1H7MA

Ribosomal protein l30e from thermococcus celer
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
SVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESRILAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Crystal Structure of Ribosomal Protein L30E from the Extreme Thermophile Thermocccus Celer: Thermal Stability and RNA Binding
pubmed doi rcsb
source organism Thermococcus celer
total genus 31
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1h7mA00
2QEXF 1W41A 3J7AR 3RA6A 3CCSF 3V7EA 3FFMA 2ALEA 1K8AH 3CCVF 1N8RH 4LCKA 1W40A 1Q86H 3RA5A 3G6EF 4BY9D 3E20B 2HVYD 1QVFF 1IPAA 3CC4F 3PLAC 1VQ6F 1XBIA 5FLXM 1Q81H 2I6DA 5GINC 3CCUF 1K73H 3NVKE 1W3EX 2KTVA 3HJWC 3JCMM 2VGNA 1YJWF 3SIVA 3CXCF 1JJ2F 3NVIB 3LWPC 1VQ9F 1GZ0A 3CPWF 3CCMF 1VQ5F 3AGKA 3CG6A 1NMUB 1PXWA 3OW2F 3SIUA 3CMEF 1YJ9F 1YIJF 5DCVA 3GYQA 2OTLF 2QA4F 1E7KA 1YITF 3G4SF 3IR9A 5G4VC 2FC3A 3N4YA 3G71F 3MCAB 1SDSA 3CMAF 1VQMF 3LWOC 1KQSF 1ZWZA 2LBXA 5A2QM 1H7MA 3J81M 1RA4A 3CCEF 5EWRA 1X7PA 3VI6A 1VQLF 2KG4A 1K9MH 3CCRF 2CZWA 1RLGA 5GAPK 1CK2A 1Q82H 1X7OA 2OHWA 2WALA 2AIFA 1S72F 3CC7F 1KC8H 1M90H 1T0KB 1DT9A 3CD6F 1M1KH 3LWRC 2QI2A 1VQKF 2KTUA 3NK6A 4X3MA 1W42A 3NK7A 1VQOF 2BO1A 4TZZA 1GO1A 1W2BF 2VGMA 1YHQF 3OBYA 3WXMB 3NMUC 1CN7A 3CPQA 3CCJF 3PAFA 1YJNF 4C4WC 2OTJF 3I56F 3LFOA 3LWVC 1VQPF 2JNBA 1VQ8F 3ON1A 4X3LA 2LBWA 1KD1H 1YI2F 3JAMM 1Q7YH 3I55F 5GIOC 4NUTA 5EO3A 5GIPC 1NJIH 3HAXD 5IT9M 3E1YA 3OBWA 4BW0B 5G4UC 5FJ4C 3LWQC 3VMFB 3CC2F 3J80M 1X52A 3O85A 3V7QA 3N4ZA 3CCQF 1VQ7F 1VQNF 2OZBA 3CCLF 5GANK 1GO0A 1QVGF 1VQ4F
chains in the Genus database with same CATH superfamily
5IJ9A 3JARA 3IKEA 1Z5WA 3J7AR 3V7EA 4U3JB 3CCVF 1N8RH 4LCKA 3V4DA 2CVLA 3WGNA 3ZP7A 2IG8A 2ZF8A 3E20B 1QVFF 5KX5A 3DDNA 2Z01A 3CC4F 3UT5B 1VQ6F 5FLXM 2I6DA 5HP7A 1VH8A 5GONB 3JCMM 3WJRA 4U3JA 3M4SA 2P6YA 3HKCB 1CLIA 2VGNA 4O4LB 3VCZA 2ZVYA 1JJ2F 1QD9A 3LWPC 2UYKA 1VQ5F 3AGKA 1W5BA 2VAPA 1NMUB 3IEWA 4ERHA 4G4WA 3CMEF 4NQ3A 5C8YB 3R0PA 3IR9A 4O4LA 2FC3A 3C9UA 3N4YA 3KHNA 3TD4A 2DT4A 3CMAF 2H6LA 5JVDB 3S06A 1GO0A 1Q8RA 2H8CA 4O4HB 5EZYB 2EWCA 3D01A 3JAWB 1H7MA 1SA0A 1RA4A 2IAFA 2MQEA 3RYIA 4BT7A 3S03A 2HRYA 3CCEF 3WGKA 3MQWA 5C8YA 5MN5A 1RLGA 2Z1EA 5GAPK 1QAHA 5JVDA 4C8IA 5EZYA 2YYEA 2GLZA 3JAWA 2CW4A 3S0HA 1T0KB 3RYHB 3HKDB 1M1KH 2VXYA 3B6NA 3S0WA 4O2BB 3DC2A 2KTUA 4KWEA 4TZZA 4YJ3B 1W2BF 2VGMA 1YHQF 4I55A 1JN1A 3K2XA 1CN7A 5LA6B 3PAFA 1YJNF 4ZOLA 2OTJF 3C9RA 3LYBA 4RHAA 5ITZA 5HWEA 5EIBC 1VQ8F 1JD1A 2PMPA 4X3LA 1U3PA 3WPWA 4O2BA 5KMGA 3JAMM 4M8IA 2DYYA 4LNUB 4BT4A 2H8EA 4C8GA 3MBMA 2GZLA 4IHJB 4R40B 1W55A 3VIUA 4E6EA 3LWQC 3VMFB 3CC2F 2RHJA 3QUWA 4X20A 3V7QA 3N4ZA 2RHOA 3CCQF 1VQNF 1VQVA 1QVGF 3VOBA 1W41A 4LNUA 1YQNA 3HTNA 5HY1A 3JVHA 3FFMA 1PF5A 2ALEA 1K8AH 4BVRA 1YGYA 4O4IB 3F0FA 5IJ9B 3JARB 2HVYD 5CA1A 3T80A 5AVMA 5LP6A 1X25A 2HS3A 1W3EX 3C8LA 3IKFA 3M1XA 1YJWF 3SIVA 4EI8A 3S02A 3JAKB 1GZ0A 5BMVA 1PXWA 5DCVA 2QA4F 1E7KA 1YITF 1U3LA 1U43A 3ELCA 5JQGA 1IV4A 3G4SF 3LDTA 3WGJA 1KNJA 3G71F 3RYCA 3MCAB 3JAKA 1KQSF 1VQMF 2V9YA 1SDSA 1ZWZA 5A2QM 1COMA 3EORA 3K12A 3WGLA 4BT5A 1FSZA 5J2UB 2ZODA 3FD5A 1XV2A 1NQ3A 4XCQA 1KNKA 3IEQA 4ZI7A 1X7PA 3VI6A 3FD6A 4BT6A 2W8BC 2R6R1 3HKBA 1SA0B 3RYIB 5LYJB 3QHDA 4C82A 1Q82H 2WALA 4ZHQB 5J2UA 1KC8H 4X1KA 4G4VA 4WBNA 3JASB 2QI2A 2HQSC 2HX0A 5MN4A 1VQKF 3NK6A 3HWUA 3ERNA 3V3TA 1Z5VA 3GTZA 3OBYA 3NMUC 5LYJA 3CCJF 3F0DA 3S0YA 2Z1UA 2PHNA 3VYTC 5CA0A 4ZHQA 2KGWA 1W5AA 2HRUA 4ZHYB 3KE1A 4BVSA 3JASA 3ZO8A 4I55B 3ZP4A 2Q1YA 5EO3A 4ZOLB 1T0AA 3VOAA 5ITZB 1FFXB 3MDOA 4FFBA 3N2GB 4I4TA 3CYQA 5IJ0A 1X52A 3O85A 5KMGB 4G4YA 2OZBA 2NMUA 5GANK 4EI9A 5CB4B 2GVIA 1RQ7A 2QEXF 3HAXD 3CYPB 3ESJA 5LXTB 2AMTA 4X20B 1FFXA 4B46A 5JCOA 2LBTA 3F0GA 1W40A 1Q86H 3RA5A 4BY9D 3N2GA 4HNAA 3VYSC 4PWTA 3WPXA 2QTPA 1IPAA 3PLAC 3OONA 5CB4A 5HY2A 1Q81H 5GINC 1K73H 4NWOB 1TUBA 5LXTA 2UYJA 2RB9A 5LOVA 1W59A 5CA1B 2ZVZA 4DXDA 5LP6B 2LCAA 1OFUA 3M84A 1W57A 1VQ9F 2UZHA 4O4JA 3CG6A 2F9ZC 3SIUA 1YIJF 1U40A 3GYQA 2G9IA 3WJPA 3ZOPA 3MCQA 3F6MA 3IMPA 5G4VC 3JALB 4O2AB 3D00A 5BMVB 3JATA 4IIJA 3P0ZA 4C81A 2LBXA 2HS0A 5EAZA 4TUYA 4I50B 4YJ2B 3J81M 5JQGB 1XRGA 1ONIA 1VK3A 4X1YA 5EWRA 1RQ2A 3RYCB 1VQLF 2KG4A 1K9MH 3JALA 4O2AA 1TVKA 1OAPA 3D54A 3Q8HA 3TD3A 3N2KB 1X7OA 2OHWA 2YXZA 4ZHVA 4ZI7B 4I50A 4YJ2A 1IV2A 3CC7F 1M90H 1DBFA 4ZHWA 5HXUA 3LWRC 1FNJA 3RE3A 1W5FA 3CB2A 3HKBB 4X3MA 1RLUA 5FNVA 3LMEA 4TV9B 2ZOVA 3NK7A 2I6RA 3VO8A 2CHTA 2UYNB 4X1IB 3KIZA 3C9TA 3K14A 4X1KB 3N2KA 1H47A 5EB1B 2Z1TA 4WBNB 3F0EA 5HXZA 3LFOA 2K1SA 3P10A 5HY0A 3KJJA 3VYUC 4BVQA 1YI2F 1UFYA 2VAMA 4DRXA 1Q7YH 1H48A 1IV3A 1SZQA 4TV9A 3E22B 4EI7A 5GIOC 5GIPC 3BYQA 2UYNA 4X1IA 1NJIH 3E1YA 3HKEB 3K0TA 3P4EA 2HS4A 3OBWA 5CA0B 4BW0B 2HP0B 4BT2A 5B8FA 2BTOA 2RHHA 3J80M 3WGMA 2CHSA 4B45A 1VQ7F 2R751 3FBAA 3CCLF 3GHZA 3I7TA 1VQ4F 2AIZP 3RA6A 3CCSF 3E22A 5EIBD 4G88A 4FFBB 3UT5A 1GX1A 3HKEA 4I4TB 5IJ0B 4BT3A 2HP0A 2UYPA 5GONA 2FGYA 3G6EF 4B62A 2RHLA 2Q1XA 3FPIA 3HKCA 3VTIC 1XBIA 5J2TB 4TV8B 4U39A 5EB0A 3CCUF 3NVKE 2KTVA 3HJWC 4HNAB 5JCOC 4F6RB 1IV1A 3CXCF 3NVIB 1TUBB 3CPWF 3CCMF 1VHAA 2Z1FA 5HY4A 4TV8A 5J2TA 3OW2F 5JH7B 5LOVB 1YJ9F 2CWJA 2L26A 4O4HA 5EYPB 2OTLF 4F6RA 2BTUA 3I3FA 1JY8A 4O4JB 4C8EA 5IYZB 3LWOC 4B5CA 4EB6B 1XHOA 5MN6A 1JFFB 5JH7A 1FNKA 2CSLA 5EYPA 1W581 2B33A 3JATB 2HP3A 4IIJB 3RYHA 3HKDA 1UI9A 3CCRF 2CZWA 5LP6C 4TUYB 5IYZA 1QU9A 1CK2A 5HP8A 2ZAUA 4X1YB 2VAWA 3L7QA 4YJ3A 3U0OA 4EB6A 2OTMA 2AIFA 1JFFA 1S72F 1DT9A 3CD6F 5LA6A 1TVKB 3WJQA 1W42A 1W5EA 3KJKA 1VQOF 2BO1A 4G4XA 1GO1A 3RYFB 1R1MA 3WXMB 3QTYA 3CPQA 4BVTA 2N48A 4IHJA 4C4WC 3I56F 3LWVC 1VQPF 2IQQA 5FNVB 1J7HA 2JNBA 4G4ZA 3ON1A 2LBWA 1KD1H 2BTQB 3I55F 1ODEA 4ZK7A 4NUTA 3C9SA 5IT9M 3RYFA 5G4UC 5FJ4C 4RQOA 4DRXB 5KX5B 4O4IA 3TD5A
chains in the Genus database with same CATH topology
2QEXF 1W41A 3J7AR 3RA6A 5HY1A 3CCSF 3V7EA 3FFMA 2ALEA 1K8AH 3CCVF 4BVRA 1N8RH 4LCKA 1W40A 1Q86H 2FGYA 3RA5A 3G6EF 4BY9D 3E20B 2HVYD 1QVFF 1IPAA 3CC4F 3PLAC 1VQ6F 1XBIA 5FLXM 5HY2A 1Q81H 2I6DA 5GINC 3CCUF 1K73H 3NVKE 1W3EX 2KTVA 3HJWC 3JCMM 2VGNA 1YJWF 3SIVA 4EI8A 3CXCF 1JJ2F 3NVIB 3LWPC 1VQ9F 1GZ0A 3CPWF 3CCMF 1VQ5F 3AGKA 3CG6A 1NMUB 2F9ZC 1PXWA 5HY4A 3OW2F 3SIUA 3CMEF 1YJ9F 1YIJF 5DCVA 3GYQA 2OTLF 4NQ3A 2QA4F 1E7KA 1YITF 3G4SF 3IR9A 5G4VC 3D00A 2FC3A 3N4YA 3G71F 3MCAB 1SDSA 3CMAF 1VQMF 3LWOC 1KQSF 1ZWZA 2LBXA 5A2QM 1H7MA 3J81M 1RA4A 3CCEF 4XCQA 5EWRA 1X7PA 3VI6A 1VQLF 2KG4A 1K9MH 3CCRF 2CZWA 1RLGA 5GAPK 1CK2A 1Q82H 1X7OA 2OHWA 2WALA 2AIFA 1S72F 2GLZA 3CC7F 1KC8H 1M90H 1T0KB 1DT9A 3CD6F 5HXUA 1M1KH 3LWRC 2QI2A 1VQKF 2KTUA 3NK6A 4X3MA 1W42A 3NK7A 1VQOF 2BO1A 4TZZA 1GO1A 1W2BF 3V3TA 2VGMA 1YHQF 3OBYA 3WXMB 1QVGF 3NMUC 1CN7A 3CPQA 4BVTA 3CCJF 3PAFA 1YJNF 4C4WC 2OTJF 3I56F 5HXZA 3LFOA 3LWVC 5HWEA 1VQPF 5HY0A 2JNBA 1VQ8F 3ON1A 4X3LA 2LBWA 4BVQA 4BVSA 1KD1H 1YI2F 3JAMM 1Q7YH 3I55F 4EI7A 5GIOC 4NUTA 5EO3A 5GIPC 1NJIH 3HAXD 5IT9M 3E1YA 3OBWA 4BW0B 5G4UC 5FJ4C 3LWQC 3VMFB 3CC2F 3J80M 1X52A 3O85A 3V7QA 3N4ZA 3CCQF 1VQ7F 1VQNF 2OZBA 3CCLF 5GANK 1GO0A 4EI9A 1VQ4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX F;  1W41 A;  3J7A R;  3RA6 A;  3CCS F;  3V7E A;  3FFM A;  2ALE A;  1K8A H;  3CCV F;  1N8R H;  4LCK A;  1W40 A;  1Q86 H;  3RA5 A;  3G6E F;  4BY9 D;  3E20 B;  2HVY D;  1QVF F;  1IPA A;  3CC4 F;  3PLA C;  1VQ6 F;  1XBI A;  5FLX M;  1Q81 H;  2I6D A;  5GIN C;  3CCU F;  1K73 H;  3NVK E;  1W3E X;  2KTV A;  3HJW C;  3JCM M;  2VGN A;  1YJW F;  3SIV A;  3CXC F;  1JJ2 F;  3NVI B;  3LWP C;  1VQ9 F;  1GZ0 A;  3CPW F;  3CCM F;  1VQ5 F;  3AGK A;  3CG6 A;  1NMU B;  1PXW A;  3OW2 F;  3SIU A;  3CME F;  1YJ9 F;  1YIJ F;  5DCV A;  3GYQ A;  2OTL F;  2QA4 F;  1E7K A;  1YIT F;  3G4S F;  3IR9 A;  5G4V C;  2FC3 A;  3N4Y A;  3G71 F;  3MCA B;  1SDS A;  3CMA F;  1VQM F;  3LWO C;  1KQS F;  1ZWZ A;  2LBX A;  5A2Q M;  1H7M A;  3J81 M;  1RA4 A;  3CCE F;  5EWR A;  1X7P A;  3VI6 A;  1VQL F;  2KG4 A;  1K9M H;  3CCR F;  2CZW A;  1RLG A;  5GAP K;  1CK2 A;  1Q82 H;  1X7O A;  2OHW A;  2WAL A;  2AIF A;  1S72 F;  3CC7 F;  1KC8 H;  1M90 H;  1T0K B;  1DT9 A;  3CD6 F;  1M1K H;  3LWR C;  2QI2 A;  1VQK F;  2KTU A;  3NK6 A;  4X3M A;  1W42 A;  3NK7 A;  1VQO F;  2BO1 A;  4TZZ A;  1GO1 A;  1W2B F;  2VGM A;  1YHQ F;  3OBY A;  3WXM B;  3NMU C;  1CN7 A;  3CPQ A;  3CCJ F;  3PAF A;  1YJN F;  4C4W C;  2OTJ F;  3I56 F;  3LFO A;  3LWV C;  1VQP F;  2JNB A;  1VQ8 F;  3ON1 A;  4X3L A;  2LBW A;  1KD1 H;  1YI2 F;  3JAM M;  1Q7Y H;  3I55 F;  5GIO C;  4NUT A;  5EO3 A;  5GIP C;  1NJI H;  3HAX D;  5IT9 M;  3E1Y A;  3OBW A;  4BW0 B;  5G4U C;  5FJ4 C;  3LWQ C;  3VMF B;  3CC2 F;  3J80 M;  1X52 A;  3O85 A;  3V7Q A;  3N4Z A;  3CCQ F;  1VQ7 F;  1VQN F;  2OZB A;  3CCL F;  5GAN K;  1GO0 A;  1QVG F;  1VQ4 F; 
#chains in the Genus database with same CATH topology
 5IJ9 A;  3JAR A;  3IKE A;  1Z5W A;  3J7A R;  3V7E A;  4U3J B;  3CCV F;  1N8R H;  4LCK A;  3V4D A;  2CVL A;  3WGN A;  3ZP7 A;  2IG8 A;  2ZF8 A;  3E20 B;  1QVF F;  5KX5 A;  3DDN A;  2Z01 A;  3CC4 F;  3UT5 B;  1VQ6 F;  5FLX M;  2I6D A;  5HP7 A;  1VH8 A;  5GON B;  3JCM M;  3WJR A;  4U3J A;  3M4S A;  2P6Y A;  3HKC B;  1CLI A;  2VGN A;  4O4L B;  3VCZ A;  2ZVY A;  1JJ2 F;  1QD9 A;  3LWP C;  2UYK A;  1VQ5 F;  3AGK A;  1W5B A;  2VAP A;  1NMU B;  3IEW A;  4ERH A;  4G4W A;  3CME F;  4NQ3 A;  5C8Y B;  3R0P A;  3IR9 A;  4O4L A;  2FC3 A;  3C9U A;  3N4Y A;  3KHN A;  3TD4 A;  2DT4 A;  3CMA F;  2H6L A;  5JVD B;  3S06 A;  1GO0 A;  1Q8R A;  2H8C A;  4O4H B;  5EZY B;  2EWC A;  3D01 A;  3JAW B;  1H7M A;  1SA0 A;  1RA4 A;  2IAF A;  2MQE A;  3RYI A;  4BT7 A;  3S03 A;  2HRY A;  3CCE F;  3WGK A;  3MQW A;  5C8Y A;  5MN5 A;  1RLG A;  2Z1E A;  5GAP K;  1QAH A;  5JVD A;  4C8I A;  5EZY A;  2YYE A;  2GLZ A;  3JAW A;  2CW4 A;  3S0H A;  1T0K B;  3RYH B;  3HKD B;  1M1K H;  2VXY A;  3B6N A;  3S0W A;  4O2B B;  3DC2 A;  2KTU A;  4KWE A;  4TZZ A;  4YJ3 B;  1W2B F;  2VGM A;  1YHQ F;  4I55 A;  1JN1 A;  3K2X A;  1CN7 A;  5LA6 B;  3PAF A;  1YJN F;  4ZOL A;  2OTJ F;  3C9R A;  3LYB A;  4RHA A;  5ITZ A;  5HWE A;  5EIB C;  1VQ8 F;  1JD1 A;  2PMP A;  4X3L A;  1U3P A;  3WPW A;  4O2B A;  5KMG A;  3JAM M;  4M8I A;  2DYY A;  4LNU B;  4BT4 A;  2H8E A;  4C8G A;  3MBM A;  2GZL A;  4IHJ B;  4R40 B;  1W55 A;  3VIU A;  4E6E A;  3LWQ C;  3VMF B;  3CC2 F;  2RHJ A;  3QUW A;  4X20 A;  3V7Q A;  3N4Z A;  2RHO A;  3CCQ F;  1VQN F;  1VQV A;  1QVG F;  3VOB A;  1W41 A;  4LNU A;  1YQN A;  3HTN A;  5HY1 A;  3JVH A;  3FFM A;  1PF5 A;  2ALE A;  1K8A H;  4BVR A;  1YGY A;  4O4I B;  3F0F A;  5IJ9 B;  3JAR B;  2HVY D;  5CA1 A;  3T80 A;  5AVM A;  5LP6 A;  1X25 A;  2HS3 A;  1W3E X;  3C8L A;  3IKF A;  3M1X A;  1YJW F;  3SIV A;  4EI8 A;  3S02 A;  3JAK B;  1GZ0 A;  5BMV A;  1PXW A;  5DCV A;  2QA4 F;  1E7K A;  1YIT F;  1U3L A;  1U43 A;  3ELC A;  5JQG A;  1IV4 A;  3G4S F;  3LDT A;  3WGJ A;  1KNJ A;  3G71 F;  3RYC A;  3MCA B;  3JAK A;  1KQS F;  1VQM F;  2V9Y A;  1SDS A;  1ZWZ A;  5A2Q M;  1COM A;  3EOR A;  3K12 A;  3WGL A;  4BT5 A;  1FSZ A;  5J2U B;  2ZOD A;  3FD5 A;  1XV2 A;  1NQ3 A;  4XCQ A;  1KNK A;  3IEQ A;  4ZI7 A;  1X7P A;  3VI6 A;  3FD6 A;  4BT6 A;  2W8B C;  2R6R 1;  3HKB A;  1SA0 B;  3RYI B;  5LYJ B;  3QHD A;  4C82 A;  1Q82 H;  2WAL A;  4ZHQ B;  5J2U A;  1KC8 H;  4X1K A;  4G4V A;  4WBN A;  3JAS B;  2QI2 A;  2HQS C;  2HX0 A;  5MN4 A;  1VQK F;  3NK6 A;  3HWU A;  3ERN A;  3V3T A;  1Z5V A;  3GTZ A;  3OBY A;  3NMU C;  5LYJ A;  3CCJ F;  3F0D A;  3S0Y A;  2Z1U A;  2PHN A;  3VYT C;  5CA0 A;  4ZHQ A;  2KGW A;  1W5A A;  2HRU A;  4ZHY B;  3KE1 A;  4BVS A;  3JAS A;  3ZO8 A;  4I55 B;  3ZP4 A;  2Q1Y A;  5EO3 A;  4ZOL B;  1T0A A;  3VOA A;  5ITZ B;  1FFX B;  3MDO A;  4FFB A;  3N2G B;  4I4T A;  3CYQ A;  5IJ0 A;  1X52 A;  3O85 A;  5KMG B;  4G4Y A;  2OZB A;  2NMU A;  5GAN K;  4EI9 A;  5CB4 B;  2GVI A;  1RQ7 A;  2QEX F;  3HAX D;  3CYP B;  3ESJ A;  5LXT B;  2AMT A;  4X20 B;  1FFX A;  4B46 A;  5JCO A;  2LBT A;  3F0G A;  1W40 A;  1Q86 H;  3RA5 A;  4BY9 D;  3N2G A;  4HNA A;  3VYS C;  4PWT A;  3WPX A;  2QTP A;  1IPA A;  3PLA C;  3OON A;  5CB4 A;  5HY2 A;  1Q81 H;  5GIN C;  1K73 H;  4NWO B;  1TUB A;  5LXT A;  2UYJ A;  2RB9 A;  5LOV A;  1W59 A;  5CA1 B;  2ZVZ A;  4DXD A;  5LP6 B;  2LCA A;  1OFU A;  3M84 A;  1W57 A;  1VQ9 F;  2UZH A;  4O4J A;  3CG6 A;  2F9Z C;  3SIU A;  1YIJ F;  1U40 A;  3GYQ A;  2G9I A;  3WJP A;  3ZOP A;  3MCQ A;  3F6M A;  3IMP A;  5G4V C;  3JAL B;  4O2A B;  3D00 A;  5BMV B;  3JAT A;  4IIJ A;  3P0Z A;  4C81 A;  2LBX A;  2HS0 A;  5EAZ A;  4TUY A;  4I50 B;  4YJ2 B;  3J81 M;  5JQG B;  1XRG A;  1ONI A;  1VK3 A;  4X1Y A;  5EWR A;  1RQ2 A;  3RYC B;  1VQL F;  2KG4 A;  1K9M H;  3JAL A;  4O2A A;  1TVK A;  1OAP A;  3D54 A;  3Q8H A;  3TD3 A;  3N2K B;  1X7O A;  2OHW A;  2YXZ A;  4ZHV A;  4ZI7 B;  4I50 A;  4YJ2 A;  1IV2 A;  3CC7 F;  1M90 H;  1DBF A;  4ZHW A;  5HXU A;  3LWR C;  1FNJ A;  3RE3 A;  1W5F A;  3CB2 A;  3HKB B;  4X3M A;  1RLU A;  5FNV A;  3LME A;  4TV9 B;  2ZOV A;  3NK7 A;  2I6R A;  3VO8 A;  2CHT A;  2UYN B;  4X1I B;  3KIZ A;  3C9T A;  3K14 A;  4X1K B;  3N2K A;  1H47 A;  5EB1 B;  2Z1T A;  4WBN B;  3F0E A;  5HXZ A;  3LFO A;  2K1S A;  3P10 A;  5HY0 A;  3KJJ A;  3VYU C;  4BVQ A;  1YI2 F;  1UFY A;  2VAM A;  4DRX A;  1Q7Y H;  1H48 A;  1IV3 A;  1SZQ A;  4TV9 A;  3E22 B;  4EI7 A;  5GIO C;  5GIP C;  3BYQ A;  2UYN A;  4X1I A;  1NJI H;  3E1Y A;  3HKE B;  3K0T A;  3P4E A;  2HS4 A;  3OBW A;  5CA0 B;  4BW0 B;  2HP0 B;  4BT2 A;  5B8F A;  2BTO A;  2RHH A;  3J80 M;  3WGM A;  2CHS A;  4B45 A;  1VQ7 F;  2R75 1;  3FBA A;  3CCL F;  3GHZ A;  3I7T A;  1VQ4 F;  2AIZ P;  3RA6 A;  3CCS F;  3E22 A;  5EIB D;  4G88 A;  4FFB B;  3UT5 A;  1GX1 A;  3HKE A;  4I4T B;  5IJ0 B;  4BT3 A;  2HP0 A;  2UYP A;  5GON A;  2FGY A;  3G6E F;  4B62 A;  2RHL A;  2Q1X A;  3FPI A;  3HKC A;  3VTI C;  1XBI A;  5J2T B;  4TV8 B;  4U39 A;  5EB0 A;  3CCU F;  3NVK E;  2KTV A;  3HJW C;  4HNA B;  5JCO C;  4F6R B;  1IV1 A;  3CXC F;  3NVI B;  1TUB B;  3CPW F;  3CCM F;  1VHA A;  2Z1F A;  5HY4 A;  4TV8 A;  5J2T A;  3OW2 F;  5JH7 B;  5LOV B;  1YJ9 F;  2CWJ A;  2L26 A;  4O4H A;  5EYP B;  2OTL F;  4F6R A;  2BTU A;  3I3F A;  1JY8 A;  4O4J B;  4C8E A;  5IYZ B;  3LWO C;  4B5C A;  4EB6 B;  1XHO A;  5MN6 A;  1JFF B;  5JH7 A;  1FNK A;  2CSL A;  5EYP A;  1W58 1;  2B33 A;  3JAT B;  2HP3 A;  4IIJ B;  3RYH A;  3HKD A;  1UI9 A;  3CCR F;  2CZW A;  5LP6 C;  4TUY B;  5IYZ A;  1QU9 A;  1CK2 A;  5HP8 A;  2ZAU A;  4X1Y B;  2VAW A;  3L7Q A;  4YJ3 A;  3U0O A;  4EB6 A;  2OTM A;  2AIF A;  1JFF A;  1S72 F;  1DT9 A;  3CD6 F;  5LA6 A;  1TVK B;  3WJQ A;  1W42 A;  1W5E A;  3KJK A;  1VQO F;  2BO1 A;  4G4X A;  1GO1 A;  3RYF B;  1R1M A;  3WXM B;  3QTY A;  3CPQ A;  4BVT A;  2N48 A;  4IHJ A;  4C4W C;  3I56 F;  3LWV C;  1VQP F;  2IQQ A;  5FNV B;  1J7H A;  2JNB A;  4G4Z A;  3ON1 A;  2LBW A;  1KD1 H;  2BTQ B;  3I55 F;  1ODE A;  4ZK7 A;  4NUT A;  3C9S A;  5IT9 M;  3RYF A;  5G4U C;  5FJ4 C;  4RQO A;  4DRX B;  5KX5 B;  4O4I A;  3TD5 A; 
#chains in the Genus database with same CATH homology
 2QEX F;  1W41 A;  3J7A R;  3RA6 A;  5HY1 A;  3CCS F;  3V7E A;  3FFM A;  2ALE A;  1K8A H;  3CCV F;  4BVR A;  1N8R H;  4LCK A;  1W40 A;  1Q86 H;  2FGY A;  3RA5 A;  3G6E F;  4BY9 D;  3E20 B;  2HVY D;  1QVF F;  1IPA A;  3CC4 F;  3PLA C;  1VQ6 F;  1XBI A;  5FLX M;  5HY2 A;  1Q81 H;  2I6D A;  5GIN C;  3CCU F;  1K73 H;  3NVK E;  1W3E X;  2KTV A;  3HJW C;  3JCM M;  2VGN A;  1YJW F;  3SIV A;  4EI8 A;  3CXC F;  1JJ2 F;  3NVI B;  3LWP C;  1VQ9 F;  1GZ0 A;  3CPW F;  3CCM F;  1VQ5 F;  3AGK A;  3CG6 A;  1NMU B;  2F9Z C;  1PXW A;  5HY4 A;  3OW2 F;  3SIU A;  3CME F;  1YJ9 F;  1YIJ F;  5DCV A;  3GYQ A;  2OTL F;  4NQ3 A;  2QA4 F;  1E7K A;  1YIT F;  3G4S F;  3IR9 A;  5G4V C;  3D00 A;  2FC3 A;  3N4Y A;  3G71 F;  3MCA B;  1SDS A;  3CMA F;  1VQM F;  3LWO C;  1KQS F;  1ZWZ A;  2LBX A;  5A2Q M;  1H7M A;  3J81 M;  1RA4 A;  3CCE F;  4XCQ A;  5EWR A;  1X7P A;  3VI6 A;  1VQL F;  2KG4 A;  1K9M H;  3CCR F;  2CZW A;  1RLG A;  5GAP K;  1CK2 A;  1Q82 H;  1X7O A;  2OHW A;  2WAL A;  2AIF A;  1S72 F;  2GLZ A;  3CC7 F;  1KC8 H;  1M90 H;  1T0K B;  1DT9 A;  3CD6 F;  5HXU A;  1M1K H;  3LWR C;  2QI2 A;  1VQK F;  2KTU A;  3NK6 A;  4X3M A;  1W42 A;  3NK7 A;  1VQO F;  2BO1 A;  4TZZ A;  1GO1 A;  1W2B F;  3V3T A;  2VGM A;  1YHQ F;  3OBY A;  3WXM B;  1QVG F;  3NMU C;  1CN7 A;  3CPQ A;  4BVT A;  3CCJ F;  3PAF A;  1YJN F;  4C4W C;  2OTJ F;  3I56 F;  5HXZ A;  3LFO A;  3LWV C;  5HWE A;  1VQP F;  5HY0 A;  2JNB A;  1VQ8 F;  3ON1 A;  4X3L A;  2LBW A;  4BVQ A;  4BVS A;  1KD1 H;  1YI2 F;  3JAM M;  1Q7Y H;  3I55 F;  4EI7 A;  5GIO C;  4NUT A;  5EO3 A;  5GIP C;  1NJI H;  3HAX D;  5IT9 M;  3E1Y A;  3OBW A;  4BW0 B;  5G4U C;  5FJ4 C;  3LWQ C;  3VMF B;  3CC2 F;  3J80 M;  1X52 A;  3O85 A;  3V7Q A;  3N4Z A;  3CCQ F;  1VQ7 F;  1VQN F;  2OZB A;  3CCL F;  5GAN K;  1GO0 A;  4EI9 A;  1VQ4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...