1H7MA

Ribosomal protein l30e from thermococcus celer
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
b'SVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Crystal Structure of Ribosomal Protein L30E from the Extreme Thermophile Thermocccus Celer: Thermal Stability and RNA Binding
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 31
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1h7mA00
3AGKA 2LBWA 1H7MA 3CCVF 2ALEA 1S72F 3LWQC 3CPWF 4C4WC 3RA5A 3VMFB 3I56F 3CCRF 1VQ5F 3ON1A 2QA4F 3LFOA 3GYQA 1YHQF 1ZWZA 3CCQF 1X52A 2LBXA 1K73H 3CPQA 3PLAC 1RA4A 3O85A 1QVGF 1DT9A 3E1YA 3SIVA 3CCMF 3CCUF 3CC2F 3NVIB 3NVKE 1QVFF 3E20B 2CZWA 4TZZA 1VQOF 2BO1A 4BW0B 4NUTA 3CCEF 1YIJF 5FJ4C 3G6EF 1NMUB 2JNBA 1NJIH 1YJNF 1RLGA 3J7AR 3LWOC 1GZ0A 1YI2F 1K8AH 1XBIA 5GANK 3CMEF 1GO0A 3G4SF 1YITF 1X7OA 4X3MA 5GAPK 1IPAA 3NMUC 1VQPF 1VQNF 1Q7YH 1PXWA 1CN7A 3JCMM 1KD1H 3CC7F 1W3EX 3LWRC 5FLXM 5A2QM 3CCLF 1Q82H 1Q81H 3HJWC 3CD6F 1E7KA 4X3LA 2HVYD 1W40A 3PAFA 3V7EA 5IT9M 1VQMF 2OZBA 3LWPC 3IR9A 2VGMA 3CG6A 2OTLF 1SDSA 3JAMM 2QI2A 4BY9D 3CC4F 3LWVC 1VQ6F 1VQ9F 1W2BF 1VQ8F 2OTJF 2KTVA 1VQ4F 3MCAB 3OBYA 2KG4A 1VQLF 3NK7A 4LCKA 2AIFA 3FFMA 3CXCF 5EWRA 3J80M 1M90H 3RA6A 1M1KH 1YJ9F 2WALA 1W42A 3N4YA 1GO1A 3I55F 3OW2F 5EO3A 3J81M 5G4UC 3G71F 1X7PA 3HAXD 3N4ZA 3VI6A 3CCJF 5GIOC 3OBWA 5GINC 1K9MH 1Q86H 1VQ7F 2OHWA 1W41A 1VQKF 1YJWF 5G4VC 2FC3A 3CMAF 1JJ2F 1KQSF 1N8RH 2I6DA 3CCSF 3V7QA 3NK6A 2KTUA 2VGNA 2QEXF 1T0KB 5GIPC 1KC8H 3SIUA 5DCVA 1CK2A 3WXMB
chains in the Genus database with same CATH superfamily
1W5FA 2OTMA 1KNJA 3CCVF 3L7QA 1S72F 3ZOPA 3CPWF 4C4WC 1CLIA 3VMFB 3IKFA 4O4JA 1VQ5F 3ON1A 3LFOA 1YHQF 4HNAB 2RB9A 1FNKA 1VK3A 5KX5A 1TUBB 1W55A 3CB2A 3CYPB 1NQ3A 2MQEA 1DT9A 3C8LA 4TV9A 3CC2F 1IV2A 2HP3A 4C8GA 4KWEA 4O4IB 3IEQA 2BTQB 5J2UA 2CZWA 3JALB 2BO1A 5LP6C 2ZOVA 3VOBA 2G9IA 3G6EF 4I55B 5JH7A 1W5AA 1YJNF 3F0FA 5LXTA 2B33A 3MCQA 4FFBB 1GZ0A 3P10A 4RHAA 5EIBD 3WGJA 2UYJA 1XHOA 2GVIA 3FD5A 1YITF 4O2AB 4DRXB 2VAMA 3WGKA 2UYPA 1VQPF 2GZLA 5LP6B 2CWJA 5J2TB 1W5BA 2V9YA 3KJJA 3HKDB 5BMVB 4EB6B 5A2QM 1COMA 4U3JA 2QTPA 4BVRA 2L26A 3CD6F 3GTZA 1E7KA 4X3LA 2GLZA 4YJ3B 1Z5WA 1SA0B 1W40A 3OONA 1W57A 5IT9M 2H8EA 4BT4A 2H6LA 3CG6A 3ELCA 1XV2A 3QTYA 2OTLF 1SDSA 1FSZA 3JAMM 4BY9D 3LWVC 1ONIA 1X25A 2DT4A 2KGWA 2IQQA 2KTVA 3VCZA 3MCAB 5FNVB 4BT5A 3E22B 4U39A 5JQGB 1QD9A 1JFFA 4LCKA 3K12A 5CA1B 3JAWA 3LMEA 5LA6A 4O4LB 5CA0B 5CB4A 3FBAA 3I55F 4IHJA 3I7TA 5HY1A 3G71F 2PMPA 4IIJA 4TV8B 3TD3A 1K9MH 1VH8A 1Q86H 2OHWA 1YJWF 4I4TB 2HP0B 3P4EA 3JARB 1N8RH 2CW4A 2I6DA 2Z01A 4HNAA 3D00A 5MN4A 1TUBA 2CSLA 4LNUB 3VYUC 4ZI7B 5ITZB 2QEXF 1KC8H 1CK2A 3WXMB 2UYNB 4F6RB 2HRUA 4O4IA 2ZVZA 1W59A 3LWQC 1IV3A 3N2GA 2W8BC 3JALA 4X20B 2QA4F 3KE1A 1ZWZA 2HS0A 4XCQA 1W581 2DYYA 3CPQA 5IJ0B 5HXZA 3SIVA 4FFBA 3TD4A 3GHZA 3HKCB 4TUYB 2Q1XA 3NVKE 3E20B 4B46A 2ZAUA 2HS4A 1NMUB 4DRXA 3S03A 3RYHA 4BVSA 1VQVA 3T80A 5LP6A 5J2TA 1H47A 2CVLA 3J7AR 4B5CA 3HKEB 3HKDA 4EB6A 3WGMA 5HY0A 5EIBC 2HRYA 3ZP7A 3K14A 3S02A 3I3FA 4BT7A 4EI9A 1SA0A 3D54A 4NWOB 4X3MA 5GAPK 1IPAA 3JASA 3NMUC 1VQNF 5B8FA 3M4SA 1W3EX 3N2KB 3CCLF 3DDNA 4WBNB 3KHNA 5HP8A 5JVDB 1Q81H 3HJWC 1JY8A 2PHNA 5FNVA 3E22A 3JATB 2OZBA 3C9UA 5JQGA 4C82A 3RYFB 1FNJA 2VGMA 3IEWA 2QI2A 3F0EA 5CA1A 3CC4F 4DXDA 4PWTA 1W2BF 3RYCA 3K2XA 2OTJF 2IG8A 4TV8A 3S06A 1VQLF 2HS3A 4X1IB 2NMUA 3NK7A 4E6EA 2HP0A 3S0WA 4G88A 3JARA 5EAZA 3CXCF 5EWRA 1YQNA 3D01A 3VOAA 1YJ9F 4LNUA 2WALA 1W42A 4ZI7A 4X1YB 3J81M 3S0YA 3HAXD 2UYNA 1TVKB 2IAFA 2Q1YA 4O4HA 5GINC 1VQKF 3VYSC 1RQ2A 3JAKA 3ESJA 3M1XA 4ZHQB 3S0HA 3NK6A 4ERHA 4G4XA 2VGNA 5IJ0A 3C9SA 2R6R1 5LYJB 5EYPB 4I50B 5DCVA 1VQ9F 1FFXB 3AGKA 3HKCA 5EZYB 1KNKA 4BT3A 4TUYA 1H7MA 4BT6A 3HKBB 2ALEA 4TV9B 5LOVA 4EI8A 1QAHA 3ZP4A 2F9ZC 5EB0A 3GYQA 3M84A 3EORA 4M8IA 3CCQF 4G4ZA 2UZHA 4ZHWA 5IJ9B 3O85A 1XRGA 3WPWA 5JH7B 3E1YA 5MN5A 1QVGF 1Q8RA 2HX0A 3HKEA 3TD5A 3C9RA 1QU9A 1QVFF 3VO8A 4TZZA 1Z5VA 4NUTA 5JCOC 1NJIH 3V4DA 1GX1A 1RLGA 2Z1TA 4YJ2B 4ZK7A 2VXYA 3V3TA 3LWOC 4WBNA 5JVDA 4I55A 1ODEA 1RQ7A 3RYIB 3VIUA 4X1KB 3UT5B 3QUWA 3RYFA 1Q7YH 1PXWA 1CN7A 1KD1H 3CC7F 2N48A 3LWRC 4NQ3A 5AVMA 4B45A 4O2AA 3MDOA 2ZODA 2Z1UA 5MN6A 3F0DA 3PAFA 3RE3A 3VTIC 4BT2A 4O2BB 4ZOLB 5BMVA 1PF5A 3HTNA 2YYEA 1JFFB 2I6RA 4C8IA 4YJ3A 3WGLA 3JAWB 4X1YA 5LA6B 4BVQA 3HWUA 4EI7A 4G4WA 3OBYA 5IYZB 2RHOA 1U3LA 4RQOA 4B62A 4IIJB 4C81A 3FFMA 3QHDA 2RHLA 4ZHQA 1M90H 3RA6A 1M1KH 4G4YA 3WJQA 5G4UC 1GO1A 5EO3A 5LYJA 5EYPA 2RHHA 4I50A 5KMGB 2UYKA 1FFXA 1X7PA 3U0OA 5EZYA 2H8CA 3CCJF 3HKBA 3OBWA 1W41A 2K1SA 3F6MA 3LDTA 5G4VC 3CMAF 1KQSF 4O4LA 5CA0A 3MBMA 2HQSC 3V7QA 3N2GB 4ZHYB 2KTUA 5EB1B 3WGNA 5C8YB 5IJ9A 3IKEA 3LYBA 4I4TA 2LBWA 5GONB 2VAWA 2LCAA 1UFYA 1OAPA 3DC2A 3RA5A 3FPIA 3I56F 3CCRF 3Q8HA 5ITZA 3ERNA 3R0PA 3WJPA 1SZQA 1X52A 2LBXA 1K73H 3PLAC 4F6RA 1RA4A 4C8EA 4YJ2A 3IMPA 3JVHA 3CCMF 3RYHB 3CCUF 5HXUA 1J7HA 3NVIB 2CHTA 4X20A 2ZF8A 1VQOF 1YGYA 4BW0B 3C9TA 4ZHVA 4O4JB 3RYIA 3CCEF 1YIJF 5FJ4C 5HP7A 1JD1A 2JNBA 4BVTA 4X1KA 3UT5A 1JN1A 5KX5B 2LBTA 1U3PA 3JASB 2BTOA 5JCOA 1YI2F 1K8AH 1IV1A 1XBIA 5GANK 3CMEF 5J2UB 1GO0A 5HY2A 2VAPA 3G4SF 1DBFA 1X7OA 3K0TA 3P0ZA 4O2BA 2YXZA 3CYQA 4ZOLA 3F0GA 5LXTB 3BYQA 2P6YA 1VHAA 3JCMM 5FLXM 1Q82H 3VYTC 1T0AA 2ZVYA 1R1MA 2HVYD 1W5EA 5IYZA 3V7EA 1VQMF 3RYCB 3LWPC 2CHSA 3N2KA 2Z1FA 3IR9A 3WJRA 2FGYA 5HWEA 1VQ6F 2BTUA 4U3JB 3MQWA 2EWCA 1OFUA 3JATA 1VQ8F 5KMGA 1RLUA 1VQ4F 1UI9A 4R40B 2KG4A 4G4VA 3ZO8A 2AIFA 1U40A 4O4HB 3WPXA 1IV4A 3J80M 3KIZA 2R751 2AMTA 3JAKB 5C8YA 2RHJA 1U43A 3OW2F 3N4YA 3FD6A 4X1IA 3N4ZA 3B6NA 3VI6A 5GONA 5GIOC 1VQ7F 2FC3A 1JJ2F 5LOVB 3CCSF 2Z1EA 5HY4A 3KJKA 2AIZP 1TVKA 5CB4B 5GIPC 1T0KB 3SIUA 4IHJB 1H48A
chains in the Genus database with same CATH topology
3AGKA 2LBWA 1H7MA 3CCVF 2ALEA 1S72F 4EI8A 3LWQC 3CPWF 2F9ZC 4C4WC 3RA5A 3VMFB 3I56F 3CCRF 1VQ5F 3ON1A 2QA4F 3LFOA 3GYQA 1YHQF 1ZWZA 3CCQF 1X52A 2LBXA 4XCQA 3CPQA 1K73H 3PLAC 1RA4A 3O85A 1QVGF 5HXZA 1DT9A 3E1YA 3SIVA 3CCMF 3CCUF 5HXUA 3CC2F 3NVIB 3NVKE 1QVFF 3E20B 2CZWA 4TZZA 1VQOF 2BO1A 4BW0B 4NUTA 3CCEF 1YIJF 5FJ4C 3G6EF 1NMUB 2JNBA 4BVTA 1NJIH 1YJNF 4BVSA 1RLGA 3J7AR 3V3TA 3LWOC 1GZ0A 1YI2F 1K8AH 5HY0A 1XBIA 5GANK 3CMEF 1GO0A 5HY2A 4EI9A 3G4SF 1YITF 1X7OA 4X3MA 5GAPK 1IPAA 3NMUC 1VQPF 1VQNF 1Q7YH 1PXWA 1CN7A 3JCMM 1KD1H 3CC7F 1W3EX 3LWRC 4NQ3A 5FLXM 5A2QM 3CCLF 1Q82H 1Q81H 3HJWC 4BVRA 3CD6F 1E7KA 4X3LA 2GLZA 2HVYD 1W40A 3PAFA 3V7EA 5IT9M 1VQMF 2OZBA 3LWPC 3IR9A 2VGMA 3CG6A 2OTLF 1SDSA 2FGYA 3JAMM 2QI2A 5HWEA 3CC4F 4BY9D 3LWVC 1VQ6F 1VQ9F 1W2BF 4BVQA 1VQ8F 2OTJF 2KTVA 1VQ4F 4EI7A 3MCAB 3OBYA 2KG4A 1VQLF 3NK7A 4LCKA 2AIFA 3FFMA 3CXCF 5EWRA 3J80M 1M90H 3RA6A 1M1KH 1YJ9F 2WALA 1W42A 3N4YA 1GO1A 3I55F 3OW2F 5EO3A 3J81M 5G4UC 5HY1A 3G71F 1X7PA 3HAXD 3N4ZA 3VI6A 3CCJF 5GIOC 3OBWA 5GINC 1K9MH 1Q86H 1VQ7F 2OHWA 1W41A 1VQKF 1YJWF 5G4VC 2FC3A 3CMAF 1JJ2F 1KQSF 1N8RH 2I6DA 3CCSF 3V7QA 3NK6A 3D00A 2KTUA 5HY4A 2VGNA 2QEXF 1T0KB 5GIPC 1KC8H 3SIUA 5DCVA 1CK2A 3WXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGK A;  2LBW A;  1H7M A;  3CCV F;  2ALE A;  1S72 F;  3LWQ C;  3CPW F;  4C4W C;  3RA5 A;  3VMF B;  3I56 F;  3CCR F;  1VQ5 F;  3ON1 A;  2QA4 F;  3LFO A;  3GYQ A;  1YHQ F;  1ZWZ A;  3CCQ F;  1X52 A;  2LBX A;  1K73 H;  3CPQ A;  3PLA C;  1RA4 A;  3O85 A;  1QVG F;  1DT9 A;  3E1Y A;  3SIV A;  3CCM F;  3CCU F;  3CC2 F;  3NVI B;  3NVK E;  1QVF F;  3E20 B;  2CZW A;  4TZZ A;  1VQO F;  2BO1 A;  4BW0 B;  4NUT A;  3CCE F;  1YIJ F;  5FJ4 C;  3G6E F;  1NMU B;  2JNB A;  1NJI H;  1YJN F;  1RLG A;  3J7A R;  3LWO C;  1GZ0 A;  1YI2 F;  1K8A H;  1XBI A;  5GAN K;  3CME F;  1GO0 A;  3G4S F;  1YIT F;  1X7O A;  4X3M A;  5GAP K;  1IPA A;  3NMU C;  1VQP F;  1VQN F;  1Q7Y H;  1PXW A;  1CN7 A;  3JCM M;  1KD1 H;  3CC7 F;  1W3E X;  3LWR C;  5FLX M;  5A2Q M;  3CCL F;  1Q82 H;  1Q81 H;  3HJW C;  3CD6 F;  1E7K A;  4X3L A;  2HVY D;  1W40 A;  3PAF A;  3V7E A;  5IT9 M;  1VQM F;  2OZB A;  3LWP C;  3IR9 A;  2VGM A;  3CG6 A;  2OTL F;  1SDS A;  3JAM M;  2QI2 A;  4BY9 D;  3CC4 F;  3LWV C;  1VQ6 F;  1VQ9 F;  1W2B F;  1VQ8 F;  2OTJ F;  2KTV A;  1VQ4 F;  3MCA B;  3OBY A;  2KG4 A;  1VQL F;  3NK7 A;  4LCK A;  2AIF A;  3FFM A;  3CXC F;  5EWR A;  3J80 M;  1M90 H;  3RA6 A;  1M1K H;  1YJ9 F;  2WAL A;  1W42 A;  3N4Y A;  1GO1 A;  3I55 F;  3OW2 F;  5EO3 A;  3J81 M;  5G4U C;  3G71 F;  1X7P A;  3HAX D;  3N4Z A;  3VI6 A;  3CCJ F;  5GIO C;  3OBW A;  5GIN C;  1K9M H;  1Q86 H;  1VQ7 F;  2OHW A;  1W41 A;  1VQK F;  1YJW F;  5G4V C;  2FC3 A;  3CMA F;  1JJ2 F;  1KQS F;  1N8R H;  2I6D A;  3CCS F;  3V7Q A;  3NK6 A;  2KTU A;  2VGN A;  2QEX F;  1T0K B;  5GIP C;  1KC8 H;  3SIU A;  5DCV A;  1CK2 A;  3WXM B; 
#chains in the Genus database with same CATH topology
 1W5F A;  2OTM A;  1KNJ A;  3CCV F;  3L7Q A;  1S72 F;  3ZOP A;  3CPW F;  4C4W C;  1CLI A;  3VMF B;  3IKF A;  4O4J A;  1VQ5 F;  3ON1 A;  3LFO A;  1YHQ F;  4HNA B;  2RB9 A;  1FNK A;  1VK3 A;  5KX5 A;  1TUB B;  1W55 A;  3CB2 A;  3CYP B;  1NQ3 A;  2MQE A;  1DT9 A;  3C8L A;  4TV9 A;  3CC2 F;  1IV2 A;  2HP3 A;  4C8G A;  4KWE A;  4O4I B;  3IEQ A;  2BTQ B;  5J2U A;  2CZW A;  3JAL B;  2BO1 A;  5LP6 C;  2ZOV A;  3VOB A;  2G9I A;  3G6E F;  4I55 B;  5JH7 A;  1W5A A;  1YJN F;  3F0F A;  5LXT A;  2B33 A;  3MCQ A;  4FFB B;  1GZ0 A;  3P10 A;  4RHA A;  5EIB D;  3WGJ A;  2UYJ A;  1XHO A;  2GVI A;  3FD5 A;  1YIT F;  4O2A B;  4DRX B;  2VAM A;  3WGK A;  2UYP A;  1VQP F;  2GZL A;  5LP6 B;  2CWJ A;  5J2T B;  1W5B A;  2V9Y A;  3KJJ A;  3HKD B;  5BMV B;  4EB6 B;  5A2Q M;  1COM A;  4U3J A;  2QTP A;  4BVR A;  2L26 A;  3CD6 F;  3GTZ A;  1E7K A;  4X3L A;  2GLZ A;  4YJ3 B;  1Z5W A;  1SA0 B;  1W40 A;  3OON A;  1W57 A;  5IT9 M;  2H8E A;  4BT4 A;  2H6L A;  3CG6 A;  3ELC A;  1XV2 A;  3QTY A;  2OTL F;  1SDS A;  1FSZ A;  3JAM M;  4BY9 D;  3LWV C;  1ONI A;  1X25 A;  2DT4 A;  2KGW A;  2IQQ A;  2KTV A;  3VCZ A;  3MCA B;  5FNV B;  4BT5 A;  3E22 B;  4U39 A;  5JQG B;  1QD9 A;  1JFF A;  4LCK A;  3K12 A;  5CA1 B;  3JAW A;  3LME A;  5LA6 A;  4O4L B;  5CA0 B;  5CB4 A;  3FBA A;  3I55 F;  4IHJ A;  3I7T A;  5HY1 A;  3G71 F;  2PMP A;  4IIJ A;  4TV8 B;  3TD3 A;  1K9M H;  1VH8 A;  1Q86 H;  2OHW A;  1YJW F;  4I4T B;  2HP0 B;  3P4E A;  3JAR B;  1N8R H;  2CW4 A;  2I6D A;  2Z01 A;  4HNA A;  3D00 A;  5MN4 A;  1TUB A;  2CSL A;  4LNU B;  3VYU C;  4ZI7 B;  5ITZ B;  2QEX F;  1KC8 H;  1CK2 A;  3WXM B;  2UYN B;  4F6R B;  2HRU A;  4O4I A;  2ZVZ A;  1W59 A;  3LWQ C;  1IV3 A;  3N2G A;  2W8B C;  3JAL A;  4X20 B;  2QA4 F;  3KE1 A;  1ZWZ A;  2HS0 A;  4XCQ A;  1W58 1;  2DYY A;  3CPQ A;  5IJ0 B;  5HXZ A;  3SIV A;  4FFB A;  3TD4 A;  3GHZ A;  3HKC B;  4TUY B;  2Q1X A;  3NVK E;  3E20 B;  4B46 A;  2ZAU A;  2HS4 A;  1NMU B;  4DRX A;  3S03 A;  3RYH A;  4BVS A;  1VQV A;  3T80 A;  5LP6 A;  5J2T A;  1H47 A;  2CVL A;  3J7A R;  4B5C A;  3HKE B;  3HKD A;  4EB6 A;  3WGM A;  5HY0 A;  5EIB C;  2HRY A;  3ZP7 A;  3K14 A;  3S02 A;  3I3F A;  4BT7 A;  4EI9 A;  1SA0 A;  3D54 A;  4NWO B;  4X3M A;  5GAP K;  1IPA A;  3JAS A;  3NMU C;  1VQN F;  5B8F A;  3M4S A;  1W3E X;  3N2K B;  3CCL F;  3DDN A;  4WBN B;  3KHN A;  5HP8 A;  5JVD B;  1Q81 H;  3HJW C;  1JY8 A;  2PHN A;  5FNV A;  3E22 A;  3JAT B;  2OZB A;  3C9U A;  5JQG A;  4C82 A;  3RYF B;  1FNJ A;  2VGM A;  3IEW A;  2QI2 A;  3F0E A;  5CA1 A;  3CC4 F;  4DXD A;  4PWT A;  1W2B F;  3RYC A;  3K2X A;  2OTJ F;  2IG8 A;  4TV8 A;  3S06 A;  1VQL F;  2HS3 A;  4X1I B;  2NMU A;  3NK7 A;  4E6E A;  2HP0 A;  3S0W A;  4G88 A;  3JAR A;  5EAZ A;  3CXC F;  5EWR A;  1YQN A;  3D01 A;  3VOA A;  1YJ9 F;  4LNU A;  2WAL A;  1W42 A;  4ZI7 A;  4X1Y B;  3J81 M;  3S0Y A;  3HAX D;  2UYN A;  1TVK B;  2IAF A;  2Q1Y A;  4O4H A;  5GIN C;  1VQK F;  3VYS C;  1RQ2 A;  3JAK A;  3ESJ A;  3M1X A;  4ZHQ B;  3S0H A;  3NK6 A;  4ERH A;  4G4X A;  2VGN A;  5IJ0 A;  3C9S A;  2R6R 1;  5LYJ B;  5EYP B;  4I50 B;  5DCV A;  1VQ9 F;  1FFX B;  3AGK A;  3HKC A;  5EZY B;  1KNK A;  4BT3 A;  4TUY A;  1H7M A;  4BT6 A;  3HKB B;  2ALE A;  4TV9 B;  5LOV A;  4EI8 A;  1QAH A;  3ZP4 A;  2F9Z C;  5EB0 A;  3GYQ A;  3M84 A;  3EOR A;  4M8I A;  3CCQ F;  4G4Z A;  2UZH A;  4ZHW A;  5IJ9 B;  3O85 A;  1XRG A;  3WPW A;  5JH7 B;  3E1Y A;  5MN5 A;  1QVG F;  1Q8R A;  2HX0 A;  3HKE A;  3TD5 A;  3C9R A;  1QU9 A;  1QVF F;  3VO8 A;  4TZZ A;  1Z5V A;  4NUT A;  5JCO C;  1NJI H;  3V4D A;  1GX1 A;  1RLG A;  2Z1T A;  4YJ2 B;  4ZK7 A;  2VXY A;  3V3T A;  3LWO C;  4WBN A;  5JVD A;  4I55 A;  1ODE A;  1RQ7 A;  3RYI B;  3VIU A;  4X1K B;  3UT5 B;  3QUW A;  3RYF A;  1Q7Y H;  1PXW A;  1CN7 A;  1KD1 H;  3CC7 F;  2N48 A;  3LWR C;  4NQ3 A;  5AVM A;  4B45 A;  4O2A A;  3MDO A;  2ZOD A;  2Z1U A;  5MN6 A;  3F0D A;  3PAF A;  3RE3 A;  3VTI C;  4BT2 A;  4O2B B;  4ZOL B;  5BMV A;  1PF5 A;  3HTN A;  2YYE A;  1JFF B;  2I6R A;  4C8I A;  4YJ3 A;  3WGL A;  3JAW B;  4X1Y A;  5LA6 B;  4BVQ A;  3HWU A;  4EI7 A;  4G4W A;  3OBY A;  5IYZ B;  2RHO A;  1U3L A;  4RQO A;  4B62 A;  4IIJ B;  4C81 A;  3FFM A;  3QHD A;  2RHL A;  4ZHQ A;  1M90 H;  3RA6 A;  1M1K H;  4G4Y A;  3WJQ A;  5G4U C;  1GO1 A;  5EO3 A;  5LYJ A;  5EYP A;  2RHH A;  4I50 A;  5KMG B;  2UYK A;  1FFX A;  1X7P A;  3U0O A;  5EZY A;  2H8C A;  3CCJ F;  3HKB A;  3OBW A;  1W41 A;  2K1S A;  3F6M A;  3LDT A;  5G4V C;  3CMA F;  1KQS F;  4O4L A;  5CA0 A;  3MBM A;  2HQS C;  3V7Q A;  3N2G B;  4ZHY B;  2KTU A;  5EB1 B;  3WGN A;  5C8Y B;  5IJ9 A;  3IKE A;  3LYB A;  4I4T A;  2LBW A;  5GON B;  2VAW A;  2LCA A;  1UFY A;  1OAP A;  3DC2 A;  3RA5 A;  3FPI A;  3I56 F;  3CCR F;  3Q8H A;  5ITZ A;  3ERN A;  3R0P A;  3WJP A;  1SZQ A;  1X52 A;  2LBX A;  1K73 H;  3PLA C;  4F6R A;  1RA4 A;  4C8E A;  4YJ2 A;  3IMP A;  3JVH A;  3CCM F;  3RYH B;  3CCU F;  5HXU A;  1J7H A;  3NVI B;  2CHT A;  4X20 A;  2ZF8 A;  1VQO F;  1YGY A;  4BW0 B;  3C9T A;  4ZHV A;  4O4J B;  3RYI A;  3CCE F;  1YIJ F;  5FJ4 C;  5HP7 A;  1JD1 A;  2JNB A;  4BVT A;  4X1K A;  3UT5 A;  1JN1 A;  5KX5 B;  2LBT A;  1U3P A;  3JAS B;  2BTO A;  5JCO A;  1YI2 F;  1K8A H;  1IV1 A;  1XBI A;  5GAN K;  3CME F;  5J2U B;  1GO0 A;  5HY2 A;  2VAP A;  3G4S F;  1DBF A;  1X7O A;  3K0T A;  3P0Z A;  4O2B A;  2YXZ A;  3CYQ A;  4ZOL A;  3F0G A;  5LXT B;  3BYQ A;  2P6Y A;  1VHA A;  3JCM M;  5FLX M;  1Q82 H;  3VYT C;  1T0A A;  2ZVY A;  1R1M A;  2HVY D;  1W5E A;  5IYZ A;  3V7E A;  1VQM F;  3RYC B;  3LWP C;  2CHS A;  3N2K A;  2Z1F A;  3IR9 A;  3WJR A;  2FGY A;  5HWE A;  1VQ6 F;  2BTU A;  4U3J B;  3MQW A;  2EWC A;  1OFU A;  3JAT A;  1VQ8 F;  5KMG A;  1RLU A;  1VQ4 F;  1UI9 A;  4R40 B;  2KG4 A;  4G4V A;  3ZO8 A;  2AIF A;  1U40 A;  4O4H B;  3WPX A;  1IV4 A;  3J80 M;  3KIZ A;  2R75 1;  2AMT A;  3JAK B;  5C8Y A;  2RHJ A;  1U43 A;  3OW2 F;  3N4Y A;  3FD6 A;  4X1I A;  3N4Z A;  3B6N A;  3VI6 A;  5GON A;  5GIO C;  1VQ7 F;  2FC3 A;  1JJ2 F;  5LOV B;  3CCS F;  2Z1E A;  5HY4 A;  3KJK A;  2AIZ P;  1TVK A;  5CB4 B;  5GIP C;  1T0K B;  3SIU A;  4IHJ B;  1H48 A; 
#chains in the Genus database with same CATH homology
 3AGK A;  2LBW A;  1H7M A;  3CCV F;  2ALE A;  1S72 F;  4EI8 A;  3LWQ C;  3CPW F;  2F9Z C;  4C4W C;  3RA5 A;  3VMF B;  3I56 F;  3CCR F;  1VQ5 F;  3ON1 A;  2QA4 F;  3LFO A;  3GYQ A;  1YHQ F;  1ZWZ A;  3CCQ F;  1X52 A;  2LBX A;  4XCQ A;  3CPQ A;  1K73 H;  3PLA C;  1RA4 A;  3O85 A;  1QVG F;  5HXZ A;  1DT9 A;  3E1Y A;  3SIV A;  3CCM F;  3CCU F;  5HXU A;  3CC2 F;  3NVI B;  3NVK E;  1QVF F;  3E20 B;  2CZW A;  4TZZ A;  1VQO F;  2BO1 A;  4BW0 B;  4NUT A;  3CCE F;  1YIJ F;  5FJ4 C;  3G6E F;  1NMU B;  2JNB A;  4BVT A;  1NJI H;  1YJN F;  4BVS A;  1RLG A;  3J7A R;  3V3T A;  3LWO C;  1GZ0 A;  1YI2 F;  1K8A H;  5HY0 A;  1XBI A;  5GAN K;  3CME F;  1GO0 A;  5HY2 A;  4EI9 A;  3G4S F;  1YIT F;  1X7O A;  4X3M A;  5GAP K;  1IPA A;  3NMU C;  1VQP F;  1VQN F;  1Q7Y H;  1PXW A;  1CN7 A;  3JCM M;  1KD1 H;  3CC7 F;  1W3E X;  3LWR C;  4NQ3 A;  5FLX M;  5A2Q M;  3CCL F;  1Q82 H;  1Q81 H;  3HJW C;  4BVR A;  3CD6 F;  1E7K A;  4X3L A;  2GLZ A;  2HVY D;  1W40 A;  3PAF A;  3V7E A;  5IT9 M;  1VQM F;  2OZB A;  3LWP C;  3IR9 A;  2VGM A;  3CG6 A;  2OTL F;  1SDS A;  2FGY A;  3JAM M;  2QI2 A;  5HWE A;  3CC4 F;  4BY9 D;  3LWV C;  1VQ6 F;  1VQ9 F;  1W2B F;  4BVQ A;  1VQ8 F;  2OTJ F;  2KTV A;  1VQ4 F;  4EI7 A;  3MCA B;  3OBY A;  2KG4 A;  1VQL F;  3NK7 A;  4LCK A;  2AIF A;  3FFM A;  3CXC F;  5EWR A;  3J80 M;  1M90 H;  3RA6 A;  1M1K H;  1YJ9 F;  2WAL A;  1W42 A;  3N4Y A;  1GO1 A;  3I55 F;  3OW2 F;  5EO3 A;  3J81 M;  5G4U C;  5HY1 A;  3G71 F;  1X7P A;  3HAX D;  3N4Z A;  3VI6 A;  3CCJ F;  5GIO C;  3OBW A;  5GIN C;  1K9M H;  1Q86 H;  1VQ7 F;  2OHW A;  1W41 A;  1VQK F;  1YJW F;  5G4V C;  2FC3 A;  3CMA F;  1JJ2 F;  1KQS F;  1N8R H;  2I6D A;  3CCS F;  3V7Q A;  3NK6 A;  3D00 A;  2KTU A;  5HY4 A;  2VGN A;  2QEX F;  1T0K B;  5GIP C;  1KC8 H;  3SIU A;  5DCV A;  1CK2 A;  3WXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...