA5A 2AGVA 3JQ7B 5BN1A 1HNNA 2DF8A 3B5JA 3VJLA 1EWVA 1WDTA 4HDNA 3LWDA 4RV4A 4Q47A 2IQQA 5JD4A 2YJ5A 5LQCA 1VXRA 3MTEA 1B06A 1TZBA 4B3JA 5TNXA 3V97A 3G0GA 2P06A 2XKJE 1KWGA 3U31A 2C2OA 3VNAA 2WKRA 3F4BA 1Y7IA 4KIGA 1QDEA 4F38A 3U80A 4LFCB 1YRHA 1K8YB 4D8XA 1TIBA 5BN3A 1RBZA 1RZVA 3B51X 3T5CA 1O5TA 4YCSA 2QRPA 4FINA 3BKWA 2QAGC 3KHTA 3L6RA 4C08A 4NESA 3U0OA 2AR7A 1UXOA 5A9SA 4XKJA 1A8SA 3E1YA 3A9SA 3FB7C 3FBWA 3EA0A 4FLMA 3ELBA 3JTEA 2BHNA 4IX9A 2AR9A 1RMQA 1UFRA 4C04A 4EY7A 4YRTA 2AJLI 2A0UA 4ASUG 5EP3A 4EGJA 2EKQA 5L3VA 1LJUA 4I50A 4RHAA 4MP8A 3N2NA 2DHDA 1WL8A 4TLDA 3EVBA 1FZTA 5AH0A 2VYVD 1WETA 5DT9A 1JT2A 5ALFA 5DU2A 2P30A 3ICXA 1VQ4F 4CQMB 2I7XA 4G5XA 5TPZD 3W79A 1KERA 3URMA 2VJPA 4ZAYA 1Q0HA 1DAEA 3QBJA 2ILTA 3AG3B 2PANA 4YV1A 1IJFA 2ZAUA 3LRXA 1TX4B 4K35A 3GXBA 3PE6A 1Y3CE 2JIOA 3WR5A 4BTVA 1OWNA 1KO7A 5GJBA 1DAHA 4V3CA 1WCXA 1BMQA 5BW8A 4JB0A 3OU7A 3WWEA 4X6LA 1X3LA 1N3BA 1VBKA 1ZRSA 4BPRA 1ZNXA 2RJ3A 4IUCS 1RYYA 1R6DA 3WV5A 3CPSA 5KI6A 1P74A 1KU6A 1WY5A 4ZCIA 2ORWA 5L8VA 2HU8A 4NS1A 4KGXA 3W9UA 1N1EA 1K5PA 5REQB 3AR3A 1SVOA 1ZVMA 2JLSA 2WTEA 1E3QA 2ZEJA 2PPVA 4NWIA 1F4VA 1Z0AA 3AVXA 1FCJA 4G2KA 5I9LA 4MV8A 4ZDJA 1L4MA 3FPEA 1Z4OA 4V0QA 1EESA 4JEMA 4FT4A 3CS3A 3OQ1A 1ZNYA 1FRVA 4LRWA 4D9EA 4Y2JA 1LSJA 4WESA 5F76A 1YJQA 1YZYA 4FVTA 1ONNA 2HX1A 2NAPA 4E7PA 4RL4A 1T36B 1YV9A 1YE8A 1YBAA 3ZV5A 2Z08A 2B82A 4BCCA 3KKKA 2BM8A 5LQSA 1A5TA 4H3HB 3ABSB 1QAOA 2Q21A 1WUHS 1M1YE 3AG1B 1EUQA 1Y4ZA 4MAFA 3RC7A 1QZUA 4DLZA 1Z39A 2P2NA 3LQRA 1BL8A 3DF9A 3PFWO 1KP3A 2BTQB 1LWOA 3QEMA 2B3TA 3R66A 4Q4JB 3BVOA 3RAPR 3LOUA 5CBFA 1OXTA 1I7LA 5H59A 4H15A 4XX0A 1R8JA 5F9MA 3JYCA 1H1DA 1MEEA 1V6AA 5IX8A 2XB6A 1P2FA 1QH1A 5DM70 5LWQA 4BO5A 1ZTEA 1FP2A 1PS0A 2IEDA 4J0JA 1IXKA 3WJPA 2QPLA 3T61A 1XZKA 3HUUA 3OQVA 3WL5A 1OLSB 4DG8A 3AC0A 1QG4A 1NMZA 1O6BA 3H9GA 2NYAA 2FSFA 1KYZA 4PN3A 1E2GA 1L0BA 2IH1C 2XGOA 5JS6A 3E4CA 5FDFA 2R7KA 1K5DA 2D13A 5D5PA 4I6GA 3AV3A 1YDXA 2WAXA 3UKOA 3BVPA 1GTSA 3O9ZA 5K09A 3PKZA 3UNXA 3HNOA 2P4KA 2QR4A 3IPAA 3TUIC 3ZDFA 2IKSA 1R3JC 3ANLA 4TMZA 4C6TB 4AVYA 3QEKA 4LV5B 4MMXB 5HPYB 2GDZA 5I9MA 2JAOA 5AI4A 1CDDA 1NQTA 1RVV1 4ZCRA 2A9HA 3DMNA 4HFRA 3IAS6 3MUOA 2MJLA 3C6MA 3KVYA 1Y7HA 2PTMA 4AZ0A 1A5ZA 3A0RB 1H6CA 1VL1A 1SCIA 4QYIA 4D99A 1B4DA 4DV5O 1KSJA 2YXBA 3COWA 2XASA 4N9QA 3PVCA 2PWZA 1WTCA 1X8JA 2EJCA 3C41J 4S05A 3DF7A 3K5HA 4R3NA 2HX0A 1SS3A 3BQNB 1Y1LA 3SQLA 4M46A 2GPAA 5BV1A 4FXOA 5JMPA 5BY2A 4KXRA 3ZE2B 4OXKA 2QF7A 3Q9UA 1P5JA 3RUHA 2BDEA 3TIXB 2QZPA 4O0LA 3U7QA 1ZOPA 1ZICA 2JBHA 3RFRA 3ICCA 3WMWA 3B20A 4QJIA 1W9MA 3EUEA 3UMVA 4G1EB 3PQ7A 3IGAC 3MA0A 1FY2A 3RFVA 1D5NA 3VPFA 1DKQA 4MWGA 2ZR7A 3JCUZ 1I2ZA 4JB3A 4DV1B 3CZRA 2PUHA 3W3AA 5CK5A 4LJLA 5F12A 5LHHA 1COWA 4IQFA 4QQFA 1MHPA 1BGWA 1NR7A 5AXAA 4IXWA 3M1IA 3D7MA 3ZJ4A 2UZ4A 2MSDB 1L4LA 1JMVA 4MB2A 4ETWA 1I3NA 1G8KA 1ZNQO 3INTA 1RXCA 4QBHA 2DR2A 3N27A 1JVSA 1GCUA 5ER9A 1U1CA 5AFSA 2ZIXB 3L9XA 3K1ZA 3FGNA 2QTBA 2XNSA 4GPZA 4WECA 1UI9A 3ROKA 1BWSA 1TGYA 1IY9A 2GGSA 4MCHA 4FX5A 4PG4A 4QVKA 4O5OA 2OUIA 2AJBA 2J0UA 2WA3A 4CH5A 4PQYA 4UEKA 4W7SA 4YP5A 3T4UA 4FLUA 2HHHO 1XHZA 4J1TC 1U02A 3U4IA 4PC7A 3VI6A 1OB2A 4BX9A 4YFVA 3K0TA 2PX2A 1KPIA 1T4GA 5AI5A 4BNXA 4CMIA 4BNJA 2FFAA 1YRAA 4KXNA 3SQNA 4E5YA 4QBFA 2XB2A 2VJLA 1TM7E 1UBKS 3AWIA 4KACA 2XCTB 3R7BA 3OIFA 4Y8VA 3RUDA 3E1KA 3AIMA 4EYSA 2EZPA 2QW1A 2EW8A 4BQNA 4RVOA 2XZOA 3Q41A 2XUFA 4HB2A 1REQB 2JZCA 3CJHA 1XAGA 5AI9A 4KC0A 3I34X 4MHOA 3HUEA 4JTDB 1NQAO 4UFOA 4W4KA 1JG1A 2P1RA 4UHDA 1N7HA 1KK1A 1AN9A 1R9GA 1AJQA 5KYNA 3N2LA 2QROA 3PKJA 4YVFA 5LHIA 1U0SY 4UAVA 5DXAA 5J5AA 1EFAA 3UTDA 3FX7A 3O03A 5E79Z 1QKKA 3UH1A 2WEKA 4KRGA 1J5EO 4K9DA 3UB4A 4RSGA 1ONIA 4M9RA 3DXRA 1HT3A 3FAZA 2CMHA 1EA7A 2OAEA 3ZI4A 1KHHA 3UT5B 4BEJA 3LWBA 4GMGA 3EAQA 2QM8A 1NFFA 1P2BA 5IBQA 5A7FA 3VO9A 3TFWA 3F5FA 3RVNA 4W1PA 1EFPA 3DTYA 4FK5C 1A8UA 2Z3ZA 4FN4A 5T4HA 4INJA 3C85A 3MQFA 4PHHA 1WCIB 4OU5A 4NLLA 4DR2O 3X2SA 3U6KA 3PQ2A 1XQXA 3D8CA 1X9IA 3WWZA 3NHMA 3GUHA 3RK4A 3OBWA 3N53A 1GSOA 4XBFA 3AP2A 4R8RA 4IGIA 4PRKA 1X7XA 4GQBA 4N65A 3VYWA 1VE3A 1FNSA 4JLOA 5JATA 1YFZA 3BB1A 2NZ8A 4UU7A 1PD3A 2N48A 5IT5A 3P9QA 4A15A 2ICAA 2AFIA 3DT8A 4XQ9A 1PJ8A 2YHIB 1BCRB 2KI5A 4Z3OA 4IOJA 4WHMA 2B21A 2W2XA 5H16A 3DS8A 5CVTA 2HMTA 3IR9A 4WIAA 4NBTA 3IBSA 3KSDO 2COEA 4WNAA 5JRDS 3MXOA 1SVNA 3I2FA 4G24A 3PXAA 1TCVA 2E6KA 3HRHA 4WFBV 1PJBA 1OX5A 2ZKIA 1QCEA 2AG1A 4HNAA 2QTFA 4CIBA 1Z9BA 2QS9A 4RS4A 3H1TA 1E2BA 5KC8A 5GM2A 1DKNA 3PA8A 1HMYA 2IJHA 5DYIA 5KREA 3O0DA 3LBFA 2VQDA 5LWHA 3B2QA 3HVKA 2TMGA 3QKUA 4R6XA 1VF5B 4H13B 2F3PA 3CLRC 2J5BA 1ADFA 2IAFA 1JI3A 3BGWA 4CMBA 5JSZB 1E1QD 4P81A 1U99A 1NKTA 2R9VA 2W8BA 1SKVA 2I3AA 2CNWA 3IESA 1PTJA 4LYGA 1H4VB 1EG7A 2PR2A 1ZI9A 4Y2UA 5JMWA 4BX3A 1FJ2A 4JJ8A 1P6QA 5L4LA 1F8FA 3JASB 4MUKA 4QNNA 3SGIA 1LVHA 4LMRA 4PG6A 2CJWA 4QXPA 1I5RA 1JPJA 3RE1A 4FFBA 5DW3A 5CG1A 2HPAA 4CS4A 1PS9A 1KXZA 4G1FA 5LXTA 1QZXA 3CTMA 1U0JA 1JFLA 2P22C 4LCBA 2BMVA 3TGLA 1UOOA 4G5SA 3WBJA 1L8XA 3SZ3A 3IAM6 4DQUA 4FOLA 3JD2A 3TNDA 3QHQA 3QKSA 3P27A 3FPHA 3M9WA 1FUEA 2GTAA 3HB9A 5TF0A 2PH1A 3HU3A 3CW8X 4U2CA 2FPPB 4X84A 4EPTA 4ZEXA 2PH7A 6YASA 1NIJA 2E1RA 5HVNA 9ATCA 2P2GA 4H17A 3RFXA 2OHOA 4UTOA 3NHYA 2UXDO 1GTMA 3V4ZA 4QEKA 2QNIA 2EWVA 2NZJA 2R751 4Q4LA 3P3NA 4OSEA 4FGZA 4UM5A 3AY6A 4XM0A 1DARA 5KHLB 5C4GB 5J2UB 3D2AA 4YCLA 2W2QA 3E2PA 2VSYA 3DLHA 2YVQA 1W7AA 3QQ5A 4IIDA 2Y2VA 2QE7A 4WXRA 2W5UA 1EXWA 1Z16A 3QUTA 1R3KC 3SSOA 4YRCA 1RYZA 2HCJB 3NM5A 1MZPA 4MR9B 4PLZA 1ESMA 1I3MA 5A3VA 5DOZA 1RYEA 5EERA 1BYIA 1J8DA 4ZO7A 4ESOA 5FYDA 1ZI6A 2PGNA 3GBSA 1U7ZA 4W8OA 3LH5A 1RRPA 2OCDA 3G1WA 3WV4A 1IE3A 4JYBA 1C29B 1CQJA 3I6BA 4KKVA 4TV8B 1WVMA 2A3RA 5LQJA 2X8LA 4NMWA 1E5LA 1GYPA 2IS1A 3HKCA 2Y4NA 3WSTA 1VMIA 5AJUA 3KLNA 3VUEA 2HN9A 2VWGA 1JJBA 3BABA 4L73A 3EIFA 4NFYA 5SZHB 3ZQ4A 1A7AA 3W5JA 2G3YA 3F3SA 4EW1A 1V16B 3ZY5A 1N2CA 4RH0A 1E9VA 3EBOA 4YLYA 1JFFA 4M37A 3ABOB 1XHXA 2EEPA 3ELYA 3N87A 5E8JA 2WI8A 4H7JA 2DCMA 5E6RA 4KYTA 2CMDA 3B3FA 3AX6A 5F51A 3OBIA 2VKTA 3C8UA 4C2BA 2AA3A 5C5EA 1T1RA 1KSGA 1Q1ZA 3O95A 4L4UA 2CVOA 3C3XA 4D3XA 1PL8A 1A9XB 1HC7A 3STVA 1DWQA 4RL6A 2C29D 1A50B 1AGPA 3SHQA 3BG5A 2P9FA 1DUVG 3OPMA 1YZGA 5TPZA 1YCHA 1OI2A 2VQ6A 4L51A 1OJHA 1MNAA 2MT9A 1P5HA 2QUIA 4IY1A 1IY2A 1WSAA 4LXTA 2UXNA 1CUJA 3CW2A 2PZEA 4NE7A 4EECA 4AM8A 1DHRA 2BHLA 3O4FA 1HY3A 3IEIA 3RUAA 1XZEA 4JCCA 4DCSA 2Y1LA 4JI0B 3M6IA 4C7OB 4N0MA 5IFKA 5J4HA 1F06A 4KXWA 1I0ZA 2E74B 3IOYA 4PV1B 1MGPA 2C4MA 3LY5A 5JDCC 3M7IA 1FFXB 1LDYA 5AK3A 3WWOA 1I08A 1EFKA 2PS3A 1LLCA 5COQA 4LRTB 1TU4A 5L3SB 4Q16A 4Q34A 1J39A 3EFBA 4IV8A 2XUMA 4EL0A 5B6JA 3UV3A 3VMFA 2B94A 4FB4A 1RJDA 5DDIP 3VKUA 3FB5C 4TSFD 4E2ZA 1ENOA 4E4EA 2REXB 1RTTA 3L70H 3JVVA 1GJRA 4ZZIA 2R6GA 1W0CA 3J7AR 5EMKA 3V8VA 2W71A 5JLJA 1LS1A 3CLUD 1B73A 2OFWA 4X8OA 4JUCA 2IBZH 4CBCA 3RQIA 1EHYA 4JYPA 4HXEB 1N36B 1PEDA 2W6ZA 1P4HA 5JFTA 1J8FA 3UO8B 3PHHA 4J7AA 2HEGA 3CJRA 3ECAA 1EMDA 4PNPA 2YI9A 1Q7TA 1EB9A 2R47A 1I6MA 4PVCA 2MMGA 1LR1A 1DTWA 3BWDD 5KQPA 4BT3A 4CTOA 3K15A 3DD1A 3OG9A 2GCOA 3FFBA 2C2MA 4A0GA 1F2UA 2JBAA 4WFJA 2Y93A 3GLIB 4Y3UA 4GYJA 4FNGA 3LDTA 5IYCO 4NU5A 3PN1A 3R7SA 3NYQA 3BXOA 2I54A 5BPFA 3R3WA 1EJ6A 1EE2A 4JFAA 2XSZA 1P1IA 5G0WA 3QVXA 3HN7A 4E6EA 4LJRA 1HE8B 4YP0A 4O02B 4EUNA 4K0KO 5DXFA 3INGA 1BHBA 3NHAA 4EBFA 4IGFA 3RRBA 3OLYA 3STWA 5AVXA 1RU3A 3BIJA 1NDUA 4DKJA 5AW6A 4ETIA 2H4JA 4HYTA 1JR2A 4DW8A 2F48A 3VMMA 3U5TA 4G97A 3A6GA 1JR9A 1EIWA 3FZQA 2H2GA 4ALNA 2PJDA 2PKYX 2I22A 4DDUA 3D2BA 5FAKA 4XFKA 5KAIZ 3E20B 4XASA 3WPWA 2BKVA 2G80A 4JOCA 4ARZB 4BMPB 2GYWA