4M8IA

1.43 angstrom resolution crystal structure of cell division protein ftsz (ftsz) from staphylococcus epidermidis rp62a in complex with gdp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
b'LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTAGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFGFEGRKRQTQAAAGVESMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFEDKPSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
molecule tags Cell cycle
source organism Staphylococcus epidermidis
publication title 1.43 Angstrom resolution crystal structure of cell division protein FtsZ (ftsZ) from Staphylococcus epidermidis RP62A in complex with GDP
rcsb
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4m8iA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4m8iA01
3M8KA 5JVDA 4FFBB 3E22A 1W59A 4O4IA 1TVKA 4X1IA 4DRXB 4ZOLA 5IJ9B 5LP6A 3JALB 2RHLA 4LNUB 4XCQA 3UT5A 2RHHA 4O4IB 3RYFA 5BMVA 4EI9A 3JATA 5LXTB 3VOBA 4X20A 2RHOA 4TV8A 3JASB 3RYIA 3RYIB 3WGJA 1OFUA 4TV8B 5LXTA 4B46A 4U3JA 2BTQA 3HKDA 5BMVB 4O2AA 3HKEB 4WBNB 3ZBQA 2R751 4LNUA 5CA0A 4X1YA 1TVKB 4X1IB 4O4LA 4HNAA 3E22B 4FFBA 4B45A 4DRXA 4O4HB 4I55A 1W581 1Z5VA 5MN6A 4X1YB 2Q1YA 4YJ3A 2XKAA 5C8YA 3HKCB 4KWEA 5J2TB 2RHJA 1FFXA 2BTQB 4IIJA 4U3JB 3WGNA 4ZHQA 1RQ2A 4O4JB 5IJ0A 3RYCA 5LP6C 3JASA 5KX5B 4YJ2A 4IHJB 5EZYA 4TUYA 4X1KB 5KMGA 5LOVB 3WGMA 3V3TA 4E6EA 3JAWB 5EYPA 5GONA 5LA6B 4F6RB 3JALA 3JARB 3JARA 5EIBC 3JAKA 3VO8A 5JVDB 3JAWA 2VAMA 5EYPB 4TUYB 4X1KA 3N2KB 5FNVA 5ITZB 5EZYB 3RB8A 5CA1B 4EB6A 5ITZA 5JH7B 5KX5A 1W5BA 5CB4A 1FSZA 4O4JA 5IYZA 5JCOC 5IYZB 1FFXB 2VAPA 4IIJB 4ZHQB 1SA0B 1JFFB 3VOAA 4EB6B 2VAWA 1TUBB 2VXYA 3HKBA 4I50B 5LYJA 4ZI7A 4I55B 5LYJB 4TV9A 3ZIDA 3VPAA 4O4HA 5MN5A 2Q1XA 3JAKB 4O2BA 3WGLA 3RYHB 1JFFA 1SA0A 5GONB 3HKEA 3WGKA 5J2UB 1RQ7A 4WBNA 4DXDA 3HKDB 4I4TA 5MN4A 5CB4B 3R4VA 3N2GA 3N2GB 1W5AA 5JH7A 5CA1A 2GVIA 1Z5WA 4I4TB 4X20B 3C8LA 3JATB 3M89A 5J2UA 5J2TA 3RYFB 3RYHA 4O2BB 4F6RA 3UT5B 5C8YB 5LA6A 4YJ3B 2XKBA 4ZOLB 5IJ9A 4TV9B 5LP6B 5JCOA 5LOVA 5KMGB 4ZI7B 3HKBB 1TUBA 4I50A 4IHJA 4YJ2B 4HNAB 4O4LB 2R6R1 1W5FA 3CB2A 1RLUA 5CA0B 3RYCB 1W5EA 5IJ0B 5JQGA 4EI8A 4O2AB 4U39A 3ZBPA 5M7EA 4M8IA 5JQGB 5EIBD 3HKCA 3VO9A 2BTOA 4EI7A 5FNVB 3N2KA
chains in the Genus database with same CATH superfamily
3OOHA 3SS7X 2O6HA 4KSCA 3DEIA 1NN1A 1NULA 2VEOA 2EQ5A 3DFZA 4MAFA 2JHPA 3HVJA 1V8DA 3EEIA 2QMYA 1IEVA 2ZBPA 3OD1A 1QC5B 4B8ZA 2II6A 1W3EX 4J49A 4D81A 4F0JA 3HVIA 4N5HX 5BQ5A 1N3BA 4M2LA 2HEIA 4QFDA 1Z37A 1F9EA 4BVHA 4GMXA 4FSHA 4RC9A 2WVAA 4CMGA 1GQOA 1GZVA 2WUDA 4G4XA 4PYJA 1IPAA 3C6ZA 4TL6A 3HLYA 4BZWA 2H48A 3R41A 3U3DA 1NR7A 4UM9B 2XZLA 1KY3A 5F9MA 1THZA 3KOOA 3B60A 4CDRA 3E9QA 5AVXA 4KQIA 1T36B 1T36A 3WRWA 5MF6A 3V48A 3GMSA 3IP5A 3KPVA 3NHAA 4MP8A 3RVNA 3U17A 2WQZA 2XYVA 3MTQA 4QXMA 2HDHA 3KYCB 1L5RA 3I1IA 4LZJA 1DC3A 4LX0A 4BIMA 5FV4A 3BOSA 2HF9A 1C80A 5KNBD 3IULA 4L0DA 3N8DA 5B7QA 1GG9A 4EKIA 5EUMA 4F2HA 2VJMA 4G84A 2J6HA 3CH7A 1KQNA 1MAAA 3T9BA 5KTMA 1CS0A 2CEAA 2PH7A 4HH0A 4RV4A 1OFTA 2FSSA 5K4GA 5BSEA 3EPHA 3SOZA 2FCAA 1G21A 1ZOIA 2O3JA 7REQA 2H8CA 3LUCA 4IX1A 4OB6A 1SBYA 2NADA 1PXWA 3TZQA 4XTCS 3RSOA 2PS0A 2EKPA 2ZRKA 2ZYWX 3FBGA 3V1YA 4DCOA 3L6DA 4FDLA 4XRGA 3SEQA 3J7TA 4BAZA 3UGJA 3P0ZA 1GYRA 2C2XA 1VA5A 1UF9A 2V7VA 2XECA 2AIFA 3OCXA 3CMEF 1DXOA 1G16A 2YXLA 1DWPA 4MR8B 4XEUA 3S1AB 3VNBA 5K0SA 2IP2A 3KX2A 1DBWA 3R23A 3D2LA 3UBTA 2J3KA 2MIIA 3PT9A 5JMTA 1HT1E 4PLPA 4ZCLA 4P33A 1YJ8A 4Y2XA 2W0MA 4C05A 4MHTA 1KDRA 3DLCA 3CV3A 2Z8YM 4FR2A 2YIDA 4AZSA 5CXUA 5EP2A 3GDGA 4AURA 1C1HA 4DV6B 3H6HA 1KR2A 3K72B 1DKPA 3ZOPA 4L50A 5A6VA 3DFKA 4UOQA 5JZVA 5MN4A 2ZSJA 3W5JA 3SPXA 2X77A 4DLBA 1RM4A 2A7XA 3KXPA 3A28A 4IX9A 4LY6A 3MWYW 4O3MA 1XEWY 1ENOA 1VSBA 2BMWA 3VU1A 1NXXA 3GROA 5CD1A 5KJ6A 1D6NA 1WU8A 2VGMA 1DWOA 2BKAA 2OBYA 4ZA2A 4DC1A 4MVXA 3OKCA 1IN7A 3HCRA 5CM9C 2AQHA 3VDMA 1DKQA 1H4VB 2BVNA 1EPUA 1ZOOA 1SBHA 4WZZA 1BROA 1QE5A 1EK6A 2J9YB 3SXUA 4C0HA 2ATXA 1Y80A 4LMPA 4BY9E 2FSFA 3RDPA 1R0BA 2ZIAA 3OZWA 4QO8A 4ZEOA 2JW5A 3OU7A 5K0ZA 4QFBA 2XUAA 3EWSA 3QXXA 1GZHB 1TMYA 3UWDA 3ICEA 2B8EA 1A96A 3IJ5A 2WINI 1IK6A 2O9JA 2IG8A 3NHLA 1D6MA 4KK3A 4XDZA 4X7BA 3U6KA 5DM60 4JCCA 4MX8A 4LXXA 3R9IA 4D41A 4DSNA 4AO8A 4RLQA 1UANA 1DFIA 1XQ1A 2F00A 4U6SA 5J5AA 3U5ZB 1KJIA 3TZ6A 4GBED 3PS9A 1U2EA 1Z74A 4AZ3B 2A5YB 4JLMA 3SEZA 7GPBA 4C2BA 4EUNA 2G9NA 5F23A 2LBTA 4F92B 4AVYA 1E66A 1I9GA 2EJCA 3KJFA 4OFXA 5UKDA 4WEQA 3FFWA 4I1RA 1NWCA 3V97A 2J5KA 3HYTA 1N34B 5KVQA 3NOOA 4OGFA 2FZLA 1UXGA 4C87A 4OREX 3NMUC 4WLNA 3UYKA 1J0DA 1I6WA 4B79A 1J7JA 2YR0A 4DRYA 5JWOA 2GESA 4TM8A 4DMHA 1UXJA 5DVZA 2VXBA 2WYUA 4Q21A 5H7XA 4KTTE 2Q1YA 4Z8XA 1ZUNB 1O94C 1NL3A 3N3AC 3NKVA 3QRWA 4TS4A 4PNPA 4UAJA 4JB3A 3OJ0A 1IPEA 1YA4A 4E5PA 4HZUA 3NM4A 1RYHA 1PBTA 1UADA 2JVKA 2R86A 4LTMA 2VDWB 3QJ5A 1FRVA 2AFHE 4FZ3A 4D7AA 4RADA 2R8OA 3E3AA 4XGNA 2PV0A 4OP1A 4GKJB 1MHPA 2E5LB 4EUSA 2EVWX 1S1MA 1P2TA 3FOEC 2FDCA 4RD3A 3CCFA 3MD0A 4R01A 1XXHA 5C7OO 5DULA 3PR2B 1E2BA 2FW1A 1GGVA 3QSGA 4WKBA 3C3DA 3FMIA 4GL4A 3LTNC 5JDIA 1T4CB 4JI0B 1C7RA 1I4EB 1W88B 1JU9A 2EWWA 3KJXA 1J4AA 5AI0A 2MTBA 3CX4A 3IT1A 1W4ZA 1U2QA 3NLLA 3PJGA 4ZT6A 4MOWA 3KB6A 3K31A 5DM2A 4BNVA 1XQVA 1GYPA 3SY8A 5FBWB 3KQNA 4QOJA 2J48A 3X2SA 1DKUA 5LQKA 3IKLA 3BIFA 1RWNA 3MTIA 5ED0A 3NM6B 2AMJA 3O3OB 3ROXA 2H1OA 3O8BA 3RC8A 2O8FA 1G5RA 1UZUA 3W4IA 3WAKA 4E4RA 4DSAA 1U2GA 2MYUA 3A4IA 3GVHA 3RFXA 5IBCA 1L0BA 2LCFA 4QUIA 4MJLA 1H3NA 1R4NA 2QPAA 4BVKA 4NPHA 2QLBA 1KC3A 4ED9A 1BVUA 1M76A 4LWPA 5DSZA 2G04A 1DCMA 3MCVA 2OA0A 3RVOA 1Z4PX 4MWBA 2EFCB 5CYFA 4F1WA 1ZC3A 5J4VA 5FAXA 5K0GA 5K7SA 1JEJA 4DJTA 4YY3B 3N39C 3A2KA 3C39A 1DO2A 3PU6A 2WD7B 3W3AD 1G5PA 2CGEA 1KVUA 2GZ3A 4NBNA 4U6NA 1PE0A 3VU0A 5HIJA 1DKRA 2XKBA 4NBTA 2JIOA 3J80A 3CQ9A 2HF2A 4ZDJA 2EQAA 4I5FA 2X4DA 3B3QA 5K20A 5LIRA 1B0ZA 2AIZP 2WJYA 1ZIPA 2YYAA 3O4VA 2IPLA 4RH3A 1E58A 1ZR4A 3PZRA 5TQJA 3ZK7A 3G1UA 1OD6A 1XF1A 3HYNA 3KJQA 3ENWA 3VR5A 4C43A 1H4TA 3R5KA 5CBPB 4A1OA 1AMOA 3E1KA 2XWJI 1IXRC 2UZ0A 4Z1OA 1JKIA 3AETB 2VHWA 4RPGA 1JQ3A 1XSEA 3GD5A 4OO3A 4V0LA 5FFNA 4OI0A 1YZUA 2RH9B 5I47A 4KKVA 3LHSA 5C8XA 3OUZA 4HEA1 1E3IA 1SNYA 4M7OA 4DABA 3LHDA 4M88A 3N6VA 2NMVA 1PR6A 1A2QA 3FMFA 2ZT7A 2ZP1A 4C6TB 1X87A 3K9BA 4Z4HA 1CS0B 1I3CA 3T0FA 4BBZA 4NF2A 2QLJA 3ZWBA 3EBOA 3HGMA 1HQKA 1DWQA 3G8DA 2D1TA 1XDBA 2P2SA 3ICOA 4MXDA 1G291 2FAXA 3LU1A 1B0AA 2GD6A 1M73E 3IKFA 3E84A 4QATA 3I5YA 1G20E 3K0SA 1P7CA 4P84A 2QT0A 4XFJA 3IURA 2ZAYA 1Q1NA 3K8QA 4JJGA 3DFFA 3DULA 2FMUA 1HZJA 2ZREA 4H0CA 5HXUA 1R8QA 2GN6A 3GG9A 4JQYA 4RK7A 1AKTA 4MS4A 1ZR2A 4U4AA 4F12A 4BUJA 1UPUA 2ZBEA 4QNMA 5CVTA 3NPAA 2QVYX 1B8UA 2YFKA 1IM2A 3C3XA 2JAOA 4RYDA 2G72A 3OMWA 3RUCA 2Q4OA 1YHNA 3OLZA 3R7SA 3R7WA 3PUYA 3OZ7A 6NULA 3ZXSA 1O95D 1DUIA 1OI7A 1XZKA 3IAM6 3VBEA 1UK8A 1PEAA 1EGQA 2Y27A 2F6RA 3PC6A 3REGA 5ITSA 3AB8A 1KAMA 4P5PA 1M34A 4CUZA 2ZJ5A 3C3CA 4MSUA 4RWEA 4D9CA 3S8MA 3I55F 2RHTA 1IAQA 3JARB 3JARA 1VLJA 3HXPA 1OA0A 2GBFA 4M1ZA 1MX9A 2IYUA 1L5QA 1J20A 1E1CA 1V1JA 2D0IA 3MWLA 4NI5A 4AJPA 1C2YA 1YGYA 5E9WA 4TLDA 1BA2A 3ZW8A 5DNVA 2DHEA 1N5DA 3F1LA 3SJCA 2DHQA 4M9ZA 3DYVA 1VQNF 3ZVKA 4I0WB 5A3QA 2QTTA 4MDFA 4OK6A 1Z68A 3JD1A 2EEPA 2QKYA 2IYPA 3TW6A 3F8TA 3F2IA 3C3EA 2VAWA 4YRAA 3L4SO 4JS0A 5A0VA 2PAFA 4EI2A 2AMTA 1KYXA 1WCWA 3JPWA 4WCVA 1SU6A 1IG0A 2R47A 3G8AA 5EMMA 5E1BA 1YOBA 2XCOA 5DSXA 1PR5A 5EIXA 5B1EA 4CGZA 1P6QA 2O52A 1CDEA 5K8UA 3S2IA 4UD6A 4ND7A 3U60B 1XZDA 4YRSA 2LBXA 3OZSA 4EG5A 1ORVA 1XDZA 3WWOA 1M6YA 3ZO8A 1VQPF 2DFLA 1E1DA 1V8FA 2PT6A 3BB3A 3DUFB 1E60A 3R3HA 4DV0B 1A98A 1HDIA 3SKYA 3I56F 2W2OA 4XX1A 1I6MA 2VA9A 3FB4A 1NT2A 3OETA 4ZYXA 2G1PA 3M9XA 1JEQA 1U7UA 1BE8A 2G88A 3SF8B 1WD5A 2CFRA 5EIOA 2J45A 2OCKA 2VDKB 2VTBA 5DWVA 1K7EB 5DN9A 4PE5B 1GA1A 3DV9A 4E5DA 5CB0A 4O2AB 2R1TA 1RAEA 4IQGA 2A3NA 1F8YA 2V5UA 821PA 1PNRA 1MOSA 4CM4A 4BXOB 1XHFA 4FFWA 3V9AA 5JQGB 2VPTA 3G23A 4PR3A 2WYWA 2WAAA 3DS8A 4A8JA 3CVWA 4JKYA 4GX2A 3N6RA 5JISA 2O1XA 1TF7A 3AUKA 4MRVA 2JL1A 1QFXA 3FVRA 2GN8A 1L9XA 1WDWB 4ILEA 4RK5A 4CV3A 5LZ9A 5IJ9B 4PWZA 1AS3A 5HG0A 3OJLA 2R66A 5DNAA 3COSA 3D6NB 6PFKA 2EFYA 1FQKA 1WDLA 3FVVA 5F1KA 1I3OA 3B9BA 1XWIA 4LY9A 5ELMA 3WNVA 2I5PO 4M53A 5HFAA 4S1PA 3PT5A 2Z4TA 3L93A 3RHSA 2RI6A 3D7NA 3WLNA 1PYDA 1YHZA 4PGMA 5HOQA 5A03A 3U7RA 1N6KA 1RSZA 3AONB 5HY1A 1E6KA 5LBUA 2NZUG 4IUDS 1GZ0A 4G36A 1NJ5A 3E3LA 4B83A 3TLJA 2CJXA 2H6LA 2I6QA 2OL4A 3IHWA 2EQBA 4REQB 4R71A 5A1JA 2FEAA 2ALJA 1J2TA 1RIIA 3KEGA 4LSGA 1V4NA 1U1CA 2PUWA 2J85A 3T7KA 3LUDA 3STUA 4B7XA 2ZBQA 3KEMA 3O3NB 1IXKA 3HY3A 2OXIA 2QSZA 2CJYA 1JG7A 1Y9JA 2R8BA 3HV2A 3N70A 4HX9A 1YI2F 1L4BA 1P7PA 1TKRA 3WIOA 4EJSA 1VQ8F 5PGMA 4RV5A 4B4DA 3B51X 3QIVA 3ED5A 2DB3A 1E7WA 3IT0A 4FFRA 2B2XA 4YX9A 2VS1A 1LLQA 1WMDA 5FOQA 3PRHA 4CIXA 1QXSA 3B1YA 4Y7CA 3VYWA 4P81A 2YZNA 3WYAA 5JCZA 1WZCA 2J41A 2A0KA 3UJ7A 4GD3Q 3JAWB 1YGPA 1KMMA 2BFOA 1SUFA 3S27A 3OMLA 2BFDB 3JS5A 4GGPA 3VI4B 1EFKA 1FDIA 2PUJA 3IJPA 3QA3E 1BDMA 2F9ZC 1E3SA 3SIRA 3R5JA 1KH2A 4WBXC 3D54A 1DTWA 2BFFB 4PCVA 1YR2A 2JIDA 3MTJA 5HWSA 1KJYA 1MG5A 1W8DA 4BGUA 3GQBB 1KOJA 1P9NA 1YE5A 1SCIA 2ZSFA 5JXGA 1WBBA 4FR0A 3S1AA 3T5MA 1DIHA 2JFQA 3FYTA 1FFAA 1I10A 5ALGA 1JQDA 2E4AA 4M87A 1R74A 2OGWA 2H1SA 3D3KA 4PLFA 3L7YA 4ER0A 2VSOA 1YB2A 2V7TA 1WPRA 2MT9A 4JLDA 4KXMA 4ZVNA 4DRZA 3AU9A 1B14A 2OHHA 2WAOA 1KI6B 3HCAA 5FI0B 5JRDS 4AW9A 3UHFA 3JVIA 4K9KA 4ZO6A 1GR0A 2PLFA 5EXEA 2EJWA 5IUJC 1PGQA 4L9SA 2F3QA 3PYMA 4M99A 4EJ6A 5E2BA 3KTDA 3MXOA 2V97A 3VZQA 5T8KA 5E8RA 1U0GA 2FRXA 3EOZA 1YB5A 2PSEA 2XY4A 3KUDA 1PJRA 4G4ZA 4LI0A 1QYVA 3CZAA 1Y9ZA 1ZK3A 5FL7A 2Z5FA 5BSGA 4KQ9A 2VH2A 5KREA 1A5AB 3BGVA 2LXNA 2B99A 4OFWA 2OWDA 4RIEA 3TKYA 3BRWA 4ZCIA 1RRFA 5A4KA 1GGHA 1PHPA 4AUEA 4URFA 3V8BA 1FFHA 1PSZA 1TCUA 1Y98A 3TXAA 5HSGA 4XOIA 1V7QA 2D2XA 4MVJG 2AOWA 2HA0A 3ZUGA 1RI5A 3HR7A 5ALDA 5T3YA 1N78A 2ZYUX 2UUBB 1XF9A 1FUIA 4XH9B 4G0NA 1CV2A 4US0R 4RM2A 5K5EA 5JQGA 3M6UA 2QQFA 4A23A 4FNGA 1CRZA 2GEFA 4Y1FA 1UODA 2AZDA 5HUJA 1KOGA 3AKEA 2H1LA 3IV7A 3D6JA 2H4XA 3DMPA 4FLEA 1KOLA 5KVAA 2VP2A 2WZBA 1YDFA 3D59A 3QELB 3HA7A 1QP7A 1ZA1A 5LU8A 1WD7A 5KINB 2I6SA 4OEHA 2PK3A 1LDEA 2OTJF 3RO7A 1L7AA 1ZH2A 1RKQA 1VDMA 3NTXA 3DBHB 4KPYA 3MCUA 2Y4OA 3L1UA 2VYND 3OEHA 5L4LA 3HDHA 5G4UC 1IXSB 1QE3A 1RZVA 2FP3A 2R6DA 3DWIA 2PRZA 3WTCA 1J2EA 2W6CX 1LDNA 2ZIWB 1A9OA 3QE9Y 3SN6A 1H3FA 1JIXA 3I0MA 3LUPA 2H4WA 2PPVA 4YJGB 2P9CA 2DTXA 2IP4A 5FWAA 1WIWA 2GJ8A 2QSJA 5G0WA 1Z39A 4NEGA 3OBWA 1QIDA 2J3JA 3IAXA 1B74A 4R2XA 2ZJOA 3EY4A 1RQPA 5TPZA 4BB5A 2VDQB 1HQCA 5JNRA 4TWZA 3GLFB 2RIRA 1N9ZA 1E2NA 1SEPA 4HPJB 3U4QA 5H70A 5IJZA 3E7DA 1ZISA 2CCJA 1I2ZA 3A32A 3JTEA 3QX8A 5IAGA 2UYOA 4EOGA 3NFYA 2BEWB 2KJQA 4ZMBA 4KQKA 1AKMA 4FMPA 3A6EA 5BVHA 5CXXA 1ZRNA 4G88A 2YNMA 5H4HA 4QPDA 4DLXA 2TMKA 4O4JB 3TPZA 2RIPA 1UMCB 1WUTA 2ARKA 3K2EA 2RHBA 2BBSA 2W6ZA 4GI1A 4IHJB 4PICA 4K87A 4CI0B 4DIEA 1Y8RB 5ED4A 2OCYC 4TUYA 5AUNB 3IDQA 2YJZA 1IYZA 3E8SA 1EJ0A 4C6TA 3WLFA 2YXDA 2ZJZA 1Z7GA 4C9BA 4PNEA 1W4LA 1YOVA 2DRIA 2O5EA 2BZGA 3VO8A 2QYOA 1CUIA 2V7QD 2R8ZA 4R83A 2C96A 5JWRA 1TPZA 2BJWA 1YIOA 2XAUA 1ETHA 1G18A 3IDAA 4NYIR 3SBEA 1JR3E 2H6EA 1IUKA 2G80A 5C52B 1MJGA 2K5UA 1CWUA 2HA3A 4Q1AA 3MTAA 4BWFB 2CK3A 4EECA 3TLKA 4R1OA 3W9SA 3PLRA 4H59A 1AE1A 3PKJA 4CTNA 4KV7A 4FKBA 1TIPA 1JDBC 1DRUA 2ZWIA 3MLAA 4S2EA 3OD5A 4JQOA 3QFHA 1QCZA 1RMYA 1BVRA 1Z4JA 1EEHA 2NG1A 3FJYA 4O4HA 5ALTA 3PCXA 3KC2A 1O97C 4XGKA 2JVIA 2JD2A 2QJOA 1XVUA 3N0VA 4L6CA 5E4FA 3GZ4A 3L07A 5HMMA 5J2UB 1Y6QA 2QI9F 1IRXA 5ESWA 4BAGA 3DOJA 3MTBA 5U4XA 3UOWA 1HXHA 3EXHA 2JI6A 4D9EA 3V8RA 2PMBA 1P91A 2X41A 4DTIA 5BUCA 3MWEA 1EXDA 1MF7A 2KBEA 3WOHA 2QTMA 5I5EA 4Y0VA 2XWQA 3CUTA 3E0XA 5LQNA 4L16A 1VOTA 5IN4A 3WLMA 5DGXA 1MFZA 1CULC 1ISFA 4IILA 3L41A 2J5BA 4ZQEA 3ZE2B 4ZTUB 1Z4LA 4YLGA 3ZEIA 1LW6E 1YI1A 1IOLA 3D8UA 4LE0A 3C8HA 4QGGA 4OHFA 4FHDA 5DOVA 3VR1A 3WQHA 3QG1A 3HKBB 2X8WA 3IS3A 3L0CA 3ZE6A 4WMLA 4BMYA 4Q12A 5KCZA 1QQTA 4MWEA 4RDCA 4NG4A 3OIYA 1K5PA 2HWUA 1JI3A 4JJ8A 2P11A 3X1JA 4RTNA 3M4XA 4ZT4A 2Y1KA 3QNWA 3CC4F 1QX3A 1UK9A 1YV9A 2QM0A 2YVKA 3HMKA 4TL8A 3TEFA 4CR7A 2ZXUA 1PG2A 4M8IA 1XVAA 3NATA 3Q12A 4K7JA 4NMWA 3DAFA 4R16A 3JQFC 4WA7A 3RJ5A 1F1BA 5A9RA 5KNDD 5IX8A 4LOIA 4CLOA 1PJZA 2WWWA 3D4IA 1QG2A 4C4YA 3OEHD 5KJFA 1V4VA 5ENZA 3F90A 3HDQA 3UMSA 4UUMA 4DCSA 3F4KA 2HRQA 2RHLA 3QLUC 2ZYAA 1C50A 3OH8A 4BJ5A 4FDUA 2IEGA 4C30A 4CMJA 1JB9A 4R05A 4BEBA 4N0QA 1ZRMA 1SHKA 2OILA 3T6KA 1EGAA 5HCNA 4KPEC 3FWHA 2NLOA 2XXBA 3WMXA 1OFUA 1E6WA 5D3MA 4D1YA 4PG6A 4F86A 1NG9A 4QHYA 4WGGA 2IWHA 5B55A 2XF2A 3Q9NA 3JWIA 3HBJA 4CW7A 5ADHA 1EU1A 1RYBA 5EJ4A 1WG8A 3QE2A 2OSVA 3JPYA 4MINA 5WRFA 2XMDA 4MUEA 1K2WA 1NX9A 1YS4A 3G2NA 1KY4A 1S9HA 4UNNA 1Y9DA 3AP2A 3COVA 3GVPA 3RUHA 3WL6A 5AUPB 4M6WA 1PV4A 3TTSA 3KZNA 4NPCA 4A2QA 4ND6A 4CIWA 1SU8A 4R3UC 5F1OA 4NY1A 5TQ2B 1DHRA 3V7YA 1EP9A 1UEIA 4L72A 3WXMA 2DY1A 2GDZA 4PZZA 5EJAA 2PRKA 3IR9A 2IDKA 3QTBA 5IAAA 2AGVA 1SQ5A 2AG0A 4KB5A 1THMA 2XBMA 4H2DA 3KUUA 5HKKD 1BXZA 2CNBA 3EXHB 2Z6UA 4X1KB 1R6DA 2HZBA 3NYIA 2DQZA 3UUEA 2E3JA 3D0OA 4O59O 2DT8A 4L5IA 1DC8A 2WI8A 1E20A 3A1TA 5EIBC 1CUBA 5DFAA 1SB9A 1X1DA 3NHPA 2HLPA 4HDMB 1T4MA 3QXCA 4WA8A 1TRKA 2I8AA 3HLTA 3JZMA 3O4HA 3PDJA 5BW6B 4XWYA 1CP2A 1G98A 1AIPA 1J39A 2FKNA 4AO7A 1CLEA 4LDRA 4NBKA 3ENVA 4X63A 2FP4A 2A1UA 2PZFA 3M84A 1OVGA 3EZLA 2NTNA 3QPVA 3SIPA 5HRCA 2RAFA 1E92A 4PO9A 3HSSA 3CPWF 2WSBA 1VKJA 3DBOB 1UFQA 2QD2A 2X58A 4XGIA 4F5ZA 2ZYIA 4R1QA 4X3PA 4ZYWA 3MTDA 1Q1QA 5A5VA 4B47A 2RC5A 5A3RA 4KXFB 4HAWA 1MQ9A 3U3ZA 4QXPA 1VSTA 3DVAA 4H1VA 3H9JA 1T0HB 2CLFB 2JCXA 4BT5A 3QBTA 1ESEA 5COQA 4G4WA 2ZSHA 3OZDA 3DE0X 3RSFA 2J59A 4KGVA 2JIQA 5JNUA 2OB1A 4B81A 1IBKB 1CUZA 4EY7A 1DJMA 3NVDA 2IYVA 3PUIA 3X1WA 2C5AA 3KBBA 4Q0MA 1AMNA 2XUKA 1V45E 2FUG6 3BXHA 3G68A 2YXBA 4L8LA 4NOKA 2HA4A 4EENA 1XD2B 5CP8A 5K2MA 2GN0A 5SY6A 4UKDA 1ONIA 5SICE 4YHBA 3HU5A 4PVCA 1F4PA 3TOSA 4ENPA 1E5QA 4ZOLB 3FKSA 2F55A 5LOVA 2NACA 1I3NA 2CJWB 4ZGGA 2ZVJA 2YOFA 4YRZA 4Z9YA 5K6AA 2QVGA 1Z38A 1AZLA 2HSEA 3EZ2A 4J2TA 4BNJA 2AEJA 3DQQA 1SWVA 3GJ0A 3ZHBA 1DEAA 1Q3HA 3SQDA 4CF7A 3WK8A 3CCBA 3MJCA 4F5WA 2R00C 5K03A 3F7OA 1TZJA 1JJ7A 2ZSIA 2X0FA 4A0RA 2IV7A 3PICA 4H1UA 4XGQA 1X1EA 3EMVA 1U1DA 5AJTA 5AKGA 2DFDA 3AR6A 3AEUA 3KYJB 2JBAA 1BHO1 1NF2A 2BV3A 3ODGA 3VR6D 4F2PA 4BT6A 2ZWPA 4K3VA 4BMVA 5CDTA 2FMTA 1BA3A 1U28C 4YP9A 4YDQA 3ASUA 3NKFA 3FOWA 4K6GA 2ZJAA 4OQNA 4XWKA 1UXHA 5MGBA 1A8HA 1Q7BA 2EU8A 3DDWA 2HXYA 3IEQA 1E0KA 2FN7A 1Y9EA 2CY0A 3F0EA 4W82A 2X15A 3Q7IA 2ZU0C 4NECA 4PN3A 4QO7A 1E2LA 5K45A 1ZX1A 3LDGA 3KKZA 4ASUA 2G5GX 1HDZA 2P4QA 4QDUA 3BWCA 4PQFA 2AG1A 3FYUB 4X64B 3QNMA 1VE5A 4LCEA 1VCNA 1ZZEA 3QGMA 3BDVA 3ZY3A 1Q1AA 2OYCA 1XRQA 2K2QB 2PKCA 3H8VA 1DOHA 5BV1A 4PZDA 2ADMA 2IOHA 1GFSA 3GZTB 4J07A 2A9PA 3HHPA 4A8JB 4WAUA 2ZB8A 5A4JA 2O8DB 1LQTA 2R7AA 3LVFO 1JECA 1LBIA 4XQCA 5EP3A 5CXQA 3RTDA 4HZIA 3QWBA 4Y98A 3S3TA 5LNK6 4P31A 1B2RA 4RIHA 4ZI5A 3GDHA 4ARSA 4NCAA 1ZO8A 4HPXB 1JDZA 2ZBUA 1SOVA 3EK2A 4HAZA 3BERA 4AY6A 2O8EA 5DYNA 4QREA 2AHRA 3P2OA 5DKFA 3CMMA 1T3TA 3UMMA 1QPBA 2D00A 2P4HX 4WFIA 2O8CB 1GT6A 5CG1A 1WTAA 2FXVA 3WB0A 1QAHA 1KIMA 4D96A 2JVJA 1F4VA 2C83A 2ZJ8A 3QFFA 4QODA 4HAUA 5ES3A 5I7EA 2IHJA 2H3EA 2C2ZA 5CURA 1GLNA 1SXJD 1T1RA 2H1HA 4TSFA 5A6SA 1J23A 2RGNC 3T0GA 4JYZA 1EQUA 4WI1A 2JLAA 3HTNA 1UK7A 1U7WA 2EBHX 5B58C 2XOKA 1VSQA 3WLSA 3CRMA 2QLFA 3R6DA 4R6XA 4GPBA 3BSFA 3RADC 1FU4A 2EW1A 1YJXA 1Q12A 2QWXA 5CEFA 3ETDA 1I9CA 1JW9B 4L9RA 3V33A 3KQLA 4X61A 4KX5A 3Q8LA 1YUBA 1QIIA 2BBWA 2JH3A 3CPHA 4XIGS 2XNCA 4W7IA 5AKIA 1FSGA 3RTAA 3UXMA 4A1FA 4JSTA 2CLEB 5FOVA 3D8RA 2WB4A 2YBDA 3F74A 3FFAA 4YRIA 4X20B 2GYWA 4BASA 2QBYA 2QVXX 1YQEA 2C29D 4MQFA 1SR8A 2HLDA 1GPMA 4H35A 4YR9A 2F3UA 2Q8QA 4U2BA 1Q0TA 4EY4A 1BDBA 2GYUA 3HJTA 1WW8A 1I30A 2R25B 4ZYVA 3UWSA 3LV8A 2X86A 4EL5A 4L7QA 3C8UA 4EHKA 4UD2A 3EODA 4IIYA 4J1TA 3ZW9A 2DFKB 2TS1A 3NJ8A 1YZFA 3OZBA 4FDTA 3KFVA 1CCWA 1XCGB 4TL9A 3H83A 1CQIB 3FNQA 4I9FA 4NS1A 4PV7A 4KGXA 3FPBA 5JAPA 3ZVMA 3SC3A 5GINC 5M34A 2C2BA 1PJCA 3GBPA 2OBBA 4BEWA 2IT1A 2ZI6A 2OXFA 4H0NA 5JEDA 2DLCX 3UK1A 3U56A 1KK0A 1JR3A 3EXIA 4FFBB 1VMIA 1GNQA 1W59A 1S8AA 1F12A 2QRJA 3VNQA 3ZWXA 2XWBF 1IPFA 1I1QB 1TU0A 3EGXA 3C8MA 3L8MA 3VKFA 3RYFA 1VI6A 1JEAA 1TM4E 1XL0A 3R8FA 4IGAA 1T0BA 4LC9A 3ZWDA 1ICEA 4URVR 4BRZA 2GCNA 4K86A 4INAA 3SC2A 3FFXA 4R9RA 1J56A 2XDWA 3R5XA 3N8GA 1C1XB 1N7JA 4XD7A 5EI5A 1MRNA 1E9AA 5IFLA 3NDBB 4R2LA 4O2AA 2R1TB 4EMUA 5JRZA 5GIPC 2UZIR 3FX2A 1OZFA 1AGXA 2W58A 4M1WA 4QJ3A 3OSZA 4B4OA 1U65A 3PE3A 4G37A 1J2UA 1P1RA 3DVAB 4E2ZA 5HM8A 2J09A 5H3HA 4X1OA 4BGIA 2A5GA 3UQZA 1MD9A 5FPYA 1IHXA 1LLCA 1IQUA 1N7IA 5DBHX 6ADHA 1HLFA 2QTFA 5BNFA 1VA4A 4M83A 2B8TA 1V5WA 2NO9A 1AGNA 3P5SA 4R1MA 4Q1CA 4V0MA 4MRSA 5K8VA 3WJRA 3LFOA 1IMOA 2XE7A 3BUSA 1UCFA 2EX0A 5E7JA 3EXAA 4LXTA 5TT1A 1G6KA 2ZXFA 2C5EA 2XMRA 4XZ3A 4ICIA 3MCAA 2XB2A 2DCUA 4QBGB 1E3TA 2PZLA 3A2LA 3C3KA 5K3FA 4KXNA 1NJGA 3JQQA 2WB2A 3EGEA 1J09A 1ODIA 4L5BA 2UYNA 4ZO7A 1Q95A 4P7KA 1ZCAA 1HQDA 3EZ6A 1NU8A 1FTYA 1IHDA 1LQUA 3H1EA 4XSVA 1RAFA 3JYHA 2ZT5A 4EMTA 4GWGA 1JX6A 4B3FX 4TXLA 4FX2A 5LLDA 2QG4A 5FUMA 2P2DA 1ODSA 1QBKC 3SG0A 3KEOA 4C14A 3Q7EA 2G0TA 2WG0A 3BRQA 5EO3A 2R44A 1MABA 2XNKA 1S3GA 1ZI8A 2OCBA 4HLQB 2XE8A 1XB2A 2OZKA 1Y7LA 2W11A 3REQA 1S8OA 4ZJYA 2PJZA 1VLZA 4AYTA 1GKKA 1PZFA 1M1ZA 4I6JA 1CNMA 4JR1A 3WQRA 1Z56C 3KZMA 3ZD9A 2QN9A 3I58A 5ABPA 1XELA 5EJIA 3ORFA 1WW2A 4QVIA 1BU5A 4P93A 2IBMA 4K6KA 1ZMBA 3D5QA 4L7VA 2ZJ4A 3I53A 2PNJA 2C0PA 3SR3A 2NUPB 1E7KA 1P19A 3ON5A 3FUVA 2QYHA 2YRWA 2O07A 2YHUA 2FPWA 3NEJA 4R69A 4UVIA 4Y2YA 1B41A 4DIOA 3THXB 4F8YA 1G5QA 5G0VA 1Q92A 3HDVA 4BJHB 2XOXA 3P9NA 3IA2A 4HQFA 4UCWA 1ZJ5A 5KWIA 1AK9A 1TLTA 3TH5A 1FJHA 3K53A 3KBOA 3ZWQA 3W8FA 4BVTA 5K0JA 3ZDEA 1HMPA 2KYRA 1KKLA 3NHZA 1QO9A 3EMKA 3NBZC 4Q3LA 4EZBA 5C5CA 4CI9A 2IUUA 2XXAA 1XKLA 3A4MA 2HFKA 3B8EA 2D2IA 3VKVA 1PWHA 4BMXA 5IW8A 2N1BA 2VPQA 1N6NA 4MRAA 4RVOA 3K9QO 5JXJA 1RKBA 3ZBUA 4WY5A 3BWMA 1ZOLA 2QA5A 3BH0A 3TLCA 3RHZA 3K0EA 2QENA 3WNCA 5BMVF 5G41A 4JI2B 3GFRA 4CVNA 5K2OA 1SELA 3KOYA 5JCPA 1JN0A 1LSJA 1SHJA 2QDKA 4KE7A 1CD5A 2WTAA 5JS7A 2FSHA 4OHRA 1CJBA 3ILVA 5D3QA 3PR3A 3GRRA 2P0EA 3K70D 3GFTA 3O4FA 2QIOA 3BXZA 1PQUA 3AW8A 1XQ6A 4O4IA 1TVKA 4X1IA 2C7BA 2PRSA 4QEKA 4LF6B 3ADDA 2KSQA 2ECFA 1RS0A 3FHJA 2EWMA 2UUCB 1KERA 1XE3A 1C1XA 2I2BA 3VOBA 4Z5XA 2B4KA 5A2GA 1AHIA 3QFRA 5DGTA 3UXEA 4BT3A 3QEJA 2YOGA 2C4MA 3PE4A 2PL9A 4IFEA 1SXJB 5B6PA 3W77A 1VK3A 1BQ4A 1FBNA 1S01A 4EGFA 4NCBA 1RM3A 2XEXA 3C98A 3LUGA 1VE3A 4C3VA 4CM6A 1JG6A 1K89A 3BL5A 4AIRA 4EHJA 1YJNF 2QGNA 2RJNA 3E2IA 4YP7A 4DIBA 4HNAA 3USZA 3LOUA 1VFNA 3AK4A 3CRW1 2ISQA 4OUDA 1LEHA 4WXYB 1TB4A 4ZDWA 3KT0A 3AFMA 1PR2A 2BH9A 2VPPA 1G20A 1QP8A 4RO0A 4YHHB 3R09A 4OHOA 3GW8A 3RV3A 3CWCA 1Q22A 3AESA 2QMZA 2BZ0A 4I8DA 4YAOA 1JZSA 5EHGA 1N2BA 4D26A 3FR8A 3UJPA 1YFZA 4KREA 1KI4A 4PO3X 1COWD 1G3MA 2Q7XA 4DDUA 4I6EA 4RGYA 3TX2A 2B4QA 4GEKA 5FOTA 3GZNA 2QVBA 4QGHA 3N87A 3HHEA 3UGKA 3FBTA 4A16A 3HUTA 1G8JA 2XJ4A 2LIPA 3DE3X 4FSXA 4U7WA 5K05A 1E0AA 3UTDA 2QLLA 1BXKA 4MQFB 1SG6A 2JFXA 3IP6A 4G24A 1DPFA 3E58A 4PLCA 2AFIB 4ZODA 4DVJA 3WK6A 1NNI1 1SCAA 3RNLA 4ETIA 3LBHA 3CE9A 5KWSA 1T34A 1T4BA 4Y0AA 4DR3B 2H8EA 2NYRA 3ZCTA 2D54A 1I1OA 1M34E 4MUXA 2VDNB 4C21A 4E09A 3T5PA 2Y0EA 4FYIA 4WXPA 1I14A 1Y0BA 1YBVA 4HVCA 3COJA 3Q0EA 1ZD5A 3G49A 3GELA 3DG9A 3QVJA 2DQSA 4IF6A 2POQX 3UAVA 4GZLA 1SUSA 3QOWA 1MA3A 5IEBA 5HR5A 1Z2DA 2D2FA 3CX7A 1PV2A 1PL8A 5ALHA 3E2PA 2OLKA 3SE7A 2PL3A 1IC6A 2GAOA 3N2EA 3NANA 1JJVA 4UXHA 3NNSA 5BYKA 1GPH1 2JAXA 1ZNWA 2DETA 4OAPA 3ZXUB 5MFZA 1YU6A 3HCDA 4YJGA 2GZ1A 3AEKB 3WYBA 3LY9A 2XMGA 2ZWVA 2P5YA 2J6CA 3KTFA 1S72F 3MRTA 4IDPA 7REQB 3M81A 1QFMA 4CIAA 2EFDB 1M90H 2Q6TA 3N0XA 4PZUA 5H16A 4N7MA 3PVSA 5B4VA 3TGPA 3EQ8A 3IEXA 5LP6B 5JADA 1D4AA 2GBIA 3CCQF 1W29A 2UZHA 4BB0A 4RPJA 3IQFA 1E99A 3RC1A 1JLRA 1ZCZA 3S0YA 2FH5B 1I7PA 2DYKA 3LC2O 3NT2A 3WWDA 1RLUA 1H8HD 3IIMA 2UYQA 1BS1A 1CDOA 1ZGZA 4F97A 1Z6TA 4G23A 4DLWA 1QYDA 2FGJA 3B1ZA 3T1TA 3KOWA 5KQLA 1U8XX 3STYA 3VOTA 4BO0A 1A7KA 1FTNA 1IDOA 3QLEA 1QRAA 4MUAA 1SN7A 1ST2A 1SUPA 1XU9A 1Z0IA 4EVRA 3EEQA 1USVA 4Y0NA 4Q4DA 4BO4A 2Y1GA 3KIZA 3L1VA 1BMFD 3T7IA 2C4KA 1E7MA 1XTPA 4FJ2A 3W5VA 3ESXA 5EAZA 1R3DA 1ITZA 3EGOA 1WPXA 1LBHA 3KVVA 1WZUA 4JJEA 1Z2EA 2H51A 2NU7A 3GMDA 3NO4A 3H9EO 4RF3A 4R9NA 3LK7A 3EIXA 1WNTA 5AKJA 3EZGA 1FXUA 2P3QA 1MRSA 3ZH9B 3ZJYA 2FI1A 3I3SR 4C0WA 4DBVO 2WF6A 2C5HA 3PQCA 1KFBB 4LOLA 4LUCA 3I61A 4K9MA 1MNAA 3NUGA 2X5JO 1T2CA 3BPSA 3OU2A 4Q15A 3Q2OA 4ONEA 1P61B 3CNNA 3LX6A 3NMUF 4LHZA 4IQ8A 3H0CA 4NK5A 1KYVA 1WB5A 4UREA 2GPAA 4NG5A 4BYMA 4DN6A 1RFGE 2ID7A 5BSHA 1ZM7A 5JV5A 5GJVC 2RGRA 1NZJA 2UZ1A 2OKGA 2YIMA 1UC9A 2BTQB 13PKA 4B2LA 1K7YA 1UKEA 3FSGA 3IR7A 2OTCA 1J07A 3TOCA 5A62A 5IEJA 1WQ3A 1L8QA 2C4UA 4KLZA 4D5EA 3C6YA 2WDZA 2ZRMA 2R2GA 4YRMA 3PEYA 1GZ7A 4E5YA 3J81A 2CE2X 2VTKA 2WSSA 3FWNA 5E8JA 3HTXA 1NJ1A 2Z58A 4N6NA 1ZUWA 2RHCA 3D1VA 3IUJA 4XGRA 4A5OA 4EX6A 1SKAA 2ASEA 1BQEA 1R0SA 4U2DA 4XB1A 1E2MA 2BAGA 2YV1A 3IAUA 3DM5A 4KLCA 1U7XA 5HYVA 3GT3A 4DIKA 1LVGA 1QGUB 2AK3A 2WSLA 3G2OA 2CL6X 2B4YA 2CL7X 1QE0A 4W5OA 3QQ5A 2A58A 4MUJA 3KUKA 2OCDA 1L5FA 5F3RA 4CKXA 4EA7A 1NJ2A 4J94A 5I45A 4H6WA 4K81B 3GJTA 3G17A 5AKKA 2P9YA 3UFXA 1TFRA 4BCBA 1YF3A 1RQXA 2AE2A 3EIHA 2BM0A 3DNFA 2GZHA 3I6ZA 2P1ZA 3S6JA 4DIMA 4XVUA 4AJLA 4IIUA 1OLSB 2AH5A 2FWNA 2RGDA 2C42A 4MV8A 3KFXA 1OF1A 3DBRB 4N18A 3E4CA 4UFPA 4IP0A 3M6LA 4XWOA 1O0CA 5HP7A 3PWSA 1UKBA 4RANA 3VUEA 3IILA 4MVJP 1C3OA 4TWIA 4I1VA 1G7RA 1V8BA 1NV9A 2G1UA 4J3NA 4LF9B 4LMRA 3WYNA 1PDVA 4LY0A 1E3WA 1GZ4A 2WAYA 3ZIUA 5HZKA 2Q3LA 2Z6VA 3U9LA 4HXFB 3V80A 4YV2A 3L8FA 3Q10A 5CHEA 7MDHA 5IJAA 1H2XA 4I50A 1KSFX 3T5AA 2CF5A 3MVEA 5EUBA 2WU1A 1KFEB 2IP1A 3EVDA 5LQRA 4ESVA 3C7AA 4NWOB 3L6CA 4BAUA 4P35A 1ESZA 1FE8A 1N9GA 2PZEA 4X92A 4B2IA 4KI0A 1ZQ9A 3PEVA 1QX4A 3U1BA 4MPDA 1TEHA 3D1JA 4KSBA 2JGEA 4C3UA 3GN1A 1DV2A 2GK3A 2W48A 5CAEA 2GPYA 4A82A 2HCBA 3ILSA 4Y2UA 1UOOA 3TVDA 4M0LA 2X1MA 4CODB 2C4NA 1SC4A 1Q0PA 4UTXA 3X1MA 3G4SF 1IN5A 3DO5A 3DPIA 3KR1A 3PQDA 4H17A 2XTZA 3DCJA 1XTVA 3K16A 1QGYA 5CFNA 3IDFA 3B7PA 1JWAB 3TSOA 5DI3A 4H3SA 2WM8A 4LX8A 3D00A 4YUZA 2D8AA 5HILA 3I83A 1MAHA 5FF9A 2ZU6A 1A76A 1TVMA 3C3PA 1K9SA 3ZHCA 2FW7A 3QEMA 4G0MA 4AJ4A 2HV8A 4I5IA 4DSTA 2FWBA 3FOBA 2O2CA 3K1ZA 5JE8A 1PS0A 4NJEB 3RS8A 1P3JA 1LPSA 4D0SA 2Q5EA 2HN9A 2OCGA 2WJGA 4LZLA 2PLAA 2W2LA 4KN6A 1VGVA 2RSLA 3AEQA 3TDMA 4EPTA 4REMA 5EQJB 3L4EA 3L5KA 1MAVA 1PDWA 2JLZA 3CEHA 2WP8J 2QUBA 1XPOA 3VTIC 2HIGA 1NMXA 3CR3C 1R8YA 3BWVA 3V2GA 2WHXA 3V7FA 4BBPA 2H1VA 4XDGA 1W36B 2ZI7A 3V4FA 3DD1A 4YRKA 3OTWA 3CEPB 3K6SB 5AQ1A 4K88A 5CNMA 1Z3CA 1JF8A 1CZOA 4C29A 5DX1A 1RJEA 1FUUA 3U80A 1IMJA 4F6RB 1RACA 4I3GA 2OO3A 3BIXA 3CBGA 3TJMA 4A6DA 2IS2A 2QTBA 3FAKA 2JCSA 2WRZA 4G63A 1QRDA 1JDVA 2GD0A 2QVCA 4U5XA 1HE4A 3Q0IA 2HJSA 2QZZA 3IQIX 4FYYA 4K46A 3ADOA 2E5FA 5D5QA 4U7DA 3ZI0A 3ASYA 4GMKA 2OK8A 2NO5A 3QTLA 4WJZA 4IGFA 1NVUQ 4JNCA 3U16A 4OK5A 1G38A 4II3A 4EVSA 2FSUA 1KORA 4ZIRA 2IS6A 4PZYA 3IOBA 2VL7A 4Q3DA 3IDOA 5IP5A 1EK0A 1QGZA 5D3KA 2FGYA 1VYUA 3IQGX 4UEQA 1VM6A 2BUAA 4RJLA 1T1IA 2TRSB 3MLEA 3VHLB 3AVVA 1YL5A 2GK7A 2FWPA 4HSEA 2DJIA 4IJKA 3RLIA 4YMGA 4M1YA 4HG2A 4AF8A 1QU2A 2BFDA 3HJNA 1BN7A 5C34B 3D3WA 1EX6A 1ZG3A 5CBKA 1IXYA 4BO2A 1R3UA 4O5OA 1U0OC 4ZCPA 4IFBA 3L6EA 4Q1EA 4XW2A 3SBXA 3TF5A 1E7QA 5TMBA 1UOEA 1YMVA 1JLSA 1WBJB 2G67A 2V4ZA 3R40A 5EJFA 2R96A 4P4LA 2X9NA 1IN1A 4B73A 4X71A 1ZWLA 4OBWA 3VYUB 4WPGA 4ZI3A 3K9WA 5FEMA 4OQXA 1PEKE 3E1GA 4F2WA 1ADYA 4N8EA 4M7WA 1Q0HA 1FRZA 3SQOA 5B2FA 2CFCA 2PUVA 2X4GA 1ZYUA 2NXJA 2O4CA 4QL3A 4QU5A 4JT2A 4R2JA 1S6YA 3CF0A 4IH1A 2IHVA 1Z9BA 4KK4A 4D0GA 2A2ZA 5K01A 5AW2A 2BEJA 3AETA 5KNDA 5KYXB 4GRAA 3A6DA 4J3JA 1IJFA 3IT3A 5CX1A 3UHOA 4OXQA 2RCNA 5KNBH 3MRVA 4EITA 2J4DA 1K98A 2BE7A 1M2HA 1VL1A 1P2DA 1BCSB 2QUJA 3N2KA 1IM8A 5HF9A 5AHRA 2ODNA 3OHMA 2OWEA 1A27A 2E6KA 2JZCA 3CG0A 5BOVA 3VOSA 3LO8A 2QR2A 4PQGA 4ZOLA 4EWLA 4F7DA 2J7PA 5FJ4C 2WW8A 4JXKA 3TNYA 1T9KA 4MB0A 16PKA 3CNLA 3WZMA 2FW6A 4DIFA 2C4VA 1GITA 2QR5A 4ACAA 2G63A 1R0RE 2WD7A 4KQ1A 4I3HA 1ZRHA 5JMOA 4NYMR 1DVRA 3Q7PA 5EGNA 5A5EA 5AKHA 3TJRA 3MJVA 4OXXA 1XV2A 2AC2A 1VIAA 1PNVA 2DFTA 3L7OA 2AMFA 1E9DA 2FHPA 5H1YA 1CVRA 1K6EA 1WCV1 2FZKA 3PC3A 5C5EA 4N48A 2L17A 4X9XA 5HQTA 1HR0B 4UBIA 1EFRD 1FUYB 1DELA 1Q0ZA 1W0JA 2I80A 5KYGA 4CEJA 1QIHA 1UDWA 1LDGA 2FG7C 2O0JA 4U2FA 1C2TA 3G8BA 3IJEB 3DOHA 5HJ5A 5JXWA 5IARA 1V96A 5CD9A 4FOOA 1VCHA 2HPVA 5T4EA 1IONA 3LBFA 3P2IA 1NF9A 1Z15A 1U2GC 1ZMTA 2C9DA 4KE9A 4E1AA 1Z5ZA 1V5GA 4FMDF 2HT6A 4ZVPA 4IRUB 2X1LA 5AK0A 3H5LA 5B53A 2HA7A 1MAWA 3I9V1 3ETGA 4G2NA 2QDXA 4UAUA 2X2PA 3VR4H 2H2GA 5K3DA 3O83A 3C4VA 1K4KA 2IODA 2BOVA 2WALA 2R6ZA 5EMHA 4LSZA 5JDCC 2W2KB 4QUBA 4EY3A 2CMGA 2EP8A 3WSWA 3QK7A 1RWXA 3EZ9A 3HM2A 5AM5A 3RABA 4LRSB 3CLSC 4G0QA 1DTSA 1UI9A 5K3CA 3DHVA 1SUEA 4M9SA 1EQ2A 3WX0A 2X8JB 3RC3A 1C3VA 4L02A 3LYUA 2JLWA 2JKZA 1G6OA 2ET6A 2I4IA 4H7JA 5CVJA 3AR4A 1U04A 3EZ7A 3R7LA 3C70A 1D4ZA 2ZYDA 4IOKA 1Z5UA 3BIOA 2WUEA 4UNQA 2VAPA 3SFVA 3PIDA 3OM0A 4HQKA 1CQIA 3FHCB 4XM0A 1QIFA 1NTRA 2O2HA 5FTNA 4W9NA 2V1XA 5JSZB 2GCPA 3WLOA 1QHIA 1P0IA 3CPEA 3I2IA 3PXXA 3R7NA 1GA4A 1M7HA 1W93A 1WMSA 1WP9A 1EWRA 2V3VA 3CR8A 4A0HA 1H85A 1NJ6A 1J24A 2WJAA 3L4BC 3KAKA 3O9VA 3V5NA 2FGKA 3GZNB 1SZQA 2ZXEA 1CIPA 4P4UA 3E15A 1RCFA 3EDRA 1IQPA 1FRQA 4Q6WA 1W5AA 1ENZA 3VCZA 5SYNA 1KI8A 3T38A 4AY4A 7MHTA 1XU4A 1YE8A 2PGNA 2FRVA 2RD2A 2DWOA 1JLLB 4KTVE 1JSCA 3NAZA 1PT9A 1Z2NX 4PANA 1DBRA 1X7GA 5T57A 3T54A 3WJ7A 2AIRA 1RPAA 3RU9A 4MCIA 1II9A 3D6UA 3I9NA 1UFVA 3ZE7A 3B53X 4L07A 3B38A 2X5XA 2VSXA 3LY7A 2SKCA 4H1WA 2QQ0A 5AVMA 4WXEA 4R9VA 2QB5A 2WF9A 1NQVA 2QXUA 4ZN6A 2BEVB 4YCDA 3H3JA 3TSYA 4PC6A 2CWJA 2CYAA 3TZHA 1CJCA 3AEZA 2XVXA 2ZKLA 3VDQA 4M7PA 3JD0A 2V96A 4Z4CA 3AVPA 1E0DA 1SVKA 1YVDA 2R60A 2PZ8A 4RA6B 1IB0A 5CLJA 2ECKA 5I9MA 1OT5A 5KNCH 5EKXA 4Q7KA 1TQ6A 5BT9A 1LNZA 3LBNA 3W9BA 3GARA 2RFLA 2CXXA 1AT1A 3HB9A 3VSAA 1WVIA 3I4LA 4RUKA 3T4XA 4XDHA 4HP8A 4PXAA 4UU1A 2VJDA 1K9VF 1XN4A 1E9BA 1ZNYA 3FHOA 2HSZA 5AKLA 5KAPA 3H9QA 1E1QA 1MC4A 1F8UA 1LI7A 1RKUA 3AHHA 3LE8A 3M3PA 1YQDA 5AI8A 5FQNA 3T9AA 2CVFA 5THQA 3ZCQA 2UYHA 3PRJA 2GM9A 3A9WA 4M0CA 4DPKA 4ER6A 5JZMA 3KE9A 5K99A 4MV9A 2AJBA 4HOYA 3PUXA 4CLRA 4Z3KA 4W5HA 1MB9A 4FHZA 3ADKA 1ZGJA 2VP3A 1EWYA 2FPRA 2JHCA 3EJWA 5GY7A 5JPDA 3HNRA 4DLVA 3FWKA 3ZLUA 4DV2B 2RHJA 1XRNA 2B3TA 4X5OA 5G1PA 3GNSA 4CCSA 1ZSYA 3A9CA 3NIFB 1AQ6A 1WNFA 3QI7A 1W85B 5FEUA 1P29A 1X38A 4BE7B 3G0OA 1BZYA 3BA6A 5CFPA 3F6RA 1QG6A 1ULUA 2WMDA 4N54A 3Q1KA 2IUSA 2HNBA 3M6FA 3OCUA 2XGJA 2D3TA 2Z30A 3AJAA 3G89A 3S2YA 4BFLA 3C74A 3DE1X 5I9SA 4BJ6A 1W0JD 4ZMRA 1E3DA 4X94A 4ZI7F 4TLBA 1UMKA 2X7HA 2B21A 1DRKA 4HNHA 1M1UA 1XZNA 5LCXA 4D8WA 1T2AA 2AXNA 1JDSA 3B12A 4RVCA 4X8LA 5L3VA 2GRUA 2NQ8A 2Z9BA 3E9NA 2B82A 1H9AA 1GTJ1 1N8NA 1TLFA 4O4JA 1JH8A 2X5NA 1ZQ1A 2FPLA 3A3NA 4PHHA 4U2KA 5IDXA 4Z54A 5KOHB 1VE7A 5KSOA 2FQ1A 1JFFB 1E4EA 3DCNA 4I66A 3K8YA 5CGZA 1A9XB 3EGIA 2HCRA 4KACA 1H2FA 2VXYA 1WHTB 2AEFA 1B43A 4RZXA 3KSUA 5ADVA 3ZX5A 3ZHUA 4QYIB 3HJAA 4CPDA 3X2EA 1UBOS 4BMNA 4F84A 4FEEA 4Q16A 3ZJ4A 4Y9DA 1JWLA 1ZVKA 5G40A 1F8XA 4DAEA 3AM5A 4O6VA 1RQ7A 1UL1X 3T12A 3GEEA 3SDBA 3GWZA 1TM5E 2JD1A 5CW1A 5F3DA 4B85A 2F8TA 1PS8A 4X8HA 3MCQA 5FTKA 4ZPXA 1L8XA 1C8KA 4V2UA 3A3YA 1M33A 2OP1A 1L5HA 3TIIA 1LGYA 1HDEA 3ADPA 4TKVB 5EUQB 3ZHVA 2ZRCA 1C0LA 1KMCA 1Q0QA 3EPPA 3IDZA 3C43A 5FULA 4XQ0A 2EG9A 3W79A 2NZVG 2GPJA 1QUEA 3LY5A 2C88A 5EHZA 2MSLA 4HEA6 3TSWA 1VHWA 1YASA 5HFNA 1HNZB 3KOXA 2UKDA 3FG9A 3INRA 2C9MA 3OJFA 4KQEA 3ZK8A 4MCJA 5LPNA 2B2NA 1DQRA 3RJ9A 3UAYA 3QWHA 3H1GA 5CJJA 1Z8DA 1DL5A 1J8DA 2UAGA 4MIOA 3PF8A 1ORDA 4C4SA 2ODPA 3QU7A 4PC7A 4AMGA 4BVAA 4HYEA 4QLBA 4RPIA 2NNWB 2G5CA 1QGDA 3BX1A 3N59A 3P27A 4GIBA 4JNKA 5AM0A 4GXNA 5EWLA 5FNVB 4BVRA 1NP6A 4X97A 2Y1EA 1O96B 1GPYA 2IYRA 3GLIA 1COMA 5G02A 1U8EA 5JD3A 2EC5A 3AZPA 3HY6A 4K5QA 3GFSA 2B35A 5F9HA 5KTSA 1Y3FE 2I71A 2H0QA 3CEMA 4O1HA 1U9ZA 3ABZA 3SICE 3JRXA 2RHHA 2FWMX 4MV0A 3FDJA 4UU8A 4EKDA 1X1AA 3KSMA 3HO8A 2BHLA 4QELA 5HKBA 3O7MA 1MVLA 3C85A 2JI4A 3COPA 3VGJA 1UC8A 2D0OB 2EFEB 2ZUTA 1KJ8A 2BM1A 3FPCA 1AZSC 1LFDB 4I50F 4MVWA 4IIEA 2NO6A 2X40A 1AUPA 3B3JA 3I05A 4IHQA 1FP4A 3QLUA 4HLUA 2E9SA 3F9IA 5FOXA 4ENUA 4AI6A 1U0EA 3Q3IA 2BMVA 2J5QA 1LW7A 4KODA 4D3SA 4ZYYA 5AIBA 2MYNA 4OAOA 5L8VA 2M6LA 5HEKA 4KYTA 4FGWA 5K8TA 3GCWA 5AM3A 2FQQA 4NFLA 3T34A 2XKAA 2OGZA 2DG2A 3HS3A 2KWIA 4AB1A 4K1XA 1E2UA 1I7SB 1KMQA 3K1JA 1WF6A 3B5JA 4PZEA 2P2CA 1H05A 5A7FA 2H92A 5IJ0A 3AEKA 4G5GA 3PC7A 3C14C 1L3IA 3IMPA 1NNUA 2W6QA 4Q9JA 5FWDA 3VR3D 2NXNA 1K5DA 3GGOA 1PWEA 1AGYA 4TS3A 3PVCA 4EBFA 4JWKA 3FCXA 2JAUA 4WRRA 5ELLA 4NJMA 2WLTA 2ZIXB 4K6CA 2CCGA 3UGQA 5I7VA 4B3MB 3GJ7A 2GK6A 3MJDA 3T7TA 3MOGA 3BS4A 1W36C 2O2YA 4IIDA 3SFZA 3CLSD 1OYOA 3RK4A 3OPQA 2D1QA 2GX6A 3QKRA 2AKAB 1A9ZA 2WNHA 4NOJA 2CCKA 3UMRA 2O48X 1X42A 4Q82A 3PNYA 5DN6D 2PL1A 1YQTA 2BEUA 2DERA 3LT2A 4G8DA 4PRZA 3ZLJA 3PC8A 1GQ2A 4Z0PA 4JP3A 4LYDA 2EP7A 3RV4A 2G71A 2VBFA 4IEEA 2FJ0A 3FPHA 5LM3A 1OILA 1TA4A 2ZRDA 3GGJA 4I55B 2QTVB 3PVZA 3AHGA 3EIWA 1G1MA 4NDZA 2VSQA 4ND2A 2GVNA 1NT4A 1TT5A 4CRWB 1H2WA 4CL8A 3MHPA 2F67A 1OB5A 1W49A 1VQOF 3HU3A 1XZLA 2J3EA 3AY3A 4HFMA 4DSOA 5E95A 3DDNA 5KS2A 4GWKA 3R4VA 4YLYA 1Z2OX 3K09A 3G9XA 4ATNA 3GZJA 1FZTA 2G28A 1GNTA 1U99A 1VXOA 2VA8A 2VRWA 4L3WA 2NMUA 4WOJA 4YA6A 1BO6A 5HTKA 3U3XA 1M2GA 2QPLA 4LWQA 1CYDA 1KYTA 5TV2A 3UJHA 1WBDA 5BWOA 2DLDA 4LY3A 5DIZA 4IFIA 2QLNA 3O9ZA 2FRDC 4D3FA 3NHUA 5F35A 4LFAB 2OV1A 4W9RA 1IVYA 4CLRB 2GGSA 1OGJA 4DT1A 3B7WA 5D84A 4RTOA 2CKDA 3BKXA 2Q1TA 1QIKA 1SD1A 2COKA 3NC1C 4CM4B 1US8B 2F3PA 5C8YF 2BELA 1F48A 1OYVA 2BKEA 4H16A 3OY2A 4HYQA 3NWOA 3IVAA 4CR8A 4EMSA 1F6WA 1ZIOA 2WZDA 2BTOA 2Z4RA 1OIWA 2X6RA 3GFFA 1YVRA 4C5CA 1RHMA 2XADA 1YR7A 1CEEA 3B3FA 3I5MA 1V5EA 1MIHA 1OXMA 3TWOA 4AMUA 4ZHQF 1N1EA 5IWAB 2HBRA 2PT7A 1J8FA 5LP6A 1PR1A 2DQ4A 2TSYB 4MWCA 4OU5A 5FOWA 3SGLA 3UHJA 1V9SA 3QVMA 4C5AA 1HRKA 4CM8B 2ILVA 5CCBA 3CUVA 2VZ8A 1GDHA 1Q3TA 3O8OB 3HXOA 2O2DA 1I7DA 1LBQA 2IK8A 3PDWA 3TRIA 3ZWNA 3UFBA 2D5AA 1OU0A 4P2GA 5D6OA 2QN6A 4Y67A 1QMPA 3PXDA 1AKQA 1TA0A 1E2JA 1QIEA 2NO7A 4J7CA 3AFGA 1YIDA 1SXQA 1T3GA 1HE5A 2YCLA 4XD2A 3V1MA 1DAPA 2PM8A 4YRRA 5LZ7A 2JLCA 4ZV9A 3SYMA 5BSMA 1JMKC 1NLUA 1BE1A 2P7IA 1GXSB 1V37A 4EYKA 4TTVA 1EDEA 4G1VA 3WLTA 4KUEA 1FX0B 5C8YA 5IT4A 3LL7A 3OAAD 1U3VA 1CZHA 4H0FA 3DEZA 1LPMA 1YCFA 1G2OA 1SZPA 2E18A 4E2FA 1EE2A 3BJEA 3KLOA 4XB2A 1YKFA 5K0TA 2ZTSA 3ZKWB 3IRVA 4Q4HA 3ADBA 3CXCF 3LMKA 4D8YA 1ORHA 5KTPA 4JI8B 4GXTA 1SXJC 5BQOA 3EXHC 1TYCA 4ZDIA 5HE9A 1KU0A 3DHEA 3U40A 5K6RA 1IZ9A 3MIZA 1VJTA 2W00A 1N1MA 3VR2D 3JSXA 3RT1A 3UWPA 3KV3O 4EO4A 2B1IA 3S8YA 4OIMA 5IZ4A 2BJVA 3BL8A 5KIAA 4J6FA 1K63A 1NFQA 3BCHA 5E6SA 3D43A 4YQFA 5B5SA 3QEOA 1QV7A 2CFSA 1Y34E 4IOLA 3ABIA 1NVWQ 2YVLA 4MKXA 1HT2E 3S0WA 3RFFA 1PF5A 4FQ7A 4CIBA 5IXSA 1VHTA 3M6MD 4EJMA 3N0WA 1L7RA 2R7MA 4HTFA 4CF4A 5BO5A 1MUUA 3ZG6A 2HJWA 2WIKA 3OCYA 2B78A 3PNBA 1JGTA 2QU7A 4C3ZA 4WZBE 3WZ2A 2UVQA 4LRQA 4PLGA 4CJXA 3BMXA 1BCRB 2ZS9A 2V5AA 2VWQA 3I72A 1U7ZA 1YU9A 2Z3WA 3X1XA 1WJGA 1XWFA 2QMEA 2VOJA 4HWTA 4EX7A 5F7OA 2CMFA 2C9YA 2JI9A 1T5SA 3OHPA 4F56A 4ZGWA 4WCFC 1W76A 3HJWC 1U3DA 2ZTLA 2GOYA 4HB2A 4LXQA 2W6PA 2PMPA 2ZRBA 2XZDA 1S96A 3CZCA 4HN4B 2OC4A 5TF4A 5TGZA 3NHFA 2I54A 1ZUNA 2J9XB 1HKUA 3S55A 4IL5A 4AJ2A 2A9VA 4GOMD 4M6WB 5FTJA 4EABA 5F4BA 1DKOA 3VZRA 2HMTA 3W4JA 4BMDA 3OE5A 5KWEA 4EGSA 1JFTA 3JQ9A 2BMJA 1XTRA 4H7PA 1L8LA 3EIOA 3FIUA 3RRFA 4OBBA 4UE6A 1Y3HA 1I6KA 3OOYA 5JTUA 2XRYA 2A8YA 5LLTA 1SCJA 1J22A 4JQZA 3MT9A 2PN1A 5EP4A 2AB0A 3LSTA 3RFUA 5A5DA 1JV2B 2HF8A 3FLBA 4JI6B 1TI7A 2IF2A 4UFOA 3MK31 3I1JA 3SYNA 4S24A 2OO5C 4OOFA 2HREA 4YP1A 1JEDA 1L4NA 2PS3A 5FTMA 3DKIA 4XR9A 4CE6A 3OKAA 1UBRS 2Y1OA 3BBPA 2IDZA 1ZC4A 1CP3A 3KKMA 4M9UA 4YQZA 4IW3B 4DLKA 3F7TA 3FM9A 1AS0A 2R1ZA 3D02A 4EJ2A 1SVNA 3WGJA 3RK0A 1P2GA 2BYTA 1ZN8A 2ECPA 3D8NA 2XB8A 3I2YX 4KDCA 1U0SY 2HXGA 3HKDA 1EUYA 1GL9B 4PSDA 3W5UA 3ACBA 2REBA 4KFCA 4JI3B 1JDBB 2G9UA 2R751 2NXEA 2YW9A 3C87A 1TUGA 2QM7A 3H5RA 3O47A 4N3NA 2JANA 2P3LA 2RG1A 4OA5A 1TXGA 1OTYA 4I55A 1FP6A 5BN5B 1ILEA 4J0GA 3DDCA 4MO9A 4E21A 5K3BA 4PC2A 1NSYA 2GLZA 1BH2A 2A4MA 3EC2A 4M1SA 5E6UA 3SR0A 3PCRB 1H2YA 4TTJA 1C3EA 1AK2A 1DJNA 1XAIA 2FW8A 4BY9D 4C0QC 4L8VA 1Q91A 2HS4A 1GVHA 1YKSA 2CYBA 2H9YA 2R4TA 3GRUA 3KLNA 4MRNA 4YRTA 3CN7A 3GFPA 3LDAA 3MW8A 1ACLA 1K5HA 2RBKA 4YRLA 4YT5A 1BXGA 3WB9A 2XLBA 5CH3A 3Q0TA 1PSWA 3F5FA 1K88A 3SHQA 3FDZA 4DA6A 2Z5VA 3WG9A 1I3LA 2GKOA 3NAQA 4WV3A 3LRXA 4ZXFA 5JJLA 1KZGB 3ZNQA 3NORA 5ECDA 1O89A 1KRHA 2X6TA 4WLVA 2VK2A 3UAWA 3UK6A 1QHHB 4LGCA 1C7FA 1VG9B 1V1MA 3QPUA 1KZYC 1ZL0A 1HEYA 1U0FA 2X0IA 5CDFE 4ND3A 1VIMA 2PHZA 5AW5A 2DKNA 3DTVD 1V71A 1U98A 2W8BA 2ZYRA 4IG4A 5IH3A 4CEHA 1FY2A 1VZ3A 1C7JA 2Z9DA 3TO5A 3W7VA 2DWCA 1FFXB 5GVSA 5TGDA 1EUDB 5H82A 2P90A 4RKQA 2YVQA 1Z0SA 2I7XA 4F21A 3C5CA 4F5YA 3GD7A 3AJDA 1PVDA 5LQSA 1R5JA 4DQDA 2N75A 4HR7A 1D3AA 4R4JA 4QASA 1GTRA 4JYAB 4QICA 1G7SA 2EZ8A 3FVTA 1X7WB 4BO6A 3LCJA 1IUNA 2P6NA 3GGGA 5LZ5A 4HWSA 4JLNA 4RZSA 1IY0A 1EUQA 3PHJA 3IVXA 1CY1A 2AMYA 2OCPA 2CDAA 2QJTA 3E53A 3H1FA 2FC3A 4G0WA 2D5IA 4NMHA 1YZTA 2GRJA 4IR7A 2G6TA 3S44A 1N2SA 1YB4A 4ZT7A 1J0BA 2JJMA 3ZHOA 5JVDF 2B5VA 2O8DA 1Z18A 3OWXA 1I0ZA 2MR6A 4AD8A 4DY6A 3F73A 1ZXBA 3D2BA 4BMZA 3TPCA 4WADA 6CHYA 2NPFA 3ZOZA 2DTEA 5DBGA 1FQWA 3UJ3X 2W42A 4XRRA 4MP6A 1C7EA 4TZ6A 4O4LB 4IXTA 4LIPD 2GKSA 1EM8B 3RRYA 3VC1A 1YC5A 1BRTA 4UHHA 1TAGA 1YJ5A 3HP4A 1SZDA 4Z0NA 4JJIA 4JBLA 4X54A 4P34A 2PWBA 1QRRA 4XLZA 4G86A 1P1HA 4RS4A 1UM9A 3IBYA 1NA5A 1BN6A 5ALQA 2IFTA 3FCAA 4TTSA 4OQMA 1XDUA 1I80A 4EGAA 5CVCA 1LNSA 1SHZA 1B00A 1IN4A 1U02A 1Q8RA 6AT1A 3CKYA 4KH1A 1Y5LA 2OORC 4JIGA 4F4FA 4Z53A 3COYA 5ICGA 4G6ZA 3E9DA 1FFDA 2PR2A 2A92A 2ZUWA 1CT9A 4HQOA 5DIFA 3W0LB 4BV8A 4ZZ3A 2DUWA 3CUSA 3G13A 4H4DA 4KQ6A 2Z1FA 4UFNA 5JY6A 1O6BA 3MJSA 1IHYA 4KUHA 1UBTS 3AX6A 4PG5A 3E5NA 1ADBA 3CX3A 4U7HA 1B23P 3EDQA 1MC8A 4P3KA 3OBBA 4MI1A 4COKA 1HOXA 3LFUA 4HGQA 1ODTC 1SEVA 2ZSDA 1CY7A 1XHEA 4AY3A 1XCLA 1YVUA 4NP6A 4OUDB 3HLKA 4GOJA 4BNXA 2FX3A 4MGZR 5AKYA 3E1SA 2DGDA 3LYAA 1DKLA 3EOAI 5ALYA 4Q4CA 2OM2A 3KJNA 4TVKA 4YMSA 1H6AA 1N92A 1N8SA 2ST1A 1GPAA 2PH5A 3H05A 1YMUA 4HMPA 2YWEA 4C0SA 1W42A 2CLOB 1EEXB 2H07A 3D4PA 1LA2A 3LW8A 3CCLF 1GA6A 4H4EA 3LWQC 2HBYA 1KETA 2QAGC 2V03A 5EL0A 4F5EA 4IJ5A 4PC1A 1DKMA 2I6FA 4EPRA 5KYUB 2VP5A 1E4OA 3HCWA 2MYPA 5ALZA 3IIJA 1UBCA 3VO1A 2PVCA 4ISBA 3V4PB 1KI6A 2EHJA 3CRQA 1GPWB 1TQ4A 1PGOA 2G4CA 1KZ9A 1Q2UA 3LUFA 4WZAB 3LAWA 4OXYA 4QT4A 4MGYR 5T6MA 3QVLA 2CUTA 1J0EA 3EWNA 4UBOA 3LF2A 1IUPA 1UBJS 3H84A 4JP8A 3TLMA 3ZU4A 1ZM9A 2B30A 3RNOA 5GVRA 2EIXA 3JVDA 4IBOA 4RQUA 2NSLA 1BCRA 1EHYA 1K8QA 5B37A 3SHTA 3VA7A 1XDSA 1V0JA 2MMCA 2OZLB 1FNCA 1Z83A 2WU4A 1TUBB 1U80A 5ECYA 4A0SA 3VC7A 1NG1A 1NNEA 2ZZNA 1IWOA 2ZRFA 4I3FA 3D7MA 4BO7A 4NZ9A 1QZ3A 4RSGA 4ES6A 1UBSB 4XXHA 3SF0A 1NBIA 5ENVA 2N48A 1JSXA 3V8EA 4F9EA 3T5CA 1NUSA 1GL3A 1I3KA 2CVZA 4D4KA 4DSUA 3AHJA 1R10A 2DVMA 1ZK0A 3NV9A 3P9RA 3ZQUA 5HTOA 5CRIA 2WPNA 1TJ5A 3R5HA 4IGKA 4UVGA 4QOIA 4HSGA 3KALA 1L6RA 1P1IA 4CM7A 2OUKA 3WXMB 1DKNA 4XJSA 4RXMA 4ESOA 1IJBA 3AUSA 5FBLB 2CVOA 3GLHE 1K5GA 3C6XA 1UPCA 3OZRA 4RW0A 5AXDA 4DMFA 1GPBA 4JLBA 4CHGA 4FNOA 2I2CA 5FPHA 5FP0A 1M0EA 2O8FB 1CETA 4UASA 3ML1A 3WB1A 1DUVG 1T8TA 4FCVA 5DU2A 1Y7IA 4AKEA 1NF8A 1KPHA 3LPDA 2IQQA 3AUYA 4HQNA 1XFDA 2FEPA 3SNHA 2WILA 3C41J 4K6MA 3ZE0B 4URYR 2X3UA 3HQ4O 1V7ZA 4KFUA 1DBFA 1JIJA 1L7NA 1QMGA 1RRPA 1SC3A 3UMJA 4GBMA 2RHRA 3K0AA 4XKJA 4JBXA 1PBNA 1UDAA 2M1ZA 2RB5A 2W37A 5HIIA 3BFPA 4WNCA 1GD1O 4PGGA 3KDPA 1PX2A 1I1NA 3CBQA 3PBKA 2HLNA 5E3IA 2DUJA 3PK0A 1UK6A 4GICA 1NVVQ 3BMCA 1TYDE 3HZZA 4JBYA 4OH7A 3SC6A 3OE4A 1G63A 2PSDA 1WY5A 4GT1A 4YUAA 3RVPA 1KEVA 1IWBB 4OQEA 2YV2A 3EUFA 2F9FA 3IKMB 3QEMB 4RGQA 5EFOA 5LUBA 3HXKA 5HF5A 2BFEB 4MYTA 5JBQA 1KEKA 4LF8B 3MMXA 4Q5IA 4WZBA 4JLSA 3FYCA 4BXOA 2PD3A 3NBQA 3KCNA 5D7NA 4P83A 4ZYUA 4IO0A 1DAGA 3L6UA 1EAYA 4OHUA 5EE1A 4M1QA 5KAMA 1SURA 1N5MA 3G0GA 4OQZA 3RASA 1O4VA 2O2IA 4FW8A 4ZZ1A 3KQYA 4FEGA 4B44A 4C20A 2GTIA 4J4BA 5B3JC 2QGZA 3L7MA 4EUFA 3Q72A 1XI2A 3SE0A 5JJBA 4GC9A 4JUCA 1UBEA 4MGEA 1A5TA 5I4CA 3BFVA 5FL7D 4B7UA 5DRYA 3I4CA 3RRMA 1GRRA 5JHGB 1OE0A 3RF7A 1BDHA 1TEXA 1THTA 5DOZA 4FBLA 2ETXA 5JD5A 4QQ8A 3U37A 2I6RA 3AOEC 3HB1A 2AE1A 1YO6A 1M0WA 4MUGA 4UXIA 2HL6A 2QRHA 1BC5A 1FDOA 1D04A 4CM3A 1LCIA 3VR2A 2XVAA 2OQVA 2DEUA 1WQ4A 3NP7A 3H16A 3OOWA 4CKCB 1HLPA 4X60A 3QHAA 3PEWA 2HFJA 5CA1B 4C2UA 1IBRA 1N2GA 3OX4A 5FLXA 3PGVA 2I1WA 2ONYA 3DYIA 4K3UA 5EERA 4B40A 1KEEB 1QRSA 3BWBA 4ZCQA 3E70C 1EJBA 1XMSA 4KNWA 2HHHB 1OXVA 4ZHQB 2IJGX 4V0KA 1QNLA 1X7WA 1A69A 2OD9A 3I1YA 3AI3A 3H17A 4HXYA 1F7VA 3OAAA 1WRBA 1F2TB 3OM8A 3PTLA 2KHZA 4HWKA 4GX1A 4R7ZA 2FB9A 4UDOA 5DBIA 2WWVD 3VU9A 4BPRA 4MWOA 1XALA 3R75A 4AS1A 3HK2A 1K8RA 3HB5X 3ICWA 4R8VA 3CUUA 4TKVA 4DMKA 4NPAA 1LV7A 1SBZA 5CPBA 1BX1A 3ETLA 5I9BA 1JQEA 1RRGA 2I7DA 3H1AA 4R31A 5IUKC 3T5TA 1MTOA 4CUKA 5KQGA 1HM5A 2BT4A 2EV9A 1UDXA 4PGHA 5DGCA 1AN0A 1VLLA 4UOEA 1ZCBA 3ST7A 5DHSA 3PDCA 5FUWA 3JATB 4BNHA 1PJ2A 5AVTA 3OZFA 3FDFA 3IEIA 3WB2A 3V6LA 3Q7QA 2G6BA 3KWJA 3SJZA 5JYCA 1LBTA 2Q5IA 1HEIA 3EZYA 4PU0A 4FB5A 1FCJA 2WWHA 4RTSA 4QYIA 3LUHA 1NXPA 4RTRA 4HNVA 4DBLC 1XZFA 1JQLB 4HDQB 4BQIA 3NYRA 1X1RA 3ICPA 3GFOA 3K96A 1M2KA 2AQKA 4BZPA 2JJ8A 4G67A 4DZTA 3PA8A 4PPYA 1DCKA 2C5LA 1KVSA 1NW7A 2P67A 2HU8A 3H6GA 3I92A 4NNOA 3WK9A 4ZAVA 4D5GA 3KT6A 4IEFB 3T06B 2XYHA 1G1AA 1L5GB 3TCNA 3D2CA 3CNHA 4PTLA 1T2FA 3WGQA 3GHZA 3L8HA 2ZR0A 3FPAA 5FUQA 1EESA 4R84A 4KOEC 3OT1B 1R6XA 4B3HA 5IK2D 1XD9A 2E82A 4JUIA 5LLSA 3G6KA 4GWLA 4LNUB 3RIGA 1JIKA 3UT5A 3VZPA 4EM6A 4RTMA 2OVFA 1Z0AA 1N25A 3LUKA 4U1RA 3GEHA 3ZE1B 2GZDA 4E33A 1F2UA 4TM7A 1FOEB 2B4AA 4B62A 4GEGA 3U4CA 3PNLA 4Q3BA 4G0ZA 1NE2A 4JVSB 4UCQA 1CTQA 3C97A 3T9EA 5I9NA 4GZ3A 5FH9A 4MVJA 4UM7A 5ER9A 4WY2A 1TC1A 2P9FA 1WMFA 5G2OA 3KZCA 1C3JA 1XVLA 4C4OA 4MYUA 4BO8A 1DEOA 5HQ3A 1A77A 1OB2A 1XCBA 3P52A 3L7JA 4RU1A 3VAYA 1G8SA 4PTZA 1B6RA 3M4JA 4XPZA 3M5CA 1CJKC 1JDUA 1XFAA 4O4HF 4DREA 3L1IA 4BVBA 2NZ8A 3CF4A 4OCZA 2QD3A 4HDNB 4IVNA 4E1VA 3H8JA 4JEIA 4DVGA 3WLJA 1WB9A 4UDNA 1F38A 3QZUA 5JAHA 1UMBB 1TL7C 3F7MA 4TMZA 4L74A 5CIYA 3RUPA 2D4HA 3FRHA 1JILA 4BV3A 1Z7YA 3PGXA 5C5DA 2FLVA 1KO1A 3MYYA 2O2ZA 3AVOA 3PRYA 2ZS8A 5KYUA 3WJQA 5ALXA 4BIIA 3G79A 2H5EA 4Z4GA 1PNTA 3KK0A 2GJ9A 3QH4A 3QVVA 4RNDB 3KKQA 3NTQA 4YIKA 4AMBA 3MWFA 3K0CC 3ZCPA 2RB4A 3DVRX 1FSZA 4EEZA 2P5SA 1AU9A 4PEVA 3REQB 1M5TA 4WKGA 1XTSA 1F5NA 4S3MA 1ZFNA 4JN6B 4QOHA 4ZQIA 1Q1ZA 1ZGGA 3AR8A 4JJ7A 4J0FA 2VHCA 3VPBA 7ABPA 1DX9A 1XMIA 2CDCA 4OYLA 3E9YA 3H11B 3P5BA 4DCVA 4KBGA 1CDDA 1H5NA 3UH1A 2QAJA 3A10A 1F3OA 5J59A 3U13A 1K06A 2PQ2A 1AUXA 4DC0A 4ZHSA 3OIFA 2UU9B 1VSVA 3WGLA 5K4HA 1RHQA 1X2BA 1ZI6A 3L0BA 4KXYA 5JCJD 2QRPA 1MW8X 3N5CA 3D7SA 3Q98A 3VUFA 4P5DA 2H1IA 3AUAA 5DLEA 2UVPA 2H4ZA 3E7FA 3IP7A 3QLVA 2ORED 5ALLA 4G2TA 4HRVA 4Q7QA 4I2NA 1NDUA 5DCVA 2BFWA 1N5LA 2Q8NA 4ZK6A 4QEDA 5AQEA 1L7BA 4CG0A 3B1JA 5BUQA 2XKKA 2B7LA 3ANMA 3R5TA 2OYSA 5K51A 5BRJA 5F33A 1J00A 2BTEA 1C7ZA 3T3EA 2FA9A 5DEIA 5AUOB 5JMWA 4GM4A 4FM9A 3GJXC 3P26A 2Q3MA 1VQ9F 4HWRA 4UXJA 2H7YA 1O58A 3GDOA 1C0KA 3G88A 4Y6LA 4DW8A 2HQSA 4TQGA 1P7ZA 1QQ6A 2FN8A 3S4YA 3O85A 5K3EA 3OONA 1FP1D 2O3TA 4WOBA 1AGPA 2AN4A 3JX9A 3WRXC 4B74A 1EUZA 1TO2E 4LGVA 3UOAB 2D62A 1W4BA 1MHTA 3TNJA 1KDTA 2B2CA 4I1YA 2AJLI 4UE3S 1RJFA 3MTEA 4MS4B 1OX6A 2R85A 4CEIA 2I2XB 2NU9A 4KE6A 1A0OA 5JNVA 1R1MA 1Q84A 2AWOA 2GXAA 1YITF 4F9GA 4L5YA 2C4HA 4TWBA 2QD5A 1NHWA 1W96A 3D0RA 3K6KA 3CZMA 5LUAA 2AJTA 2VG8A 3NZEA 4YT8A 5EIEA 1XTBA 5CX4A 3KDSE 2RAVA 4JHLA 3OG9A 2IEBA 3CLUD 3E8XA 3I3OA 3QOFA 2ORVA 3CZQA 4M22A 4A6XA 1BAPA 1M66A 4S1VA 3C9UA 1UBHS 3BRSA 3KKEA 4IM7A 5TJHA 4C4ZA 4WLEA 3K9LA 4AKHA 4DEYA 1S3SA 5C32A 2GHQA 5LMCA 3TMKA 4KDFA 3C9SA 3RFCA 4O4IF 1GV0A 1YA6A 3VAZA 4I2VA 2XTAA 3V4LA 1PFYA 2VUHB 4MVJI 3HKCB 1COWA 2C92A 1TKCA 4M60A 2Z04A 1MO2A 3QMPA 5E4JA 1UP6A 2RGNA 1Z4OA 2CD7A 3I12A 1EWVA 2EZ9A 1ONOA 4HAVA 4J1QA 1C0EA 1XL1A 2C8JA 2P5TB 5D3MB 5JSFA 4F2GA 2IH5A 1H8HA 4W9NC 4RQTA 4QUDA 4LNAA 2ZSUA 1XYGA 2QRNA 1ZDMA 2Z2KA 3KIPA 3OZTA 2JK0A 4LF7B 2BFCB 3AKYA 4Y2RA 3CLTC 3K9CA 1QHHA 1CF9A 1W6UA 1EX1A 1PQWA 2G76A 1ZEJA 2IOYA 2J3QA 4GE3A 4E94A 4LW8A 3IQZA 3LLMA 3PKIA 3VNSA 3WP1B 5JAUA 3FR7A 2AC4A 4WLUA 3I23A 5B1YA 3GU3A 1T5OA 2WMNB 3PRKE 3IVRA 5JZOA 1T1JA 4AJEA 3FNEA 5JAZA 1E3MA 1VE9A 4GL2A 5G0SA 3CPJB 3NHSA 3GPLA 4BO5A 2H2WA 1K68A 3H2BA 1UQRA 2V9CA 3N0TA 1XMXA 4D8VA 1XJ5A 4Q24A 4LWOA 4ZVVA 1ZZGA 4EHAA 4EHBA 4OLFA 2GTPA 1S1CA 3OLXA 3U2QA 4KAFA 2VCEA 1JHOA 3NPMA 2IZ5A 2BFBA 3EDYA 3C5HA 4ML3A 1VIVA 4LDAA 3WQQA 4WXMA 5BOSA 4DB4A 3OTIA 3T9FA 4F3CA 2E85A 2I7TA 4Q4LA 2ZRAA 4JLPA 1PS9A 4AQYB 4D99A 3GXOA 2K87A 1NI4B 4CQMD 4I4TB 3HRHA 3EAQA 4QNRA 1YZHA 5IT9A 1USWA 3ZHXA 3H0EA 4KQGA 1QV6A 3VVBA 2ZE6A