1H7MA

Ribosomal protein l30e from thermococcus celer
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
SVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Crystal Structure of Ribosomal Protein L30E from the Extreme Thermophile Thermocccus Celer: Thermal Stability and RNA Binding
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 31
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1h7mA00
2VGNA 1KQSF 5GIPC 3CCSF 3G71F 1X7PA 5GAPK 3FFMA 3N4YA 3VI6A 5EO3A 5A2QM 5G4VC 3GYQA 1YHQF 3CC7F 5FJ4C 1YITF 1GZ0A 2ALEA 5IT9M 1SDSA 3NK6A 5GINC 1QVFF 3CMAF 1K73H 1NJIH 1W3EX 1E7KA 3OW2F 3CPQA 3CMEF 2FC3A 5DCVA 1XBIA 2OHWA 3JCMM 3O85A 4X3LA 4LCKA 3V7QA 1VQPF 1CK2A 1W40A 3WXMB 3OBWA 3N4ZA 4X3MA 1Q81H 3E20B 2QI2A 4BY9D 1VQ7F 3ON1A 1X52A 1Q7YH 3NVKE 3LWRC 1YI2F 3SIUA 2OZBA 1VQ9F 1NMUB 4TZZA 3LWQC 1VQ6F 3J80M 1K8AH 2QA4F 1W42A 4NUTA 2VGMA 3CCQF 1YIJF 4BW0B 3I56F 1DT9A 3CCEF 3VMFB 3I55F 3CC2F 1VQ8F 3NMUC 1S72F 2I6DA 1QVGF 3LWOC 2OTLF 3LWVC 1Q82H 2LBWA 3CCRF 1KD1H 1N8RH 1Q86H 1M1KH 2HVYD 3G4SF 2BO1A 3CCLF 1YJWF 1K9MH 2QEXF 5EWRA 3CC4F 2WALA 3MCAB 1T0KB 5FLXM 2LBXA 3V7EA 1PXWA 5GANK 3NK7A 3SIVA 1W41A 5G4UC 3CG6A 1M90H 3RA6A 2KTVA 3CXCF 3HJWC 1CN7A 3OBYA 4C4WC 1ZWZA 1GO1A 3CCMF 2JNBA 2KTUA 3RA5A 1VQ4F 2KG4A 1VQLF 3HAXD 1IPAA 1RA4A 3J81M 3PLAC 1VQNF 3IR9A 3AGKA 3LFOA 3CCVF 1YJ9F 1X7OA 1VQKF 3E1YA 1YJNF 1VQOF 1RLGA 3CCUF 2CZWA 1H7MA 3G6EF 2OTJF 3LWPC 1KC8H 2AIFA 1GO0A 5GIOC 1VQ5F 1VQMF 3JAMM 1JJ2F 3NVIB 3CD6F 3PAFA 1W2BF 3J7AR 3CPWF 3CCJF
chains in the Genus database with same CATH superfamily
3B6NA 3C9SA 4O4LA 4BT4A 4WBNB 5J2UB 5GIPC 3CCSF 3P4EA 4EB6B 4ZOLB 3VI6A 2R751 1YHQF 2EWCA 4ZHQB 2Z1TA 1IV3A 5C8YB 2ZF8A 3F0GA 2HP0B 2ALEA 1XHOA 1SDSA 3NK6A 4TV8B 4BT3A 4B5CA 3CMAF 4G4ZA 4WBNA 1W3EX 5HXUA 5HP8A 5LOVB 2VAMA 1OAPA 2ZAUA 4I50B 2AIZP 2OHWA 2VAWA 3O85A 1TVKB 4TV9A 4X3LA 3JCMM 2IQQA 3LDTA 2AMTA 1FFXB 2LCAA 1CK2A 1YGYA 5C8YA 1W57A 4BT6A 1Q81H 3HKCB 2RHLA 3VOBA 3HKDB 3GHZA 4YJ3B 4ZHWA 5LOVA 1JY8A 4E6EA 2OZBA 3CYPB 2P6YA 4I50A 1NQ3A 1TVKA 4TZZA 1FFXA 4X1YB 1YIJF 4BW0B 3I56F 1DT9A 2RB9A 4EI7A 3HKCA 3CCEF 3VMFB 3CC2F 2HS4A 5CA1B 3HKDA 4YJ3A 2LBWA 1KD1H 5JQGB 2LBTA 3G4SF 2BO1A 1JN1A 3LYBA 4G4VA 4FFBA 3VTIC 2GZLA 5HXZA 4X1KA 1GX1A 3QTYA 4NWOB 4EI8A 1PXWA 3NK7A 2HX0A 5JQGA 2VXYA 1TUBB 4TUYB 2IAFA 4HNAA 5JVDB 4DXDA 2H8EA 3F0EA 4O4IB 1ZWZA 3WJRA 3CCMF 2JNBA 3L7QA 4KWEA 2KTUA 2KG4A 4O4HA 3D54A 4C82A 1RA4A 3S0WA 1TUBA 5JH7A 4TUYA 1SZQA 5J2TB 5JVDA 3IR9A 3AGKA 1X7OA 4B46A 2H6LA 5FNVB 1Q8RA 2HS3A 3P0ZA 3FD6A 3T80A 5KMGA 5IYZA 1H7MA 3LWPC 3FD5A 1KC8H 1GO0A 4BT5A 5GIOC 3C9UA 3TD3A 2BTUA 1IV2A 3KJJA 1PF5A 5J2TA 3J7AR 1W2BF 4C8GA 3CPWF 4F6RB 2ZVYA 5LP6B 2RHHA 2UYNB 3GYQA 3S06A 1GZ0A 5IT9M 5LP6C 1QVFF 3WJPA 1VHAA 4F6RA 5HY0A 4ZHYB 1JFFA 3CYQA 3RYCB 1QAHA 3JARB 4ERHA 2N48A 4ZHVA 4X20B 4ZK7A 3OBWA 4PWTA 4BVTA 2UYJA 4G4XA 2QI2A 1VQ7F 1QU9A 3ON1A 1R1MA 2GLZA 1W581 3KHNA 4TV9B 3RYCA 2UYKA 3JARA 2HQSC 1RQ7A 4O2BB 2BTQB 3LWQC 5HY1A 2Z1FA 5HP7A 2BTOA 3QHDA 4X20A 4NUTA 1W5BA 5LYJA 3UT5B 3VYSC 3NMUC 2I6DA 3LWVC 3CCRF 2HVYD 2CW4A 3HKBB 4O2BA 1U3LA 1VK3A 2L26A 3OONA 4I55A 3RYIB 3UT5A 3MCAB 2Q1YA 3C9RA 4I4TB 5EB0A 5FLXM 2LBXA 5EAZA 2UYPA 3V7EA 3F0FA 3P10A 2ZODA 4FFBB 3HKBA 5MN5A 2CHSA 3RE3A 3Q8HA 1ODEA 1COMA 3CG6A 3ERNA 1M90H 4X1KB 2VAPA 3HJWC 4C4WC 3RYIA 3RYFB 4I4TA 2CWJA 4BVSA 4DRXA 3WJQA 3F0DA 3ZOPA 4HNAB 3VOAA 3J81M 2KGWA 1QD9A 1ONIA 3JAKB 4X1IA 3RYFA 4O4HB 2UZHA 3VYTC 1RLUA 2CZWA 4M8IA 3G6EF 5CB4B 5JH7B 2AIFA 3GTZA 5ITZB 1VQ5F 5EB1B 3NVIB 3I3FA 3CD6F 1W5EA 1U3PA 2VGNA 5KMGB 5IYZB 3S03A 2FGYA 1X7PA 3IMPA 3JAKA 4C8IA 5GAPK 3G71F 3FFMA 5G4VC 1SA0A 5CB4A 1UI9A 3CC7F 1RQ2A 5ITZA 1XV2A 3ZO8A 2DYYA 4O2AB 3WGKA 3KIZA 3JASB 4RQOA 4U3JA 3CMEF 2FC3A 2QTPA 1XBIA 4XCQA 2YYEA 2F9ZC 1W55A 3V7QA 1W40A 3LMEA 1OFUA 3WXMB 1VH8A 2Z01A 1W5FA 3N4ZA 4X3MA 2HRUA 3E20B 4RHAA 1JFFB 1X25A 4O2AA 3VO8A 4G88A 5KX5A 5IJ9B 1FSZA 5GONB 3JASA 1J7HA 3NVKE 3LWRC 1YI2F 3SIUA 1W5AA 2NMUA 3N2KB 1VQ9F 1NMUB 3QUWA 3JATB 3J80M 3ZP4A 3IEQA 2QA4F 2RHJA 4ZI7A 2MQEA 3U0OA 1W42A 2ZVZA 2VGMA 3CCQF 3JVHA 2G9IA 3E22A 5IJ9A 2HP3A 1QVGF 5GONA 3LWOC 2OTLF 1Q82H 3N2KA 1Q86H 3TD4A 3ZP7A 2RHOA 3K12A 4G4WA 1M1KH 3JATA 2Z1EA 3IEWA 5HWEA 3MDOA 5LYJB 5B8FA 2QEXF 5EWRA 3MBMA 1IV1A 1T0KB 2GVIA 3CB2A 2CVLA 5CA0A 4YJ2B 3WGJA 1W41A 5G4UC 3WPWA 1KNJA 3RA6A 4I55B 1Z5WA 3OBYA 3VYUC 1H47A 3ESJA 1GO1A 4O4JA 5BMVA 3EORA 4G4YA 4YJ2A 3WGLA 3PLAC 3V3TA 3N2GA 5LXTB 3M4SA 3CCVF 1VQKF 5EZYB 1VQVA 4DRXB 1YJNF 5J2UA 3S0HA 4EB6A 3HWUA 4ZOLA 1FNJA 2Q1XA 2OTJF 3KE1A 3C9TA 1JJ2F 4ZHQA 1U40A 5LXTA 2HP0A 3CCJF 4X1IB 4BT2A 5EZYA 4TV8A 4IIJB 2OTMA 1KQSF 3RYHB 3N4YA 5A2QM 5EO3A 1H48A 5HY4A 2YXZA 3HKEB 5FJ4C 1YITF 2K1SA 3JALB 5GINC 1XRGA 2CSLA 1K73H 3MCQA 4IIJA 4C81A 1NJIH 1SA0B 3RYHA 3OW2F 1E7KA 1KNKA 3CPQA 5DCVA 4LCKA 3KJKA 5JCOC 3HKEA 1VQPF 4C8EA 3JALA 3TD5A 5JCOA 2CHTA 4BY9D 4X1YA 3V4DA 5MN4A 4U3JB 3ELCA 1X52A 1Q7YH 1T0AA 3IKEA 2PHNA 5HY2A 5EYPB 4U39A 5EIBD 3VCZA 3M1XA 5CA1A 1IV4A 4BVQA 3BYQA 3I7TA 3S0YA 1DBFA 1VQ6F 1K8AH 4NQ3A 2HS0A 3D01A 5LA6B 5KX5B 2IG8A 3C8LA 3WGNA 2ZOVA 4IHJB 3I55F 1VQ8F 4LNUB 1S72F 1YQNA 3FBAA 5EYPA 5AVMA 4BT7A 2I6RA 1N8RH 4ZI7B 3FPIA 3CCLF 4EI9A 5MN6A 2W8BC 1YJWF 3E22B 5LA6A 1K9MH 2H8CA 3F6MA 3CC4F 2WALA 2PMPA 4IHJA 1UFYA 3DC2A 4O4IA 5IJ0B 3K0TA 4LNUA 5GANK 3MQWA 4B62A 2DT4A 3K14A 3SIVA 3WPXA 3DDNA 3WGMA 3VIUA 1Z5VA 2B33A 2Z1UA 1U43A 2KTVA 3CXCF 2V9YA 1CN7A 5IJ0A 1JD1A 5CA0B 1FNKA 5FNVA 2R6R1 4B45A 3JAWB 3RA5A 3IKFA 1VQ4F 1VQLF 3HAXD 2HRYA 1IPAA 3M84A 1VQNF 5EIBC 3K2XA 3LFOA 3D00A 1YJ9F 4R40B 4O4JB 3R0PA 4O4LB 3HTNA 5BMVB 1W59A 3E1YA 5LP6A 1VQOF 1RLGA 3CCUF 4BVRA 3S02A 3JAWA 2UYNA 3N2GB 1VQMF 3JAMM 1CLIA 3PAFA
chains in the Genus database with same CATH topology
2VGNA 1KQSF 5GIPC 3CCSF 3G71F 2FGYA 1X7PA 5GAPK 3FFMA 3N4YA 3VI6A 5EO3A 5A2QM 5G4VC 5HY4A 3GYQA 1YHQF 3CC7F 5FJ4C 1YITF 1GZ0A 2ALEA 5IT9M 1SDSA 3NK6A 5GINC 1QVFF 3CMAF 1K73H 5HY0A 1NJIH 1W3EX 5HXUA 1E7KA 3OW2F 3CPQA 3CMEF 2FC3A 4XCQA 1XBIA 2OHWA 3JCMM 3O85A 4X3LA 4LCKA 5DCVA 2F9ZC 3V7QA 1VQPF 1CK2A 1W40A 3WXMB 3OBWA 4BVTA 3N4ZA 4X3MA 1Q81H 3E20B 2QI2A 4BY9D 1VQ7F 3ON1A 2GLZA 1X52A 1Q7YH 5HY2A 3NVKE 3LWRC 1YI2F 3SIUA 2OZBA 1VQ9F 1NMUB 4BVQA 4TZZA 3LWQC 5HY1A 1VQ6F 3J80M 1K8AH 2QA4F 4NQ3A 1W42A 4NUTA 2VGMA 3CCQF 1YIJF 4BW0B 3I56F 1DT9A 4EI7A 3CCEF 3VMFB 3I55F 3CC2F 1VQ8F 3NMUC 1S72F 2I6DA 1QVGF 3LWOC 2OTLF 3LWVC 1Q82H 2LBWA 3CCRF 1KD1H 1N8RH 1Q86H 1M1KH 2HVYD 3G4SF 2BO1A 3CCLF 4EI9A 5HWEA 1YJWF 5HXZA 1K9MH 2QEXF 5EWRA 3CC4F 2WALA 3MCAB 1T0KB 5FLXM 2LBXA 4EI8A 3V7EA 1PXWA 5GANK 3NK7A 3SIVA 1W41A 5G4UC 3CG6A 1M90H 3RA6A 2KTVA 3CXCF 3HJWC 1CN7A 3OBYA 4C4WC 1ZWZA 1GO1A 3CCMF 2JNBA 4BVSA 2KTUA 3RA5A 1VQ4F 2KG4A 1VQLF 3HAXD 1IPAA 1RA4A 3J81M 3PLAC 1VQNF 3V3TA 3IR9A 3AGKA 3LFOA 3CCVF 3D00A 1YJ9F 1X7OA 1VQKF 3E1YA 1YJNF 1VQOF 1RLGA 3CCUF 4BVRA 2CZWA 1H7MA 3G6EF 2OTJF 3LWPC 1KC8H 2AIFA 1GO0A 5GIOC 1VQ5F 1VQMF 3JAMM 1JJ2F 3NVIB 3CD6F 3PAFA 1W2BF 3J7AR 3CPWF 3CCJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGN A;  1KQS F;  5GIP C;  3CCS F;  3G71 F;  1X7P A;  5GAP K;  3FFM A;  3N4Y A;  3VI6 A;  5EO3 A;  5A2Q M;  5G4V C;  3GYQ A;  1YHQ F;  3CC7 F;  5FJ4 C;  1YIT F;  1GZ0 A;  2ALE A;  5IT9 M;  1SDS A;  3NK6 A;  5GIN C;  1QVF F;  3CMA F;  1K73 H;  1NJI H;  1W3E X;  1E7K A;  3OW2 F;  3CPQ A;  3CME F;  2FC3 A;  5DCV A;  1XBI A;  2OHW A;  3JCM M;  3O85 A;  4X3L A;  4LCK A;  3V7Q A;  1VQP F;  1CK2 A;  1W40 A;  3WXM B;  3OBW A;  3N4Z A;  4X3M A;  1Q81 H;  3E20 B;  2QI2 A;  4BY9 D;  1VQ7 F;  3ON1 A;  1X52 A;  1Q7Y H;  3NVK E;  3LWR C;  1YI2 F;  3SIU A;  2OZB A;  1VQ9 F;  1NMU B;  4TZZ A;  3LWQ C;  1VQ6 F;  3J80 M;  1K8A H;  2QA4 F;  1W42 A;  4NUT A;  2VGM A;  3CCQ F;  1YIJ F;  4BW0 B;  3I56 F;  1DT9 A;  3CCE F;  3VMF B;  3I55 F;  3CC2 F;  1VQ8 F;  3NMU C;  1S72 F;  2I6D A;  1QVG F;  3LWO C;  2OTL F;  3LWV C;  1Q82 H;  2LBW A;  3CCR F;  1KD1 H;  1N8R H;  1Q86 H;  1M1K H;  2HVY D;  3G4S F;  2BO1 A;  3CCL F;  1YJW F;  1K9M H;  2QEX F;  5EWR A;  3CC4 F;  2WAL A;  3MCA B;  1T0K B;  5FLX M;  2LBX A;  3V7E A;  1PXW A;  5GAN K;  3NK7 A;  3SIV A;  1W41 A;  5G4U C;  3CG6 A;  1M90 H;  3RA6 A;  2KTV A;  3CXC F;  3HJW C;  1CN7 A;  3OBY A;  4C4W C;  1ZWZ A;  1GO1 A;  3CCM F;  2JNB A;  2KTU A;  3RA5 A;  1VQ4 F;  2KG4 A;  1VQL F;  3HAX D;  1IPA A;  1RA4 A;  3J81 M;  3PLA C;  1VQN F;  3IR9 A;  3AGK A;  3LFO A;  3CCV F;  1YJ9 F;  1X7O A;  1VQK F;  3E1Y A;  1YJN F;  1VQO F;  1RLG A;  3CCU F;  2CZW A;  1H7M A;  3G6E F;  2OTJ F;  3LWP C;  1KC8 H;  2AIF A;  1GO0 A;  5GIO C;  1VQ5 F;  1VQM F;  3JAM M;  1JJ2 F;  3NVI B;  3CD6 F;  3PAF A;  1W2B F;  3J7A R;  3CPW F;  3CCJ F; 
#chains in the Genus database with same CATH topology
 3B6N A;  3C9S A;  4O4L A;  4BT4 A;  4WBN B;  5J2U B;  5GIP C;  3CCS F;  3P4E A;  4EB6 B;  4ZOL B;  3VI6 A;  2R75 1;  1YHQ F;  2EWC A;  4ZHQ B;  2Z1T A;  1IV3 A;  5C8Y B;  2ZF8 A;  3F0G A;  2HP0 B;  2ALE A;  1XHO A;  1SDS A;  3NK6 A;  4TV8 B;  4BT3 A;  4B5C A;  3CMA F;  4G4Z A;  4WBN A;  1W3E X;  5HXU A;  5HP8 A;  5LOV B;  2VAM A;  1OAP A;  2ZAU A;  4I50 B;  2AIZ P;  2OHW A;  2VAW A;  3O85 A;  1TVK B;  4TV9 A;  4X3L A;  3JCM M;  2IQQ A;  3LDT A;  2AMT A;  1FFX B;  2LCA A;  1CK2 A;  1YGY A;  5C8Y A;  1W57 A;  4BT6 A;  1Q81 H;  3HKC B;  2RHL A;  3VOB A;  3HKD B;  3GHZ A;  4YJ3 B;  4ZHW A;  5LOV A;  1JY8 A;  4E6E A;  2OZB A;  3CYP B;  2P6Y A;  4I50 A;  1NQ3 A;  1TVK A;  4TZZ A;  1FFX A;  4X1Y B;  1YIJ F;  4BW0 B;  3I56 F;  1DT9 A;  2RB9 A;  4EI7 A;  3HKC A;  3CCE F;  3VMF B;  3CC2 F;  2HS4 A;  5CA1 B;  3HKD A;  4YJ3 A;  2LBW A;  1KD1 H;  5JQG B;  2LBT A;  3G4S F;  2BO1 A;  1JN1 A;  3LYB A;  4G4V A;  4FFB A;  3VTI C;  2GZL A;  5HXZ A;  4X1K A;  1GX1 A;  3QTY A;  4NWO B;  4EI8 A;  1PXW A;  3NK7 A;  2HX0 A;  5JQG A;  2VXY A;  1TUB B;  4TUY B;  2IAF A;  4HNA A;  5JVD B;  4DXD A;  2H8E A;  3F0E A;  4O4I B;  1ZWZ A;  3WJR A;  3CCM F;  2JNB A;  3L7Q A;  4KWE A;  2KTU A;  2KG4 A;  4O4H A;  3D54 A;  4C82 A;  1RA4 A;  3S0W A;  1TUB A;  5JH7 A;  4TUY A;  1SZQ A;  5J2T B;  5JVD A;  3IR9 A;  3AGK A;  1X7O A;  4B46 A;  2H6L A;  5FNV B;  1Q8R A;  2HS3 A;  3P0Z A;  3FD6 A;  3T80 A;  5KMG A;  5IYZ A;  1H7M A;  3LWP C;  3FD5 A;  1KC8 H;  1GO0 A;  4BT5 A;  5GIO C;  3C9U A;  3TD3 A;  2BTU A;  1IV2 A;  3KJJ A;  1PF5 A;  5J2T A;  3J7A R;  1W2B F;  4C8G A;  3CPW F;  4F6R B;  2ZVY A;  5LP6 B;  2RHH A;  2UYN B;  3GYQ A;  3S06 A;  1GZ0 A;  5IT9 M;  5LP6 C;  1QVF F;  3WJP A;  1VHA A;  4F6R A;  5HY0 A;  4ZHY B;  1JFF A;  3CYQ A;  3RYC B;  1QAH A;  3JAR B;  4ERH A;  2N48 A;  4ZHV A;  4X20 B;  4ZK7 A;  3OBW A;  4PWT A;  4BVT A;  2UYJ A;  4G4X A;  2QI2 A;  1VQ7 F;  1QU9 A;  3ON1 A;  1R1M A;  2GLZ A;  1W58 1;  3KHN A;  4TV9 B;  3RYC A;  2UYK A;  3JAR A;  2HQS C;  1RQ7 A;  4O2B B;  2BTQ B;  3LWQ C;  5HY1 A;  2Z1F A;  5HP7 A;  2BTO A;  3QHD A;  4X20 A;  4NUT A;  1W5B A;  5LYJ A;  3UT5 B;  3VYS C;  3NMU C;  2I6D A;  3LWV C;  3CCR F;  2HVY D;  2CW4 A;  3HKB B;  4O2B A;  1U3L A;  1VK3 A;  2L26 A;  3OON A;  4I55 A;  3RYI B;  3UT5 A;  3MCA B;  2Q1Y A;  3C9R A;  4I4T B;  5EB0 A;  5FLX M;  2LBX A;  5EAZ A;  2UYP A;  3V7E A;  3F0F A;  3P10 A;  2ZOD A;  4FFB B;  3HKB A;  5MN5 A;  2CHS A;  3RE3 A;  3Q8H A;  1ODE A;  1COM A;  3CG6 A;  3ERN A;  1M90 H;  4X1K B;  2VAP A;  3HJW C;  4C4W C;  3RYI A;  3RYF B;  4I4T A;  2CWJ A;  4BVS A;  4DRX A;  3WJQ A;  3F0D A;  3ZOP A;  4HNA B;  3VOA A;  3J81 M;  2KGW A;  1QD9 A;  1ONI A;  3JAK B;  4X1I A;  3RYF A;  4O4H B;  2UZH A;  3VYT C;  1RLU A;  2CZW A;  4M8I A;  3G6E F;  5CB4 B;  5JH7 B;  2AIF A;  3GTZ A;  5ITZ B;  1VQ5 F;  5EB1 B;  3NVI B;  3I3F A;  3CD6 F;  1W5E A;  1U3P A;  2VGN A;  5KMG B;  5IYZ B;  3S03 A;  2FGY A;  1X7P A;  3IMP A;  3JAK A;  4C8I A;  5GAP K;  3G71 F;  3FFM A;  5G4V C;  1SA0 A;  5CB4 A;  1UI9 A;  3CC7 F;  1RQ2 A;  5ITZ A;  1XV2 A;  3ZO8 A;  2DYY A;  4O2A B;  3WGK A;  3KIZ A;  3JAS B;  4RQO A;  4U3J A;  3CME F;  2FC3 A;  2QTP A;  1XBI A;  4XCQ A;  2YYE A;  2F9Z C;  1W55 A;  3V7Q A;  1W40 A;  3LME A;  1OFU A;  3WXM B;  1VH8 A;  2Z01 A;  1W5F A;  3N4Z A;  4X3M A;  2HRU A;  3E20 B;  4RHA A;  1JFF B;  1X25 A;  4O2A A;  3VO8 A;  4G88 A;  5KX5 A;  5IJ9 B;  1FSZ A;  5GON B;  3JAS A;  1J7H A;  3NVK E;  3LWR C;  1YI2 F;  3SIU A;  1W5A A;  2NMU A;  3N2K B;  1VQ9 F;  1NMU B;  3QUW A;  3JAT B;  3J80 M;  3ZP4 A;  3IEQ A;  2QA4 F;  2RHJ A;  4ZI7 A;  2MQE A;  3U0O A;  1W42 A;  2ZVZ A;  2VGM A;  3CCQ F;  3JVH A;  2G9I A;  3E22 A;  5IJ9 A;  2HP3 A;  1QVG F;  5GON A;  3LWO C;  2OTL F;  1Q82 H;  3N2K A;  1Q86 H;  3TD4 A;  3ZP7 A;  2RHO A;  3K12 A;  4G4W A;  1M1K H;  3JAT A;  2Z1E A;  3IEW A;  5HWE A;  3MDO A;  5LYJ B;  5B8F A;  2QEX F;  5EWR A;  3MBM A;  1IV1 A;  1T0K B;  2GVI A;  3CB2 A;  2CVL A;  5CA0 A;  4YJ2 B;  3WGJ A;  1W41 A;  5G4U C;  3WPW A;  1KNJ A;  3RA6 A;  4I55 B;  1Z5W A;  3OBY A;  3VYU C;  1H47 A;  3ESJ A;  1GO1 A;  4O4J A;  5BMV A;  3EOR A;  4G4Y A;  4YJ2 A;  3WGL A;  3PLA C;  3V3T A;  3N2G A;  5LXT B;  3M4S A;  3CCV F;  1VQK F;  5EZY B;  1VQV A;  4DRX B;  1YJN F;  5J2U A;  3S0H A;  4EB6 A;  3HWU A;  4ZOL A;  1FNJ A;  2Q1X A;  2OTJ F;  3KE1 A;  3C9T A;  1JJ2 F;  4ZHQ A;  1U40 A;  5LXT A;  2HP0 A;  3CCJ F;  4X1I B;  4BT2 A;  5EZY A;  4TV8 A;  4IIJ B;  2OTM A;  1KQS F;  3RYH B;  3N4Y A;  5A2Q M;  5EO3 A;  1H48 A;  5HY4 A;  2YXZ A;  3HKE B;  5FJ4 C;  1YIT F;  2K1S A;  3JAL B;  5GIN C;  1XRG A;  2CSL A;  1K73 H;  3MCQ A;  4IIJ A;  4C81 A;  1NJI H;  1SA0 B;  3RYH A;  3OW2 F;  1E7K A;  1KNK A;  3CPQ A;  5DCV A;  4LCK A;  3KJK A;  5JCO C;  3HKE A;  1VQP F;  4C8E A;  3JAL A;  3TD5 A;  5JCO A;  2CHT A;  4BY9 D;  4X1Y A;  3V4D A;  5MN4 A;  4U3J B;  3ELC A;  1X52 A;  1Q7Y H;  1T0A A;  3IKE A;  2PHN A;  5HY2 A;  5EYP B;  4U39 A;  5EIB D;  3VCZ A;  3M1X A;  5CA1 A;  1IV4 A;  4BVQ A;  3BYQ A;  3I7T A;  3S0Y A;  1DBF A;  1VQ6 F;  1K8A H;  4NQ3 A;  2HS0 A;  3D01 A;  5LA6 B;  5KX5 B;  2IG8 A;  3C8L A;  3WGN A;  2ZOV A;  4IHJ B;  3I55 F;  1VQ8 F;  4LNU B;  1S72 F;  1YQN A;  3FBA A;  5EYP A;  5AVM A;  4BT7 A;  2I6R A;  1N8R H;  4ZI7 B;  3FPI A;  3CCL F;  4EI9 A;  5MN6 A;  2W8B C;  1YJW F;  3E22 B;  5LA6 A;  1K9M H;  2H8C A;  3F6M A;  3CC4 F;  2WAL A;  2PMP A;  4IHJ A;  1UFY A;  3DC2 A;  4O4I A;  5IJ0 B;  3K0T A;  4LNU A;  5GAN K;  3MQW A;  4B62 A;  2DT4 A;  3K14 A;  3SIV A;  3WPX A;  3DDN A;  3WGM A;  3VIU A;  1Z5V A;  2B33 A;  2Z1U A;  1U43 A;  2KTV A;  3CXC F;  2V9Y A;  1CN7 A;  5IJ0 A;  1JD1 A;  5CA0 B;  1FNK A;  5FNV A;  2R6R 1;  4B45 A;  3JAW B;  3RA5 A;  3IKF A;  1VQ4 F;  1VQL F;  3HAX D;  2HRY A;  1IPA A;  3M84 A;  1VQN F;  5EIB C;  3K2X A;  3LFO A;  3D00 A;  1YJ9 F;  4R40 B;  4O4J B;  3R0P A;  4O4L B;  3HTN A;  5BMV B;  1W59 A;  3E1Y A;  5LP6 A;  1VQO F;  1RLG A;  3CCU F;  4BVR A;  3S02 A;  3JAW A;  2UYN A;  3N2G B;  1VQM F;  3JAM M;  1CLI A;  3PAF A; 
#chains in the Genus database with same CATH homology
 2VGN A;  1KQS F;  5GIP C;  3CCS F;  3G71 F;  2FGY A;  1X7P A;  5GAP K;  3FFM A;  3N4Y A;  3VI6 A;  5EO3 A;  5A2Q M;  5G4V C;  5HY4 A;  3GYQ A;  1YHQ F;  3CC7 F;  5FJ4 C;  1YIT F;  1GZ0 A;  2ALE A;  5IT9 M;  1SDS A;  3NK6 A;  5GIN C;  1QVF F;  3CMA F;  1K73 H;  5HY0 A;  1NJI H;  1W3E X;  5HXU A;  1E7K A;  3OW2 F;  3CPQ A;  3CME F;  2FC3 A;  4XCQ A;  1XBI A;  2OHW A;  3JCM M;  3O85 A;  4X3L A;  4LCK A;  5DCV A;  2F9Z C;  3V7Q A;  1VQP F;  1CK2 A;  1W40 A;  3WXM B;  3OBW A;  4BVT A;  3N4Z A;  4X3M A;  1Q81 H;  3E20 B;  2QI2 A;  4BY9 D;  1VQ7 F;  3ON1 A;  2GLZ A;  1X52 A;  1Q7Y H;  5HY2 A;  3NVK E;  3LWR C;  1YI2 F;  3SIU A;  2OZB A;  1VQ9 F;  1NMU B;  4BVQ A;  4TZZ A;  3LWQ C;  5HY1 A;  1VQ6 F;  3J80 M;  1K8A H;  2QA4 F;  4NQ3 A;  1W42 A;  4NUT A;  2VGM A;  3CCQ F;  1YIJ F;  4BW0 B;  3I56 F;  1DT9 A;  4EI7 A;  3CCE F;  3VMF B;  3I55 F;  3CC2 F;  1VQ8 F;  3NMU C;  1S72 F;  2I6D A;  1QVG F;  3LWO C;  2OTL F;  3LWV C;  1Q82 H;  2LBW A;  3CCR F;  1KD1 H;  1N8R H;  1Q86 H;  1M1K H;  2HVY D;  3G4S F;  2BO1 A;  3CCL F;  4EI9 A;  5HWE A;  1YJW F;  5HXZ A;  1K9M H;  2QEX F;  5EWR A;  3CC4 F;  2WAL A;  3MCA B;  1T0K B;  5FLX M;  2LBX A;  4EI8 A;  3V7E A;  1PXW A;  5GAN K;  3NK7 A;  3SIV A;  1W41 A;  5G4U C;  3CG6 A;  1M90 H;  3RA6 A;  2KTV A;  3CXC F;  3HJW C;  1CN7 A;  3OBY A;  4C4W C;  1ZWZ A;  1GO1 A;  3CCM F;  2JNB A;  4BVS A;  2KTU A;  3RA5 A;  1VQ4 F;  2KG4 A;  1VQL F;  3HAX D;  1IPA A;  1RA4 A;  3J81 M;  3PLA C;  1VQN F;  3V3T A;  3IR9 A;  3AGK A;  3LFO A;  3CCV F;  3D00 A;  1YJ9 F;  1X7O A;  1VQK F;  3E1Y A;  1YJN F;  1VQO F;  1RLG A;  3CCU F;  4BVR A;  2CZW A;  1H7M A;  3G6E F;  2OTJ F;  3LWP C;  1KC8 H;  2AIF A;  1GO0 A;  5GIO C;  1VQ5 F;  1VQM F;  3JAM M;  1JJ2 F;  3NVI B;  3CD6 F;  3PAF A;  1W2B F;  3J7A R;  3CPW F;  3CCJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...