5LOVB

Dz-2384 tubulin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
417
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The synthetic diazonamide DZ-2384 has distinct effects on microtubule curvature and dynamics without neurotoxicity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 417
sequence length 426
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lovB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lovB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lovB01
2RHHA 4ZI7A 5MN6A 5MN4A 5GONA 4EB6A 3V3TA 4B45A 4U3JB 2RHLA 3WGJA 4FFBA 2BTOA 4X20A 1RQ2A 4XCQA 3JASB 5JCOA 5IYZB 5KMGB 1W5AA 5FNVB 3VO9A 3R4VA 3JATA 4O4LA 4KWEA 5EIBD 1FFXA 3HKCA 5CA1B 4F6RB 4E6EA 4I50A 3HKEB 4O4IB 3ZIDA 2VAPA 4O4JA 5MN5A 5JVDB 3CB2A 2XKAA 5LXTA 5J2UB 2R6R1 5EZYA 5LP6C 4DRXA 5ITZA 5LP6A 5JH7B 2VXYA 3N2GB 4X1IB 3RYHB 4ZI7B 2BTQA 3UT5B 5GONB 4EB6B 2Q1XA 4EI8A 5CB4B 4U3JA 4X1KA 4I4TA 3VO8A 1W59A 4EI9A 1JFFA 5KMGA 1W581 4U39A 3JAKA 3ZBQA 1RQ7A 3JATB 1SA0A 4O4LB 3JARA 5J2TA 4IHJA 4X1YB 3WGMA 1FFXB 3HKCB 5CA1A 4F6RA 5BMVB 4I50B 4O4JB 3JAWB 5JVDA 5IJ9A 5LXTB 4TV9A 3E22B 5LP6B 4EI7A 5JH7A 3WGNA 1TUBA 3N2KA 4X1IA 2Q1YA 2BTQB 3UT5A 5CB4A 4X1KB 5CA0A 3RYIA 4I4TB 3RYHA 4B46A 4ZHQA 1JFFB 5LA6A 3VOAA 1RLUA 3JAKB 1OFUA 1FSZA 1SA0B 2RHJA 5JCOC 3JARB 5J2TB 4IHJB 4TUYB 4X1YA 5LYJA 1W5FA 2R751 3RYFA 5BMVA 4M8IA 4IIJA 3JAWA 4HNAA 4LNUB 5IJ9B 4O2AB 4TV9B 5KX5A 3WGLA 3HKBB 3E22A 4TV8B 4O2BA 5EYPA 1TUBB 4O4HB 3N2KB 4YJ2B 5IJ0B 4WBNB 3RYCA 2RHOA 3HKDA 3JALA 3RYIB 4I55A 5C8YA 5CA0B 5JQGA 5LOVA 3M8KA 3M89A 5M7EA 4YJ3A 1TVKA 4ZOLA 1W5EA 3VOBA 4ZHQB 3RB8A 5LA6B 3ZBPA 4TUYA 5LYJB 2GVIA 4DXDA 3RYFB 1Z5VA 4FFBB 4X20B 4IIJB 4HNAB 3JASA 5IYZA 2XKBA 4LNUA 4O2AA 5KX5B 5FNVA 3HKBA 1W5BA 4TV8A 4O2BB 5EYPB 4O4HA 5EIBC 4YJ2A 2VAMA 5IJ0A 3VPAA 4WBNA 3RYCB 3HKEA 4O4IA 3HKDB 3C8LA 1Z5WA 3JALB 2VAWA 4I55B 5C8YB 5JQGB 5LOVB 5J2UA 4YJ3B 5EZYB 1TVKB 4ZOLB 4DRXB 5ITZB 3WGKA 3N2GA
chains in the Genus database with same CATH superfamily
2GEJA 2R8EA 2NXJA 1PKXA 4WCFC 4IVRA 4FXOA 4Q03A 3ZV5A 3IQWA 4HLUC 3CRW1 3AG1B 3OFNG 4B45A 2RB5A 4UDOA 5FV7A 3RSSA 3ZCVA 3FOCA 1UFIA 3RF6A 4DV5B 4OSOA 4PG6A 2W6JG 4R8CA 2JAQA 1IC6A 4ZVVA 5D00A 1L7BA 4DPMA 2DX7A 1UP4A 1NW7A 4L5JA 4MV5A 5F3WB 1DAGA 3C15C 4MITA 4UNRA 4FIPC 4UCWA 4IG9A 1HM5A 2JCYA 2ZJBA 2J9XB 1KRWA 1QG6A 1Y1RA 1CFJA 3ORQA 4TTQA 3WHLA 1OCCB 2WJWA 1ITZA 1GL7A 1Y9JA 1Z7YA 2F9LA 2HOQA 4NCXA 4HAMA 2PHNA 1A4XA 1OV4A 1QE0A 3FZQA 3GFTA 3H65A 2DOKA 1P2TA 5JO9A 5SYNA 3VYUB 4MVJG 3TCNA 1TJYA 1BKDR 2Z6AA 4YX9A 2A9KA 3FIUA 3K9QO 1X9HA 2BELA 4UNIA 2JLVA 1ZUD1 3O84A 5CEEA 3DYBA 2A06H 4M0EA 3UPTA 1IEVA 1L3BA 2BM1A 4JR1A 5KMGA 2JI9A 2ZR8A 1DCKA 2XZPA 4WCDA 1T6ZA 2CNDA 1V1MA 1W4BA 3C3BA 4JI2O 1XZBA 3L8GA 1TLTA 5IVKA 5KWEA 2PH3A 1PV0A 2VT2A 4PLYA 3L7LA 3SYCA 2EIMC 3DAFA 4H3HB 1Z18A 2ZE7A 3IOCA 1D2CA 4IRXA 4WECA 1M1UA 2IX9A 1GNVA 3KJFA 4XB6B 1MAAA 4OJMX 4TV9A 4CKBB 3HY3A 1QHFA 3BAAA 4WL0A 5CFQA 1P7CA 4N0MA 5T6BA 4NHOA 1NR5A 2G88A 3W8EA 1DXHA 3WLTA 2HG5C 3LL4A 4S0ZA 4G86A 5KC9A 3OZBA 4OUDA 4P4UA 3A14A 3UQ8A 3FDFA 3KHUA 3KJJA 3KQWA 3QE3A 4HMQA 5TGZA 4ZHQA 2R9IA 1IZ9A 1N7JA 2CUNA 2R2GA 2IU0A 3NDRA 5H8WA 4C7MA 3DDOA 4D7SA 3V8VA 2MIIA 3GLHE 1WVGA 3HNRA 2VSOA 1SCJA 1M34E 3H5NA 2OCCB 3K1JA 5BMVA 2J33A 1TOAA 3KHKA 3Q3VA 2QLMA 3K0DA 5LL6Y 1VECA 4IH9A 4OI2A 3M7MX 4JX8A 1L7PA 2GS9A 3U5ZB 1EX1A 1ZITA 2EP5A 2YMPA 1JLMA 1XZAA 2Q7GA 2X8AA 3S1AB 1BYIA 4E5MA 5AM5A 4UBKA 5JALA 4RKRA 3M5WA 5C5IA 1A9XA 3C6YA 2BMDA 1GA1A 1Y3BE 5JCJA 4TM8A 2E6KA 5FL7G 4RM3A 2H57A 5HIIA 1U9JA 1QHIA 3WAGA 5F98A 1CDOA 4LXIA 1A8UA 4NEQA 1TQDA 5TX7A 2JIMA 2PANA 2FTKA 3EXEB 3ILYA 1KAEA 1G17A 3OTIA 3N39C 3O74A 3CCQF 4TMTA 3ZBTA 1J6UA 2FUNB 2HK8A 1T6XA 5L3EA 2H16A 2QU7A 2ZP1A 4OFZA 4LEIA 1A04A 5AH0A 3RJ5A 4BE9A 2GFQA 4C7OA 4RQTA 1E5TA 4N8DA 3B77A 3DXYA 4AG5A 2BRUA 5LXTF 4BIMA 3FLBA 1OVGA 3PZBA 5AXBA 1MRZA 3P3NA 1G5TA 1RQLA 1P7GA 2GDSA 1BU8A 3PPWA 3KLMX 4KIWA 3S1LA 4AN4A 2RK4A 1GN8A 3ZGYA 2JH3A 2Q3HA 5AKIA 1CC1S 4HZUB 4CF4A 5DNYB 3L0BA 4MS4B 1V9LA 2M1ZA 1LPAB 3BZUA 3RVDA 1HG0A 3IDQA 2CHEA 4W5TA 1W8IA 2FFQA 2QRLA 3P9NA 2J3IA 5GONA 3JQAD 3H8VA 3E1YA 1WZIA 2E74B 1Y6JA 2YY6A 3NUGA 3RIEA 1ORTA 3JD1A 3TWOA 2ON6A 4M9XA 1H5UA 5GJBA 4MVJI 5EQTA 4Z0TA 1P3Y1 4U2DA 1ADBA 5BXYA 4GX1A 2WFLA 3WJQA 4WXPA 3DMRA 4AZSA 3U7FB 2XCOA 1E60A 2FWAA 4TX1A 4A8JB 3OLXA 2IKSA 2Q2NA 2BGGA 1Y37A 4UM5A 1EI9A 5DIZA 4K26A 5EEGA 2PMPA 4E15A 3M5PA 4GPEA 1NRJB 4R6WA 1ILEA 2ENUA 1QHSA 3PXEA 4FBLA 3IQDB 2HKOA 3SXUB 2AOWA 5JXHA 4GKKB 3V8RA 2F1MA 4FJCC 2UUOA 3H18A 3D64A 3LCRA 4UJ3A 3TYXA 5CLFA 2CSXA 4G4XA 2FZ5A 2ZAIA 3A1WA 4EFMA 4LF5O 3CF0A 5JPIA 4EY6A 2C2WA 2Y4UA 3LCUA 3O03A 4D4LA 2QZPA 1ZA1A 5A5FA 4HWTA 5KQGA 1SXQA 2IHNA 3GLGB 2FTKE 3KBBA 1SUIA 4U3JA 4ZP1A 3W77A 4EPWA 1M56B 1RRCA 1K7FB 3ZD7A 5HKAA 4K8XA 3ORSA 1GT91 4EI9A 5EERA 3CPJB 3J7AR 3TW8B 3ZX5A 1EUZA 3OIYA 3DTVD 3R9XB 2HJRA 2VK8A 1AKYA 2A9PA 1BEZA 1RAIA 2J85A 4N6OA 3C7AA 3RROA 2YNMA 3HG7A 1VQPF 3CWBH 5ECDA 3DO8A 4WKPA 5JSYA 1NHWA 4XCXA 1VCMA 3G7UA 4IO1A 2REQA 3KQNA 2G71A 4JI1O 2B82A 1KZ7B 3U31A 3C2QA 2XNHA 4CLHA 4FDLA 4BWGA 5ICCA 5AVVA 3FAZA 1RD4A 3KZOA 1S5LZ 2Z6QA 5IJWA 1CUIA 1ZJ5A 1JHXA 2K87A 2W8BB 4OHYA 2NO7A 1OJHA 2WQ6A 3RIXA 1F0KA 2YZ2A 4RS4A 3OMWA 4JLVA 4XPIA 5DCLA 1E7QA 3C74A 2QTWB 1NLMA 2JRIA 3RG8A 1JR3D 3WLKX 1B4DA 2FQYA 4D9HA 4F5YA 1ND5A 2QLNA 4U2GA 4G0PA 3G59A 3LI2A 2B83A 4JB2A 5H2FZ 2AN4A 1NN1A 5T3YA 2Q9AA 4Q9NA 2VJAA 1W9MA 2X40A 3PT9A 5B5SA 1I3NA 2XUHA 3S8MA 1FX0A 3I83A 1VYHA 2DECA 2PUTA 1K86A 4Y2UA 1PM9A 5IUKC 4A8PA 2C8JA 4KPYA 1GNTA 3NX4A 1Z6YA 4PZDA 3HR4A 4AZVA 4CHTA 3LTNC 3DD1A 2VRZA 2YNMC 2N05A 3MWEA 1O95A 4KCGA 5A6SA 1WB9A 5KHHA 5FBRB 1ZD9A 3OCXA 3FNBA 4DKXA 2XUDA 3CLSD 2QIPA 1Y1SA 2QPOA 5DISB 4E6PA 3BBLA 4NWIA 1EUQA 3EZ9A 1ZGZA 5LNK1 1RP3B 2CJPA 1C3OB 3HUUA 3WGHA 1LSUA 1CLUA 2ZJ1A 4EG6A 1P72A 4CLRA 1SVNA 2FUG1 3LPDA 1AD2A 4YROA 1R8YA 2VYVA 4I55F 2MYTA 5LYJB 1N4CA 1U4OA 4IJWA 3IVRA 3RYFB 1SPBS 3FVRA 5BSTA 4R1LA 4X1OA 2FJ0A 2UU9B 4J0HA 4TGLA 2PMWB 1W41A 4QSHA 3HKBA 3JQQA 5H70A 5TGTA 3RUDA 1UZNA 3IODA 4DC0A 5GJWC 3TECE 5DB4A 4R1TA 5KU7A 3DMFA 1T2DA 2NU7B 1YZ3A 3K0CC 2VQEO 4ZT6A 4G85A 1JPVA 1RC0A 3F7MA 3GYBA 3SZGA 1UZLA 3CRQA 3ZRXA 2G40A 2I6DA 1QH1B 3GEEA 3OPYA 3OG9A 4YRGA 4QOHA 3KQHA 1D2DA 2X14A 3DLIA 1MEJA 1DAKA 3U0VA 1Y8RB 4ENPA 1AA6A 3NT5A 5TDHA 4NBNA 2HJFC 1SC3A 5JNVA 4ME6A 4UOZA 4D3YA 1Z74A 3Q9UA 2O2ZA 1WHTA 2WWVD 4ESHA 3UH0A 2IOQA 3OUSA 5JZBA 4W9MC 2RE8A 3WPXA 1H8ED 3FCXA 1TB4A 1NVPB 2D59A 2FDCA 2FH5B 1WQ3A 5GTIZ 2ZUSA 5BWOA 1ZVKA 1JG2A 5ESDA 3OQMA 3MJRA 3AH8A 1AM4D 3F7OA 3MF4A 1SHUX 2OFXA 1L8AA 2I4NA 3ND9A 4KVAA 4PYOA 4TT3G 1CTQA 1RRVA 4EKIA 2VTVA 4BY9D 3PFKA 1MC5A 1DT5A 4WLUA 3G6EF 4G4GA 3DP9A 2R8PA 4PFKA 3WGUA 1D6SA 2GN4A 3UTCA 3FR8A 1Z7BA 2I4LA 4JYMA 2I8CA 2X3UA 3MW8A 3CC2V 3X43A 1UXIA 1ZJZA 1AGNA 1KYOF 3HA2A 1WY5A 3H1IH 4LRUA 3OCYA 4I5EA 2YN2A 5AVRA 3KKNA 2WF5A 3EVTA 1KQPA 3E7FA 4JT4A 5ENDA 1DBFA 3UAWA 1UXGA 4R50A 1ZLXA 2AXPA 4Q4LA 1KJ9A 3F3KA 3QHAA 2D2CB 2ZR9A 1Y8QB 3HYSA 4XB1A 3ASUA 1FLDA 3SJAA 1USGA 1Y42X 2HU5A 4O5OA 3B89A 2X0JA 4ZYUA 2AR9A 4M38A 3GJTA 4JLPA 1XQYA 4JITA 1FXSA 4MTGA 1OBHA 1FRQA 2FRXA 2JC3A 3AEKA 4LV6A 3V9PA 4REQB 3U60B 1VLZA 2OK8A 2YIBD 2C2HA 2XWBF 3IC7A 4M99A 4XFKA 3RASA 3B2EE 4C0AC 5BORA 3T9FA 1DG3A 3RIMA 4BO9A 3D1JA 5J4LA 1OH5A 5AJHA 1DIBA 1G9XA 1H69A 4MQMA 5TMEA 1XT6A 3R3ZA 5J58A 3P27A 4I4IA 3SE0A 4RTRA 3EDOA 3K03A 3NMUC 4PV1B 1HDIA 1UKAA 1YRAA 1ZNZA 2AC7A 3QBJA 4LQ4A 3VKGA 1E66A 4BGDA 3TNFA 5KOYA 2WUVA 4JDUA 2F4NA 4I0XA 3JRNA 1OFUA 1H2XA 4K86A 2KE5A 3F5QA 2PMCA 4YC7A 2P1RA 4J29A 4DUPA 1KY3A 3GA7A 4EQ6A 2V97A 3G2QA 3SJAC 2HQ1A 4OU4A 4ZBMA 4GOJA 2OA0A 4Q6WA 1GM7A 3FAVB 2NT4A 2J0VA 1FTGA 3PK0A 4QXMA 1R6UA 1Y1TA 2LGWA 2LFRA 2VJMB 3M4YA 3PR2B 1Z29A 3CEMA 1CERA 2LCIA 4FLEA 4D4JA 4LMAA 1VSUA 2IHBA 2E6UX 2LKCA 2Q1SA 5JDCA 4P2GA 4DR5B 4H1WA 1TECE 4OHXA 4DUYB 5L3QA 1ECJA 1DZIA 1E6EA 1ESNA 2I03A 2Q50A 1EX9A 3N05A 2RC5A 4TKMA 3EODA 4NL4H 2H92A 1SUBA 2HDOA 3ESRA 5CNIA 2C0PA 5DHRA 1NHGA 4AF7A 5A3JA 3ASOB 3BA1A 3QPUA 1N8RH 2JLBA 3PUJA 2ZS8A 1FP4B 4BFXA 4PZZA 3ZW7A 1CX9B 5K8CA 3PUHA 3PF8A 3O95A 4D8UA 1WA5A 3GFOA 3BHIA 8OHMA 2XZLA 1JUDA 1LB1B 4HDAA 4MS2A 2B4KA 4FFOA 1T0KB 1U2ZA 1NPYA 5IYZA 2QQEA 3QVKA 4JSTA 4TN1A 4EG0A 3I61A 1OIWA 3V2GA 3CCJV 1R18A 2HJ9A 3E8MA 3I1JA 1T6YA 1BGXT 3ETDA 2F64A 2VPIA 2FWIA 2QTFA 3L6RA 3N8GA 4Q3EA 4WA7A 4PN3A 1YH3A 3VR4A 1MJHA 1LQTA 3EC2A 4C8EA 5EP1A 4ROTA 1N6RA 1V11A 4KREA 4K3UA 4MTCA 3ISVA 2O8DB 4F84A 1P9OA 2CHGA 2W11A 1I7FA 5F1KA 1FXWA 2X8JB 3DTYA 3N74A 1OAOA 4HSEA 1LPSA 5ICFA 3SSMA 4Y2SA 2FZWA 3QELB 5KSOA 3EQ6A 1TRKA 4MYHA 3WL3A 5JRDS 1BWQA 3V97A 4MRMA 1HG1A 2BSKB 4Z9XA 2H5JA 3FTNA 4R2LA 4NENB 1TM3E 2BHSA 1NDQA 2DSNA 4OOEA 2OMKA 3GJ5A 3CRMA 1GSHA 2J6CA 2YYSA 1SH7A 1CJTC 4MB2A 1KO8A 3SFVA 5HZKA 3ZHUA 2AFIE 3EWIA 4V1CA 2OGSA 2QL6A 4XD7D 1JJ2U 1C1YA 4PGGA 4AY6A 2ZAYA 4P54A 3KQPA 3JCMM 4O02B 2H52A 2D1FA 3FUTA 2SKCA 2PGLA 4GOND 3D3IA 2PZAA 3FD8A 2D3TA 4MW6A 2V6MA 2VDWA 4G8BA 4TWRA 3DCNA 4TTIA 5CP8A 1ZUQA 3STZC 4DCGA 3FFQA 3R66A 1SKUA 3I6MA 2YC4C 3PWZA 5BSGA 4OHVA 3UT0A 3ZHCA 2HLDD 4CMEC 1U7PA 3ZWWA 3LUAA 1UQRA 1IWPB 1IHUA 3KE9A 4FFPA 4CU2A 4I7ZB 1XUQA 1DO8A 5T67A 3UGQA 3QYPA 2B5UA 4GP6A 3G9UA 2EULA 2XB4A 3HRKA 1A5ZA 4O4LB 3K1AA 1GU1A 4OBWA 4R8VA 1JJOA 3UOWA 1CY1A 1U9ZA 4DCSA 1ADFA 2CDBA 4DNOA 1YFLA 3CNQS 5AM2A 1E5DA 1ORWA 3DHEA 1E92A 3RTEA 1NA5A 5H9VA 3UK2A 3VU1A 3GLFB 3KZKA 4JOBA 2YJZA 2I54A 3CLHA 3VZQA 3DZBA 2Q4TA 3QNUA 1YRHA 5ESRA 1S3GA 3JVIA 5K4GA 2CTQA 4HH4A 1X7YB 1DC4A 1Q81H 4L1KA 1IU9A 4H1UA 4UXHA 4HAOA 4OREX 3VKUA 3AIMA 3A0RA 1EQAA 1JSCA 4DBZA 1ZRMA 2V65A 2VLIA 3JZIA 2Y1CA 1JALA 2X4GA 4XIJA 4QBKA 4LSMA 2N74A 1CDDA 1PJTA 1KPIA 4FHGA 3R0PA 1PNLA 3U0BA 2ZWAA 2LBXA 5C52B 1SKYB 2UYNB 1ABEA 2HVYD 2PKQO 2R6JA 3RAFC 3DVLA 4R1SA 2CVLA 1AV7A 3B36A 1CNMA 3QU5A 3QF7A 3M84A 1VP3A 2X9NA 2CHQA 4L9SA 1BN7A 1XDZA 2FEWB 2Y66A 2CVOA 3L07A 4GXNA 1GGMA 4JB0A 4R05A 4U7PB 4C06A 3G6KA 3N7TA 1DADA 3QI2A 5CMLA 4HDKA 5DSXA 1GQQA 1KOFA 4ALJA 1Q0UA 1FVHA 1X70A 1YDMA 3ME5A 2CD7A 4ZCRA 1JIKA 2NUAA 1C2TA 2PUCA 2DFPA 4X7BA 3KAQA 2NV0A 3AERA 2YUIA 3P2MA 5DCYA 2Q6AA 4CUKA 1IN1A 3UICA 3PVCA 2VZ9A 3QVMA 1ROPA 2OCGA 2ZS9A 3U7QA 3GDGA 3JQDA 4U2FA 3RS7A 1RPZA 3ZQUA 3CQ9A 3HCEA 1KI6A 1W4LA 1YR9A 3IL2A 3KKOA 4DDHA 2V7VA 3QEBZ 2RGRA 2E89A 4YAGA 4Q00A 1UT8A 1YA8A 4HX2A 1LBIA 1MZVA 1PQWA 1V1RB 4M53A 4HMPA 2DLNA 3LD9A 1M93A 4XGIA 3C8LA 1PP9H 3K0FA 3NJ8A 2ODWA 5REQA 3DUFA 4BJ3A 4CMHA 3HJHA 3R0QA 1RLJA 1KOJA 1QC5B 3H11A 1AHHA 4LRYA 2JD1A 3F6PA 4V24A 4IDNA 2YICA 3FPEA 4P9PA 4R68A 4QATA 4ENRA 3HWWA 4URWR 4JT9A 5EL0A 2NZYA 1AHPA 1I4DD 3AG2B 2VHUA 3UOGA 3AIOA 5AUQA 4RE5A 3KKMA 4HAUA 5H68A 4DT1A 1RWWA 1M2FA 3NQ41 5JSHA 1UJBA 3AEZA 2WIGA 3DOFA 4E33A 1AMNA 4ZRNA 1V7ZA 4QWWA 3L7QA 1V5FA 3QFFA 1H0KA 1RAEA 3W79A 3P0HA 5KEIA 2OV6A 3SY8A 2P9ZA 2ZBGA 1YBMA 2XRFA 1YB4A 3GG9A 4P4NA 1CLEA 5G4KB 2C9MA 5IAGA 2VDVE 4AB1A 1B14A 1SXHA 3GUCA 3K9LA 4FX2A 4RF5A 1SCUB 4BBJA 2ZSKA 1J2EA 1G21A 1YZGA 2AZ2A 2JFNA 2ZK7A 1GCOA 3Q8XB 1B74A 4LF5B 1EFLA 3LCJA 1Z0KA 2WIDA 1E4EB 3I9LA 1IONA 1RJGA 2I6FA 2ZAGA 3EGXA 4FSXA 2WILA 2WALA 3MMZA 3RQIA 1MA1A 1FQJA 2WWRA 1T4MA 4JSYA 3QIAA 3UO3A 3RFRA 1B16A 2UVQA 3WG7C 3VYTB 2J8ZA 1BWRA 1JEQB 1Z45A 3MT8A 3OA0A 4MVJA 3W3ZB 3W8NA 4RJJA 4HB0A 4P7GA 4I0WB 3G80A 4M60A 4YWJA 1D8TA 3DQPA 3CCQV 1QS0B 1Y7TA 4FGUA 4XX1A 3O93A 1AGRA 5G0SA 4ZK2A 6YASA 5AVTA 5KA5A 3MBOA 2HMVA 4RSRA 3LT4A 1SBQA 2EGHA 3P0JA 2Q0QA 5HZMA 3KCNA 3KQTA 2R00A 4QD3A 4RPJA 5A9RA 3WB2A 1DHTA 1FW8A 3QE0A 1ZVMA 4AUMA 2CMFA 1OWLA 4MV4A 4DR6O 2LQTA 3Q9LA 4CMBA 1PL4A 1EPUA 1U5BB 5B1AC 4DV1B 1GZ6A 2C5AA 1M1KH 2NZ2A 3I4LA 5ALSA 1DP4A 5HZHA 5IK2D 4IYRA 4LF8B 4H15A 2H9AA 3AM4A 4CEIA 1ZFNA 5CDTA 3RS9A 3Q7IA 3FNRA 4LTNA 4NOMA 3NAGA 2P6UA 3PD1A 4K2HA 4F93B 1AKNA 2OC9A 1U3TA 1VQ8V 1G5PA 4G81A 4QQRA 3SFZA 5BURA 1NNEA 3N75A 1K9VF 1NUPA 1C1XB 2P2GA 1JHYA 2PLAA 5T8KA 4YV1A 3MIZA 4NJEB 3CLSC 2J3HA 3ZE6A 4P9OA 1F6BA 2A94A 1BMTA 1RRPA 3GN1A 3RM3A 5P21A 1QRAA 4DIFA 2RGNC 2IWRA 4BVHA 1Y7LA 3TD2A 4ZZIA 3ADCA 3SU8A 4ALIA 1COWA 2NV6A 3WFJA 5EKUA 1M2HA 4ZAYA 3V4FA 3R5FA 2VH1A 1BZKA 1QONA 2WZQA 3O9ZA 4DM3A 4XLTA 4TMYA 2OBLA 1JDSA 2QLBA 2Y2VA 4XJXA 1UDRA 2QJ1A 2MT9A 4BAYA 5E4JA 1K8QA 4CL3A 3LOPA 1Z2OX 1XMXA 2C4MA 1MG5A 2QK4A 3D0OA 1XCJA 3WXMA 4B3MB 1L5HA 4Q1AA 2LW7A 5ALMA 2PKQP 1PR3A 3VQWA 1J33A 3GGCA 4GYYA 4PC3A 1OA0A 5CXXA 4ZXFA 4CW7A 4J0CA 3DL7A 3O2QB 1FJ2A 1U7HA 1L5RA 2PWPA 3AK4A 3RSLA 5C7LO 2A4MA 2P4EA 1KMIY 1GK9A 1FP1D 1J00A 3UK0A 5AUOB 4RV9A 2DCUA 1OBOA 1WXEA 4G5HA 4RHUA 1EYZA 3ZWBA 4BFYA 3C85A 3PXCX 1FJGO 2HS0A 1DAHA 1GL9B 4GZ6A 3J7AC 3JALB 2UZ1B 2JLXA 4OB8A 2YQZA 4LDNA 5A9SB 3IERA 3ILVA 4B32A 1S2NA 1JAZA 3MUOA 2JL1A 2F1KA 3LZCA 4EO4A 1VBKA 5B4VA 5KPDA 2HA6A 4EM6A 1JR6A 1Z8NA 4MW4A 4GICA 3ZWKA 2A9HA 4ROSA 1VQOV 2C1XA 3KBOA 1ZAKA 5LJLA 3AJDA 3NWEA 4EA7A 1AMUA 3Q7EA 2AMLA 1PD1A 3I39X 4QU0A 4EMSA 4YMTA 4L5BA 1A69A 1FIUA 5B8FA 4HGQA 5KQSA 4EJFA 4HS4A 3CXCU 4RZXA 4RHFA 3RUEA 4M1KA 4MJLA 4FM9A 1XWIA 3KKPA 2IZ0A 3FWZA 3P0RA 2ZBDA 3GNQA 1EFPB 3MBMA 3O4HA 3ZUGA 2H8KA 1XVUA 3SSOA 3ZU6A 1IG3A 5AW0A 1NF9A 4DR5O 2OBFA 3CCCA 4I1RA 3VPFA 2EJRA 2GJ8A 2PL3A 4JWKA 2CE7A 5F76A 2IHKA 1ZH8A 2LIVA 3MQ4A 3L3BA 4HDQB 2W6PA 1P1CA 4UBIA 1D07A 1L0NH 1AR1B 3MDOA 3DDNA 4TXJA 4DW8A 1RKVA 5IC4A 2P4QA 3WLPA 4EHAA 1J0BA 4OKSA 1JQLB 1KEVA 1C8KA 1PP4A 1NY5A 4JMLA 5FULA 1BGYH 4KLZA 4MQ5A 2QUZA 4BLQA 1BDMA 2DFDA 1PWHA 2W2KA 2ZSBA 4IOKA 1ACLA 4ANFA 4BE4A 4GF5A 1BW9B 3AKEA 5JHGB 5JI2E 1ZH4A 2P3OA 1II8A 4A9AA 4YV2A 4O59O 1W93A 4G4VA 5AOBA 1U8YA 4JBHA 2X1VA 1T26A 5JY1A 3I56F 4Q12A 4E2ZA 4C3VA 4UE3S 1CQXA 1QWSA 4QTZA 2G8LA 3FOEC 4QG3A 1R9GA 2W93A 4II3A 3SJUA 3NI2A 3LDGA 4MWDA 2DHEA 1FYFA 1XDGA 1E6UA 5JAZA 1QKJA 1P2FA 1ZJ4A 3JSXA 1N0JA 3IT2A 4DUZO 1SBCA 3AP3A 5HKLA 4D9EA 4YHHO 3ELYA 1N5MA 1G41A 3D7RA 1EK0A 1IAVA 3PTZA 1THZA 1RWKA 1KAQA 1C7IA 1RRMA 4Z6KA 2IZ5A 4EVRA 2R44A 3O26A 4KLNA 5LQRA 3KETA 4R8KA 1LJLA 3K04A 2JI7A 3PUZA 3DFIA 1Y3AA 2HSJA 5BV2P 1P0FA 2AKAB 3OWXA 3MILA 3FTEA 3RW0A 2VDKB 4QXQA 2VPYA 3CRCA 2GLUA 3I2JA 1X6VA 5G2OA 3TTVA 4WZZA 5A02A 5KYGA 1XZEA 2B8WA 3AUKA 1IBSA 3AKCA 3MRXA 3ANTA 3AU9A 3KVRA 2RBKA 4TSRA 4UCQA 3T7TA 3ZY3A 5JCZA 1UFRA 2ZI4A 2WSBA 1KMIZ 1DJOA 1Q8IA 2OBXA 4MTOA 3PGVA 1S1MA 1SFRA 5T3UA 3IE1A 1PJQA 1PZFA 2PR2A 2WZDA 3HYRA 3P2JA 4G0OA 5FPRA 1A7JA 5FI3A 4DMLA 4GOOD 4AJ4A 4KHPO 2XQVA 4D4GA 5DN6D 1B7GO 1JWAB 4K6GA 1DBQA 5JNLA 2G08A 2I6GA 1WZ2A 1SAYA 2BUAA 2EEPA 4L7VA 4G2NA 2X9QA 4EY8A 3H1EA 1P8JA 4CDMA 4R9UC 2L82A 2YC0A 4GPBA 4URFA 5B58T 3RC7A 4ER3A 2PBLA 4M0PA 3THWB 2O8DA 4J7KA 5J43A 1SO8A 1DFGA 1S5HC 5LQCA 1EH5A 1PBNA 3PIIA 2FUKA 4MKXA 4YJ2A 5E6SA 2MSNA 2FWPA 4CKCB 3CEAA 3TMYA 1NBAA 2IYUA 2E87A 4MYCA 5KTSA 4PHTA 4N1AA 4X89A 3NHUA 3HU5A 4C14A 4RIIA 4FFLA 1Q17A 4AKTA 4YIOA 1B0AA 2ZRFA 3OOWA 5EO3A 1Q1QA 2HCTA 2BFOA 2I3BA 2JVIA 2LKDA 5DSZA 2Z08A 2I22A 4GLJA 4HV4A 3TW4A 4D74A 1QD9A 3B52X 3X1ZA 4JEIA 4E7OA 4ZI2A 1XZ8A 5JJCA 1BS1A 4XQ0A 2QRMA 4MK4A 1VI5A 3T1NA 3UVEA 3ABZA 3AK3A 2LRHA 1D9ZA 4URZR 3ICPA 5EK0A 4WAUA 5IJZA 1XZKA 1TK3A 1DAFA 4NPCA 3TIGA 5CB6A 3X1JA 5TQVA 5K2MA 2P4UA 1YI2F 4Y2YA 3NEJA 3GXBA 3SWWA 4OH1A 4L3VA 1RAHA 5TVGA 3SNHA 4E07A 5FPYA 2XUAA 1M72A 1WBBA 2Z3ZA 2QUKA 1QCEA 1VQNV 2Y1KA 3ZZNA 3DGEA 1XEAA 1E2GA 2CHFA 4X24A 1KFCB 5FTMA 3WLQA 2F8TA 4A6PA 4AY3A 1P91A 2XWJI 2R6ZA 4DJ5X 4IZIA 5KYUA 3ZWVA 1FTQA 4JI3B 2AQHA 1BA3A 3CSUA 4TWKA 4HN2A 2BY4A 1XKTA 3F2VA 3GNTA 3NTOA 3RS8A 2QYHA 3LUFA 3LYLA 5DI9A 2OKGA 4UTPA 4G56A 3AW8A 1KKLA 2EW1A 2O1EA 3M3PA 2OHHA 3UB3A 4QJIA 1KQSU 2R00C 3PHCA 3T2MA 2WYWA 3GROA 1FXKB 2XDYA 5L3DA 2JDID 4G5FA 2G5CA 3VPHA 3HU2A 2Y27A 3LUGA 1XDCA 4EGJA 2H2GA 4DYDA 2QMUA 2IIVA 1BN6A 4HQNA 1SBHA 4WNAA 3JARA 2VIIA 2EG9A 1FL9A 4PQEA 2PV7A 3WIVA 5D5PA 1AOXA 1ISFA 3Q88A 5FLXN 1OV9A 2AFHB 4UVCA 2WT9A 4YAJA 3ZIUA 4CJXA 2VC2B 2C1EA 2WDPA 2XIJA 2VI5A 3EDQA 3LQ2A 2EKZA 3M3HA 4IDPA 4YJHA 4Q7QA 1VFNA 2EZ9A 2OHFA 3ANMA 2Z6UA 4P0QB 5JH7A 3UIEA 3V1TC 3E0XA 1D7OA 1SUWA 3NHBA 1LDBA 2YJ3A 1WU8A 5JNUA 1CIPA 1HOTA 5JS8A 3B6NA 1XRJA 1GZVA 3CH5A 3AG4C 3IQFA 1W0JD 2Q28A 1MPTA 2ASEA 3C4QA 4OYHA 1SRYA 2PL9A 4DIEA 4PDVA 5AW7A 2IXEA 1PFYA 3TUZC 3LPMA 5LL6P 1F1BA 4LDRA 4HZ3A 2F4VB 2WVHA 3GD7A 4MV3A 3RA5A 3KKYA 1I0HA 1OLSB 4DSOA 3GH1A 2VHQA 3TLZA 4G2KA 2HIGA 3VR3A 3W90A 2I6RA 3EDCA 1EDEA 4H2DA 3P9CA 3OT1A 4PA9A 1SURA 4PZUA 1QTNA 1NF2A 1TMGE 3NKLA 1UBEA 3GAFA 2H51A 1ORIA 4NSNA 2GBFA 2FZEA 2QKSA 2JJ1D 1CJMA 3QZUA 3UK7A 4ARAA 5H59A 2W5UA 4FW9A 4QT4A 2PY5A 3JRXA 4B6JA 1LF5A 1GPBA 1Z4KA 1V6SA 1QAHA 1WXFA 2C7VA 2HJVA 2GYVA 2D5BA 3L7KA 2KLBA 2PJZA 2C1ZA 5B3KA 1UEIA 5MHTA 3BDAA 3KPVA 4EENA 1NZ6A 2QTLA 2YDXA 4RKFA 2J1LA 3WAJA 2IBMA 2EZPA 2XNDA 2HKIA 2YFKA 4L8JA 1BHAA 1OHHD 1TA0A 1T5HX 2J4FA 4FK5C 4XE5A 3SZLA 1X7XA 4RTKA 5I8ZA 3TI7A 4ETNA 4U63A 2YXDA 4JLDA 4MCJA 2JKZA 3HJFA 4LTMA 4QTYA 4RYLA 3RKUA 3UUWA 2F3TA 3SEQA 3K0CA 2UYKA 1KAOA 4Z3KA 5JMWA 2XUMA 1L4MA 3HR8A 3NRCA 4LIPD 1XNGA 3OZEA 1TVEA 2HNBA 5K03A 2MW2B 3Q4HA 1AS3A 1VF6C 3ZV6A 5KVAA 3K57A 2BSQA 2D2FA 3PLNA 4CH3A 2DHDA 3VNSA 1E1NA 4Z9FA 5I9IA 1OC4A 2GK4A 1F51E 3H6KA 1W4ZA 3GK3A 4I8IA 2WTXA 4TKUA 3WZMA 1ABBA 4R98A 1G59A 4UE2A 1FU8A 3NBQA 3E15A 4OQMA 4J9UE 3WJ1A 5K0BA 1J0DA 4UDXX 2B8NA 4BNMA 3WGJA 1Q7GA 2FW7A 4ZYVA 2Q6OA 3HL4A 4HDOB 3ASNB 3VNRA 2ITCC 1V0JA 2PT5A 3QF4A 4MKRA 3UWPA 5JCOA 4AZ3B 4EHJA 4BKMA 4DQKA 1O6GA 1U96A 1D4AA 1KYTA 3I5UA 4ZIRB 4V0OA 4AAYA 3QKIA 1FFXA 3CEIA 4JFRA 4QLAA 2DWQA 1CJUC 4PLHA 2YVKA 3M82A 4UNNA 4DHEA 1CR1A 1H48A 1E8DA 3AM5A 3QNMA 3EBLA 1UMKA 5CLHA 3PGMA 2J3JA 3PFIA 5ITZA 3G71F 1Q0PA 4BFVA 3LNNA 3ASZA 1P1BA 3C6ZA 3DPSA 3DZCA 3AR7A 3NVMB 3ZWAA 3VAAA 4CR6A 3UT5B 1DQSA 2Y93A 3HXOA 3D8SA 1C9JA 3ACCA 4IV0A 2WJAA 1R5JA 3Q2OA 4YRDA 4AO8A 2W00A 3ZJZA 1TPYA 5DHSA 3IAFA 3CO5A 4Q4AB 3CE6A 4LJ9A 3TIVA 4TS3A 3DW1X 4OXXA 4RQBA 3COPA 3VJRA 4E1AA 2J3DA 3V4LA 1ZKMA 1I2DA 1BDIA 1T5EA 2OO5A 1MA0A 2GD2A 3MLBA 4ZCPA 3ECAA 3HUDA 1MOFA 4FYYA 4NG5A 3UYLA 2F9ZC 1S1CA 1WULS 3MVEA 2CZWA 3M8AA 4FINA 4JYAB 3WE7A 3OUTA 2YIMA 1P1RA 4OFXA 4PIMA 1YS6A 3I9MA 3D4IA 1HDCA 4DKJA 3GPBA 3V9AA 5JR3A 4NTXA 2ZNIA 1KMMA 2YY7A 4L15A 1AKTA 5AKXA 1D1PA 2V7TA 3L0IB 3PGKA 4AT1A 3B1YA 2PZSA 2CHTA 2G72A 4K0KO 2VO1A 2A9VA 3B78A 1DZ3A 2GJ4A 2WT4A 3ET5A 4WH0A 3JYOA 3WLAA 4EOGA 4HT3B 2ZGVA 1N2CE 1N2OA 1YV9A 1AU9A 3HS3A 3A9WA 4H0LB 5AHKA 5B64A 2PMFA 3KE8A 4EZBA 1T6BY 4KXRA 1C4XA 3CMEV 2P75A 3BK1A 3LH5A 3PHJA 4KXVA 4LQLA 3IP3A 1Z82A 5IT0A 1B8VA 1CJCA 2NADA 2ZT9B 2I1VB 2OPBA 3F5SA 4ZODA 1V35A 3K1YA 5IM5A 4BZZA 2YW9A 1VQ7F 4JBLA 4K0KB 2HSEA 1TGYA 3ZCXA 3U62A 5A0TA 5B1BC 1BJKA 1FMJA 1Z3IX 3M89A 3SBEA 4PGFA 1GZ0A 2IG8A 4CF3A 4IV5A 3VOBA 3DLAA 3EWSA 4NBKA 1D6NA 4RZ3A 4YH1A 4QE9A 2QBYA 3NH9A 4V0QA 2CF5A 1U0LA 3UXMA 1B76A 1ZOPA 3IB3A 2UYCA 2G6BA 3A0BZ 1EWRA 1PT6A 2O0HA 2SNIE 3ITEA 4CU5A 2R8ZA 3LOUA 1L1RA 3WJ2A 1LDNA 2ZSDA 3SGIA 4B3CA 4FFVA 4PA4A 4NR1A 5GINC 2CHVA 2IQ5A 1AHIA 5AHWA 2OXIA 3D6NB 3MWYW 1O95C 5EC8A 4JP5A 3T5MA 2QM4A 1FUKA 4FYWA 2OZBA 1CE8A 2VSXA 1I4EB 4R83A 1U0NA 4KQEA 2Q49A 2CN1A 2C9OA 3R6DA 1VM6A 3CLTD 3D6UA 3DPIA 1AF4A 4NCNA 1QDLB 4U9UA 5BYAA 2XECA 5JY6A 2G9VA 3ABIA 3BHJA 4L5YA 1HURA 3BWYA 3UGTA 4AQDA 2H2WA 4EJ0A 5A4IS 1WMEA 2VPPA 1A7UA 1ZUWA 2RJ3A 4KYUA 3T7AA 2C96A 4M1ZA 3PDCA 4GI7A 2ZI5A 2H7XA 3AVQA 4RPCA 1DC6A 3AI1A 3OY2A 4LI3X 4B3JA 4GCZA 3EBPA 4OK5A 4EF5A 4ZEOA 3CH4B 3O8QB 4EUSA 5KYNA 5L3BA 3VTZA 4DRZA 2XD4A 3M4ZA 3WFVA 5BYKA 5EKXA 1RWMA 2JKYA 1CUVA 4ZEVA 4GAEA 5D3MB 3E2IA 4C22A 2TMGA 3TPCA 1YB1A 4J94A 2AZMA 4Q1BA 3DMYA 4XVCA 4N3AA 3IVAA 3ONDA 3CLVA 4EHKA 1QHXA 4QREA 2J4DA 1T5SA 2CAZC 1UCFA 2JIQA 2DKNA 5A04A 2D74A 2H4HA 5J2UB 1FLNA 4RETA 4C08A 3EX7C 3FTDA 1HQDA 1U3WA 3HMQA 2JVJA 2GN6A 4IXNA 4YDSA 5EWRA 2OBYA 4GDFA 2V74B 3MJHA 5LA6F 3CMAV 3SZRA 5LQMA 4YA6A 4IILA 4YMSA 2WIBA 5KU1A 5J2TF 2GK3A 3IULA 1ODLA 3G6BA 1G6UA 4YTEA 1P19A 3QKRA 4ZI3A 2UUAO 1OI7A 2FAXA 1NDHA 1E0SA 3DFFA 3O92A 4GG1A 2PX0A 3S2ZA 2RI0A 4J2TA 1TU0A 3RK4A 1SU7A 3DO5A 3H3XA 1TIPA 4U7FA 4XZ3A 4IS3A 3Q7SA 4QPJA 4BAUA 3BCHA 3TKLA 3PJEA 4P30A 4PAWA 3VYSB 1VJDA 1NDUA 3PCXA 4D4IA 2XCTB 2H1RA 4C4ZA 1GQFA 1J7HA 5FLKA 4PA6A 3CC7F 3O8BA 1IYZA 4Q7JB 2GZHA 3BWDD 4C6TA 4CIXA 5AOVA 2VK4A 3MHTA 1NYLA 3VAZA 1DAPA 1WBJB 4OD0A 3DKRA 1J25A 3D2LA 4IQFA 1MG0A 4PS1A 4RA9A 4RF4A 1UFVA 2XY4A 4Z4EA 3A1NA 2RIPA 5EIAA 4RDHA 3LL7A 1FFSA 1IDN1 4Q9LA 4D9MA 5JZOA 4K8RB 2Z1UA 1SGWA 2H1SA 2VEOA 3BB1A 3K15A 2IV3A 4FZVA 1JTVA 1NOKA 3IAXA 5KSWB 1JDTA 5IUNC 2O8BB 3V4ZA 4HNQA 2C4TA 2VAXA 1QV9A 1FFGA 1GPH1 3T4EA 1CY8A 1QPZA 3E8HA 3W2GA 1QF6A 1MIHA 4WK0B 2DRIA 1J5EB 5LGNA 4AMYA 5IXJA 3CW2A 4BO2A 5KZMB 4WGFA 3CPWF 3W9UA 4B33A 1TZBA 1V3QE 3DFMA 3SYKA 3R3WA 3PFFA 4Z1MA 3QEMB 3ZHOA 1MMMA 4A92A 1QJCA 2BGNA 2D0DA 2N3ZA 1VE3A 2I4TA 4DEYA 1M1XB 1KA9H 3K6SB 2JLYA 3JZFA 1U0EA 3Q6NA 2DW4A 3OE7A 2NO9A 3OOYA 2ZNJA 4I4CA 1ID8A 3U7GA 3D4BA 2EU8A 4L8LA 3QMWA 3VI3B 4BX2A 4BEJA 2XZDA 3LVFO 3GLTA 4NYIR 1XZPA 3B9QA 2F8MA 2LXNA 3FSGA 3OHMA 4L28A 3SQWA 4RDXA 5MFZA 3PJRA 4XD2A 1FNKA 3JASA 2CFOA 2DN9A 4DR4B 1UDXA 4BT2A 3DTVA 3PG5A 4PEVA 3WHKA 1MW8X 3M70A 4TV8A 4UDNA 3ESYA 1DKNA 3MS4A 2FMFA 2HWXA 1KU6A 3AFOA 4EKYA 3GRFA 4BNTA 3A9CA 1NJIH 1P60A 3DS8A 5KHIA 3IEXA 2QG4A 3CUEF 1EJ2A 5EGSA 4BMPB 5LOVB 2ADFA 2JGAA 4DLUA 3FGNA 3I56V 4K9RA 4PI2A 4ZOLB 2XQGA 3LKDA 4TKZA 4HYYA 3L04A 5F2NA 5T7BA 3AG2C 4EHLA 2WA1A 1C2YA 1W0KD 2GVNA 2YV1A 3DMGA 3CZ5A 1OH8A 3P94A 2R6GA 1O6CA 3HSKA 1W4CA 2OD9A 3S0YA 2B78A 5FFMA 4QJFB 1UM8A 3A6HA 3KXPA 1IPEA 2C3OA 5CT6A 3N76A 4DQXA 4W6QA 1UBUS 2WZBA 5CG2A 4KIGA 3HR0A 4BDTA 3CCLV 1NVWQ 4JYAO 1OYYA 2RK3A 2WJ4A 3PEEA 3QUCA 2Y1WA 5AW8A 3OEHA 1J07A 4OF4A 3DOEA 1AP6A 5IM4F 3U4CA 4B2YA 3V3KA 2PUJA 3WRYC 1L5MA 2VZLA 1GZDA 3H1PA 1ZS9A 3QBTA 2E3JA 2ZVQX 4U7WA 3OPMA 1U2QA 4NBTA 5DYTA 3TXXA 4UM9B 1WB6A 2HBRA 5LP6A 1H2SB 1T4BA 3E27A 3HXKA 1ESCA 4B5CA 3FVVA 1M1NA 1K5DA 1MNQA 3E7DA 4UD6A 2HFJA 1PWXA 4PINA 4R2JA 2OYCA 3VR2A 3J7TA 3OQNA 4WLOA 2WYOA 2CUKA 2Z2JA 4MOWA 4WOJA 4I4TA 2HIHA 5BYBA 3KZVA 2J7KA 4RAQA 3WHIA 4BNVA 2OYSA 1JAHA 5FUYA 1KO1A 2JIDA 3AGKA 1A27A 1VBNA 1XN4A 6NULA 3CCFA 1D2AA 2J0QA 4RJTA 1M0SA 2HX0A 4PXAA 3NBZC 1N36B 3NT2A 3VNBA 1U6JA 2JZCA 2CLKB 4MR7B 3AG3B 2AXTZ 4GGPA 1N2BA 2ZJ8A 1CQIB 4GQIA 5EQJB 5KDLA 5TF0A 4F6LA 1DLBA 3GIDA 1N8NA 5EUQB 1ZOLA 1XD2A 5KNDA 5CJPA 3T5AA 2PK3A 4PGAA 3N2KA 1BO6A 3LDCA 1YVRA 1N5KA 1PL0A 2WD7A 4PO8A 1JHVA 4UAJA 5CT8A 3SC4A 1R0XA 2ETNA 1B0PA 3M1IA 1Y1PA 3MHSC 3P9YA 4U9HS 5JVDF 2WB2A 1Y4UA 3OIWA 3TTWA 4RO0A 5B3SB 1GO0A 2PX8A 5EINA 1F2UB 3WWPA 3KJIA 1CVIA 2WLSA 3AP1A 4WFJA 4UBLA 4CQMA 1ZHHA 3QSYA 5TPWB 4UUNA 4B3SB 3ZWDA 1YUMA 2G1UA 2IOFA 4WBSA 2ZIZA 1NE7A 5B3AA 5LQNA 1SA0B 1XA0A 3R0ZA 1QVGU 4W5OA 1CEQA 3HFSA 1R0LA 2PEZA 3QLUA 2XBUA 3FDZB 1RCUA 3MMXA 1BMFD 4CKWB 4U7TB 3E5NA 2ZPTX 5IAAA 2GDJA 2EP7A 1GRNA 3TN7A 1E2NA 1KVQA 3L8HA 4ZOBA 3OIFA 4BX0A 2VCEA 4F91B 5HWEA 1AXEA 1NI4A 1I32A 1C1HA 1UJMA 4ZVRA 1Z36A 3SDBA 3NIWA 2B3TA 1ZVVA 2GM5A 3I3FA 1JAIA 2XSZD 2N1MA 1OHHA 2RMKA 1QDEA 4KYVA 1NQWA 3GVXA 4J1TC 4JQYA 1RZ3A 4DUZB 3OUFA 4BO4A 4FW8A 1NPTO 1IBKB 1X3LA 2PX5A 2YYYA 3CCRF 3WPWA 3A58B 3ANXA 4HCJA 4EUEA 3VNUA 2QRNA 2VOJA 5FTNA 3ADBA 5K0NA 4W5RA 1RC1A 2UXCB 3F78A 3QWHA 3RUPA 5KTYA 1PV4A 3U1TA 4CWAA 4GXRA 2QWXA 2QYTA 4QTUB 1N32O 5HGXA 2O2IA 5CAEB 4PYNA 5J1TB 4O33A 4W9NC 3LMEA 2MSDB 1M90H 3D36A 2B4RO 2ECKA 1M6WA 2J9FA 4QJBA 5BSRA 3S2UA 5F9FA 2JJ8A 3OSZA 3PLRA 2R7LA 3PUKA 1M34B 2P3SA 4HNSA 3QTBA 4C1BA 2XMQA 3IESA 2OQIA 5K3SA 3HFRA 1UIMA 3C6MA 3SHVA 4UVEA 2FEMA 1NQUA 3WYNA 3L92A 1GZ3A 4I1OA 4OI1A 1QH8A 5E4FA 1Q1NA 3ZE2B 1PVVA 2WHYA 2PT7A 3M6LA 3APOA 1HW7A 2WAMA 2ZPAA 3FKSA 1Y6XA 4YLEA 4XDKA 3TQOA 5DU2A 1BJTA 3K6RA 3MB5A 1EB8A 1X25A 3WRWA 1P9LA 3L7MA 3IT3A 2J0UA 3GMTA 4K9KA 2OBMA 2Z5VA 4NWOB 2Q8QA 4Z0PA 1VLVA 1RWXA 4CG1A 4EAAA 4R2IA 1AS0A 2R1TB 1G2OA 2OHJA 1K5PA 2WR8A 4RY2A 1M76A 1L4YA 1L4FA 3KYBA 1QO7A 4DLPA 2AIZP 3TRDA 4I5GA 3QYJA 4I5IA 1VQ4F 1XQ6A 2W43A 4LX8A 4MRVA 3VNVA 3GLSA 5HHTA 1VH8A 1GGVA 3DHWC 3Q1LA 3ASNC 1PN3A 3OKPA 2BWJA 4I2VA 4PRKA 5CLIA 4KXLA 4AC9A 5EC2C 2LGJA 4PYIA 2A79B 2P06A 1AN0A 3JRWA 3PRYA 2C9BA 1FMFA 1WP9A 3UB4A 3RTCA 5U1PA 3UXEA 3L4JA 4QUEA 1W59A 4GUNA 3SIWA 4G0VA 4ZICA 3BULA 4XYBA 2X8LA 1WAZA 4C4TA 4TLBA 4EHDA 1N7IA 1LR1A 5M2QA 3JAKA 1V37A 3L82B 4GYCB 1D7AA 4FT4A 3QXCA 2EBOA 3OZVA 2B94A 3FGZA 4CT0A 2B33A 3IC9A 1AVTA 2WMDA 2XR1A 5ALFA 5EXXA 3WAKA 2VHCA 4JLWA 4RPIA 4AZWA 4DGSA 1DIHA 5IMSA 5EPUA 3BMOB 5JNTA 5AG2A 2IWHA 3ZW9A 3PL1A 5FUBA 1W73A 3CLRD 3FZYA 3S68A 1SXJB 2WWGA 4RHTA 2W2LD 4E2FA 5JNSA 4MYUA 1Y8AA 4RORA 4CM9D 1SUCA 3EFEA 5KOJB 1OU0A 4UM7A 3M1XA 3OAAD 1I1OA 3W7XA 1X7PA 4ZHWA 4QGPA 1MN6A 4M89A 1Z2EA 3CCUF 1YJWV 3PLAC 4NV0A 4YJGB 1UF9A 4EHHA 2BHLA 3QX9A 3RRXA 1RRFA 3F90A 4EIWA 3K5NA 4U2CA 4CF7A 1VL6A 2H06A 4NECA 5CJ2A 1U97A 1LX6A 3Q12A 3H2GA 5AVKA 1CETA 2ZRPA 5K3BA 1BS3A 4UCTA 4UEQA 4GGOA 4XD7A 4BCBA 2XBLA 3A3KA 5BNWA 3QUBA 1EN4A 3TQCA 4EYSA 4CMCA 4FOSA 4GUAA 2UZ4A 3EZLA 1P6UA 2FK7A 1TGVA 3OLQA 4BT6A 1EKXA 5EJMA 2ZIVB 1IE3A 5JSQA 1Z7GA 3ORYA 5T8KC 1VL0A 3GFPA 4TYWA 2E5LO 5C1BA 5K0EA 2WQ7A 1TVKA 3NJ4A 1OD6A 3F98A 4A82A 2RH9B 2OXEA 4X3OA 5CVUA 4D26A 4DLAA 3WYEA 1WCV1 2FW9A 2P65A 3CO0S 4G1UC 1T9BA 4QTXA 1DO0A 1U7TA 2ZIXA 3GJ8A 2GCOA 3MN1A 3FOWA 4CKEB 5DWQA 2LPMA 5C34B 1OGIA 5IDYA 5IYBO 1YC5A 4DANA 4CV0A 4QLOA 5L6LB 5D86A 1QIMA 1MB4A 2MYUA 4JROA 4Z1OA 4LJAA 4YXWG 2JK1A 2ZRDA 3M4XA 3PICA 5WRFA 4ABTA 3HO6A 4LOLA 1HYBA 2FHPA 1FD9A 3AFGA 4GI2A 3ZMUA 3OZ7A 2ATKC 3GB7C 2B34A 4EPVA 4UVAA 1K63A 3AHEA 1N32B 4HAYA 4RUFA 3ZKWA 1HE8B 1F8UA 4YMUA 3RVBA 1XREA 1YQQA 3V46A 2WTAA 1Y9ZA 1QQAA 3KIZA 3AETB 3RBAA 5LHIA 3KSAC 1X74A 5K3FB 4EDFA 3TLEA 2QTRA 1NBMA 1M6VA 2ZETA 2ZJZA 4JD5A 4ZVLA 5LM3A 2YC2C 3BH6A 3FJYA 2PV0A 3E3OA 5I5GA 3VC7A 5B2FA 2O8CB 5H5NA 4DR3O 4FM0A 1BCSB 2OM6A 2R60A 3JX9A 3KU1A 1XTVA 5JAQA 5B4UA 3RDPA 5LP6F 3FF4A 1QK5A 1TCCA 1NLUA 4QXPA 2J6IA 2GJAA 3E3MA 3FIJA 4UU8A 4B71A 5IEJA 1MFPA 1WPQA 1XKLA 2H1HA 4X9XA 1LBSA 5DYNA 4ER5A 1IN6A 3KQLA 2NVWA 4LQDA 2PMEA 2V7QD 4XJSA 1L7OA 1GGHA 3O4RA 4MA5A 3L7JA 4HUTA 2HFKA 1JB9A 1YJ8A 1RP7A 1VQ4V 1FS0G 3HK2A 4QELA 5JU6A 5CGQB 1BSMA 3CYOA 4ZJZA 1KEEB 2ZXUA 1U5AA 4KNVA 3ZKAA 3AW9A 1BWPA 1E94E 1IULA 1ZL8B 1RIFA 1W88B 1R9NA 2X1HA 1U3LA 2YV3A 3O6VA 4L75A 4MDHA 4LYGA 4Y2QA 4YAEA 5EWJA 3LRPA 2RG1A 1QF9A 2FQQA 5LSAA 1M9NA 1WXGA 1LW6E 4C0JA 3AGPA 4HEA1 3ID6C 3KQSA 4OGLA 3RABA 4IHJA 3H7IA 2DERA 1JH8A 4YXFA 4AKHA 3A6KA 1DBPA 1SCAA 2EJUA 1BMFG 3QK7A 1YJWF 5JVDA 3M6AA 2BTEA 2OGUA 3M6UA 4QFMA 1FYJA 1VK3A 2I4MA 4H17A 4PYMA 1SXJC 4WXRA 3ZGOA 4B85A 4L8VA 3K9HA 4JWTA 1GG2A 3TJRA 4BWAA 4NB5A 2VPQA 4MQLA 2OHXA 3V7QA 4II2A 1Z6AA 4WESA 4C43A 2H1OA 1H93A 1KH2A 2I8LA 4FOLA 1W4RA 2AB0A 3ZH2A 4LCKA 4JJAA 3GGSA 5FBZA 3EEBA 4OK3A 4ZEWA 2L69A 3TOVA 2CDAA 1U8ZA 5BV8A 4YRIA 1IVSA 2ZU0C 5BVHA 2YVUA 4GQAA 1X80B 4RTQA 2IXFA 1I7SB 2AK3A 2AXNA 4DGQA 3A25A 4RK4A 3EFFK 5CDFA 1ZOSA 1N77A 2KG4A 2AG8A 1TO2E 2GF9A 3CM0A 1Q12A 1QTIA 3ZTTA 3ZS9A 1DTSA 4U0JA 1I0IA 2PQ0A 1DX9A 2KBEA 3WYDA 3ZGVA 1H2AS 2E4WA 2OO5C 3PUVA 1AR5A 3LQQA 4ZVUA 5K6RA 1XVVA 1ZW6A 1AKWA 3WDSA 2WP0A 1E1LA 1H5NA 3T8YA 3PJSK 4FWBA 4FCVA 4KYIB 3KB2A 3DBLA 1B04A 1VRCA 2PSHA 1ZNYA 3NWJA 4F8JA 2ARHA 4BKOA 3RKSA 4OA8A 4DK1A 4JHXA 4BKUA 1NW9B 2HTFA 5HF6A 3C98A 4P22A 2Q0OC 3V8NA 4Z9YA 4MS3B 1VQMV 2BSXA 1XMSA 3K4QA 3VDRA 1TJ5A 4ES6A 1JKJA 2FSFA 3KLBA 4G5GA 4F5WA 1C29B 3H04A 4PO1A 4O4JF 4RTLA 2ZI7A 3LY7A 4Q21A 4OMDA 4D43A 5KDDA 2ID4A 2BOVA 3LE8A 3QKTA 4AJ1A 5EYPB 5J4KA 2VTBB 1A1VA 3KWJA 1GLVA 5HJ5A 3BWCA 2G06A 1DDOA 1ECCA 4YRTA 1A71A 1LS6A 3BMNB 3WRXC 3DF7A 4MMXB 4R1NA 4F8YA 3QJGA 3SCZA 4MUBA 3ZQKA 3RJZA 4AN0A 1ZMBA 3TK1A 4OX9B 4EHBA 1YFJA 1I7DA 8MHTA 5MN4A 4JZGA 2B1JA 2VWKA 4JUAA 5F51A 3J81k 2MHCA 2R3SA 2G07A 4EY3A 2CNOA 1BOFA 1GGKA 1GRVA 3PC2A 5ELLA 5JYDA 4WKCA 3PHLA 5CD9A 3JQFC 1K6XA 2H17A 2G76A 2KQUA 3OFSA 4OMFG 1G2IA 4ARIA 1UBJS 5C9ZA 1RXYA 5EHNA 1PJAA 1LK0A 1UM9A 3RAEC 2LO1A 3L1UA 5EIBD 2A0KA 3PEYA 1DPFA 4GM0A 4C7KA 1GTRA 4JV5O 3FYEB 3CZMA 1WPBA 2WHXA 2NX2A 1QU2A 2F3QA 1MO2A 4ENVA 1UBHS 4KXQA 3HB7A 1TADA 1B1CA 1QZZA 2QDOA 1UOOA 4M6WA 2OORA 2GETA 1QP4A 5DT9A 1NVTA 2CKDA 3QPAA 1VJGA 1QRRA 3H1HH 3BE5A 3EPLA 1M5RA 2ZBPA 4R2WA 2IS4A 5BRJA 5AIAA 2UYJA 3TLGA 4JLMA 1F51A 2O1WA 2VUUA 1AT1A 2GTIA 2NQ8A 4H0NA 4LYFA 4CQJA 4Z51A 4FGLA 3I9V6 4MLCA 4ZK7A 3KZCA 5CK4A 3A1SA 3L7CA 4X1YB 4M1YA 4XUEA 4O2BF 3AFMA 2GO7A 1W2GA 4B3IA 1XMQO 2VRCA 5HQTA 1U9YA 4A26A 2DM6A 3GBSA 3VRHA 2Z83A 4AS3A 5DZSA 2MQEA 3PC7A 4H08A 1Y9DA 1Z4QA 4Y6PA 1YCGA 5F2EA 4AURA 1EWYA 2JBHA 2QVCA 1YJNV 1UBLS 4KQ9A 2BV3A 4R2KA 6REQA 3UCFA 1DEHA 2F3UA 3QP9A 2UXDO 1IUOA 2A0XA 1J1IA 1ZR4A 2ZW9A 3VVCA 3L7YA 1AJQA 3LF2A 5E9WA 2HQOA 2YDYA 2O5CA 3FPLA 4JOCA 4F3NA 2Q3LA 4X66O 3R8XA 4NCIA 2J30A 4JH0A 1USVA 1YQXA 2XRYA 3UXYA 3RVLA 4JC8A 1YQWA 4Q9AA 4DJTA 3V1YA 4BBPA 5C3MA 1LEHA 4DR2B 3KV3O 2WJ6A 1CZHA 1GU7A 1H05A 2PD4A 3R44A 3EIEA 4B3DA 1EN6A 3B48A 3D3WA 3FW1A 3RFFA 4D0RA 4KH1A 4CETA 3F47A 3A6GA 2E4UA 5I9MA 3RRYA 3RYCA 2QR2A 1ANKA 2XPCA 5BVGB 3K5IA 2HQSA 5PNTA 3L0ZA 4BO6A 3RYIB 2ZQYA 1FQKA 2FRDC 3MBIA 5EJ4A 2HW8A 3WYBA 5AKEA 3NBFA 1Q7BA 2FDXA 1WV0A 3L6BA 3P2YA 2O2EA 4B4VA 1RTTA 1J21A 1G0NA 1VJCA 3EWAA 5KVQA 3K9SA 1C3XA 1AJPA 4I1IA 5IDQA 5FFFA 5DEDA 1Q15A 2Q62A 1ISSA 4H1HA 1RABA 4ZOQI 5KAMA 1UPTA 3LNTA 3AIKA 4NJOA 2XOEA 2R5NA 3JWEA 4EDHA 4JL8A 4Q24A 2XCIA 3PITA 3QXHA 4Y9SA 5EHQA 1JSRA 2TRSB 5LIRA 4MVWA 3B51X 2CH7B 1E3QA 3ZWMA 5CTAA 2HC9A 1ECLA 3DZ8A 2CYAA 4PLTA 3FE2A 3FKSD 3RREA 4BV9A 4M9QA 4QOSA 3AP2A 4NBSA 4IH1A 5IKOA 3TR0A 7REQB 3VNQA 3CR3C 1EWKA 5FAXA 3AG1C 1ZKDA 3HDQA 4FJ0A 1WP7A 3J80A 3EVNA 2CFSA 2X0FA 3K72B 4LCUC 1FDWA 3OJWA 5FLEX 3DVAB 5CRIA 3AVTA 3JD4A 2ES4A 3NBYC 3EEQA 1HZZC 5BQOA 3O0TA 5LHHA 4PX3A 5KCZA 1NQTA 5HRCA 1H7MA 1DOHA 3HDVA 2HRZA 2Q1TA 4KC0A 3O8LA 2OZPA 3G0BA 4RMHA 3SX0A 5JXWA 3NIBA 1JGTA 5FOQA 3TLCA 4L5CA 1KO5A 1J5XA 4MARA 3W3AD 4AJKA 1ENYA 3PR1A 3RC9A 5IP5A 2GBIA 2XVXA 1OYVA 3I5AA 4ETWA 5C8ZA 3M9WA 5KWSA 2P8SA 5U4XA 4AX8A 4I8XA 5AXDA 2XZOA 1HDGO 3PI6A 3N8IA 2WWTA 4B3TB 2O5VA 3DKIA 1RRGA 4B4OA 1CF4A 1NVKA 2B5WA 2I7DA 3R2JA 5F7JA 5KTOA 2E4XA 2FLVA 3FUVA 1JLLA 5JDIC 5JAOA 1NJIW 1NIJA 3ZBUA 3CE9A 3KEFA 4RD6A 3A4YA 1G6HA 4JIGA 3VHLB 2QAJA 4ZEMA 3OX3A 4XM0A 3E3NA 3WP0A 4RPHA 3GRYA 5DX0A 4XSGA 2ZOVA 1XA4A 4BVLA 2PWBA 2RGYA 3C1UA 1UOPA 2NOAA 3CLRC 2YYEA 2Q5EA 4B4UA 1NW4A 1N1MA 3GWOA 1F4MA 3X2SA 4TSFD 4YCSA 2X0KA 1O03A 1UEXC 5C8VA 3M49A 5F7XA 4ARCA 5BMOA 4DRYA 4Q7KA 1G1XB 1ZZGA 1K7DA 5EY5B 5DM6V 3DZIA 4BYGA 2QMQA 2B1GA 4F4IA 5BSWA 2XMCA 3R7AA 4ISBA 3OONA 1M33A 3KEQA 4TYQA 2BMWA 5CH3A 1UXHA 3S2FA 3VZRA 5CK5A 4DAOA 1Y89A 3AMVA 3OLZA 1NBHA 1FP2A 4EY4A 3PU6A 1J99A 2FW6A 3MTDA 5EZ6B 1R0YA 1X1TA 2VS1A 1QLNA 2IUEA 2WSLA 1A5AB 1JVSA 3CF6R 3HP7A 3F9RA 3K53A 5DHUA 1IOWA 5AXAA 3VPCA 2NO1A 4RF3A 1JA9A 3W2TA 2A9JA 5I4KA 3PT5A 3DAPA 1BDJA 3A8TA 1ZY2A 2HVJC 4O1MA 3FOFC 3K0SA 3JR3A 1TF5A 1DQPA 5L7YA 1AV6A 2DBYA 3GRAA 3DC5A 4KHZA 3T5DA 3TCXB 3CWCA 2ZD9A 1TKRA 5AVOA 4LP8A 5IJ9B 4PONA 4HG2A 3UC9A 3MC1A 1G8YA 5HNKA 4J7JA 4QJ3A 2QD4A 3VGPA 5JPCA 4ZT3A 1P2DA 3KVVA 4YJ3F 3F6BX 3SE7A 5JZ9A 4A0QA 3GQBA 5ADVA 1NW3A 1JIXA 2EJTA 5CVTA 4PO3X 2BGIA 4OXIA 4RKWA 4JAVC 4YAOA 5FR2A 5M7EA 4DR2O 5EBWC 2HSZA 5LLTA 1FFCA 4RK0A 2IL1A 2JGEA 2JHPA 2PVPA 4JPRA 2Z2YA 3QM1A 4PRYA 1Z2CA 3LLCA 1K06A 2OUKA 3EBOA 3N8DA 3CF4A 1FNMA 1ZK2A 4G1CA 4C7BA 1HX7A 4P4SA 4QXRA 2FPGA 1ZRNA 1IY9A 2QMZA 1SF9A 1KU0A 2BEWA 2J6HA 5FUVA 3TR6A 2PU7A 1X2EA 4FM1A 1DF4A 2F2TA 5DWDA 1UMDA 2O52A 1GCIA 4ITUA 1N2SA 2C4KA 5I3CA 1BQEA 1PDOA 3NR2A 2EQBA 3ZCPA 1OJLA 1IV1A 1XDSA 5CHYA 5B53A 4JC0A 1W2HA 2GEBA 1D4ZA 1HZZA 1B8OA 4MZDA 1NFFA 3EIOA 1YRQA 1ZSYA 4O63O 4RELA 3WQBA 4IX9A 4DDVA 2RHCA 3NBAA 3KCYA 4LJ5A 3EPJA 4R01A 3CA8A 3NWOA 3ET4A 2MMCA 3EVCA 4Y6SA 2MINA 3CTPA 4L4XA 3SPJA 3L1JA 5B1OA 4GOLD 1VCOA 1WXIA 3B1XA 1E3WA 4M21A 5EKTA 4DV5O 1QIFA 3ZN1A 1V45E 3EVZA 1Q82H 1GFSA 4P3XA 3EVDA 3IEMA 4QUBA 4GKKO 2GKSA 3L7AA 3N5CA 4FFMA 3LSQA 3CCUV 1T4CA 1V6CA 3BK7A 4PX5A 4ILEA 3TGUH 3EVKA 3RR2A 3SXJA 1CQWA 3CLUC 2BFFA 4WLFA 5LZ5A 5TMDA 3CKMA 2QDXA 4LHYA 3CCRV 1NMYA 3AEXA 2JCGA 3LDTA 2GUZA 1ATIA 3CB2A 1CF9A 4GUDA 4ZCIA 3OD5A 3M34A 3PVSA 4XR9A 4AMZA 2CZQA 2RKWA 1X4TA 2JJ1A 2H2AA 2XVMA 4GYJA 4IDOA 2YHIB 3I32A 4NXNB 4YCAA 4L08A 4UUAA 1FP7A 1OIXA 3WMEA 2ZJ6A 2A5GA 3KPJA 1YR8A 1NMEA 5CYOA 3ELBA 4Q18A 1PGPA 2WICA 2VDQB 2JRLA 4GR9A 1NBME 3M9LA 1YRYE 4LJKA 1VHDA 1JEAA 2A3RA 3S2GA 4U7OA 2JIBA 3GDFA 5ALOA 4DWJA 3LWPC 5FLXA 1PKEA 5KNDH 4HN9A 1EA5A 2AEJA 1T0JB 3CX3A 4GSKA 1SC1A 1AQYA 3PTLA 1ZIOA 4IKOA 2CK3A 1O57A 2GVZC 4QPZA 3PQ2A 1BD4A 5F5LA 5AI9A 1E7KA 1CK4A 4QYIB 1X59A 4G5QA 1H8HA 1JXOA 1Y1QA 2FK8A 2HJWA 5D1HA 4EJSB 4B44A 1TO1E 2F43A 2X9LA 4YACA 2F00A 2AGVA 2VKTA 3AONB 5EZQA 1GADO 3KUCA 1TM4E 1EGVB 2ZRNA 3IR5A 4DADA 1I94B 3LHIA 1Q6IA 3ZU4A 1CIVA 2H4JA 4MB6A 1KMCA 5C1IA 3UH1A 1SKYE 3BJRA 4RFSA 2C61A 3F97A 2PGJA 3R7WA 3WJRA 4J75A 4OQNA 1K4MA 4BPBA 5H6QA 3ZHXA 2FSGA 4UUPA 1TFUA 3K9BA 4TLLB 1GH6A 2DT4A 5BV1A 3EXIA 4A6DA 1GR0A 3NHWA 2O2YA 4UTNA 2ZXWC 1ZBQA 4FZJA 1T3ZA 2FSSA 3Q87B 2A4KA 1QRUA 3RIHA 3TQQA 2P2CA 1LSOA 2B35A 1QLHA 2KYRA 3JQ7B 1EM8B 1MHPA 2WJYA 4H0FA 5KYWB 1AC5A 1SUEA 2B36A 3LO5A 3ZNOA 2XNKA 1AKQA 3TTUA 1F4PA 1B3QA 4DJDC 5KWVA 2WU1A 4L8WB 4D41A 1NRIA 2OTJV 1XP8A 3WMXA 4XDGA 2X4DA 2VPZA 2HU2A 4DM7A 1XKXA 5IH7A 3KFVA 5BR7A 3K79A 2P9FA 2HWYA 2K9PA 4Q3NA 4L76A 3L79A 3MOSA 1R6NA 3U7EB 2F6RA 2JLRA 3MELA 5ALWA 5LB4A 4NCHA 3CJRA 4DVGA 1IVNA 4MKZA 1L7NA 2GCPA 2WG0A 3CNBA 4L02A 1TE2A 4BBAA 1AILA 1AK9A 3IQXA 4BB9A 2EZTA 3EMVA 3OQ1A 4BQEA 4DBLE 2LVBA 2Q6VA 1QIGA 2W2OA 3Q0TA 3G2JA 3DZDA 3RQSA 2ECPA 5IAOA 3Q2KA 5D84A 5HBGA 1NXXA 4G4IA 4UVIA 3L0SA 3JZMA 1MO4A 4DLNA 4X90A 3QENA 1VSTA 2DBRA 4LYDA 4RZSA 2A14A 3OZGA 2PKRA 1QTQA 3H1TA 2IS2A 3MTBA 3OW2F 2HEGA 3SIUA 1K92A 2IZ7A 4L6IA 1B2LA 4OX9O 4KXNA 2FSPA 2QNBA 3DC7A 4ZCQA 4D0SA 1JFSA 3BXHA 4Q34A 4TTSA 3GIWA 4QDUA 1EVLA 3F6CA 3KKZA 1DGSA 4FZ0A 3MCAB 3DONA 1R6TA 2DQ0A 4UFOA 3LWBA 4MULA 3E23A 1R6XA 1H6BA 4NZNA 2OCIA 3LGXA 1WUYA 3UM7A 3L40A 4ZK6A 4QBIA 5KMGB 3V4OA 3SPIA 5G02A 4CKYA 1ECGA 1HRKA 2VP6A 3BS4A 3PIDA 4I99A 1H66A 2D3WA 4ZV7A 2BKXA 3CWQA 1YEWA 13PKA 3QKWA 4QHYA 3C4JA 5AJWA 4CF6A 5CBPA 4INPA 2WJZB 3WTBA 2X5NA 4LXYA 5DIFA 3SK0A 5HY2A 2Z9DA 3FHTA 2GPBA 2GGSA 3LIIA 5KYXA 3D8BA 2GASA 3FB8C 1E0JA 2P6OA 4ARVA 1DB3A 3E2EA 5J40A 4C7JA 1U2EA 2XVZA 4ZPJA 3V2UA 1RKXA 4NXNO 2EL9A 1NPDA 4UCSA 3GZ4A 3OU7A 5C7YA 5K0SA 1ZTEA 3S29A 4KPUB 4Z5XA 4G4YA 5JD6A 4UCUA 1NG9A 4OUDB 1KRXA 4MKHA 5K3DA 2R65A 4R1PA 4RMGA 1KNKA 1QSGA 3CUUA 4JVNA 3ICVA 2R62A 5CJJA 3ZI4A 1VCIA 3KAJA 4RH3A 3BTOA 3JQAB 3P97A 1U0HC 1K9MH 1ZSVA 1FZTA 5HFMA 3KD2A 1D2GA 3PNPA 3A0HZ 1FXVA 4PPQA 1EFRG 4ETMA 1ZW1A 4F6RA 5BMVB 4I50B 2W2TA 4KQCA 3HWRA 3FUCA 4BV8A 4DPLA 2HF8A 1UMCA 4I1VA 4JAUA 1LFDB 2BSAA 2HHHO 3MGAA 1FYWA 1KC3A 1R6VA 2Q4EA 3JYHA 4NHEA 4WFIA 1IMJA 2AL7A 3B3QA 1UZAA 4L51A 2GAIA 4WJKB 4FOTA 5EMNA 4HEQA 3FROA 4YRKA 3QMPA 3JQ9A 1LW7A 2L0XA 1LNZA 1X0VA 3NHRA 3UMSA 4MW1A 4U7GA 1WMFA 1X2BA 3UV3A 3TW6A 4AG3A 2Q69A 2FEOA 3P1JA 1SBZA 4HDSA 3UJBA 3W04A 2C5GA 2X3FA 1S77D 4M1WA 1MZEA 1P2SA 2PKEA 3JAMN 3QUTA 1PJ8A 4MI6A 3HI4A 3ETCA 1H2MA 4AJOA 1LK7A 2NZUG 2XWSA 3B9BA 3H6HA 4W6ZA 1RMQA 5JWRA 2JS7A 2M1XA 3VC3A 1WUIS 3DTTA 4CFSA 3ZVKA 5FHRA 3T80A 4FYHA 4JP2A 3GEMA 5CVCA 3OMIB 1GQYA 2UV8A 4BO1A 2DZDA 3LVRE 5IAJA 1AZSC 5LU9A 2NNWB 4LJSA 1ADGA 1VMAA 2V9PA 4QPPA 2CT8A 2R1VB 5U4QA 4ZRDA 2AIRA 1F9EA 2DWPA 2DYKA 1O87A 1PNOA 2GSWA 3BF8A 4G0QA 3C5WP 4KN8A 4LOIA 5SY9A 3WLIA 1SCQA 4I6GA 2O19A 1M2OB 3VH1A 2KM1A 4DA8A 4MWSA 1NTMH 1GHTA 4U5XA 2B1IA 4J90A 2Q0HA 2Q21A 2YWHA 4KVZA 4OXNA 2V7QG 2P69A 2CNNA 4IVPA 2C8KA 1H1LA 1V55B 3K8QA 5BYJA 2QSUA 3C7DB 3AZOA 3W2FA 3P52A 1M2GA 2ZUEA 3ZRVA 3KYCB 3H8JA 4JJ7A 5SV2A 4BRWA 1VE5A 4BATA 5B12A 2WFLB 4HLNA 4A15A 1RYFA 1NH2B 1SBYA 1TCAA 2OEPA 2OXFA 4K5QA 4ZVTA 3UFBA 1NLZA 1W2BF 1T10A 4GP9A 2VDPB 4NDNE 4R3UC 1Z63A 4IDGA 1BE0A 5BWNA 1O97C 1S89A 3HDYA 3I01A 3MOGA 3ZUPA 4AECA 4EJMA 4EY5A 1S8AA 1IV3A 5B3SC 2PIDA 4YJ3B 5DN6G 1A95A 2EDAA 1XIVA 3BK2A 2VPTA 4NZOA 3NFRA 1WETA 1N2ZA 4ZT5A 1YAJA 1ZC4A 2BD0A 1UPUA 1EFAA 4F92B 1ZGGA 1GSOA 2JIOA 4EB8A 3IO3A 2HXYA 1D6JA 2GAOA 3C9TA 3KKLA 3AG7A 7MDHA 4U3JB 4I8DA 4CGYA 4HWSA 5HIKA 3GLGA 2ZE6A 3KOMA 1F1JA 3MT0A 3ANYB 3H2YA 5ERGB 3FBGA 1V9PA 4EVSA 5JJ5A 4YP0A 3INGA 1J2RA 4XEUA 1K7EB 2JH8A 3VMFA 3FPJA 3EZ2A 3OE1A 2N9UA 5AKGA 3ZZ1A 4DSNA 1C4OA 2IJKA 1J1ZA 2F1OA 2H4ZA 4RZQA 1MNAA 3RWBA 4BNKA 5AJUA 3K06A 1ONIA 1I36A 4K9SA 2VN8A 4TMWA 1Z3CA 4JEHA 3I05A 4U7DA 3EC7A 3PUIA 2UZ0A 2XQIA 2YXPX 4CMJA 2I65A 4OQZA 3SF8B 4LR3A 2WHPA 4MQBA 2OFOA 2WFMA 3LRTA 1YBFA 3A4NA 2IYRA 3I2KA 4LHVA 4RHCA 3GNLA 1MJGM 1J90A 2I91A 2X6AA 3OTOB 3TTTA 1OCZB 3JATB 3WNCA 1QYXA 1PQUA 2VNSA 4C1NA 1F7YA 2EF0A 4CL8A 4MZXA 4JUBA 4J4BA 4F9EA 1N6HA 1XTQA 2CXHA 1PZHA 2DT8A 4HATA 3IDOA 2RAVA 3BA6A 4R16A 2W0FC 4NV3A 2NMVA 2WIAA 2HREA 2XAAA 3IQIX 4B4DA 4RDIA 2VQEB 1KTIA 1AGPA 1TD1A 4YRFA 2CTPA 2A5FA 3HGTA 2JK5C 4FD2A 3O4JA 2E4ZA 4FE3A 5FUXA 1TPZA 3JQ8B 2IQIA 1XTZA 2QD2A 1JKMA 3FPHA 3TD5A 2I4RA 4D7AA 2GZDA 1RZRD 1MC4A 2VF8A 4IICA 3TNDA 4B0OA 5L3FA 2DSTA 2P2ZA 4PR3A 4A8JC 1ODIA 4L50A 5TISZ 3NYIA 1KC1A 2VS0A 4BVTA 4DLTA 1KVRA 5F3RA 4K81B 5TQ0B 2AW9A 5JCOC 3AUUA 2FEAA 3BWMA 5LYJA 3PC8C 4FXPA 3SEAA 3GFBA 5C7IO 1RRKA 1Y6RA 3D54A 4BGUA 3HLTA 1BXGA 5BRNA 4HI0E 3TG8A 2I1QA 1BMQA 1Q11A 2OWEA 3DDZX 3P2IA 1FC0A 1T36A 3B8NA 2QTVB 3BIWA 3CH7A 4KR7A 4HLUA 1KHTA 4P32A 1P4RA 2L6LA 3AF4A 5T64A 4DJFC 4EPYA 5BW5A 4ETIA 3BYZA 3D81A 2C3UA 4IUCS 1YS1X 2D62A 2OTJF 3QVLA 1CP3A 1B26A 2W6CX 3EZXA 2E9SA 3T1YO 3T4DA 5LA6B 1GLNA 1WNFA 1IEXA 1OTXA 2A2ZA 4PCLA 1C4WA 5G53C 4DCUA 5K0FA 3T1TA 2QM8A 3GGJA 1AXRA 5BNIA 4D25A 2FNAA 2BFCB 4QC2A 2JLWA 4ZQHA 2RB9A 2KBFA 3GLQA 4QGFA 1IV4A 1WXDA 2ZSEA 2ACVA 1XI1A 3DBRB 7GPBA 5I7FA 3VQVA 5A5EA 5I7EA 1D0SA 3OOSA 4MHTA 1RI1A 3V7FA 3CC8A 1P9RA 1Z4MA 3WIUA 5D7BA 3HVUA 3HKEA 1YGPA 2V5UA 3I2HA 4Q47A 2P0YA 4C01A 1Z08A 5B5EZ 1US8A 5A7GA 5JQGB 3JQ9C 4WZAA 3TCKA 1USUA 2NSDA 2Y8EA 1UXOA 1Q3EA 2O2GA 2NACA 4UV8A 3HN2A 1ULSA 3IJ5A 2M9MA 4NX2A 4DCPA 4POAA 2HK7A 3M2TA 3CUSA 3K14A 1P31A 1TT5B 3PWTA 2V7EA 1W36C 4B9EA 2WPDD 1QU9A 2QA4F 1XZNA 3BD6A 3CLKA 4Q1FA 4UXIA 5FB3A 2I9PA 3V2IA 1G3UA 3NWPA 4JBGA 3FNQA 2W6IA 3KO8A 3ZMTA 5DEIA 1V5EA 4ZZ1A 3TF5A 3WKEA 3H1KH 2VHWA 5J59A 4NBWA 1XROA 3UMGA 2HDWA 2V9YA 4CF5A 4DLSA 3U4DA 2V3VA 4FGSA 4NFHA 4Y0NA 1PHRA 2J32A 3DWFA 1UOEA 3AEKB 2IKQA 2C00A 2FG6C 3H5TA 4B43A 1VHAA 2UYHA 3FYCA 2Q3CA 4BQNA 2Z4TA 3IDSA 4OHCA 4WLEA 4EWLA 3L7IA 3IPLA 1FMLA 4MNTA 3IKJA 1WE2A 1O94A 4KACA 4OAQA 2O6HA 1CP2A 2OGZA 4N82A 5PGMA 2TMKA 3VSEA 3K32A 4BNLA 2BFNA 4FZRA 4CS2A 1CS0B 5I7AA 4FUQA 1BNCA 3NH6A 4N39A 1AI6A 3F46A 2F4VO 3B6ZA 1CQJA 4UMEA 3V33A 2C7QA 4JASB 1YDXA 3OW2U 1YOBA 1ARZA 1K34A 1W0KG 1Z22A 1S9HA 2PUDA 1V7CA 2XTAA 4OM8A 4E2YA 1T1EA 3FAVA 4DV4O 4D4KA 4R7TA 5F4ZA 3BIXA 5LMNO 2GN1A 3AY6A 3WK4A 3VYUC 4HDRA 4WXEA 4UU1A 5EE5B 3ZPXA 4CLDA 1HMPA 3K16A 3C5EA 3GLHA 3BREA 3HDHA 4D3XA 4EW2A 3M99B 2I7XA 3FTFA 3IP9A 2GZRA 1QLEC 4DR4O 4NJMA 4OLHA 2OP0A 3NHFA 4C4YA 5KVVA 2IS6A 4GW3A 2XA9A 3SKXA 1OXKB 2P0AA 3F5MA 4ISCA 3LYHA 5AVSA 2XGOA 3D0QA 1IRXA 3F9CA 1L5OA 4PQRA 2GRUA 4JX9A 4MDFA 1NFQA 4QUHA 1PT7A 1ETUA 1C4KA 2M2IA 2NTYC 1UAYA 2UZHA 5DBIA 1BRMA 3TX6A 4PWYA 4YQYA 2V7PA 1J23A 3O75A 1VLJA 2Q46A 2QKYA 5DSTA 1N0IA 3QVGA 1WA8B 4I1YA 4KQIA 4P7KA 1LWOA 4QTTB 5CIWA 3AJ8A 5AHRA 5H0IA 3WL8A 1NSFA 3TD9A 4HK4A 4YRCA 2YEVA 4YCCA 4V0MA 1GFIA 4I9WA 4MXDA 2KX7A 1UODA 4IYIA 3AHFA 3BVOA 3RT3C 1C9DB 1RYEA 1V11B 2FV8A 3IOYA 4KQHA 4KU4A 1KDOA 1FFWA 1E5LA 2D5CA 1MXFA 2Y67A 4MI9A 3S2SA 3HBFA 3V4DA 4QBGB 1QUFA 1D9XA 6CHYA 4BMOB 1GPMA 4XJTA 4YRJA 1L4GA 3O94A 3IJEB 1F4NA 1VCHA 1E98A 1YQTA 5E1DA 3R7SA 2JAXA 3LBHA 3RFTA 3V8EA 4MWZA 4B87A 4EEKA 4NENA 5IM4A 5F23A 1DXQA 3B85A 1LH0A 4KKXB 4XOIA 3IQEA 2C2BA 4BB6A 5GIPE 4V1CB 3COVA 4OQ4A 1I4WA 4WN9B 2P6RA 5KA6A 1KR2A 3QHQA 4RV5A 5D85A 3D36C 3N87A 1YE5A 4D5EA 1BHO1 1OZGA 5FBHA 4I9HA 3ZWXA 2Q7HA 5FPKA 4L2IB 5L45A 3HRIA 5K8TA 2C9YA 4I55B 1ZESA 1FYDA 2ECQA 3LKBA 5BQ3A 1HQCA 3R3HA 4J76A 4N3NA 4QYTA 1MDFA 1YNSA 2IOYA 2PS3A 5KJ6A 3D5EA 2D5IA 4DA7A 3RYHA 3BEDA 4J0KA 4UZFA 1IATA 5MGNA 5IVHA 1VF5B 4B09A 4CM9A 1ODTC 1PK7A 2UUPA 3OAAA 3WS7A 3OFNA 2AE2A 3FB4A 4HXYA 4UEWA 4BW9A 4BNFA 1QRSA 3BDIA 4MGKR 1DC5A 1OCEA 1HKUA 4MWBA 3N6VA 3OEYA 2BM8A 2QG6A 5K6AA 3LUBA 3SBDA 1TCUA 5E1AC 5FNVB 1RCFA 5CCBA 4MGHA 1WN7A 4BB5A 1JOYA 1I3OA 4O4LA 2R70A 2HRBA 3H86A 3N2YA 1PDWA 4WY8A 2G1PA 1QNMA 2PNFA 4EELA 4O4IB 1SUPA 1K8AH 2HP3A 4LWQA 3G5UA 1ZRSA 1W44A 2YWRA 1EDOA 2W6IG 1Y80A 2EOAA 2DMXA 2IC5A 2NUBA 4J43A 1OFIA 4LGYA 1GARA 1K89A 4J2HA 5BSMA 4B82A