4M8IA

1.43 angstrom resolution crystal structure of cell division protein ftsz (ftsz) from staphylococcus epidermidis rp62a in complex with gdp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
LATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTAGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFGFEGRKRQTQAAAGVESMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFEDKPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.43 Angstrom resolution crystal structure of cell division protein FtsZ (ftsZ) from Staphylococcus epidermidis RP62A in complex with GDP
rcsb
source organism Staphylococcus epidermidis
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2013-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4m8iA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4m8iA01
4E6EA 1TUBA 2XKBA 3HKDA 3JAKA 3JASA 4O2BB 4X1KB 4ZHQB 5IJ0A 3RYCB 2RHLA 3WGLA 4TV8A 4U39A 3WGJA 4X1IA 5CA0A 1W59A 2VAWA 3JARB 4LNUA 4DXDA 3ZBPA 4O4JB 1RLUA 4I50B 4B46A 3JAWB 1TUBB 3WGNA 4EI7A 3E22A 1TVKA 4B45A 5IJ0B 5LOVB 4HNAB 4IIJB 3N2GB 2XKAA 4O4IA 4DRXA 2RHHA 5LYJB 5IJ9B 4M8IA 5JH7A 4I4TB 5CA0B 5J2UA 5JQGA 3JARA 1SA0A 2BTQA 5LP6B 3RYIA 3N2KB 2R6R1 5GONB 3JAWA 5EZYA 2RHJA 3E22B 1W5FA 1OFUA 5M7EA 3UT5A 4HNAA 3R4VA 4O4IB 5LYJA 4I55B 5JQGB 4O4HA 5EYPA 4TV9A 3VO9A 3RYIB 5JVDA 3ZBQA 5JCOC 5KMGB 5EZYB 4YJ3A 4EI8A 4X1YA 5BMVB 3WGMA 2VAMA 3HKDB 3HKCA 3JAKB 4X1KA 4WBNA 5IYZA 2VXYA 2R751 3HKBB 4X1IB 5EYPB 4YJ2A 4TV9B 4EB6B 5JVDB 5LA6A 5KX5B 3JATB 3HKEA 5C8YB 1FFXA 5FNVA 5CB4A 5IYZB 4FFBB 3RYFB 5LOVA 4IIJA 5IJ9A 3HKBA 4F6RB 4I4TA 5J2UB 1SA0B 2BTQB 4YJ2B 1W581 4EB6A 5J2TB 3N2KA 3ZIDA 2GVIA 5LA6B 5GONA 3JATA 5ITZB 3HKEB 5C8YA 1FFXB 5MN6A 5FNVB 3JASB 4O2BA 4ZHQA 4FFBA 4O4LB 3VO8A 4ZI7B 4ZOLB 4I55A 4TV8B 3JALA 3VPAA 4IHJA 5MN4A 1W5AA 4U3JA 1W5BA 5JCOA 5J2TA 4O4JA 4I50A 5KMGA 1Z5VA 5LP6C 4YJ3B 5CA1B 5ITZA 4X1YB 4TUYA 5BMVA 4O2AB 5MN5A 3HKCB 4WBNB 3RB8A 1TVKB 1JFFA 4O4LA 4ZI7A 3CB2A 3N2GA 3RYHB 4ZOLA 4DRXB 4X20B 5EIBD 5JH7B 3JALB 4IHJB 5EIBC 1Z5WA 4U3JB 3VOAA 5LP6A 2Q1XA 5KX5A 5LXTB 5CA1A 4KWEA 1RQ2A 4TUYB 1W5EA 2RHOA 4O2AA 5CB4B 2Q1YA 3RYCA 1JFFB 4XCQA 3RYFA 3UT5B 3C8LA 3RYHA 4EI9A 3V3TA 4X20A 4F6RA 3WGKA 2BTOA 3VOBA 4O4HB 3M8KA 4LNUB 3M89A 1FSZA 2VAPA 1RQ7A 5LXTA
chains in the Genus database with same CATH superfamily
2BEKA 3OY7A 1U0HC 4IWNA 1WLYA 1VCMA 5INTA 3WJ7A 1ZMOA 1NJ2A 2QP3A 1BCSB 1NOJA 3QY9A 1H22A 1C30B 1EVQA 2OT3B 1N3LA 3QOXA 1E3WB 2PKQP 2X9LA 3IQEA 4GW3A 4Y18A 1W52X 6ABPA 4L95C 3O38A 3WY9A 1YRBA 1D0IA 1PX0A 3IP9A 1E0DA 1FW8A 4M9SA 2EQBA 4ZU3A 1E2EA 3Q2KA 1QAQA 4YRTA 3RROA 5K0FA 1GNPA 1L3CA 2IG8A 1A82A 3OG9A 1HDCA 1E2HA 1ZXBA 4ESEA 5ULLA 4BQNA 3T7SA 2OLJA 2CXRA 1GNSA 1W29A 1FP1D 4RTJA 2WT4A 4BNZA 1EU1A 4P3PA 3U80A 5LB4A 2JLBA 1KU0A 3DQZA 3L6BA 5EESA 3B9BA 4PU0A 3R7WA 3SG0A 1JLLA 5DN6A 2BGNA 3CUUA 1U31A 3DWIA 1O6FA 1X80A 3HCPA 1O54A 4BT6A 1UBKS 4TKVB 4XUGB 1BN6A 5CX1A 3IAS1 4FE3A 4WLFA 4E2WA 1Q21A 2JIQA 2OESA 2HB6A 1L9XA 2XZPA 3FWZA 4PR0A 5AKYA 3KJIA 1TLTA 2ALEA 1GAWA 2P68A 4RHFA 4B3CA 3MCQA 5DTJA 1E7SA 2I71A 4HN9A 5KYWB 2ODAA 1QFYA 4U7JA 4CIVA 2IX9A 1FUUA 4OOEA 4M86A 4YMUA 3SZMA 3V8QA 5BVGA 5DM60 2JIPA 4NOLA 2C5LA 3GJ0A 5EINA 4AJLA 4YI3A 3VR0A 1OMOA 3WLMA 3OF3A 3H9EO 1WMDA 4QOGA 4ND7A 2WE8A 3EFOA 1JG7A 1E9SA 1R5NA 2QMZA 4EGQA 4IXMA 4YN3A 2JLXA 2VF8A 2F1IA 2ZB4A 3ZGOA 1FFXA 1AF4A 1JL3A 1EWVA 1I5OA 2DFNA 2PSHA 1X7OA 3JD0A 3C6KA 1A9YA 5REQB 2OFOA 4FBGA 4X8LA 2ZJOA 1MPXA 1XEWY 3OBBA 1CS0B 4BN5A 1X1EA 4KPYA 3JVEA 4LKRA 5BUCA 5J3JA 5JW6A 2XNSA 3IVRA 3HQ4O 1NMYA 4XGRA 4YP9A 2EOAA 4Y1RB 5HS4A 3DZDA 2V0GA 5D85A 3BD9A 4RD3A 2GN1A 5CX4A 5ES4B 1AS3A 1KVSA 1UAYA 4K2HA 1RJDA 1CS0A 3IBGA 3LKVA 4OP1A 1V8OA 2IW3A 2GBLA 2Y0EA 4O2AB 1ESDA 3BD7A 1M74A 1ISSA 1B6TA 3MGGA 4ZMBA 4NESA 4IDQA 2ZATA 2CHGA 3GHYA 3CC7F 1T9GR 2PLFA 4OXIA 4PO1A 1JHZA 1UQUA 5HHTA 1YCFA 1SQGA 2OHIA 6LDHA 5JXJA 2JGRA 4J0GA 1L4UA 5EGNA 3G5LA 1TMGE 2YS7A 5DV9A 1X52A 3C6XA 5KQGA 3Q6MA 3NM4A 4UCFA 3NAMA 4TSKA 1DC7A 1IU9A 1JLSA 2Q1YA 1YQGA 3C15C 4V0OA 5T4EA 4BO7A 4DR3B 2HJGA 1XJWA 2GCNA 2DTXA 3H2IA 4IQGA 2VZEA 2ZI4A 4NBUA 4BJ3A 3PPVA 3ND5A 1T0KB 2IKSA 2Z30A 3D3EA 3PSHA 4FMCB 4IHQA 1QG2A 1L8LA 1QUFA 3IR5A 2OCAA 2YX1A 4NU0A 2IQ5A 5BYBA 2P4QA 1N0IA 2B7CA 3PXUA 2RHMA 1RI3A 5DNCA 2WB2A 1MO2A 4MGYR 4JXXA 4NFSA 2OM6A 4FHCA 2QRKA 3HN2A 4ATNA 3RRXA 4F2WA 4UTPA 3UCFA 2JBHA 2N46A 3GGDA 5JSYA 3SMVA 4DA4A 2ZSHA 3C45A 3TD2A 3L8EA 3ZV3A 4JDUA 4WXRA 4MVJP 4UVEA 1LDMA 1W59A 4XCVA 3GFQA 4MPTA 2DP4E 1V39A 5I7SA 2RJNA 7MHTA 2IS4A 5IT9A 3ZD7A 1YK0A 3IQIX 4U2KA 5HKBA 1ORVA 4AJ2A 1OWOA 4W1SA 3HP1A 3F90A 5FCDA 2Y9MB 1UBUS 1UF9A 1ZD9A 3N8HA 2XKAA 1RMYA 1QHGA 3U09A 4LF8B 1S4QA 3ER6A 2QTLA 4ENUA 5LU8A 3TAHA 1NJ1A 1SH7A 3GD7A 4P8RA 4UREA 4WNAB 2QXTA 1IQUA 2Y1GA 3EY4A 5IM4A 1SELA 3U3OA 4EX7A 4FMCF 1Q19A 5DM4A 3EZYA 3Q15C 2X6TA 4EL5A 5JJ5A 3EORA 2H85A 4GMXA 4EG3A 5D00A 2RHTA 4C07A 4HQRA 3B9QA 4MB2A 3B5JA 5KTSA 1N2CB 5GADl 5H16A 2RHCA 3GLHB 3LQQA 3OEEA 1GL7A 2H00A 3ICCA 3JQ7A 4IIVA 1R0RE 2PPVA 5FJJA 3N0TA 2F55A 4G5YA 1RI5A 4IO1A 1XQ6A 2X0NA 3AB3A 4QFBA 2GK7A 3WP1B 4D5EA 3ELUA 4O5OA 2QG6A 3F0TA 1SOWA 2AYYA 2XOXA 3NHUA 1D07A 2AL7A 3Q6NA 4F2DA 2X1VA 1L3BA 3P9QA 2FR1A 2CCKA 3DUFB 3I2KA 1LDGA 4KOEC 2EDAA 3RSZA 3DOHA 2WWHA 2GESA 3N05A 1I6WA 1M67A 2IWHA 3TVYA 1PD1A 1YJBA 1BAPA 2DHRA 2XMPA 3PUWA 5KHOC 3VVMA 4WBXC 3IDSA 1R6BX 4HAIA 2WEKA 3A4IA 4FUQA 5FI5A 3UUWA 1OAKA 4ZT6A 5C5DA 4LBZA 3THWA 1SB8A 2AR0A 3LKDA 4WESA 3FOBA 5E7QA 1OX4B 1KMHA 4LQDA 2ZWOA 1R37A 2AWNA 2PGJA 4PGMA 4QD3A 4GL4A 2PQMA 2XIQA 1KH3A 1E2PA 1WCIB 3A11A 5B7PA 2J3IA 3N70A 2WIGA 3QA9A 1UPCA 2PWAA 2V4ZA 3ITEA 1NUSA 3O1LA 1LF5A 4MRMA 5AWFC 3FNRA 3QI2A 1CY4A 3PT5A 5ALNA 1O77A 4D6YA 2IP4A 2EKLA 4MUIA 3FE2A 2J0VA 4JA2A 1JLRA 3EXEB 4XDZA 1BCRA 5WRFA 1RT9A 4FS3A 2EF0A 1TYEB 1IV3A 2ZT7A 3HFSA 4QYWA 1CB0A 1WL8A 2BEUB 2C57A 2JJ2D 2WHPB 2DBYA 3F3YA 3I9LA 4FOOA 4QLOA 5F64A 2FU5C 4NBWA 3LF1A 3ZU6A 4B2IA 3RUFA 2YYZA 2NTEA 1QP0A 3ILHA 8ABPA 1AQLA 2E3JA 2O2SA 3HJBA 3LHDA 4IJMA 4UTZA 1T2NA 2CL0X 3OTHA 4HWGA 3VUFA 3EZ9A 5KTKA 3EGWA 1T8UA 3DR5A 2CKMA 2VXCA 4E12A 4EDFA 1SIBE 1OA0A 1CFJA 2KBFA 2X0RA 4QHSA 1AG9A 2QL9A 2FWMX 1U7WA 3AUJB 2G7MC 3AL2A 3QYPA 4QXQA 2DH6A 1U43A 4W5OA 4Z3DA 4LZWA 4GKAA 4D45A 3NDIA 4X7PA 4CIWA 4XGNA 4DV3B 1RXVA 4C6TA 1CT9A 1UK7A 3NQ41 2Q7OE 4LMBA 1D2MA 1IZZA 5SV2A 4O08A 4I8XA 2QRMA 1KI9A 1WMSA 1KBOA 3CCEF 2L42A 3LIIA 3PV0A 5CYGA 2XRMA 5JNVA 2SKCA 2JZCA 3W8DA 1LA2A 3NMUC 3MJSA 4V03A 4E4TA 3L7DA 2YH2A 5AVYA 5LZ2A 2C4TA 2QP9X 1RLUA 2PGIA 4DJEC 4ZXPA 4UNRA 5JALA 3FTEA 4UC0A 2RIRA 3L7JA 4R9VA 5JSFA 2WFZA 3MJCA 2GN0A 5HTKA 4DG8A 4GECA 2AOUA 1K7CA 4X5OA 1L7RA 3K09C 1QFZA 4ZCSA 4PCVA 1TYZA 2AW3A 4B7CA 3I5YA 4I4TB 4J91A 1KVQA 2GTIA 5JQGA 2H2HA 3CE9A 4GDMA 4IDOA 5HXAA 2C04A 3EDRA 4KQCA 5T7BA 3BXGA 2VJQA 4NENA 2CSLA 2W9XA 4J0HA 4HNTA 3AVOA 3GPCA 5EJ2A 3P2EA 4B83A 4TKLA 3SU8A 3ZP4A 1N5IA 2QLMA 1Z2AA 3AQIA 3D3WA 4FFVA 4UFNA 1DAOA 2PYDA 4ZHWA 3D6NB 3KT6A 1BGWA 2CHVA 5ECWA 4MGIR 1H6BA 4LJ5A 1RYYA 4X62B 3ZOZA 2P41A 2RGXA 3BL5A 4EJMA 4HGPA 4BKUA 3ENQA 1P2BA 2FZCA 4IXNA 2FW6A 2W2PA 4YFYA 3ZK7A 2AFHB 4JAVC 4DC1A 4DR2B 2H29A 4L57A 5I47A 5JBQA 4XYMA 4DA7A 1F0KA 1LCIA 4C14A 1NJ8A 2Y68A 1YR2A 3F4LA 4IW3B 2WQ6A 3BQNB 5K4AA 2B8TA 1GUFA 2FWRA 4G9BA 4BO5A 1ZJZA 1Y6RA 2MIIA 1XKLA 2OHXA 4JT2A 4ZGWA 3JSXA 3STXA 1AMNA 2YBDA 3BCUA 3A3KA 2XNDA 3MWDA 4E11A 2O1SA 3CYFA 5L40A 2UYNB 1UKYA 4CPDA 1UJNA 2G0TA 1BXGB 1GNLA 4PBRA 3DEJA 3L4BA 3NCTA 5C5EA 5JXGA 1P1JA 2YOGA 3RHSA 1L7EA 1UZAA 4DMKA 4HRAA 2Q6IA 3IUMA 1RHUA 4UBLA 2J0QA 3H42B 3HKEB 3KQUA 1XLUA 3E81A 4GOKA 3GT7A 1PFGA 1Y4DE 2B7BA 2FRDC 3D7SA 3EIOA 4IEIA 4M0UA 3WLTA 5LQUA 1YOVB 2C2GA 1IXSB 2D3WA 3IV7A 1X7ZA 1U2DA 2GM9A 1OB2A 2RI6A 2NZYA 2Z5VA 4M9UA 4QNNA 3WKCA 2QTMA 3KOOA 1W5AA 4XJVA 4ALJA 4AN0A 5LFAA 4AS3A 4O4JA 2EKQA 2GILA 3SLGA 1E2DA 1E3SA 3VR6A 4A0GA 3U9SA 4MVJA 4Q01A 3T6KA 2QBYA 4AURA 4BNKA 2YUIA 5DSTA 1O5TA 10MHA 1RRCA 1GRCA 4FYHA 1CRZA 1NKVA 3TRHA 3UATA 5A5FA 5EIBC 3I3OA 4KSYA 3SIRA 1RPNA 2ONJA 3FAZA 4R4JA 3C8MA 3W8FA 2H07A 2I2DA 5FP0A 2E4ZA 1Y7PA 1XD2B 2H3EA 1C7JA 1Z2CA 5THQA 3FWPA 5FUVA 1E2QA 2DUJA 1BE1A 1UXGA 1PT7A 4L6CA 4TXLA 4C29A 4O2BF 4B3JA 5BNTA 4TZZA 5EZ5A 3QSYA 2CBZA 3O4JA 1NT4A 3IAEA 4G07A 2V59A 2AC7A 5HKKD 2WWGA 2V0NA 1YNSA 1K8ZB 2XF2A 3ANNA 2C92A 4U8GA 3ZPXA 3LOPA 3IDAA 1VHLA 2DBQA 2FSVC 4JU8A 4BX9A 1T0PA 1TVEA 2JIRA 5FV7A 5HK8A 1A97A 3N8NA 2XWQA 1YU9A 3VU1A 1QLHA 3HB5X 3V8BA 1QAMA 4XVUA 2C31A 4TV8F 3FPHA 3KEQA 2OC9A 3WLFA 4N0EA 2F9ZC 1TA9A 3AIIA 3H84A 4KODA 2GAFA 2WYOA 2J1LA 3LMEA 5E9JA 4C04A 4HEJA 4E1AA 2P2YA 1E1MA 4GR5A 1UFYA 1R0KA 5BSRA 1SURA 5IJ9B 2CVPA 3RFCA 1GLGA 4WCFA 2XQIA 4HWKA 1QR6A 4NV1A 1CQZA 1M7GA 4JGBA 1MTOA 2QMQA 2P3LA 4IIEA 4P3XA 4DNOA 1XU9A 1YL6A 4J0CA 3LNCA 3R9IA 5AQ1A 2PT6A 1C3VA 3ZWCA 1PF7E 2PGDA 3L0PA 3K70C 5E6UB 1EQUA 2GAAA 4G4VA 3OJWA 1NNUA 4NCHA 4G1EB 2YHBA 1XJQA 2GJSA 1NXVA 5M34A 2XWPA 3FPEA 3MTJA 1OH6A 2Y0CA 3I2FA 1M6HA 4EJSA 5EXSA 1XRQA 5AW9A 4R41A 5EZYB 4BVBA 2J9YB 2C8KA 2H4ZA 4CQMD 1N1EA 4K8RB 4OA5A 5ABPA 1IZ0A 3O8CA 1CYDA 3VAAA 1CR2A 3DAYA 2YV1A 3BE5A 4K9QA 3QTLA 4HWOA 4KDEA 3BK1A 3P32A 4TV9F 4UBOA 3WAKA 2HMUA 1LI7A 3RABA 4MINA 3Q3GE 4J1SA 4AJKA 5BXQC 3FVVA 1X87A 2KJQA 1YQWA 4RPCA 2CB0A 2ANCA 4ZQBA 5CYOA 4FLMA 2I66A 1ZWZA 1AXEA 1JIVA 2ZXEA 2YZMA 4GS5A 4KMOA 1FTQA 1O5IA 4S1TA 3UWOA 4XSVA 3RF7A 3ZY5A 1TMOA 5KNDD 3PUYA 5FA6A 2HRBA 3ANMA 1GO2A 1Y3DE 3GJ6A 3K9NA 3DLHA 1IUPA 3GIWA 3TWOA 4D9IA 1NVUQ 1XMSA 4G81A 3MD0A 2ATCA 1MT3A 1IQPA 4JYPA 3M1XA 4RLFA 4XIYA 4ZHSA 4FJ2A 1DAGA 2CNNA 3JW8A 1EK6A 2G9IA 2ZJ1A 1MV8A 1YDEA 4L0DA 3RQIA 4LF5B 1RPTA 1EVKA 1Y1KE 2AUTA 5G4KB 3DVRX 1H2YA 3I1IA 2OCGA 1R8QA 4R98A 4D3SA 5BUZA 1VSQA 1H0RA 4KXWA 3GVXA 1PRYA 4OHXA 4NZYA 3C1AA 4LHXA 3N2GA 1R27A 3F6SA 4PGHA 1NU8A 5EQTA 4BUZA 3B6NA 3NUGA 2VDOB 4UHKA 3V2IA 3OX3A 3F7NA 1SU7A 1LNZA 4YRZA 2YOHA 4JKIA 2D2FA 5DTRA 4IWYA 1J97A 1RQNA 4R8MA 2I4OA 3LQ1A 4CKWA 2GN4A 3TX2A 4ARCA 1ZC4A 3G2IA 2UUPA 2Q0XA 3OC0A 2D5BA 4MWTA 5T8KC 2Z8YM 3GARA 3JQGA 3TLCA 3UMCA 3ZCRA 4CG3A 3B8HA 2IEIA 1O87A 1Y1LA 4L72A 4W6QA 4KACA 1IHYA 2GXUA 4WLEA 2RC6A 2D0OB 3M3HA 1DFHA 2HXSA 2VNHA 4XD7A 3AOEC 3SJCA 1SCIA 4DE5A 1EFPB 4MH0R 2FAXA 2CUTA 3KKMA 4Q24A 3ONWA 4BMNA 2RKOA 1UP4A 3LSTA 2HA4A 4J90A 3KOZA 4RELA 1P8AA 1B6GA 4MS1B 3TAXA 1YUMA 4IBOA 1Q0ZA 3G7SA 1BDHA 2GXAA 3LE8A 1WDMA 4OJTA 1JKJA 3A9SA 3VKFA 4CLDA 4ETIA 4QJIA 3PRKE 3Q5EA 3DD5A 4ZQEA 3UT0A 4ALKA 1VQ1A 3G3EA 1RC0A 1J42A 4XZ3A 3MWYW 4FZRA 1U0GA 4YB8A 1HEUA 1KNQA 3NHRA 2WY2D 4AULA 1K8YB 1SULA 4MV4A 3F49S 1O97C 4MQEA 3QQ5A 2F43B 1TAQA 1MVLA 1UFOA 4URVR 1J4AA 3IKLA 2ZCJA 2NYUA 3D2CA 2JI7A 4FHZA 4IJ5A 3KQLA 1L2TA 1OE0A 4UAVA 1I9CA 4AI6A 5CVEA 2X58A 1QHFA 2BMWA 3A36A 1G5HA 4G9EA 4EW3A 4XWKA 4DHWA 5KSWB 1WY5A 1TZKA 3RVBA 3QI7A 4I1OA 4ME6A 4EW2A 4YCAA 2BIFA 5C5CA 5HIKA 2Q5HA 3RJZA 4F6LA 4L2IA 3R7WB 1D4ZA 4KO2S 4MAAA 1U3DA 4WBNA 2BFCB 1WKCA 2IUEA 1XRSB 1VJ0A 2Y4NA 1NAHA 5JD4A 1YBMA 2O3JA 1EFKA 3FMFA 3NP9A 4KP7A 5FFMA 1T2DA 4GR9A 3FDFA 3PQ8A 3QYFA 5L53A 2NSHA 5AHKA 1OXSC 3VSEA 4R3NA 2X8BA 4TWJA 3A9WA 2VP3A 3W2FA 3CPEA 5FNVA 1X7YA 4BO1A 5AW3A 3U4QA 2QGFA 1WB9A 4ACAA 2CXUA 1XZGA 1YOVA 4TTVA 2XRYA 4WK4B 3FNHA 1E94E 1G5PA 2PCLA 2HF9A 2GX6A 1LPAB 1M6YA 3TJRA 2C5EA 2X4DA 1X7WA 4DIOA 2ILVA 1VHJA 4ILEA 4JLOA 4LRUA 1B76A 4CIYA 3AR4A 2GK6A 5IDWA 3SLKA 1U5CA 4DIDA 2Q2VA 3VNQA 4DWWA 1OGJA 3ZTTA 2EEZA 3INNA 1J21A 1ZH4A 3ROGA 5J2UF 2Z1NA 1NVXQ 2ZRMA 5DYIA 2BTEA 1NXSA 3SF8A 3HZHA 4LW8A 2VTEA 4E4RA 5IXYA 3M70A 1FDOA 1U99A 2BJWA 1TM3E 2WG2A 5DYWA 3WB1A 5LR6A 1GUYA 4ZVRA 3OT1A 4G0VA 3QPUA 4L8VA 5EIEA 1WP9A 1ZJJA 1WUYA 4K3UA 2B25A 4PANA 4ZIRB 3IPAA 4AZ0B 3L84A 1HK7A 5JXHA 3VTKA 2CV2A 2XVZA 1FNSA 3IJPA 1A96A 1NZDA 3IBSA 5KYUA 1EHIA 2C7VA 2C5GA 4HSEA 4FCVA 1WXDA 5DLPA 3Q88A 1EFAA 3SZRA 1DT9A 1ZNZA 3EXIB 3GJSA 3QVWA 4CMCA 1NQUA 3JPWA 1RLIA 4ISCA 3OZRA 1M1YA 1TMKA 1ZIXA 3K6KA 5I9TA 2WYUA 2HO4A 1VPLA 2A57A 3DLIA 2PUBA 2RH4A 4F4FA 1SG9A 2CL7X 1Q82H 1SCNE 4UJ5A 3M6MD 5CCDA 2UZ3A 1FEZA 1HUQA 3Q3JB 3QBDA 1L5MA 2QLNA 3KKZA 2NZUG 4FGLA 3OCCA 4K86A 1KDTA 1YT5A 2B9EA 2CLEB 2EZ9A 1CUDA 3IRVA 4WFJA 3WSTA 4DA0A 1O9BA 1RWMA 2IYNA 3BK7A 3OCUA 4EO9A 4YHHB 1JDUA 2RH9B 5IU6A 2CHEA 2W4QA 4UTVA 2ZT5A 3QPBA 2JFHA 3SX4A 3Q5GA 3WGOA 4V1CA 5KNCA 2B8JA 2HIAA 2CXXA 3L7LA 2X5NA 3PLNA 4LCBA 4RDXA 1DXYA 5BQ3A 1NG1A 1E18A 3CFYA 4EHFA 3OLVA 1F8FA 5TEVA 4FZJA 2NU8A 2G5PA 5SY9A 2H4XA 5FXMA 1AN9A 1C9JA 3REOA 3EQZA 1IB0A 5FTWA 1VBKA 4Y6OA 2ZUEA 1L6IA 1CB7A 1QK3A 1XDDA 2I4LA 1GL9B 1B1CA 2GPAA 2WDPA 3MSXA 3OETA 2HCFA 3H4MA 4D25A 2FGYA 1KAOA 3E7WA 3HCWA 1ND6A 3BRWD 4IDPA 5K7SA 4IDFA 3NH6A 3GGSA 5AVKA 1ML3A 4ZOBA 4HWPA 3P52A 4LKOA 3UGQA 2I34A 4QECA 2JGEA 3U7QB 2JIZD 1DNPA 4EUNA 1W88B 2LXNA 4LOAA 5EE1A 1BTOA 2Q5FA 4Q05A 5I7RA 2WK1A 4UM9B 4HDOB 1N6HA 1V2GA 2VJMB 2XE6A 3F7MA 1U02A 3T12A 3UWKA 3VR6D 3ZTYA 3O2SB 1TJPB 3EN0A 3GMIA 3IUPA 4N7RA 1C81A 5DVZA 4NZPA 1YJQA 1OIWA 2G5GX 3ZLTA 2Q0SA 1G59A 2CY0A 1KI6A 2YNMC 3G0DA 4AZ3A 4CVNA 3Q7SA 5AXAA 4MEJA 3HABA 4D44A 3HKDB 4P1ZA 3T5BA 1XYGA 1UKZA 3H0CA 5CM2Z 2I55A 1EUCA 3KKLA 1I33A 1V47A 2OTMA 4QYIA 2L19A 4YBRA 4Z54A 2R0QC 2LBXA 1LVHA 3GG9A 4NCKA 4TSFD 1EWYA 3HB1A 2WF9A 3PEEA 4NARA 1IHPA 3AIKA 1WETA 1W5SA 1WULS 2ZS8A 3C3WA 1OU0A 1I3OA 1X7GA 3GROA 3RSFA 1GXSB 4H1WA 3FOAA 3S7ZA 2GZSA 2AK2A 5P8WA 3J7TA 3FD5A 3VO1A 5IVIA 3K2EA 3V7EA 3B9PA 3E0QA 1J0XO 3P71T 1E79A 4IJ6A 4KGZA 1QCYA 4RFVA 4C8IA 4OUDA 3V34A 1C0LA 1HETA 4M0CA 4K1LA 3MB5A 4A0HA 3E1YA 2W00A 1C9DB 2WNIA 2Z04A 4X8OA 5ECGC 1WV0A 5AOCA 4TKVA 5JBNA 4UHFA 5FT9A 5KAPA 3CCUF 2R79A 3JD4A 5MHTA 1M75A 5CCBA 5BSEA 4W6ZA 4JLMA 1W5BA 2VNKA 4GEKA 5E1OA 4NJOA 5P21A 2PFGA 5UKDA 4CQMA 2CD7A 5JZMA 5LWQA 1T5DX 2P6OA 5GAJA 2FRDA 5GANK 3OCJA 4CLRB 4C43A 3LECA 1VA5A 3CNLA 5KKAA 3ZO8A 2VHQA 1OZHA 3BIJA 3IDOA 5TPWA 4A8HA 3T3IA 1H2EA 2OKCA 2DC1A 4Y9DA 4NQZA 4X71A 4A3SA 5JCJD 2WICA 1YZVA 4FQ8A 1CJKC 4L8LA 2P67A 2I3GA 3CH6A 2JANA 3I6IA 3TBHA 4U02A 4YPFA 3GLIB 2DPMA 5BR7A 3U7QA 1KQNA 1ABBA 3IODA 1FIUA 3ECCA 3EFBA 2WKSA 4KBGA 4LGVA 4OGFA 3ZWMA 4HDMA 3K5PA 4BVQA 2C98A 4PAWA 4EPYA 1DKQA 3OP4A 1G2OA 3AJ8A 4HZIA 4LTNA 4JP8A 5AD1A 2CVQA 1C8BA 2A3NA 2QTCA 4HJXA 4IOJA 4C1BA 4CTOA 4EHAA 2R48A 5HZKA 5JISA 5H8WA 1LFAA 1EP2B 4PFJA 5TRTA 1H2RS 3WPXA 5G2OA 4G88A 2R84A 2IX3A 2VTKA 3BIFA 5LLDA 4YCMA 5K6AC 1M5RA 1MU0A 1E3MA 4YGXB 3D6HA 1X7PA 4Q1FA 4BRSA 2FK7A 4XIFA 3VPBA 3WK7A 4XB2A 3JAWB 5EE0A 2O2HA 4JVMA 1QH8B 4LXYA 1M2KA 3VNSA 2RK4A 1YDFA 4QU8A 3Q8KA 3VGJA 3VRHA 4WVFA 2OMEA 3B70A 1U8YA 1FBTA 1H4SA 1O6CA 1S3GA 4OGWA 3HYSA 4AAYA 2J5XA 5JRZA 4AKGA 4G0MA 5DCVA 1EJBA 3DNFA 5AXCA 3IUJA 2O7RA 3GA7A 4LV5B 2HSEA 1SVWA 1Z0KA 3DQPA 1QB8A 2XRZA 1WSAA 3E5NA 1K9MH 4OK5A 4D3ZA 2EARA 1VSUA 2JLRA 2FW7A 4Q37A 2XVYA 4B34A 4BZQA 4QBKA 4R7GA 3KE1A 4WZBE 2OO5A 3WRVA 3GEMA 4X66B 1CUUA 1LPPA 2IIQA 2ZSFA 4Y8VA 1KDYA 3WK6A 3AESA 1BRMA 3ZIAA 3ZZMA 4FWBA 3QM1A 2C97A 3ORFA 1T1IA 2OAQ1 1G2QA 3OQHA 4J07A 4DDUA 5JNSA 3KSBC 4ND3A 1FU8A 3TO5A 3X43A 2NV6A 2WU1A 1ONIA 3VI4B 4YLEA 2B2XA 5I4BA 3HU1A 4OHZA 2A35A 2VJNA 5B3AA 3WLLA 3CWQA 4QRIA 1N75A 2KWIA 4GLLA 2YWBA 3CHYA 2C7OA 1JA1A 2IEAA 3ZDQA 4B6SA 1PJSA 4H1TA 3RS4A 1BJKA 1LY1A 3FOCA 1IG0A 3UJ3X 5EXPA 1ZAYA 1NF2A 1G9TA 2R1VA 5E0OA 4WY2A 1VSVA 2GBGA 1ACLA 2BVNA 1AZSC 1HMYA 1SJ9A 2R6FA 1SXJE 1M10A 4GZMA 2PZEA 4PICA 1C8KA 4PLFA 4DDTA 1EXNA 3HXMA 1AV6A 1R8SA 2G07A 1WF3A 4Q9AA 2JZOA 3U2QA 3IUBA 3IV9A 3KELA 4UXJA 5B55A 1AF7A 1DDIA 3NC0C 1TJ4A 4R2IA 3CCLF 3G23A 5ED0A 1TKAA 2QJWA 1GG5A 3DKRA 4RK7A 1WDKA 1LXCA 4XYGA 4NVRA 1T5SA 1OI3A 3CB2A 3BH6A 4ZAFA 4CIXA 1ZVKA 5MGNA 1B43A 1UMBA 4JGIA 1DV1A 1I1NA 4Y9UA 1I94B 4JXKA 1R0SA 4J16A 4UARA 3EF1A 3QPWA 4RX1A 5HE8A 4L74A 3C3JA 3T5AA 1O0CA 2FPUA 1UUFA 4GMHA 1Z4NA 4JEUA 1KC3A 4O2AA 1K86A 1MAWA 2XNKA 3PF8A 4GEGA 4LVCA 4A8PA 1G5QA 1QU2A 4MW2A 1SC4A 3MW8A 2V65A 4ZN6A 3WHKA 1GEGA 1Y63A 4HN2A 1QRTA 5D84A 2ZROA 2WU4A 5FD8A 3QLVA 1IWPB 3ENWA 5LYYA 3ZWXA 3CD6F 1THZA 1RZ3A 1JA0A 3D5QA 3L8DA 4RMNA 5CNIA 3L6DA 3SFVA 4CFYA 1E69A 1SGWA 3L92A 1YGYA 1HWYA 1WD5A 3VISA 2AVDA 5AVQA 4KXLA 2Q6VA 1BVYF 4BFVA 3O8LA 1QGUA 4TS3A 5BWBA 3TJZA 4NPAA 4OHWA 4R9SA 4YVFA 2R97A 5DOVA 1B93A 2NSDA 2Q3BA 3P9ZA 3W1EA 5IAAA 2BKUA 4ZCPA 1RAHA 2RGGA 1HYEA 2YXDA 4QRHA 1USVA 4R6XA 5C7IO 1A5ZA 1C7QA 2XUQA 4CI9A 1XELA 2X2EA 1S2GA 5H9WA 4Y6LA 3U6KA 3ZD9A 3C5EA 2A0WA 1WU8A 3OZDA 3H86A 5GP1A 4P7KA 1L5RA 1IAQA 4L8YA 1GRRA 2J3EA 3DB1A 5K3OA 1XEXB 1E6KA 5F9FA 1KDPA 4AG3A 2E37A 3FBAA 1IE3A 1CZKA 1SXJC 3B53X 4RVHA 3W90A 3IULA 4O25A 4Q5IA 4TL9A 3V8MA 5AP9A 3EVDA 3T54A 1YS7A 3C5HA 2X8AA 4CDNA 2VTDA 8MHTA 1X74A 4L7VA 4N5HX 4R0MA 1WJGA 4Q48A 4DW8A 1WIWA 4OLFA 5M7EA 3QNWA 4KFSA 1UZNA 2EVWX 1G21A 2ZJ0A 2YFYA 4FYMA 4GYJA 4YUVA 3ZWVA 4EY6A 3OO1A 2CNDA 5JUWA 4IH9A 3OZUA 1Q15A 1BVRA 1JX6A 2GZ3A 4KR9A 4DMLA 2AYXA 4QXRA 1K5PA 3HDQA 5TXGA 3AVUA 4FT2A 1MHPA 2DJIA 2HSZA 4BB0A 1MC5A 1CQXA 1P4SA 3ZE1B 4LYEA 2WA1A 1Z35A 5JTUA 3EISA 3DMHA 1P0MA 2FXIA 3G6EF 4CDMA 1Y9JA 4P86A 3FDJA 4PS0A 1BYUA 1FNNA 2JD1A 5HG0A 2NVUB 3TAUA 4DJTA 4NICA 3GA0A 2D7DA 2RAUA 4KRFA 1OT5A 5HXZA 2IIPA 3G59A 4C3UA 3PFNA 3ZJVA 2EFGA 4MLDA 2Q1WA 4D6PA 1E3LA 4G01B 2PGLA 3EWSA 5G1PA 2C2WA 5K0TA 2AF3C 4WLVA 1NE7A 3H83A 1SHZA 2J07A 3PWSA 4KXNA 3GDGA 4OYYA 1N78A 3PR1A 5C1OA 1N8KA 1E1LA 1W96A 2OBBA 2ZRLA 1NBAA 2WNSA 1N2SA 4KUEA 4M53A 1VYUA 4OMFG 1IQRA 1JR2A 2MYTA 3WMGA 2CLDX 2PNFA 3LQ2A 5CW2A 1RFGE 2P2DA 4YRRA 3ESJA 3BYZA 1LLFA 3K72B 3IB3A 2I2BA 1DQZA 1BE6A 4N3CA 4YRNA 2NPOA 3THXA 3ESAA 2IIBA 1XNRB 2F1OA 2ZTVA 1KYTA 1O7JA 2ZRIA 4H3KB 4K81B 5FTNA 3VNVA 4TS1A 4Y9SA 3V9AA 4D8UA 3HWX1 1TE2A 1ZNXA 7MDHA 3IA2A 4Q93A 4DYVA 2DLCX 3PUVA 3IAXA 2WM3A 4EPXA 3UOWA 4XTRA 4DA9A 3BRCA 4C4SA 1XF9A 3O6VA 4UUQA 1MW9X 3UOGA 1UBNA 3MN1A 1W48A 5JJIA 1V25A 4E5YA 3QNMA 5EJ8A 5C7LO 3GGJA 2V7TA 1SU4A 4QM6A 5CDUA 5B53A 3LDFA 1UEXC 5HIMA 4K40A 1E64A 3JYPA 2DFTA 4C7XA 2PKWA 3U3KA 1RS0A 3QOYA 5KJCA 5DISB 4X60A 3RU3A 3Q5DA 4KV7A 4FOLA 4DTCA 2CFRA 5HXUA 8ATCA 1K2WA 3MJ4A 1REQA 3HXPA 1DELA 5GJWC 1FU7A 4KIUA 4W1PA 5ADUS 4DEYA 4TX1A 4E3ZA 4HB3A 2YZ2A 3PQ4A 3S5UA 3ZUGA 2FCRA 3NHAA 5AW6A 4X1IA 1N4DA 1Z5OA 1HDIA 2DFPA 1Y5LA 3ESRA 1FVFA 1RVDA 5FWYB 2A30A 4RHTA 2DKNA 5CH8A 4HH3C 2JCXA 1XSEA 1K3UB 4WFIA 3FHLA 2J0EA 1R0YA 4BP9A 1WXEA 5K0BA 2XT6A 3KXPA 4WOCA 1UPAA 4RVCA 2HYDA 5K03A 2EBUA 4C89A 5A4KA 1KI1A 2VXOA 3ZY3A 4OXKA 1F5NA 3T1NA 1QX4A 1N34B 1J8DA 1JEDA 5FWYA 3V8NA 3H75A 2OGZA 1JI3A 1D09A 4IIGA 4W82A 5GINC 3UV6A 2QVBA 3LW8A 2HA3A 4H4CA 4JC4A 3W6PA 3P94A 3FYSA 4HN4B 2ACEA 4MS4A 3WDKA 1W75A 2B5WA 1PFWA 1QB7A 3HB7A 1XXLA 4FFWA 1FDSA 5CK5A 5KSPA 3G5TA 4GD3Q 3TH5A 3AM3A 5ALVA 3WK9A 5AVRA 1DE0A 2VL7A 2OZBA 3DDSA 4K7JA 1Z88A 1TU4A 2B1GA 1NQOA 3BHMA 3OEYA 2FGKA 1YE8A 5C8ZA 2PMDA 1EXVA 5ARCA 2PGOA 3BMCA 2WVAA 1FFWA 4OAOA 2RC5A 2C9YA 3Q7QA 3HTNA 3VYVA 3I55F 4YCCA 3IFSA 2R62A 3VI6A 3DBHA 4I19A 4MKIA 4WY5A 2MMCA 3ESYA 5KNCH 2OWDA 2QRJA 1F06A 2OWEA 1JHXA 3WLRA 5FORA 5KJEA 1Z12A 3H5RA 1AZWA 1LPOA 3O75A 5KDOA 5D3MB 2XDYA 3I0NA 4CV0A 5L7WA 3QPAA 3CNOA 4XX0A 5F3WB 2HP3A 4ZREA 3L1HA 1ZEMA 3DBHB 4NL4H 3UPUA 3PX7A 5GZ6A 1QE3A 2DUUA 5KIAA 1UKEA 3LUAA 4JIGA 4BQFA 3H5VA 4BKMA 3U49A 2VHCA 5AIBA 4CETA 5IWAB 4CFSA 3FXAA 1J8MF 4O4LB 1I01A 4LJAA 5FUQA 3KYIB 4KPGA 1SZJG 2C4MA 4RACA 4YJGA 3OQPA 3ACDA 4C0JA 4CHGA 3UKJA 5MF6A 1C29B 2PUJA 1NNSA 5IAEA 3PCTA 2Q2WA 4EJSB 3K32A 2JPDA 4CMKA 2IEBA 3E9QA 3JWJA 1L1EA 3L79A 4OXQA 3T1OA 4M9RA 5JWRA 2Q5JA 2F3PA 5CDHA 3C8DA 4S2EA 3A0RB 4TT3A 5FOTA 1AUXA 5I9IA 5GPBA 1KARA 4R1PA 3W5AA 2GCGA 2P4SA 1RABA 4GT1A 3DEHA 4HFNA 1EPUA 4WJKB 1A1VA 1UOQA 3ZD6A 4NENB 3IHWA 3PI6A 1ZN7A 2FRXA 4HC4A 3MMXA 4RA9B 5FR1A 4LI3X 4LSGA 1TVMA 4LUCA 3I09A 5YASA 1DXHA 4OJKA 4URUR 4DJAA 2DH5A 1WZUA 3QEMA 4NAVA 4KIJA 4N3AA 1U4SA 2FW9A 3E53A 1AUVA 1ZA2A 4B5KA 1KSHA 3NV9A 3PE3A 3UJCA 1XMOB 1QIFA 3DB2A 1HZZC 2WFMA 3ONNA 3NPMA 5IXSA 1NLFA 2ZLBA 3KJKA 2H2GA 3FMPB 3RR2A 4YUWA 2NXWA 4GSYA 4LJYA 3NGMA 2AX3A 1HYGA 1MD9A 1RHKA 1Y8CA 2IIVA 2QF7A 1W4LA 1Q17A 4W5TA 3K2BA 3UPTA 3RSLA 4QT0A 2QZ9A 3EY9A 2GFQA 3STTA 3UEOA 4PO3X 3D2AA 3RJ5A 3QX9A 4FEGA 4MQBA 4OP2A 2NO1A 3UJ7A 1O95C 2GD0A 4AJHA 1B6SA 1JHRA 1PGJA 2R00C 4U9IS 5JASA 1JAHA 1XNQB 1VL8A 1E6EA 4FEEA 1Q7YH 1S8AA 4D9KA 1LQTA 1AC5A 1WB4A 2PANA 1BC5A 2XXJA 2NX2A 2YWXA 2ZBRA 3U5TA 3C9UA 1PZNA 3KTAB 2IH2A 2DT5A 2DB3A 1M5UA 5DT2A 4JL6A 4IH1A 4QDXA 1QPBA 3Q6IA 4JBXA 4DLZA 1XDZA 4OQMA 3SHQA 2VBFA 1Z83A 2PCJA 2UDPA 2VP4A 2Z08A 1VQMF 1Z6XA 1ZJYA 2HHCA 3NB0A 1LJ8A 2XH8A 1K9SA 2QUJA 2V8OA 1KZ9A 2HWKA 1KIAA 2X1LA 4PHHA 1YITF 4D74A 1S72F 4U4AA 4P84A 2VHXA 2B0JA 1LX7A 4GWKA 2BDEA 1NQ3A 1A4RA 2V7BA 4N76A 2CF6A 4TYNA 1LWNA 2DLDA 3UT6A 1EVLA 1ZMTA 2FXVA 1XROA 2V74B 2WU0A 3ETEA 4NCXA 5DW3A 3ETJA 2D54A 4DMFA 1ZM9A 2NAFA 4GWLA 1SOMA 4UQOA 5EMJA 3ZQ6A 4MXDA 1X2BA 2WTAA 3OZWA 4PC3A 3ZE9A 1T3LA 4QM7A 4C0WA 2ZYTX 2C58A 3T15A 2R2AA 2C0PA 2QUZA 3T38A 1N5JA 4QDKA 1A5AB 2XBMA 4JC0A 2FN8A 5HP8A 3Q1KA 3FIJA 4GX2A 4KO8A 2YIMA 4J94A 4GZLA 3C48A 4YLYA 3KQMA 5FNZA 4WV3A 3FLBA 3MHPA 3TSOA 3WGGA 1QVGF 5F5LA 1T4GA 5IBPA 4JI4B 6GPBA 3KQOA 3Q8XB 3C3BA 5LBTA 4QU9A 1TUGA 2Q9CA 4L07A 3CV3A 1JBKA 1C9MA 2PA3A 4UD6A 2VUHB 1N25A 2JFBA 5JO0A 1FSSA 2GETA 1RLOA 3PQ6A 5LZ5A 1FTSA 2J67A 4IG9A 2COKA 2IYTA 4HNQA 2NQTA 4B4KA 3A14A 2L0XA 5AW0A 4AJOA 3ICVA 1X3LA 2HUPA 3LUGA 4QZVA 2VXBA 3MBOA 3H65A 2NXJA 1IBKB 2QM8A 4D92A 1CE8B 1AUOA 1J6UA 1E6CA 1G60A 4Z8XA 2QN8A 3LZ6A 3TE7A 3LRPA 1T5TA 2FPIA 1T24A 1OYOA 1QF6A 3ZWAA 2HREA 2JA1A 4BFLA 2P91A 4GM1A 3LI2A 5DH9A 1H2WA 1JMYA 5DMXA 4H0CA 1JYSA 1OA1A 4IKPA 5FBLB 3WA7A 3IQXA 1LLCA 3UK6A 4B73A 1IEQA 1ZD2P 4UNPA 2OQVA 1P2UA 2ZITA 1CVLA 4B81A 3W8RA 1ZSVA 2VDPB 4O1MA 1W5EA 2ZOVA 2LIVA 3E3NA 5CJPA 2G9VA 4CM1A 1JDJA 1RAFA 1V43A 5BQXA 3S8EA 1XVIA 1THTA 3MWLA 5T6MA 4KV9A 1DG9A 1K6MA 3N3AC 1H7MA 4DCMA 3G0GA 1BQ3A 1ZCZA 4B43A 4MVCA 4QPPA 3AF3A 4XR9A 2H51A 1VQ9F 2AEJA 1XFDA 3E2MA 1AV7A 3MWEA 2KQUA 4ITVA 5ETJA 3NRBA 2X77A 4EMSA 2VZ0A 3QG1A 1PF5A 4HS4A 4WOKA 1FZTA 1J2JA 2Q49A 2YWHA 1L5YA 3ME5A 1EI9A 2C2BA 3RIGA 4GOND 4N39A 1N7IA 2IUTA 1CUIA 1FVOA 3GZJA 4AD8A 3GLTA 4V0LA 4FDTA 1WV1A 2D4AA 3AP2A 2P79A 3KL2A 1I4OA 3L0CA 3N7TA 4NYMR 2I8CA 3ITDA 2ZP1A 2B98A 4MP8A 3SR0A 4FJ0A 1EUYA 4PTLA 4PLHA 3D3WB 4C6SA 3JWIA 4MI3A 2O5RA 2DX7A 3IEMA 3TLGB 2O2EA 2J48A 5DTMA 5HGJA 5I7OA 5IAOA 1W36D 2FQQA 3FLMA 3RVKA 1VDMA 3BERA 3LGSA 5ALRA 1W0KD 1JZQA 4S1VA 5JS6A 4QGBA 3VKHA 5LP6B 1R8XA 2G36A 3CKYA 4US1R 2GD1O 4FMPA 4PO8A 1L7QA 1NUAA 4FEYA 4CM4B 1J1ZA 3AGQA 4I7EA 4LJKA 1W5FA 2JKYA 1OFUA 2QAJA 3FPAA 3KOWA 3L04A 4UNQA 2Y1CA 3WE7A 3TLGA 4D8YA 2WTUA 4O02B 1RXSA 4FBLA 3OE5A 3VDRA 2IF2A 2Q6LA 2H1HA 2GEBA 2IP2A 2JHCA 3I9NA 4D9NA 5GTDA 2F43A 3MSCA 5KMGB 3ZKWA 4BMOB 4BUCA 5TIIA 1DRKA 1RAAA 3SYNA 4MKZA 2QJRA 4DLBA 3RUHA 4ZFNA 4MR8A 3S29A 4B3GA 3WISA 2QY6A 2G70A 2ZJ8A 4Q9KA 3RAJA 3Q8WA 1PKEA 2AUNA 3C85A 1LDEA 5IT0A 1OTXA 5GINE 2IGBA 1S7GA 4J0IA 3VYRB 4RJIA 2ZULA 1NUPA 2GEJA 2DVMA 3CX7A 4DLLA 5EIHA 3I64A 4BQPA 1FA9A 2ZR8A 4WQMA 4L4SA 3T4EA 5A5DA 2K6GA 5JSKA 5KNCD 5EQDA 4ABYA 4EF5A 2XUFA 2V98A 4HRVA 3RS7A 5BT8A 4NQ3A 1U4NA 5EHNA 4GGPA 3EMVA 3D31A 3T7RA 4Z0NA 4U7DA 3WZMA 4WL0A 3DONA 2YDYA 3S3TA 3ZXSA 4ZCMA 3H9QA 2QI9F 4ER3A 2Q4RA 1UT6A 2Y0BA 1NN0A 3M83A 5CCEA 4G0QA 3TW4A 4BVGA 1M1UA 3A10A 4RSRA 1QCDA 4ZJZA 3NC4A 4H4EA 4P4UA 3PCRB 5FNVB 1X7YB 2JVKA 5F7ZA 4DIMA 1YQEA 2OB1A 2FEPA 2PSDA 2Q5EA 3DOUA 4ZVTA 4AYTA 1U63A 3PEUA 4ZOLB 1U5BA 2FX3A 3AEZA 1QH1A 4F2GA 2Y6VA 5HCIA 4B71A 3Q8HA 1ETUA 2OBLA 4LX8A 4XDGA 1XALA 2PAFA 1PFKA 2OFPA 4YCDA 3UV7A 4XM2A 1QKKA 2BTUA 1GZSA 1V6CA 2WTXA 4HL6A 5IUKC 5I7HA 3AEQA 4GP7A 1LWOA 4DR1B 2FRVA 3VAYA 3CSUA 4HQKA 3LSYA 1J56A 3KKEA 2LTAA 5JAPA 1V7ZA 2IHBA 1JDPA 4ODIA 4B75A 4BMYA 3UJDA 1UADA 2PD6A 4P5PA 1C2TA 4UPEA 1V7CA 1YZKA 2CNOA 1G66A 1KERA 2BFFB 2F59A 2Z6VA 3PWZA 5FI1B 421PA 1VL1A 4BUJA 5CB4B 1YO6A 4TM8A 2LW7A 3R75A 2BGKA 1GM5A 1CY2A 3TYXA 4O4JF 4YCSA 4IZHA 4OOFA 1P9RA 1XQVA 4KQMA 4FB5A 5HF9A 4B09A 2AF4C 4L4RA 5CM9C 3EC1A 5JYCA 1JKXA 4TXHA 1OBCA 3BAFA 1SUIA 1W87A 3UM9A 1KF0A 2LBWA 4QU0A 1E32A 2ZE7A 3EGEA 4OG2A 4AB1A 5HRUA 3TOSA 5D3ZA 1OVGA 4OA8A 4WH0A 2ZG6A 4Y6GB 5DNVA 2MSNA 3IBCA 2FWIA 1YZLA 2I65A 3C6YA 3O8OB 2MJLA 1KTVA 1Y9AA 2WQ7A 4MPJA 4XEHA 1GR1A 2X5OA 1LK0A 2UV8A 1L7BA 1J7KA 3P9RA 1L7XA 2GS9A 2OY0A 1S9DA 4LIPD 3TW0A 3PR2B 4PGFA 2HFKA 4E2YA 4R2LA 4XSHA 4KUHA 1OH8A 3WJQA 2A3RA 3I73A 1KI2A 4J76A 1QGUB 1SKMA 3KKNA 3S44A 4LSWA 1HSZA 3CUEF 5HE9A 3SFTA 2D62A 2VWHA 5JH7A 4DL9A 2BBWA 3DPSA 2W48A 1F8XA 3E3AA 4DIKA 2O5EA 3COVA 3CONA 1R6VA 2XITA 3IUEA 5HDBB 1Q8RA 4RKEA 1W1UA 1T6BY 3WB0A 1Y7IA 3GH1A 4DQLA 1P2TA 1UL1X 1ODSA 2UZ0A 1MOQA 3R4VA 1ZR2A 5KSOA 4WA7A 3BAZA 4NU5A 3FSEA 4DKJA 3K8ZA 4CKEB 1JVSA 2RHRA 1MX3A 1FUYB 1XWFA 3DOOA 1UWLA 1XFAA 3O84A 4JR0A 4O4HF 3HP7A 4YJ3A 1H94A 4X1YA 2P2GA 4IHAA 2QS9A 1RI2A 5A2QM 4FU0A 3TSYA 4DDWA 3ENNA 1KZ4A 1F4PA 1E2NA 2FPXA 3KVOA 4MUGA 3W05A 1V0JA 4AK9A 4AWBA 4KFRA 5A7FA 4J1TA 2RH5A 4TOIA 1DBVO 5GONF 3IB6A 5FA5A 3NR2A 1DUIA 4YRMA 5JVDB 1ILEA 4PPGA 3JWEA 1MXHA 1OWPA 4KWTA 3TR5A 3W9UA 5JEDA 4C2TA 2CMHA 2WAYA 5CBPB 1COZA 1ZQ9A 3LPLA 5LOVA 3QMPA 5JS8A 3T0FA 4DADA 5HUQA 4KPUA 2C9DA 4GVPA 4A2CA 2D0IA 4G1VA 3MMNA 1HE4A 3OFJA 3ZI0A 2C96A 1W581 2BE7A 2GVIA 1BQEA 3SEAA 1EM6A 3TZQA 4NMLA 3JATA 1HL7A 2GERA 2FQYA 5KQSA 3QVUA 4GMDA 2GTHA 2EX0A 1DKOA 3IAFA 2HRCA 5E3JA 3TLBA 4BRWA 4EYSA 4PLGA 3JALA 1CJSA 1XTBA 3TD5A 1VOTA 4HB2A 1R4NB 1RYHA 1RI4A 3OTIA 1JHMA 4BT4A 3DGEC 4KPFC 3V4RA 4DYDA 4AWAA 1M8JA 2BO1A 3DAHA 4O4LF 2GNAA 3KQTA 1M3SA 1VZ2A 4MVYA 4MYSA 4IHKA 4JASB 1A1SA 3KK0A 3LOQA 1AN0A 4DLAA 1ZX1A 2W2LD 5EQJB 5C4IA 5LP6F 1DFIA 4C21A 5FWDA 4PIMA 4JMLA 3DZFA 4AP9A 4W1QA 2I76A 2CV0A 1R10A 2ATIA 2BI8A 3NRCA 4BP8A 2MOKA 3KR9A 3U44A 3NGXA 3AHEA 2I2FA 1P18A 2OHFA 4CJXA 3LDAA 1EGVB 3TR0A 4TYPA 2FZGA 2QRPA 3PNVA 2GH1A 3QXJA 3BHJA 2EIXA 3PQCA 4PO9A 5KOJB 2R1VB 3IVGA 3MQ4A 2QPLA 4D9MA 3GOQA 3OTOB 1PGPA 1EDDA 2E2WA 3W5UA 4LOHA 1UPFA 3RE3A 5IASA 5K99A 3R74A 5J4YA 5SY6A 1ORDA 4TMZA 1KOJA 4IDGA 2JHAA 2WSLA 4MQEB 5AJHA 3U3RA 2CLIB 1NF3A 4RTPA 3V5NA 4K3VA 3NIFB 2F4VB 3LTEA 3S0HA 3N6VA 4ITRC 4MIOA 1BE8A 1VKNA 1NW4A 3AFGA 3CLUC 3FVWA 3MJFA 1SVUA 2JK0A 4G4JA 4HAWA 1R6XA 2JIMA 5K6AA 3QBTA 3SE7A 2ZAYA 5ED4A 3OJEA 4IDAA 4O4IA 3JQFC 1ID8A 3C24A 3RA6A 2ZSBA 2GLUA 5ERYA 1XVAA 3V1MA 2QR3A 2CSXA 3FPCA 1FP6A 4Q03A 3LXRA 4DNPA 1OZAA 1T91A 2FMHA 3RNOA 4EITA 4LFCB 1Z4OA 1D4AA 3I9V6 3PEYA 3KQNA 3EIEA 2ALJA 3HG7A 3P9CA 5LYJA 4JXZA 1CP3A 4BFWA 1IZ9A 3K6SB 4A0SA 5JQGB 4OSPA 2AMTA 1EZ4A 5CIWA 4LYDA 4QNRA 1QC5A 1CXZA 1SNYA 2ICAA 4AS2A 3EH1A 3OSUA 4X94A 3PG5A 1MIHA 2Q4DA 1VG8A 5BMVB 3EIXA 2R6ZA 5FADA 4Y3UA 5AT1A 5JDIA 1KZGB 2EW2A 2G1AA 1NY6A 3E15A 3M5WA 4QYXA 5TMDA 5TPWB 3SHOA 4Z1MA 1N2XA 2FQ1A 4KOAA 7REQB 1QHEA 1NMXA 2OG1A 2YZKA 2OO5C 3RVDA 3T41A 5AW4A 2G5TA 5EYPB 3URMA 1KZHA 2G80A 2QLTA 3NHFA 4JBGA 3KFXA 3QX8A 3TGPA 3NBYC 3UGTA 2FSGA 4ROSA 2WJIA 1FP4A 3HMQA 2QM7A 2IHNA 2XLCA 2VDJA 4ZU1X 1CY0A 2XYGA 1QANA 1UBEA 3PSAA 2PIAA 4KRXA 2IY9A 5E9QA 3JWPA 3HKBA 5EVJA 4PGAA 1NM5A 5HR5A 3U81A 1UJCA 2GEFA 4W7IA 1EWTA 3TSAA 4BNXA 4ZOQI 3PTAA 2P35A 1LNSA 1O1YA 1SG6A 2EW8A 3KNZA 4L9AA 1NLZA 4XD2A 1LSSA 3VIUA 4S24A 4M6WB 2AKEA 4Q82A 2YMQA 3IR7A 4J0KA 2H2FA 2GHRA 1E0SA 1E7RA 1I36A 1BXKA 1V4NA 3WAJA 4G0OA 1BA2A 1RE0A 2NMVA 2RB4A 4N9QA 3UJ9A 1TEXA 3CX8A 3DJYA 4RLQA 1X8JA 4YV0A 1YF3A 2NP6A 1A2BA 1IXRC 1M1YB 1H1LA 1DBIA 3RS3A 3QXGA 3GVPA 3RRYA 4RY8A 5HWEA 3H2JA 2ZPAA 3IVXA 1CQWA 2I3AA 4EH1A 1OSNA 3TFOA 3L6RA 1KNKA 3WQSB 1WU7A 2A84A 5IHXA 4GLFA 1IL0A 5SZHB 2OHJA 1DWQA 3V46A 2NVUA 3BWYA 3V1UA 3VR3A 1I2MA 4R81A 4O63O 5ALZA 3TB4A 2WTEA 4M7OA 1K7XB 1GRQA 3VV3A 3W5SA 2PZAA 4Z86A 3DV2A 2GKOA 3VOTA 4I50F 3TLKA 1TAUA 3W2TA 3LUPA 4M1EA 1GGFA 1VJ1A 3HP4A 3ILVA 1KMHB 3BCRA 3AF4A 4EABA 1VFNA 3A4LA 4JSYA 2XMDA 2HDNB 3CPHA 1XTIA 3B2EA 1W0JA 3AK4A 1G4HA 1E9DA 1W42A 3IJRA 4PCLA 3T34A 3B48A 3DOFA 4FSXA 2M6SA 1EX1A 2IBMA 4P92A 2ASEA 1L5SA 3BBLA 5C5IA 1D1SA 1KK3A 1ORWA 2CMKA 1RKVA 2PX8A 3EF0A 4YK7A 4B79A 5CYFA 2NPFA 2J9ZB 4GOLD 2XCQA 3HBMA 5G0WA 4DLTA 5CEEA 3IP3A 2A9JA 4HEA6 5FLXM 2QB5A 5PNTA 4BB6A 5LOVF 4B33A 3OCVA 1KWGA 3R9XA 2EJVA 1N2ZA 2I99A 2C2MA 1CR0A 1ML4A 2N9UA 1LRLA 4OATA 3CZ5A 5U4XA 4Y2HA 1KYIA 4Z3KA 1U2GA 3WL8A 3ZHVA 3GUUA 2FSPA 1CUWA 4YIHA 1PEYA 2BPOA 3H1EA 5ELMA 5FBRB 2GZAA 5JAZA 3F7OA 4UDNA 2H1OA 2HEIA 4ALNA 1JIKA 4FSDA 4OKIA 1W9HA 4ANFA 2VRBA 2ES4A 1IZ7A 4BLOA 1Z6ZA 2VO1A 3V2HA 3CW8X 1FTYA 3ESBA 1KSGA 1H4VB 2GDZA 2XQGA 1A2KC 1CW2B 3VMMA 1THMA 3KLOA 1D6JA 1IBSA 1LBQA 2IYXA 1D7AA 2BELA 4ND2A 2JLSA 3RO7A 4M0MA 2FN4A 4J4HA 5AVVA 3GAZA 4IRXA 4S1OA 5HW0A 4JHLA 3ZWKA 3GXBA 4O1HA 1AQNA 2HN9A 3D1JA 1U2EA 2EBFX 2FUKA 3UMYA 4HATA 5EJ6A 2JHFA 3C43A 4AYXA 5JY1A 1YVEI 2AOUB 1YB6A 2KX7A 2ODWA 4Q15A 3T7AA 5TNXA 1F8YA 3JCZA 3EAGA 4LYJA 4KR2A 5FDFA 5IKXA 3IEIA 4HCJA 3RVOA 4ZT3A 2BSQA 5FOVA 4K6OA 1DL5A 1WXGA 2PBLA 5BP7A 3FOFC 1CJUC 4UHDA 4QXMA 2QN7A 4A6PA 1VMIA 1KQPA 1QHSA 2F90A 4KQEA 4DCNA 2Z8YA 1PBTA 3RRBA 4CG2A 1XTTA 4QTYA 1I1QB 3TRKA 4N4AA 3I1YA 4WXPA 4DWVA 2J85A 3GLGB 5A6SA 3JZIA 1EWQA 1G55A 2OZKA 3ZH9B 4K03A 1ODIA 4KQXA 4EHDA 1CD5A 4WX2B 4PC6A 4OKSA 2I0FA 4N5NA 5AJWA 2ZAUA 4G4WA 4O5AA 5GIPC 1ZD1A 4HDNA 4ETMA 1FNDA 4YUZA 4YRDA 4MMYB 3MT0A 2P6YA 3AONB 3OCYA 4GYYA 2FVXA 4JLAA 5EJ5A 3N2EA 4KC0A 5JI3E 5DHQA 1YR8A 1Q3KA 2UZ4A 3ROTA 3I83A 4M0EA 4RPLA 4I5IA 1I7LA 5A5GA 2NU7A 2OOKA 3QOWA 4GFDA 1JPVA 2QTBA 4G86A 1YZQA 2WYWA 2YN2A 4DEXA 5FWNA 1ULHA 1SXJD 3M9XA 4AY6A 4Y9TA 1Q7EA 3C16C 3EQ2A 4KU4A 3FDIA 4HQOA 4IEFB 1IH8A 1VMDA 3KYDA 2QVGA 2I8AA 1JR6A 1RHMA 2IXBA 2X0KA 3DR3A 3DTYA 3BJIC 3KTDA 1II9A 5TV2A 1ZA1A 1II0A 1W2BF 3R5SA 4RTRA 3BG5A 4JBWA 4ZYUA 3MJTA 1JHAA 1FYVA 4HQLA 1L4FA 3WS7A 1NI4B 1Z4QA 2AMFA 3FWHA 5DXAA 4DLXA 3KSAC 2G0AA 1W36C 4KR3A 2H5EA 2OQ2A 2QRQA 1B16A 4QVGA 4JK3A 1BEZA 1Y8QA 1UC8A 4MW5A 4Y7DA 4LV6A 2H7XA 4JEHA 3HY6A 2Q3JA 5ALSA 2E55A 3AVYA 2IS2A 4W7HA 4ZAGA 3CW9A 4LMRA 2J4CA 4DRYA 3SSNA 5JAMA 1DRUA 2BEVB 4QXOA 4G8CA 1MKYA 3UZUA 4YXFA 4M7WA 4E5SA 4HKTA 1EQAA 1JDVA 2ZUWA 3THWB 2W2VA 2EFHB 4UUNA 2DCMA 3G5UA 3F73A 2BCJQ 2R47A 5HJ7A 5JTTA 2PJRA 1P74A 1C9YA 4NCNA 1S6YA 1VKOA 1PDWA 2WA2A 1ZCAA 3IHTA 3Q0TA 1Z4IA 1OCEA 2XMRA 3A6GA 5CTAA 3QU2A 4M1SA 3TK1A 2O8FB 2YMMA 5KAMA 2I87A 1TT5A 3LLCA 2WUWE 4NBKA 4NE7A 4M1OA 4YUAA 5F9HA 4RKQA 3WJAA 3AF6A 4KDRA 1BKDR 3A6DA 4UASA 2Z8XA 1RLGA 2E1PA 2IYAA 1G41A 1P2VA 3KAPA 4NTZA 3ZCSA 4BLRA 1NG9A 2VEOA 2VA8A 3AYZB 3L82B 4K9KA 3ZHRA 5BV2P 3U3XA 1HMPA 4G1UC 4GOMD 2CVLA 1P9WA 3LWBA 3BSFA 5A71A 1ZNYA 1GPUA 1UODA 5SZJA 1RJ9A 4EPWA 1XRPA 4PAOA 5FQOA 4EENA 2FSUA 3OUTA 4FWIB 2HGSA 1URPA 3L43A 4O33A 3VOSA 2QRGA 1PJQA 3DD1A 3QUSA 4E30A 3AKYA 1CDEA 3CWZA 1RMTA 2OORC 1R3DA 1QSGA 5E6RB 4D8WA 3A6LA 1JG4A 1QMPA 2QOEA 2AFHA 3O95A 3IC5A 2AG6A 3HLKA 3ND8A 5B6JA 2NP7A 2JFUA 1X39A 3BTUA 4N49A 3THOA 4OI1A 1Z6AA 2VQ3A 4Z4CA 5J47A 1NOKA 3P9YA 3P9PA 2BMFA 3QXHA 5AOVA 4CUZA 3M4XA 5H81A 2J7PD 5C81A 5EP4A 5F51A 3SP1A 4KLAA 4BVRA 4P81A 5KOHA 1S2OA 3VR5A 4B62A 1CUEA 3NVMB 3CZ9A 3OM8A 4L76A 5B6IA 2G4CA 2XQFA 2OR3A 4N1AA 4BX2A 3F6RA 5BUSA 5FFNA 2R5FA 5E9AA 1KY5A 3K71B 4KYIB 3OHMA 1QF9A 2DPHA 3G2PA 4OM8A 5CA0F 1TCBA 1LDBA 4P3NA 2EATA 5AW5A 2XE4A 3TTWA 4RADA 5IPFA 5IULC 4OB7A 4TMVA 3DEAA 3KYCA 2PGXA 1VQOF 2UUCB 3HEAA 1OBOA 3RVQA 5AM2A 3A70A 2P2ZA 3NYRA 4AUMA 4DDKA 4I1RA 3HO8A 2P9GA 1Z0UA 2VSYA 4F06A 4MW9A 4QBHA 1SHTX 4PRKA 4BLSA 3RREA 3CKMA 3DOEA 3NORA 4HLQB 4L3WA 4A6DA 1UR5A 2X8JA 1QG6A 1N4AA 2HDOA 2H31A 2VPWA 4KIGA 1DQYA 1TXGA 3SM3A 1TCVA 4DGQA 4E32A 1DTSA 3I9KA 3VCZA 4HGQA 3U9TA 4MS4B 4KYTA 2ARKA 2EJBA 2ABWA 3HC7A 4WMLA 3H05A 2GJAA 3PNQA 3OE4A 2GXSA 4YP0A 4A2WA 4XRGA 5K8LA 3ZDBA 3EGDB 1VE7A 4DLRA 1V4VA 3KVRA 3GJ4A 1XU4A 3QELB 4MVJM 5HILA 1K73H 4MS3A 3OOWA 2OYSA 3U0VA 1QTQA 1KJQA 3CZ4A 3AZQA 4X1KB 2ZS9A 1RJWA 4J2TA 2OXCA 1RNLA 3LP8A 3NBQA 1Z3IX 1QJCA 1W76A 3B78A 1SG0A 3OM0A 2R65A 3PGLA 1L7PA 2F6RA 4WFKA 1P77A 2C7RA 3I6YA 4OCZA 1Y37A 4NC9A 1O94A 2FB9A 3SF0A 3ILSA 2JVIA 1YE3A 4ZEOA 3GLVA 2CBXA 1EP3B 4EI7A 3CMCO 4ZGGA 4UVDA 3ISJA 4MYHA 4OB8A 2RHHA 5CU7A 4EUKA 5REQA 4CG0A 3MK31 4H3HB 5C51B 3HRKA 3PI7A 2HMWA 4UU8A 3PE4A 2JGKA 1RYEA 1TZJA 2X0IA 4MB6A 3S68A 4EHJA 4PX2A 1YZTA 1YS9A 5IYZF 3ABQB 4RY9A 2VP6A 2AI2A 3PD0A 3J80M 1P1KA 1P0QA 2A1UA 1ADYA 5I7EA 2X7XA 1PJZA 2QDXA 4DM4A 1CETA 4QWMA 1RWKA 2PD3A 2H1VA 2YY5A 2NZXA 3C8HA 2H8KA 1JWAB 3BQ9A 3G2QA 5KYVA 5BWLA 4CEHB 2HBZA 4G5XA 1U1IA 1C8VB 4AMYA 2NTNA 1VSTA 1P91A 3F0EA 1MAUA 4FGKA 3SR3A 4AP6A 1I2BA 2I8LA 2ZIFA 3DE7X 4P34A 1XKTA 3FNGA 3MMSA 1TB4A 1O2DA 1DG3A 5TQ0B 1ZJ6A 3G79A 4KLNA 3PQ5A 3VPCA 2IYPA 4QBGB 1RCTE 3FUVA 3FVTA 5FPYA 3QKTA 5AOAA 3WQHA 5JWHA 2X6RA 3H19A 1PLKA 2XUHA 5CFLA 1CZNA 3CN9A 2ZWAA 3KBOA 4P2GA 2PUFA 1XTRA 2O1XA 3WR5A 4NWOB 3EBPA 3NOQA 4E22A 3VNUA 1KRWA 4OHBA 4YO8A 4MA0A 4X6UA 3TCKA 1WOMA 2WPDD 3VHXA 2J46A 4KN5A 3VU8A 3DKKA 1QYRA 1GG2A 1HKUA 1R9GA 1R9NA 2ADOA 2I5PO 2VSQA 3ENZA 4AYWA 2AG0A 4BKOA 4ECEA 5ADVA 2GF0A 1P2GA 1KDRA 3CH4B 5A05A 1UWKA 1R2QA 1ETHA 2VQSA 4M2LA 2IV3A 4RGYA 1Q1QA 3OBYA 1S0UA 5JROA 1AGRA 1CUGA 3MAAC 3ZK8A 3EW7A 4I50A 1J7HA 1EFRA 2GA9A 3FRIA 3L4SO 4QIHA 2ZYRA 3IPLA 4OPMA 3KUXA 1DT5A 1FXSA 4AKSA 2E49A 5F4ZA 3AEYA 1M6VA 4W5HA 2EZUA 3EZ2A 3P9NA 3PWKA 1YBFA 4EFDA 4TSFA 4C3VA 2NPIA 5H5JA 3F1LA 1OHHD 2GZHA 4Y6SA 4QOHA 4CMJA 1U28C 1VIVA 2ZJ2A 5LDGA 3VPFA 5FWXB 4J7CA 1L5HA 1ZAKA 2WD7A 3TL6A 4BN4A 4C6TB 3A58B 3K4QA 1QVZA 3QU9A 4M4SA 3O8QA 3QWBA 1AQ6A 4ZO7A 5L3ZA 4AF6A 4D4KA 3ONDA 3H5WA 4IG4A 4HLUA 3RRFA 1U7XA 3F96A 4X3MA 3ACBA 3I4LA 4UPVA 3TRFA 1E79D 3NHYA 3WRXC 4M8KA 3DT9A 4UHHA 4JC5A 4B6OA 5IANA 4XVQA 2BUAA 3E9RA 4PN3A 3S2EA 3ZNQA 2JLAA 5HX7A 1GGVA 4C9BA 1I4WA 1XRRA 2H9YA 1IBRA 4FX5A 3X0DA 3PFGA 5JYDA 4DQXA 3HV2A 4LMPA 4FFMA 2X3FA 1N1GA 1IXZA 4CBVA 1Y1RA 5FTJA 4XVCA 2ZEJA 4TMYA 5FO1A 1VC2A 5T41A 3STWA 4YT8A 1NW8A 2H7YA 3WGJA 3SVZA 1L4HA 2F9FA 3WJRA 1J5XA 4HGNA 4OHOA 4DV2B 1QYXA 2GBPA 2GFHA 2HSJA 1YL7A 4ARVA 3CCFA 3OLQA 2ROQA 4DV7B 3NH9A 2PRYA 1W9MA 1B8OA 1XQXA 2Y92A 1VM6A 2LNDA 3F8WA 4MUKA 4TM7A 2I7XA 4EGCB 3LFTA 2RJOA 2V1XA 5GJVC 4JOCA 4RC9A 2WJHA 2H48A 3Q3EA 4OQXA 2DR2A 4ZTUB 4CUKA 3DE3X 4R69A 3GRRA 2P30A 5BSVA 2OBXA 1MAAA 1T2CA 4DZZA 4BWVA 2HQ1A 4KMSA 4TTJA 3UOAB 3LWDA 1ZK4A 2I33A 1LV7A 2V3VA 4F45A 1RZUA 1WSBA 2GYUA 4O8CA 4R2WA 2PSFA 1F51E 2CE2X 2R11A 2HRZA 3QF4A 4OFBA 5DHUA 3GC6A 5CRIA 3EIHA 3BKXA 1EXWA 1ORTA 1MW8X 1EK0A 2C2YA 1VJRA 4CWAA 1W8IA 1QF7A 3R0XA 4RM3A 5EIAA 3PDCA 1H8EA 3PITA 4PC2A 1RR6A 4II3A 4LE0A 1OV4A 3WMEA 4TZ0A 4RIGA 3CA8A 3CGWA 2VDWB 3VPSA 4BZWA 2ASVA 2SKEA 1VPVA 3NHLA 3NW9A 2I4MA 4P2BA 3VH1A 2ZE5A 4YAOA 5D3MA 5GGYA 2VXYA 5KCMA 4EYGA 5C37A 4R0NA 5KOIA 2GJ9A 3PJEA 2VNSA 1PZHA 4DCTA 4V1CB 4QTXA 1WPRA 1ZKDA 3UMSA 3V4LA 4D5GA 3FNBA 2Y0DA 2VPIA 3N58A 4UM8B 3NEPX 4EB6B 5DJ5A 4MV3A 3EHEA 4DSZA 3CUTA 2VLBA 4DF3A 5KNBH 4MROA 3LPDA 2IFTA 2XYQA 2BFCA 2B3DA 1OJ7A 1OLXA 2J30A 2RIPA 3EULA 4J75A 4IIJA 3QBJA 4RTLA 2OZEA 3OKFA 3AU8A 4GIBA 5IJ9A 4W5JA 5D3KA 3H8VA 1YQXA 3R7SA 2W0MA 2ZU0C 2FUCA 5H02A 3RF6A 3IL2A 3K0BA 1GILA 1NGSA 2ZVPX 1BWPA 4OO3A 2FWPA 4Q9HA 1AGPA 5BRNA 4TTSA 2F3UA 3ANLA 5DBHX 1EM8A 5F5NA 5THKA 1XTKA 4YWJA 3H1PA 1WBDA 2MINB 2XTMA 3QRWA 1RFLA 4XVRA 4PXAA 1OY1A 1JHYA 2NO7A 2GF2A 1QAHA 2A6PA 2RONA 4B9EA 1VIDA 4RORA 2H5IA 5ISMA 3PEFA 5B2ZA 1C3JA 2YV2A 3KC2A 3QWIA 4JJIA 2X0FA 4PYMA 1E1CA 1RKQA 1KORA 3AFNA 3PNYA 5I4KA 5ELXA 4C7KA 2CLMB 3N28A 1XCLA 3WZ2A 3QFHA 4EGFA 5HP7A 1SVLA 5C80A 5JD6A 1VE5A 1P73A 1RE1A 3HM9A 2HDWA 4PE5B 2YJ5A 4WKOA 4NYIR 4BU1A 3KM0A 4OYLA 2VYNA 4YBZA 1XF1A 3WFZA 4E46A 1IJKA 4KH1A 1Q7CA 4ZIRA 3MEQA 5CBPA 4I5GA 5I7WA 1KJJA 4GICA 2Q8NA 2F2TA 4R3UC 1B0AA 4CR8A 2HK9A 3LZCA 2DUNA 1YVPA 1GARA 3LCRA 2XJ9A 4CQJA 2WALA 4O4HB 4CDGA 3HCOA 3ROKA 3FH0A 4KAFA 1TFUA 1IIBA 1G8GA 2Z1EA 4OL9A 1YZGA 4N47A 4KWIA 5JFOA 1EA7A 2ORVA 1EH5A 3PUHA 4KX3A 3JQAD 5AJYA 1YACA 2VHZA 2VPYA 3KUDA 1VKZA 3LGXA 3MOGA 3OMLA 3PXAA 1WUJS 3VHRA 3N87A 4FGSA 3W7VA 1B0ZA 3GI1A 2OLEA 5DNAA 3WFIA 4DCVA 3M6XA 5KJ1A 3QE2A 3GLUA 3N59A 3Q3HA 4DC0A 2P90A 4K0KB 2WIAA 1OC4A 2I6UA 3OC6A 1TQDA 1GV0A 1LS1A 2CGEA 1Y34E 1SD2A 2PLWA 3FPKA 3M81A 4P31A 3L41A 2QJFA 2EC5A 3VUEA 3U5ZB 5JLAA 3VYSC 2C9CA 2XNJA 3GUVA 5E1MA 1FRQA 1YDWA 2EV9A 3K2IA 4V38A 1UDWA 2ZUUA 5K4HA 2X2OA 3KKPA 1JQJC 3L7OA 5K2MA 1NMZA 1W4AA 1CLEA 3BQMB 5A9RA 1C0KA 1XRMA 1O4VA 2CUKA 1HY3A 1JT9A 1P0CA 2WF7A 3DEFA 3LJKA 4KXQA 2R6R1 1ULTA 2VCYA 5FA8A 1SHKA 1IM2A 1BWQA 2C7PA 1ZOSA 4KK3A 1JTFA 2DETA 4YIKA 4GRAA 3P4EA 4I1UA 4EZEA 4HMOA 2BM8A 1YJ8A 1WZIA 3V1NA 4ZKDA 5DN6D 2M9MA 2WF6A 1E5QA 1PJ2A 1T2AA 3RLFA 3ETHA 3B5EA 3BD8A 4G25A 3WLPA 2ONKA 2XQKA 1Z37A 4DM3A 1QWOA 2Z6UA 2OV2A 3CLSC 3OUZA 3IT3A 4H16A 4X3OA 4CMEC 4IJWA 2FPRA 1FF9A 1TTQB 3HI6A 3KG2A 4EHKA 1CEYA 1DKMA 3DE1X 3LPNA 4J3FA 2XXBA 2EGUA 2Y1LA 3P2JA 1VMKA 2IH4A 3ZKAA 3F6CA 2LR0A 3ANTA 2GNPA 4OHUA 1WCWA 1XD2A 2HGZA 4FJ1A 2F8LA 4LE1A 5CB4A 2EW1A 2EBHX 1TQHA 3E58A 3K09A 1WXWA 4BV9A 5EJ7A 2J08A 3HVUA 1UIRA 1O57A 3LBNA 3PHHA 1S2NA 2X7HA 3KZ1E 1ZWLA 4QTZA 1VQ5F 1AM4D 4YJ2B 4RENA 5F7OA 4RXMA 3Q7RA 3BJRA 4PZUA 1OIVA 1KI8A 1DQRA 2C8LA 1L1FA 1Z8DA 5MFZA 1D6NA 1JB9A 5JD3A 2Q2QA 2Z57A 5HGXA 3KD2A 1O94D 4NCAA 3RG8A 4DSOA 3B51X 3KJZA 1S02A 3T0GA 3JCMM 2XD4A 2C95A 3WWCA 3MS4A 4I1IA 1SUAA 1XPJA 4HI0E 4WK2B 5IC5A 4ZI5A 3GEDA 1I6LA 5I5GA 4BJHB 2AG8A 5KU7A 2OEPA 1T9HA 5HVNA 1PJ4A 3K0HA 3M6UA 4HSGA 1J39A 1DBQA 1P44A 3CTPA 1LTQA 3KQQA 4IVNA 5JH7B 3PC3A 1J2TA 1KFJB 5HS6A 3TZCA 2Z6QA 2AXQA 3TLZA 1KE1A 4EQ6B 4B8ZA 4B74A 2G17A 2RGWA 2BF4A 4I14A 3QFCA 3JQEA 4JLBA 1E89A 4WAUA 3GEEA 4WADA 3UWMA 3UT5B 2J3KA 4HDNB 4BE7B 4GL2A 4EJ2A 4NFLA 3A2NA 2MMGA 3S4YA 3IMCA 3E7DA 2P11A 4PG4A 5FBHA 1ULSA 3PZBA 1J5EB 3WB9A 3IQGX 4REOA 3AG6A 4MV7A 2EDCA 4A0RA 4FWTA 1ZOIA 2KI5A 1Z2NX 4Q4JB 1SEPA 4JD5A 4EFLA 2O2IA 4P33A 4AUKA 4DVJA 2WLTA 1PZEA 1J2EA 2BGIA 1MIOB 2JASA 3K9BA 5BUQA 3U56A 1JZTA 2DOKA 1L0BA 4Q4DA 3IT2A 4ZTBA 5JQWA 2XB8A 1H1LB 1NBMA 1Y89A 3KOUA 3ZG6A 1AHHA 3I9V1 1UXKA 1VZ3A 2RJ3A 3RE1A 3DV0A 2C4KA 1G7SA 5LOVB 2EF1A 3TINA 4ZZ0A 4I9HA 4YRBA 3GGCA 4Y2YA 5DHTA 2OL4A 3QFRA 3L0ZA 4HY3A 4KMRA 3OURA 3QBVA 2AX4A 3F6BX 621PA 3H1TA 2WUGA 2WUVA 1OFGA 4ZODA 4C0AC 4EKEA 3IVCA 3R8CA 1KPIA 1T0JB 3EIWA 2HHAA 4PG6A 5BN5B 3SHWA 3MRVA 1U1GA 2IUYA 4JSRA 3KHSA 4AP5A 1TF2A 2H54A 2OAEA 5A4AA 1O3YA 2EFYA 4IDHA 1TC2A 5JJBA 2JIDA 3FGZA 3O4IA 2Y05A 2DBVO 4Q1AA 1P7ZA 1M2HA 4XJSA 2ETVA 3I4CA 5DLYA 4CTNA 1KJ9A 3ASZA 2QN2A 1QVFF 3SS7X 4OM7A 3D3JA 4KBFA 3TE6A 3ZWPA 2NT3A 3PJFA 2VJCA 3ZHZA 1XT6A 1D0SA 4IQ0A 3QP9A 3ZCPA 5KQRA 5U4QA 4LJ4A 4R2MA 5J5CA 5FRDA 2DYKA 2HIMA 3KUUA 2AKAB 2B94A 2WAOA 3MJHA 3IX7A 1NIJA 2XTZA 5BWOA 4CF7A 2ZQ5A 3UK7A 3BSYA 1XU7A 3C6BA 3FRJA 2AOTB 4KUGA 2JGAA 1B15A 1XZCA 3D43A 3A6EA 3WBJA 3R9XB 1YTLA 4CM6A 5JFGA 5K3AA 4W1RA 2PLNA 2D00A 3NWOA 5D5PA 4CF4A 5I8PA 2QTPA 1ZZEA 2YS6A 3ZLUA 4B2PA 2NVOA 1MJHA 3JYLA 2AFIB 3KWMA 4AQ7A 3O9MA 4N7BA 5M5BA 2R8OA 4H1HA 1T3ZA 5BV8A 1FFXB 3K05A 4QBTA 1N5KA 3CISA 1KEKA 5ALOA 2RSLA 5C8DA 5EKTA 5CD9A 4RWEA 3FTFA 3H1FA 4P9NA 3O4RA 1DJLA 4KXMA 3G8BA 3MZ0A 3QA3E 5LNK1 4M8SA 1UK9A 5BQFA 4X1YB 1R18A 4LZOA 5I7AA 1JG1A 3WA6A 3A4YA 2XDWA 2FZLA 1E6WA 2E85A 4LE2A 1PSZA 3OEHD 3PE6A 5G3ZA 3QF7A 4B5CA 1VJTA 2AGVA 4F3TA 3ZWQA 2GNOA 3A25A 5K0SA 3N75A 4HEHA 3DUFA 2DG2A 3WRXA 2PUEA 3AUTA 1H93A 1UWCA 1G6KA 3WK5A 3KSDO 4KZPA 4MUHA 1CHNA 3I56F 2IXDA 5IAKA 2Z95A 3TQIA 5GIOE 221PA 5K05A 4YRKA 3Q8LA 5L45A 1IUOA 2P2CA 3HYNA 3TKLA 2GDJA 1U7TA 3UCEA 5CEFA 2Z9DA 1VL6A 5TPZA 4CL2A 2LP4Y 3LDTA 5HMLA 3FPJA 1X1DA 1Y4UA 1Z06A 1LNQA 1DRVA 3AETA 3TUIC 2QRZA 3W9BA 1L8XA 2IDZA 1V11A 2I3DA 3EG9A 3MF4A 3AYXB 4M38A 4M0FA 3I9JA 4HDRA 3ND7A 4BATA 2IEGA 1NQXA 1I4TD 1Q0UA 2PWYA 2BMJA 1NC1A 3NFRA 5DK6A 3FCXA 1AQYA 1C8LA 1E63A 4JT9A 1PV1A 4NCJA 5LQDA 3HS3A 5A2GA 1DLJA 4XSGA 3A1SA 1ILWA 1RRVA 2XUKA 5E8RA 6AT1A 4RESA 1IJEA 1UQTA 2X9NA 3D59A 3WGNA 1BFUA 1NV9A 3BWXA 5SYNA 4HDRB 3FTCA 4JQOA 2BDTA 4RHYA 4EHHA 4EKYA 2BR4A 1WAMA 3E03A 4UUPA 1ANKA 3UJBA 3KHNA 4B3IA 1Z4MA 3P2OA 4OQEA 4MEAA 1VE3A 3PNLA 4TPKA 5DHPA 3SC2A 4LI0A 1H66A 3VJKA 2IZ7A 5IARA 1V8FA 2C88A 3DL0A 1M33A 4FSHA 3S2FA 2RHJA 4BT3A 5A3JA 1FJHA 4V0RA 4F72A 4ZVPA 2XIJA 2Q29A 3TUJC 1E2KA 1AH2A 1K4KA 1N0UA 1SVIA 4I2NA 2X42A 3KAKA 5DLDA 1APBA 3NVKI 2O3UA 2MYNA 1ZHHA 2G4LA 5TR9A 3GCWA 4A6XA 1XMQB 1NA5A 3V8PA 1IFXA 1JF8A 3AR2A 2JFYA 3C7DB 3DDWA 5DNDA 3T61A 1W55A 3OBIA 4CTKA 1E4VA 2C3OA 5K5EA 4DLPA 1S96A 3KKKA 4QAQA 2QTVA 1E6MA 3T94A 5CEJA 3N07A 2NZJA 4L6IA 1UMBB 1IULA 1DQSA 2UVPB 1DC8A 1SHJA 3M9WA 4QAJA 4YJ2A 1XCJA 3HVJA 3S06A 2OCLA 5K3SA 2GM5A 3JATB 1SKUA 3I62A 1ONSA 2P77A 1FMLA 2WMDA 1N77A 2FEAA 4JLKA 1BMQA 4GI7A 1GPBA 4HUTA 3HLYA 3W5DA 1FFBA 1KRHA 1Q1EA 1D1PA 2OE2A 2WD8A 1QUEA 2B1RA 3JQAA 1B74A 2O4UX 2XLBA 3GJ7A 5ALLA 3MILA 3FVQA 2CXQA 3JVUA 5F2EA 5IH3A 1YD7A 3BH7A 3TL2A 4EG8A 4JITA 2XMSA 4MSUA 2GFIA 4ZV9A 1X7XB 4EY7A 2QNBA 2P9YA 2BHNA 3JV7A 1L6RA 1ODTC 1GUBA 1JEJA 3C14C 2NV0A 4X45A 1M0EA 2I1VB 1IIRA 1E3TA 4UM7A 3QSGA 4ZEWA 4PEVA 2GGSA 4BE4A 1V8DA 1QDEA 2ZUSA 1B2LA 3ZGLA 1C7RA 4DXAA 2HO5A 3HGTA 3PQ3A 4AJEA 1E92A 4HRYA 5JJLA 3IPXA 3LP5A 4W9NC 2GN2A 2X9GA 5DK4A 1RZVA 1NVGA 4FEAA 3HRHA 4JIMA