3E22B

Tubulin-colchicine-soblidotin: stathmin-like domain complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1C chain
publication title Structural insight into the inhibition of tubulin by vinca domain peptide ligands
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 110
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3e22B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3e22B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3e22B01
5J2UB 4YJ2A 4TV8B 5LOVA 5LP6A 1FFXA 1SA0B 4XCQA 5JCOC 4I50A 3N2GA 5EYPB 1JFFB 4TV9A 5JVDA 1RQ2A 4ZOLA 5C8YA 4EB6A 4O4HB 3N2KB 4X1KA 4O2AA 5BMVB 2VXYA 3JAWB 4O2BB 3C8LA 4I4TA 5GONA 1Z5WA 2BTQB 4X1IA 5JH7A 5KMGA 3JALB 4I55A 4F6RA 4M8IA 4IIJB 1W5BA 3M89A 3HKBA 1RLUA 1W59A 2RHHA 3HKDA 1TUBB 4WBNB 5ITZA 4YJ3B 1W5EA 2GVIA 4TUYA 5CB4B 5IJ9B 3JATB 4HNAA 5JCOA 4DRXB 4O4LA 5LA6B 3ZIDA 3RYFB 5CA0B 2XKBA 2Q1XA 4ZHQA 4O4JA 5CA1A 3WGKA 3JASB 2VAMA 3JAKB 5EZYB 2Q1YA 1TVKB 3E22B 4O4IB 4FFBB 1W581 1SA0A 5LYJB 4LNUB 1OFUA 4B45A 3JARB 1RQ7A 1JFFA 3ZBPA 4YJ2B 5LOVB 4DXDA 4U3JB 4U39A 3RYCB 5KX5B 3N2GB 3VO9A 3UT5B 4O4HA 3N2KA 2R6R1 4IHJA 4TV9B 5JVDB 2XKAA 4X1YB 4ZOLB 3RYIB 5EIBD 3JALA 2RHLA 4IIJA 4O2AB 3M8KA 5JQGA 3HKCB 1W5AA 1TUBA 3VOAA 5GONB 5MN5A 3R4VA 4WBNA 5FNVA 5JH7B 3VPAA 1Z5VA 4X20B 3ZBQA 3HKBB 5J2TA 5J2UA 5IYZB 4TV8A 5IJ0B 5LA6A 5ITZB 3RYFA 1W5FA 5CA0A 3CB2A 5EIBC 3HKEB 5LXTB 3V3TA 4ZI7B 5EYPA 2BTOA 3JAKA 3RYHB 4HNAB 1FSZA 4E6EA 5LP6B 4FFBA 4EI7A 2VAPA 1FFXB 4ZHQB 4I50B 3WGJA 4LNUA 5MN4A 3RB8A 5BMVA 3VO8A 3JAWA 4O2BA 2BTQA 2VAWA 4U3JA 5C8YB 2RHOA 3RYCA 3VOBA 5KX5A 5LP6C 4EB6B 3WGMA 3WGLA 4X1KB 3UT5A 4I4TB 4EI9A 4B46A 4X1IB 4YJ3A 4X1YA 3RYIA 4I55B 4F6RB 5KMGB 2R751 5CB4A 3HKDB 3JATA 5IJ9A 4IHJB 3HKCA 4DRXA 2RHJA 4KWEA 4TUYB 3JASA 4X20A 5EZYA 4EI8A 1TVKA 5JQGB 3E22A 4O4IA 4O4LB 5IYZA 5IJ0A 5M7EA 5MN6A 3WGNA 5FNVB 4O4JB 5CA1B 5LXTA 3HKEA 5LYJA 4ZI7A 3JARA 5J2TB 3RYHA
chains in the Genus database with same CATH superfamily
3N7AA 3WL8A 3SDBA 5BR7A 1YR6A 2QRZA 4C3VA 1UJWB 3TQFA 2LIVA 1G5RA 2HEIA 2VKQA 2W5UA 3M70A 1F1JA 2W2MA 1IUNA 4QQRA 2DBZA 2Q3LA 2WYOA 1WDKA 4E5NA 3JQRA 3N8DA 3E5NA 1X19A 3DV9A 4KFSA 1Y98A 4MQEB 3G5TA 4D97A 1C7JA 3UH1A 4EG3A 3P0ZA 2HA6A 5I3CA 5FOQA 4LF5B 1PIWA 2VPZA 4GM4A 1VL1A 3H0CA 4TWKA 3CTMA 4DQDA 4REMA 3GGDA 3NUGA 4URYR 4DZTA 4R1PA 3AHHA 4FMDF 3C3DA 4WVLA 4P54A 1M7BA 4X66B 2ZRJA 4NP6A 4E15A 3JASA 3DBHB 3TTVA 2QENA 3R8XA 1BWPA 4IINA 3UVEA 4O59O 2PSJA 2ISQA 3DCIA 2W6ID 3QYPA 2QA4F 1GA1A 3KLPX 3OLYA 3C8ZA 3VGPA 4TLAA 3FPBA 4NBLA 4EL5A 1GP2A 1O95C 1Q0PA 2QGZA 5BVHA 2GCGA 5A4MS 4K81B 3OIYA 2W8BB 3RG2A 1RJGA 2JRCA 1VGRA 2PKWA 1UKZA 3ABLC 2X8WA 1WXIA 3R44A 3LDDA 3VX4A 1F51E 1JPJA 3OX4A 4KZPA 1Q7EA 2AD5A 1NVTA 1W4LA 3EA4A 4OX9O 4I9WA 2WC1A 3JYCA 5AK4A 4K0KB 4HEJA 4BQNA 2Q3MA 3HRIA 1FUIA 2V0GA 3LUPA 4MVOA 3T1HB 2NGRA 1I1HA 4W9NC 3CUWA 1FSPA 1UC9A 2DJ5A 5BW4A 1GGFA 621PA 5EKTA 1J56A 3SJZA 3QYJA 1EGHA 3P52A 5H9WA 3RUHA 1JY8A 2GHYA 3OOSA 4HVLA 1WPGA 5B6IA 2WOJA 2IHBA 2X5NA 1Q7GA 3ML1A 3PNMA 3TSWA 1MSWD 4EKYA 2FSIA 4O4HF 2IHYA 2HJGA 4ZYVA 2UXBO 1A2KC 4CMIB 1X0XA 5CVVA 3CJHB 2HREA 5DEDA 1OYWA 4OH7A 1C3OB 5GY7A 1H93A 3LYAA 3VQYA 2IHUA 2ZSUA 2VDKB 1ZMOA 3KUCA 1QGED 1IV1A 4P6VF 1E2PA 4MAAA 3TFWA 3O74A 1GQRA 4YCMA 4JEHA 1PFVA 5GOZA 4PC7A 4P1ZA 1BXGB 2BGUA 5GGXA 1SAYA 4EEXA 1DARA 2IHTA 1GPKA 5FBLB 4S1PA 2O6HA 3LVQE 3ZQKA 3BE6A 1OVGA 3LO8A 4C6RA 3ZXUB 2IIPA 4N9QA 2DAPA 4K9RA 1JXMA 1IV3A 2YUIA 2EYUA 1ISGA 3ICOA 2GCNA 2HKIA 3C8UA 5DX0A 5B1SA 2I22A 1E2FA 1P80A 2DMRA 1OIVA 1Z2CA 1UJ2A 1KEUA 3GJ4A 1GILA 1Q16A 1C7EA 1ZNYA 3T9BA 4B87A 4X8HA 4O2AA 4JJ4A 5DN6G 3UICA 4HAVA 3NCTA 4ZTUB 4BWVA 3DGEC 4RK7A 4ESVA 1UOPA 3JQGB 4MVJM 1M2FA 2C8VA 4UQOA 3DE1X 1WKBA 4HGNA 3UAZA 4LF7O 3FB8C 3LPAA 4DSAA 2J8ZA 3GWKC 3G5UA 3WGTA 3FKQA 2RGGA 2Q2QA 4LZOA 3M8KA 4UMVA 2TS1A 4LYJA 4P4LA 2HRYA 4HQ6A 4HN9A 2X1VA 1JJOA 4AMYA 3BFRA 3R6GA 4N3NA 3B1WA 1JLKA 4JDUA 3PUZA 3DP9A 2CL7X 4S2EA 2QSYA 2R7LA 1V7ZA 3CM0A 4G37A 2IYYA 4PC1A 3QVGA 3JSNA 2CKMA 2X1LA 1HTBA 4YV7A 2BR4A 1KY3A 1I36A 2VTBB 2EBUA 1EFCA 4IS3A 5CBPA 4JP1A 4QREA 4OXXA 4CCYA 4BNDB 4GI1A 2NG1A 4KYIB 1ORDA 2IGBA 4MTLA 3SZOA 2V6MA 2RJ3A 5C5IA 4CL0A 2FQQA 5IY5B 5K0FA 3B6ZA 4YAFA 4TT3D 2AV6A 3KZNA 3R24A 2AFIB 1UKEA 4NXNO 1CD5A 3JQ8B 1N2GA 3O7MA 3OE7D 1YOBA 1XLVA 2DLDA 2ZRFA 1JDVA 3DOHA 4LOLA 3BZUA 4YALA 3PR2B 1XPUA 4V2IA 3O47A 2Z1FA 1T26A 3AJ8A 3F67A 1ISFA 5U4QA 4FE4A 2I2BA 1U0FA 4XOUA 1TE2A 1WM1A 1VSBA 4LYDA 3U11A 4URXR 2QL9A 1DC3A 4Q16A 1G21A 2HKOA 1BHO1 2BTUA 4NZOA 2O3QA 1SD5A 3Q1LA 5E3IA 4MITA 1PJ3A 4HWGA 5DBGA 2F7SA 3T1CA 1P77A 2Z1TA 4DVJA 3BCUA 2MHCA 1M5RA 3MFYA 3PLRA 4IJQA 1TMGE 5L9AA 1CJUC 1L1RA 2B5OA 3ENZA 3ZHBA 2FUKA 4LPKA 3L77A 1BS1A 2ZEJA 3WG9A 2BD0A 2QT1A 3Q11A 4MCIA 2SNIE 5IDVA 4BO3A 3IKVA 3KVRA 1AHIA 4NYIQ 2ZBDA 4X1OA 3EDRA 5D5QA 2GAIA 3E9DA 1UBJS 3UV7A 4GR5A 2ERYA 2I9KA 1QE3A 4HX9A 2ASVA 4Z1MD 2PGJA 1OREA 3RR2A 3KRTA 3PKZA 1SRYA 1Z0UA 3KBBA 3ADPA 1I2AA 1R00A 3G5AA 4NIMA 1T24A 1KI6B 4RANA 4WGFA 1K5QA 3TTUA 4GVXA 1XMVA 2WJVA 3O5AA 1P1JA 2CLMB 3EARA 4ZCRA 5I8ZA 4EVQA 3AF3A 2PKEA 3MMZA 5EIWA 2WIGA 4M9RA 1XV5A 1IUKA 1Q7RA 4WASA 2H00A 2M7WA 5BMVF 5D00A 4N9WA 2GLZA 4NCBA 2AXTZ 1GRRA 3ZLUA 1JTEA 4HAUA 2ECOA 4P5EA 3I92A 1E1QA 2ZRGA 5TDHA 4TSFD 3PVZA 1VQ4F 4M2LA 1H8HD 4JB0A 3ZI7A 3P0EA 3GLVA 2X9LA 4BBAA 1EP3B 3JQFC 5HYVA 3L5OA 4YUVA 2IXBA 5HF6A 2GEUA 1U0RA 1FPQA 1W5AA 3GELA 1X94A 3K5MA 3GLFA 4S0XA 1WETA 3V8NA 4R6XA 2PKQO 4ND2A 1QO9A 5JSUA 2FPKA 3SYNA 1YFKA 4BQQA 3GGCA 2FVYA 3MJVA 4P86A 1ZGCA 5DTRA 3ZRXA 3FCCA 2HF2A 3PNKA 4R54A 1TADA 1UDRA 4X7BA 4KIFA 2VHJA 4EY7A 3DAHA 4ILEA 1I33A 1W5SA 2H8PC 4C22A 3IIIA 3TZLA 3GUVA 4ND3A 3H1EA 2YWCA 5CBKA 2E4XA 1VOTA 2FVXA 2WM9B 3GROA 4IOMA 1YHQF 2VVTA 5F3WB 1WVIA 2GCIA 2M98A 1W581 3ZU6A 1PT7A 5BORA 2P0AA 5CYFA 5CFNA 5EHNA 3TECE 4G4SP 3IO5A 3HA7A 2IE0A 1XG5A 4Q00A 2VLBA 4N76A 3B8NA 3QENA 2F43G 3B7GA 1H6DA 2FEXA 3IIMA 3H5TA 1TMOA 3Q8KA 4HRXA 3OT5A 4WNAB 3GCZA 5DN6A 1Q7CA 1XAGA 2IFTA 2IEIA 3KYIB 3H9EO 3W3AH 2Y6UA 2I29A 4R1NA 2C20A 4H1VA 5CA1B 2AI1A 2FWMX 3A1EA 2FSPA 3TDKA 2PE5A 1SUFA 3KQMA 4U7JA 5DE3A 2D3WA 4G41A 1XRPA 3HCRA 3I6BA 3QUTA 3L72H 4P30A 5EVJA 2Q49A 4KXUA 3LHKA 1SC5B 5DNDA 1M54A 5L3SB 3G0BA 1RI3A 2AN5A 9GPBA 2IH3C 3Q72A 1EM1A 4RLSA 4Z4IA 3CIOA 2DYYA 3IVAA 2ZGVA 1E1YA 3QWHA 2YFYA 2Q3BA 4OK3A 4R0NA 3S0JA 4WFIA 2OUKA 5DM2A 2C7VA 2XNDD 3BL8A 2WU3A 4GW3A 5FUXA 3CWQA 1EG7A 1KZ6A 2X22A 5EQTA 3RYHB 8OHMA 1A9XA 2HXYA 1PD1A 1N33B 5KTOA 2H8GA 1M2WA 4JZYA 1IG3A 1GT6A 3S8YA 2GN9A 3BCSA 3QELB 3JYNA 1K68A 3VZDA 1PZNA 3IC7A 4JXKA 3KPYA 4HNRA 4OBWA 2JEOA 3TWOA 1JEDA 2W2LA 2QTLA 1KQFA 4M8KA 1M1YB 4B8WA 2V4MA 3OFSA 5EYPB 1Q0ZA 4CDRA 2RG1A 3CUKA 3H5NA 1QYCA 5IASA 1NN5A 4LBWA 4WLOA 1NFQA 5I5EA 1UFQA 3KOOA 3NHKA 1H2AS 1O5OA 2W6ZA 3RC9A 1ODFA 2Z9DA 2WWFA 1N6RA 3KYJB 5CHEA 1GGKA 5BW5A 3ZE9A 4CMEA 1SZTA 1OAOC 5F76A 3X1MA 1Y4SA 2HB6A 4WN3A 2I4NA 1ADYA 1U65A 2QE7D 3D7NA 1P62B 4EPRA 3A70A 1RE0A 2CLFB 1KO1A 2P11A 3VM6A 3GMSA 3LWBA 4DJDC 5GV7A 3LFUA 3KB1A 4X91A 2X6CA 2YJGA 3CLTC 3PZBA 1N34O 3ZWCA 2A06H 1KSFX 4N7JA 3SWWA 1H2BA 3EIOA 4X1YA 1JU9A 1QHHB 4PM4A 2FR0A 5C8XA 2XR1A 4UD6A 4OQXA 5FOUA 3HGQA 2QTCA 4DLSA 3P0IA 3GJQA 3JQBC 4EB0A 3ZO8A 3NHBA 2Z1UA 4EDFA 3O3OB 3AIKA 5ALGA 4JOBA 1ODSA 2EX4A 3KEQA 1A27A 2COUA 4MUNA 4JMLA 4C89A 5CFPA 1SA0A 4CC6A 5HWEA 4ZO9A 3HUTA 1SUBA 1TIKA 3ZD7A 1I4EB 2VPWA 3EWSA 5C3MA 3B51X 4OATA 4UVBA 1P2DA 4KR0A 1I5XA 4YIPA 4L4SA 5DYIA 3L1IA 2YS8A 2Y1KA 3EAFA 2GCPA 4DAEA 1TTTA 1XCJA 4ZHQB 1R1DA 2D0IA 3T5MA 1Y1LA 3L6BA 1AV7A 5JD3A 1VBFA 3G5LA 4DR3O 1GTG1 1ML4A 4AX4A 1EVJA 1B1AA 1UEXC 2PF4E 2ZIMA 1Z4NA 4II2A 1Q0SA 2CLKB 3BHJA 2F1IA 2EQ5A 1BJTA 5T3YA 3GUUA 4B4VA 3V3KA 4P3PA 1STOA 4Q1AA 1MB2A 1P5RA 1RM0A 5B1NA 3BERA 4IZ6A 1LBTA 1YZTA 3H5VA 1P3JA 1G4AE 4I4CA 4BFTA 1CUUA 5C1OA 4OGFA 3UAOA 2V1DA 1OTHA 4MLZA 1R6DA 3RE1A 1GVNB 4ZPJA 3WGKA 4P83A 2ODPA 2WTEA 4HR7A 1PYGA 5CK5A 3LZDA 2NYVA 3FGOA 2D2EA 1K0FA 2AHZA 1SHKA 1YZ3A 5J40A 3PFIA 2GT1A 3A1TA 3D5EA 3REGA 4N0DA 1LJ8A 2H4YA 1B04A 1KFCB 1RBZA 3FJ1A 1J21A 2J3JA 1R0RE 4FEGA 4DG8A 1K9VF 3KB6A 4J6EA 1VM6A 2X9GA 5KPJA 3NP9A 1P1RA 1YBVA 4XDYA 4COOA 4J2HA 3C5EA 3T3EA 3PL1A 3FVRA 4Y2HA 4OA8A 4B3FX 2ET6A 1GRJA 2X14A 3PUYA 4C6TB 2R97A 5CB6A 3QFTA 4Q9LA 3TD4A 4L07A 5A7HA 1JPNA 1WOYA 2O7SA 2WKSA 4EG6A 1WAMA 2PMFA 2HT6A 1QVFF 4S1VA 3C3KA 5TNXA 4R69A 5THXA 4PSAA 4F6RA 4PHGA 2MQEA 2OV8A 3UN1A 1E7RA 1S8AA 3IDOA 1OU0A 5IYZF 1NI3A 5I48A 4L4ZA 3DEFA 1UODA 3KYBA 2QUZA 5K01A 2OLEA 4YHHO 4UTVA 1OZGA 1E8DA 4JBYA 1E2GA 3Q98A 2FB5A 1XDDA 2AN1A 1MF7A 2HWXA 1G4YB 1IXBA 1B8NA 2VQEB 1EWRA 1MAAA 4KIGA 2CHEA 2E21A 3OP1A 3KR9A 4CTNA 3HHPA 3H9GA 3Q9LA 2P75A 4ZCTA 1S8OA 1K8AW 4DLTA 1V43A 1V4VA 4ENPA 3PQ6A 5FWNA 4Z9AA 1JWBB 1TVKA 5LN1A 3I42A 2HPVA 2P4KA 4F7WA 3IFXA 1KXZA 1AQLA 3QU7A 4K6OA 2WABA 2ZIFA 1U5BA 3ELWA 4PG4A 3VUFA 2CF6A 3LBFA 4MW1A 1QPBA 4YAIA 3T5CA 1AR4A 3C24A 4RIGA 4L3WA 1F48A 4JS0A 1RQNA 4XCVA 1DNPA 1MUUA 2J31A 1OLXA 2GESA 1V16A 4RWZA 2JS5A 3GPIA 1JWLA 2YWBA 3EXIB 5AJZA 5L3CA 4MUYA 4BQSA 1UK8A 2R8RA 4J9VA 4HUQA 1NLYA 3KOXA 1UZNA 2R62A 2WA3A 3I05A 4M0UA 3EMBA 4RDIA 4NUTA 3U4CA 3DEKA 3EORA 3WIDA 4POOA 3I01A 3KV3O 3U26A 1ZX3A 4X45A 1U0NA 3SQNA 1UPXA 3A0HZ 3MCZA 3RSLA 1GSAA 4IDDA 2QTFA 2OE2A 2Y1FA 1ZN8A 1U94A 2NUAB 4CM1A 4LGYA 1PQUA 1QIIA 4JN6B 4KLCA 1V4NA 2WFLA 1T4CA 4RTMA 1XP8A 2DZDA 2J4DA 2BEVB 1JIIA 4PZDA 3QTCA 2BUAA 4Z9FA 3QSYA 4M9CA 4YAUA 1HL3A 3U7QA 2QL5A 4PLPA 5FL3A 1U1IA 3K9CA 3R3XA 2AC4A 2MWMA 1CUFA 1P17A 5BV7A 2E1PA 2NV6A 2OYCA 4DCVA 4XLTA 2N74A 1XMJA 4FFPA 4DCNA 1YE5A 2GHIA 2X0RA 1NF3A 1U90A 1ZNQO 3H5LA 2IPLA 2OFPA 3K4PA 4XVUA 4BMCA 2H1VA 1W88A 2XT9A 4YB8A 3H4MA 1CQIA 5KYWB 1Y5MA 3NMUC 2ZVYA 3NBMA 1RFLA 5FLKA 1LWOA 2AC2A 1FLNA 1AZLA 2HXSA 4HN4B 3OQIB 4OIFA 3PAFA 4WN9A 2NYUA 4X64O 4EVRA 3RS3A 1W36D 1R50A 4DIEA 4KWHA 2VJMB 1LF0A 4U7WA 4MXDA 1FY2A 2DR3A 5JW6A 4PF1A 4D82A 3PHCA 3QIVA 1ZCJA 5AJYA 5HOEA 4JLKA 4Q4JA 2EWWA 5IJ9B 2VPTA 4YXWG 1FFBA 1EUCA 4XX0B 3N58A 4WRRA 3D2AA 4LWZA 3LP8A 1P7VA 1O6GA 1KORA 1XZDA 5LCXA 1M75A 1ZO8A 1NE7A 3IR6A 2XHZA 4KE8A 5DU2A 4K9KA 3CPQA 4LJ7A 3FOFC 3VGJA 2JFNA 3D1VA 2HLDD 3K0EA 1ZSYA 3X2EA 2ZRNA 3RSQA 3NBQA 3RTAA 3K58A 3WNVA 3ENVA 4KQEA 2ANCA 2CHSA 4U9IS 4YJKA 5A2QA 1W0KA 2PN1A 3BK2A 1YJBA 2YMPA 3ZUPA 1RLTA 2HRZA 4NG4A 5EUCA 3LC0A 4X71A 3H2YA 1TU4A 4QSMA 2O54A 2O5RA 2I2WA 2PYDA 3F4LA 3TCNA 3MHPA 4ZBMA 5EXTA 4NKRA 1EMDA 3ZCVA 2QW1A 2IYLD 1PU2A 5EEHA 3FYCA 4C8IA 1ZK3A 5TRTA 2QWQB 2VBCA 1OLUB 2E4YA 1ULSA 2UAGA 3O8CA 2NU7B 4B1FA 3G9TA 3QV2A 3CO0S 1O5TA 1DHTA 3F7OA 4B74A 4TN5A 2VK8A 3SBXA 3RJ9A 3E9ZA 2XMSA 3QKRB 4KQIA 5JYCA 5AVXA 3I2JA 2P41A 4B3RO 1DTSA 3K6KA 5GANK 4QLBA 1XZ8A 3T4EA 4PTZA 3KO8A 4M1QA 5J2TA 1PNQA 1ZOIA 4DIOA 2EJTA 3H75A 1VRCA 2X2EA 3OO0A 4PAWA 1XD2A 3IKLA 1F0PA 4KQKA 2LIPA 4NENA 3PRKE 3NAMA 1KQSU 1TK3A 4FJCC 4GLXA 2GVZC 1TQDA 4QICA 4TYWA 1ILWA 4TXLA 3N8NA 1RRKA 1IAQA 5HNKA 2WZDA 4YJHA 1FZQA 1IY2A 2PWPA 2R48A 1ULBA 2QEXV 1MX5A 4JJ6A 2EV9A 4LH7A 3WLEA 4BX8A 2QG4A 4B3TO 4KJXA 4YPFA 1Y1TA 4YECA 4D3FA 1U2SA 1W3EX 3E8HA 4FN4A 4MKHA 3PXBA 3OLWA 3L74H 4Y0VA 5K0JA 2R1ZA 3KDAA 2C7QA 3FJYA 3JARB 4CDNA 1U1EA 3DXYA 1WXEA 3O2JA 4OKIA 1N6LA 3EC1A 4A92A 1HT0A 5B64A 2A35A 2EILC 1XF1A 3M0EA 4JT2A 1RM5A 4D46A 2NU6B 1K8AH 3CRAA 1ZGZA 3F6YA 2H1FA 4RAIA 3V2IA 4L6IA 4TS4A 3V1LA 1DKMA 4MULA 2IXDA 3Q41A 3MAQA 3N39C 1ZL8B 3UY4A 4V0QA 1FDUA 5KAFZ 1BSVA 3LYUA 4HZ3A 3FDJA 3RVRA 1QHXA 2XDQB 2YFQA 2EW2A 2NUTA 3UUFA 1N3LA 3CJQA 1YVDA 1R8XA 4PWZA 4HH1A 1PNMA 3CC8A 2Q2WA 3N0RA 4HV4A 4BVBA 1KKUA 4F85A 1MO5A 3I6QA 2IJHA 5L3GA 1MDBA 5CGZA 1YVUA 3LXMA 3G6BA 1P5HA 4G4IA 1VIDA 1PGOA 3LHFA 2JI4A 3E9CA 4ZO7A 4RGBA 3LFOA 3VQVA 3G2NA 1NOKA 2W48A 4K6GA 4MCJA 1J9ZA 3BFKA 4WCDA 4Q05A 1FNCA 5E6SB 4NC9A 2CJXA 1ZIPA 3CLUC 1N5LA 3IDQA 4RMJA 3C98A 1YGPA 3HKDB 3ZVKA 3K71B 1L0NH 2GKOA 4JP2A 2IBZH 5HY0A 1QQ6A 1H2HA 3A1FA 1VCMA 4GBJA 4K8XA 3VC1A 4D3XA 3OESA 2YHIB 4UHFA 2FYTA 4NULA 1V3VA 3G6KA 4QIWF 3A6ZA 4ER7A 1UOEA 4DV6B 3H86A 4O2BB 3CLKA 3SIPA 1PG5A 2HQOA 3GJ8A 5JMTA 2WPDG 4O63O 4LI3X 3P20A 1IOLA 2WUWE 3A6EA 3DVLA 1DJPA 1JHPA 4JLBA 3VPSA 3QEJA 1NJ6A 1PQ4A 4AKSA 3HNOA 2W6QA 1WNTA 1R9GA 4FXOA 4ENQA 2F1KA 1EPUA 4L57A 1WWKA 1XBTA 4ZVVA 2HS4A 1U4NA 1YTLA 1XJQA 5BSGA 3CONA 4QHSA 4YRQA 2XQJA 5AM2A 2W8BC 4FEYA 1TAHA 4ZQCB 4EHFA 3K31A 3FKSD 4IKEA 5D3MA 4QDOA 4MS2A 4HDMB 2XA1A 2DFLA 3P30A 4EZEA 4FYWA 5T57A 1NT2B 2ZSBA 5AOVA 1CWUA 4TMZA 1JA1A 1LBSA 1JE1A 3EB9A 2ZTLA 3QRWA 1EDZA 1D6MA 2ZBRA 3LA6A 5IM4F 2X2FA 3F73A 2QTAA 3LC7O 2F90A 1SOVA 5KVAA 1IN1A 3VHXB 1K4MA 4F8YA 2MSLA 2GF2A 1QF7A 3AEIA 1KZYC 3KEOA 1UWLA 1OZ0A 5BWLA 1RI1A 4DSZA 4UU0A 1ETUA 2EZ8A 3ZHOA 4ZAWA 1KDRA 4BC0A 5JV5A 4HGYA 3D7MA 2QUHA 5AVWA 1UPUA 2P6UA 3NYQA 2P8SA 4CW7A 3IKFA 2O2YA 2WUGA 1KYXA 3WNBA 1V5GA 3T7TA 5CJ2A 4X20B 1OPRA 1IK6A 5KDLA 1LPPA 1S4MA 1U0HC 4HK4A 4KVZA 4PYOA 3GDWA 3TLYA 1O77A 1B0UA 3FNFA 1QLJA 1QTNA 1QK5A 3WI7A 4EZBA 4RAQA 4YACA 1F1BA 5G3YA 4EJSA 4J03A 1RACA 2PDAA 3EPRA 5BN4B 4E94A 3O4GA 1FSFA 4QPJC 3AF1A 1ZM4A 3RYTC 3U1VA 1YRQA 3O8LA 3KR1A 4RBNA 1G20E 4MW0A 2EJCA 1VE6A 2V4DA 2EWVA 4OYHA 2XDWA 3OPYA 4ZV4A 4OX9Y 1SXHA 4BECA 1TM3E 2GZ1A 1U98A 2UZAA 3UAYA 4ABYA 2WAAA 2XOKD 4QO8A 4GOLD 4CLRB 3TQRA 3RGWS 2J3QA 3MCAA 2NAFA 1N57A 3A06A 2P4HX 1ZW1A 2EJRA 5KHLB 1UM9A 5ALOA 1MN6A 5I7VA 2WZCA 5KDOA 4ITUA 3EYWA 4FHDA 1NW5A 3EOBI 4P7KA 2O0LA 2NWQA 2VPPA 3AR6A 2IEDA 4TMTA 5BPHA 2HYIC 4AYXA 1MQAA 1ULUA 2R6GA 3VOAA 4FHGA 3QBTA 3GAMA 1KTVA 3F49S 4BGDA 3AOGA 4Y6QA 3RIYA 3DC5A 1JHAA 4QJ5A 1TRHA 5F52A 2LUOA 2E2WA 3GX1A 1JH9A 4JT8A 2WLKA 1RW4A 1ARZA 4W63A 3D01A 2JJ2G 1QIDA 3BCHA 1P4SA 3PFBA 3N9IA 1WMEA 3NTVA 1XMQO 4BGUA 2UYHA 3ZI0A 2BHSA 3TW8B 3A2FA 5FUYA 3ABMB 3ZX6A 3DV2A 1GM5A 3CLVA 2ZLBA 3T3DA 4WZBB 4DLVA 2M2IA 4BN0A 3ICVA 5CB4B 4U00A 2QW0X 3HSYA 4BMYA 3AKEA 4I66A 2NXJA 4QG7A 3LT1A 4UM8B 4M46A 1IXMA 1G2QA 1R0ZA 2PKCA 1XKLA 3AUTA 1P8AA 1JB9A 4WTOA 4X63A 4R2XA 3RS2A 4G8DA 2UZ1A 4C4YA 2IXFA 3K6SB 5EUQB 2W4IA 4OHBA 4RZIA 5FDFA 2ZI4A 2I8AA 2HNBA 2WTAA 4L9AA 2BFBA 3QX7A 2J59A 3GAAA 3LYBA 3VQXA 3C70A 1E3IA 1ZK2A 1E6MA 1WA8A 4IQGA 4UUQA 1FDWA 3LL7A 4HMPA 2I6FA 1DAIA 3KYCA 2ETNA 1Q1ZA 2PH1A 1PW5A 5AVVA 4BLTA 1A9RA 1KEKA 3B8EA 4FKMA 3KD2A 5LQAA 1D4ZA 5CURA 4NEGA 1VCOA 3FVWA 1IBLB 1F2VA 3E4CA 1IG0A 3ZX4A 2AJCA 4KSBA 2REOA 2D7CA 4H37A 2B4AA 3A1SA 2BLLA 4EPWA 2FFHA 4H3SA 4INOA 4LY9A 2A0UA 4BX2A 4CMKA 1GUDA 1UWCA 3KVNA 1V5WA 4C01A 4RLQA 2CZGA 3UT6A 4RPKA 1Y6QA 3DKPA 2DUNA 3ZDAA 4QU8A 4OY3A 1SCJA 4UCVA 1TD9A 1ECBA 2Q73A 1PL8A 3G68A 4XM1A 3L7MA 1G1MA 4NHEA 4R2IA 3I01M 2ZSJA 4XAQA 4NYJQ 1K2WA 4Q3NA 1KBZA 1P7WA 3KSZO 2VDPB 1UMBB 4PCAA 4U5XA 5B2FA 2PD4A 4MVRA 1PR5A 3JU3A 4RYLA 4AI6A 1VXRA 5E9QA 2FWPA 3M34A 5EBLC 1F6WA 1U7UA 2PZBA 2XAFA 2QP3A 1RP3B 1P2TA 1W9MA 4DN6A 4EYGA 2UYCA 4PZLA 1K5SA 2AZ0A 2AS0A 2ZBFA 3I52A 3M6MD 1FQKA 4L5CA 1CJTC 3R8FA 2OMEA 5C2JB 1KD1W 1OJLA 2XTMA 1YZGA 1X7WA 3HC7A 4BIIA 3I5AA 1UADA 1W5FA 2BELA 2ZUDA 1HYGA 3AB7A 1A7KA 2R60A 1TYDE 4I0WB 5C8VA 2Q7OE 5LHHA 4YJ3A 3GHHA 2QJRA 4EF4A 2A1UB 2QT9A 3S55A 3FVQA 2Z58A 3N87A 2AJDA 4ARZA 4A8JA 2CZQA 1GAEO 4IGGA 2LKDA 2ZZMA 1MJ5A 3TZ6A 4MHTA 2XGGA 2HIAA 1EK0A 1ODKA 1S8FA 2VEDA 4TZKA 4NDNE 1H2SB 3AF0A 4PFJA 4EY4A 2OOKA 1EK5A 2WLLA 2OLJA 2FMIA 2QEXF 3BBLA 3BA1A 5LIRA 1F12A 2B9ZA 4CRWB 1ZW6A 5LC1A 4UASA 3ZZUA 3FAVA 5G2OA 4GXRA 4CXMA 3SE7A 1VSVA 3AH8A 3CZPA 4R6ZA 4MV4A 3FBAA 1CR1A 1FD9A 2DU8A 3ZLVA 1F8GA 3ZJZA 5FWAA 4BVRA 1HQKA 4NBKA 2B5UA 4Q4AA 4BJ3A 1OI2A 3TR0A 2HA2A 1KVSA 4BWFB 3EF0A 3JAKA 4GYWA 4E7PA 1U8YA 3EXHB 1X7ZB 3C6QA 1V54B 3OJCA 2Y9PB 2I76A 2R6HA 4G5QA 4EPYA 3QUWA 5A2QM 2OYSA 5DM4A 1YHQV 3A6GA 3INNA 2NUPB 4V3CA 2ZYDA 2Q41A 4DA7A 1H2KA 3RC2A 3OQJA 1Y7TA 3D3JA 2XX3A 5A02A 5AOAA 3IQFA 3HB3B 5J2UB 1J9EA 1GUBA 4BIZA 1QGUA 4D0NA 4ICGA 4ERXA 1M1KW 5FJJA 4YMGA 2QK4A 2EIMB 1KI7A 3R9KA 4LFAO 4M1WA 2CZCA 2GNOA 2BEWA 3N0XA 2JIOA 3F1KA 4CM9A 1BMFG 1JHQA 1XRMA 2FOIA 1YK0A 3F8TA 2HSGA 1BVRA 2X0JA 3PC8C 5CT9A 5GIOC 1BNCA 1L3CA 4EG4A 3PXCX 3ZXXA 3VQTA 2EG5A 4CPDA 3DTTA 1XI2A 4KPUA 5BT8A 1V1RA 1PJQA 2CUZA 2P9BA 3MWLA 3I72A 2WJWA 1QHTA 1JIQA 1Y42X 1OWMA 3UCXA 2AZDA 3B3AA 1DC8A 3MIZA 5KNCD 4REOA 2QAGB 3WGGA 2SCUB 3E89A 3D3EA 2V7UA 1NIPA 4G26A 5BQOA 3B9PA 4YMTA 4YNBA 4EG8A 2W43A 4GC5A 4FOLA 4UCTA 1Z07A 1SFRA 4RF3A 3W2GA 2KB0A 4OKNA 3TRIA 3GNQA 4NI5A 4MDYA 2FTKA 1EAYA 2BI8A 1KOLA 3UHPA 5E95A 3UUWA 3M89A 4DMLA 1OV9A 2CLLB 2EFYA 3DLTA 3KDPA 1ZJ5A 4EPVA 3W0LB 4K40A 1E2QA 2ISCA 3W78A 1SCBA 2WPNA 4B3JA 3MT7A 4C5AA 1CG6A 5HFMA 1E3MA 2FMLA 4FFNA 2PZEA 2EZOA 2QGFA 2X5KO 4D4KA 3N0TA 2C4UA 2ID8A 3NXKA 1QH9A 4DSNA 4DMMA 3K09C 4ZJPA 4BJ6A 1JF8A 4I8IA 4OM7A 3NYIA 3ZWDA 4UBJA 3TOZA 3WLTA 3NK7A 1H1LA 4H6XA 3RIGA 5IT9N 5AHXA 1JR3A 5CNKA 2I67A 4X0EA 2HBQA 4IIEA 3PD7A 4UMFA 5EUMA 3WX0A 4QBIA 3L75H 3IERA 3L0IB 3KCYA 1YZUA 5DMHA 2YZNA 4LX0A 1XRQA 4GR4A 3PHHA 1JIUA 6ADHA 4QUIA 1ADCA 3BWYA 4OLFA 4KDFA 3P2IA 1KYIA 1DS6A 1PYDA 4C4AA 4DQXA 5F35A 2O07A 5B1OA 3OJFA 4YAEA 1RS0A 3FAZA 3OF3A 1FNKA 2X1HA 5IFLA 2B5VA 1CRZA 1LW6E 3TMKA 3H8VA 3BXHA 1JPUA 1XB2A 3U4QA 3MWYW 4JAUA 1KDZA 4G4GA 4RESA 1Z5VA 3IBCA 1VSTA 3AL3A 2YQ5A 5AUQA 3WISA 4JIGA 4CG1A 1VHAA 2YXZA 1TAEA 4ALJA 1FLVA 3BRQA 2XCRB 2HRQA 1B0ZA 2XAJA 2OZBA 1Y3BE 1M2VB 5H7XA 1W36B 2J3LA 2Q6AA 4Y6SA 4GUNA 1ZC4A 2BISA 1XNQB 4J0CA 4WACA 1SXJA 1I0HA 2N75A 3GD7A 2IPXA 2B20A 4CMGA 3UUGA 3AM4A 3HKBA 2ERXA 4WV3A 5D8DA 1UZUA 1T3LA 1YDWA 4LE2A 2GUWA 3OZWA 3EISA 1WBBA 3SF8A 3ZDCA 3V5NA 2EKBA 1KD1H 1M5TA 2AOXA 1XZMA 2KG7A 2ITDC 1G5QA 4ZC1A 3FMOB 4A5SA 4KE6A 5TPWB 2Z3ZA 3H3XA 2DTXA 2BBOA 3A36A 4DS3A 2BLNA 2QBYA 5L51A 4KAFA 1AZWA 3HUFA 4RVNA 4DR6O 4ZCIA 5J5AA 1Y34E 1XU9A 4TXMA 4CWAA 2WF8A 3FOEC 5JC8A 3H99A 4PXYA 4ZDIA 1YF3A 4ZZ0A 3TI7A 2EKZA 2NADA 4RJTA 1ULHA 3MDSA 3GJSA 5U1PA 3H1IH 4S1NA 1ORHA 2UYGA 1TCBA 1J5XA 4BB5A 1LDYA 4QU9A 2JBHA 2PKRA 5JQGB 3EXG2 4E0BA 3C6ZA 3LUJA 4XYLA 1DC4A 3OI7A 4U0JA 5C3UA 3ND9A 3EH2A 1WQ3A 2A57A 3KU1A 1AXEA 2F3SA 3RLIA 4IFEA 4Q5IA 2G0AA 4E12A 1B3BA 4WBNB 1XX6A 1JCHA 3TN7A 1M0SA 4UULA 5IAKA 3QJYA 3EQ2A 4JI3B 2DG2A 2KE5A 5J1TB 2P22C 4JLWA 1CUGA 1R66A 1VLLA 2CMFA 1G7RA 3V1TC 3MJSA 5JROA 1JQEA 1QH1A 5LZ4A 2E87A 4H7KA 1YB7A 1Z47A 2JJQA 1D3AA 1ZUWA 3EGOA 1THZA 4RTSA 4K9LA 4EG7A 2C2ZA 2DR0A 2PZ8A 2DHQA 3VR4A 4GMFA 1KL7A 3BQ9A 5AUNB 2DXIA 2H59A 2Q4OA 4MVJD 2ILVA 5JAQA 1V35A 4LYGA 2ZU6A 1BMFA 3BX1A 2WYHA 3LK6A 3EHBB 1TTHA 2VDUE 3DLIA 3GNLA 4LJ9A 4RKQA 4FGWA 1M1KH 4I14A 4CM5A 4MI9A 3WLJA 3GFGA 4HBGA 2Q5CA 2YJ6A 4Z9BA 3FTQA 3KUDA 1Z33A 4A82A 3G9UA 3PT5A 4NATA 2XE6A 5I3ZA 3COJA 2FMTA 1ONNA 2I3ZA 4CMHA 3V2HA 4BBPA 5EKSA 4DRXB 2AUMA 4LCUC 3DTVD 3J81k 2IXEA 4JUAA 2UYQA 3DE4X 1U7OA 5E6UB 3TB6A 1WP9A 5JC1A 3R3YA 1A71A 3FB6C 3TPZA 3ESBA 4GM0A 1A4RA 1AP5A 4RKYA 2G72A 3OD4A 1WLYA 2QTTA 1DTOA 3QE2A 1LNZA 1CZHA 4M98A 2OFWA 1PJBA 3GIWA 5FTMA 3N8GA 1XPJA 4MV7A 2HY7A 3DMPA 4HVCA 2VNKA 5A9SA 4DR7B 3GLGA 3GK3A 4LBYA 1XVIA 4HDOB 3FIUA 3AO0B 3SEAA 4ZGWA 4ZGBA 1KKDA 1C1DB 2F8SA 3PN1A 2DWPA 2JLSA 2K2WA 1TFUA 4NG5A 3PKJA 2GA8A 3LDTA 1YB4A 4PYMA 3OF5A 3U4GA 2RQ6A 1DT9A 5JAHA 3WIOA 1U6JA 2BN4A 1T3SA 1NQVA 4PYNA 2E89A 3G1UA 1SXIA 3KQYA 3AEQB 3NOVA 4PELA 4G1MB 3G49A 2MJLA 1A8HA 5DNUA 2VIIA 3KSAC 2W2TA 1HETA 1DCTA 4A0RA 3N2EA 1XN1A 5LMUB 4QATA 4ISBA 3ZNOA 4ZDWA 3TXSA 3ET4A 4FOOA 2NNWB 3CXHF 4Q9AA 1EZ1A 3IJ4A 2CVZA 2ZWMA 4RPGA 3DQPA 5BXZA 1CIJA 1DUVG 4B80A 4YH1A 1J25A 1Y4DE 2W6MA 4ZIRB 4C05A 3INRA 3VC2A 1HDOA 2HAEA 3COYA 3V4VB 1D8AA 3D36A 5IVKA 4E32A 3AETA 2YUTA 2RAVA 1UP6A 2YMMA 2DKFA 3LY5A 2AKEA 4NAVA 3WYNA 3ZN0A 2OXEA 1GKLA 2BFFB 2GF0A 3PA6A 4WXPA 3L4BA 2HIGA 3ORSA 4G5FA 3G2QA 2IHNA 4A36A 4WKNA 4CG3A 2YYSA 5TGZA 1HQCA 2PLWA 4A2QA 3PGLA 2A0WA 3C9UA 1ODLA 3A9VA 3OTHA 4RTOA 3LKVA 4P53A 3DCNA 4ZREA 1SJ9A 5AOBA 4N3BA 1ZWIC 4IVNA 4O5OA 4BVJA 1JQ0A 4BVEA 1QP8A 1YCDA 4QPDA 1NI4B 1VL0A 5TMBA 4D42A 1FDTA 2O2DA 2WA2A 1NUPA 5D85A 3BMOA 1MC5A 1KYOF 2GYUA 2IOHA 3HBNA 2I7VA 1N4DA 3AEXA 1NY5A 4BFCA 4NMWA 3EODA 3K70D 2D54A 3KQQA 1OFTA 3TD6A 4OAOA 4PYKA 1N0IA 2JLBA 1AC5A 1EXNA 2GXUA 3FTNA 3WY9A 2ILMA 3OLCX 5F51A 1YHNA 1DQNA 3PS9A 5H6QA 3R9XA 1V3QE 2WMNB 2UUAO 1T6NA 5CA0B 3ONWA 3E0XA 3KQSA 1QQBA 3IJPA 4LF4B 4U7FA 2O23A 2OG2A 5D1NA 3IQGX 2X0IA 4G1CA 1E7SA 2BFMA 3FLEA 4A91A 3WLIA 5LU8A 2NO9A 2WLMA 5JPIA 3QFHA 3KJNA 4RZHA 3V4PB 2VSFA 3F71A 3QPCA 2VJPA 3P2OA 2VQFO 3ZCRA 5KOHB 4TM7A 2OECA 2ETXA 2VCEA 2EF0A 1PZEA 5CEJA 3OWHA 4CDMA 1I7DA 4AJIA 2XTNA 3L07A 1L5OA 4EI9A 3HGMA 1ZS9A 1YDEA 1SU8A 1L6IA 4NPAA 2ZBQA 4BDTA 7REQB 4DDMA 4KFUA 1OI4A 3P8ZA 3UXHA 4XB6B 1SHZA 2HL6A 1ZHFA 1YS1X 4NS4A 4KPGA 1O58A 4ZMRA 1U6KA 4B6EA 2UYKA 1E2KA 1DMRA 4DGQA 4FZ3A 2YIVX 5JXGA 2Q1UA 3H2HA 1R0WA 2IZ5A 2CFCA 3CV3A 1JQ5A 2IYUA 1JA0A 3G82C 4R7TA 5KNLA 1VQ6F 4IJMA 3GRKA 4QT0A 4WZAE 5AQEA 1Y48E 2I3AA 1M5IA 3BMNB 1V7PC 4C2UA 4B7XA 4G1FA 2J5QA 2PVCA 3CG0A 2I33A 2P9YA 2JIZD 1THMA 4L0CA 1QP0A 5DXAA 2ARHA 2AOUA 2H1HA 2FW6A 4JOCA 4QPCA 3ELCA 1HZZC 4D74A 1CQJB 3L4EA 3QF7A 1EG2A 2AK2A 2R66A 3HXQA 1CUIA 1MG5A 1B2LA 2TRSB 3FUUA 4NBUA 4V0MA 3IBSA 3KXKA 2DQ4A 3CNLA 4BE4A 3D0OA 4TM8A 4YJ2A 1E3WB 4KL8S 1HDEA 1KKCA 5JJ5A 4QGPA 3QTYA 2VHVA 1XV2A 4EA9A 1N6NA 3QVSA 1IL0A 5HKOA 3EX7C 5AW3A 4AXXA 4FDVA 5AW8A 1WMBA 1KY5A 1OCCC 2OY0A 2VXOA 4GX5A 2Q1YA 4IDEA 4PO9A 4IDNA 4ZZ3A 4LRXA 1JAZA 2LBTA 5JFOA 4II3A 4P98A 3SYQA 3AP2A 5A3JA 4F2PA 2OC4A 3I1IA 3ZD6A 1MZEA 4RJ2A 2CXTA 4OLHA 1PZHA 3LQ2A 4ABTA 3LOUA 4J0DA 2AB0A 2YC0A 3GJZA 1N77A 4QOFA 1NXWA 4QL3A 5THQA 1TMYA 1Z4IA 2ID4A 3KXDA 2PV0A 1E5QA 1XQWA 3PDIB 2YJZA 4I2NA 1TGOA 4J9ZB 1NYRA 4L3VA 5IDXA 2OFXA 2QAJA 1B0PA 1W5TA 4MPTA 1MB9A 5EFZA 2B21A 6ABPA 1HRDA 4R8SA 3ZV7A 4ZCPA 2PU5A 1D07A 5H16A 2FFJA 3A8TA 1IBKO 2LTAA 4WLVA 4HTFA 1YIDA 3PNLA 2WD7B 3RPEA 2GPYA 5KYGA 1XLUA 3RGGA 3ULKA 3UXYA 2ZCEA 1LQUA 1DIAA 2P9FA 1Y7LA 5GONB 1DKUA 1IBMB 1SZDA 3LY9A 1Z73A 2QKCA 4JI5O 1GXSA 1WTCA 2YWDA 1S2NA 4JHLA 1NZFA 4QXPA 4F93B 4CG2A 4KNVA 4QRDA 4V1CI 4XD7A 1DKOA 1AY0A 1VMEA 1XU7A 2FN3A 2NMUA 3FNIA 2P0YA 4Z7OB 4D8YA 2UXDO 3E7XA 2P9EA 4QM6A 4I50A 2HCFA 3EWIA 5DGCA 1XAJA 3RVDA 1NUTA 1DXQA 1ZOOA 1IULA 4NV1A 1T13A 5AM5A 1KYZA 4EHKA 2OAEA 1RXEA 1GGEA 5GVRA 1IOVA 4G25A 1RKXA 2FEMA 4FQ7A 3RVQA 3F7TA 2PPVA 1G8SA 1M2JA 4HG2A 1ZRMA 3B9BA 1FS5A 2OAP1 1N5KA 4UJ3A 2X15A 4A03A 3NVKI 4RFVA 1QH8B 1Y74B 4OHRA 3DXRA 3GLTA 3WVNA 4WL0A 4XARA 4OXSA 4DLKA 4AM8A 4CKEB 5KUMA 5EXXA 2D3TA 1D03A 2DH6A 1KDOA 2ZSAA 1PPJH 1R3DA 4AURA 1XZPA 4L7QA 4MGKR 4F72A 2C5EA 1T1IA 1XROA 3UBMA 3G1WA 1NMSA 3MVEA 3MTBA 1BW9A 5J9PC 3EMVA 2F43A 2JJ8A 4NU6A 3VMMA 4C08A 4JAAA 2BEUA 1U9ZA 3OZGA 3L7DA 3RRXA 4AUMA 1EFRG 2OIGA 2VT3A 2ZF8A 2GN0A 2GPJA 3BAAA 4JI2B 1E5XA 1O94D 5KKCA 3ZVLA 3PVCA 1O2DA 3GFVA 4ZKIA 2H5LA 2ZITA 2EINB 3CVUA 1SB9A 1GTSA 2D6FA 1NVVR 1SHTX 1BU8A 3VJLA 3LHSA 1X1SA 4DZRA 1TCCA 1UH5A 4B45A 2HUNA 1G8FA 3UK6A 1F8YA 2DP4E 3W5CA 2VHCA 2QU8A 2IWHA 1N5JA 5BN5B 3LUCA 4PZUA 4JI7O 4ZOCA 1R1MA 4OHPA 2FW9A 1DVRA 3IVMA 1T6XA 4QRHA 5T5QA 4JYMA 2HPZA 3PIDA 1B74A 2KTVA 3PL5A 1L4EA 3AVOA 3WP1B 4ZZ1A 1PL0A 1SOMA 1VKOA 4N39A 1FFDA 4CQLA 5I9SA 2QWOB 3L6RA 3AM3A 4DPKA 3QF4B 2G07A 4JI4O 1CFJA 1TAUA 1OF1A 2OBLA 2VH1A 1V55B 3CNBA 5IC4A 1NASA 4J49A 4L2IB 4RTRA 1GFSA 3F74A 1NMQA 3A2KA 3PSHA 2D06A 3L6UA 2XEXA 2QE6A 3BHMA 1ZFNA 1IB6A 1D2NA 3A3PA 4HNAA 3DF9A 4X3PA 3AC0A 1SVWA 1EVLA 3FCAA 2FUNB 3HB4X 3KZCA 3DQZA 4XQ9A 3OU7A 1BGVA 1QP4A 4L22A 4HUTA 3RYCB 5LWQA 5AVQA 4D3ZA 3ABMC 1TCUA 4I5EA 1U3WA 1L4MA 2L18A 3EUFA 1AGPA 2PG3A 1YVEI 1L7OA 1LVHA 3HCFA 3DDCA 3ZY4A 5A06A 3ZDRA 2G5GX 3OZSA 3IV9A 3ZHZA 5EWMB 2VAWA 1O97D 3TTSA 3EIEA 3ZLJA 1OCEA 1CCWA 4OD0A 3C85A 5A4FS 3FCEA 1Y3AA 2W0MA 4QULA 5HMMA 4DM4A 4GEKA 2YY5A 4LVNA 4CT4B 3UOWA 3S27A 2ZCVA 4OG2A 1LGYA 3LPMA 1J0AA 4EKWA 2HO5A 1PE0A 3ZJTA 5A71A 1Z0DA 3NHSA 1WHTB 1CKEA 3LBNA 2RHHA 2ZRQA 2QLFA 4PIMA 5CIWA 3HUEA 1Y9EA 3WBFA 1Z74A 4HPJB 1AMNA 5C1DA 1EDBA 3R20A 3BFPA 3DYIA 4DZZA 2I62A 4JLMA 4B43A 4G65A 3FFXA 4E46A 4DQLA 3I4CA 10MHA 2CVHA 2ENWA 5LKAA 2J9YB 2H29A 2O5CA 2PS3A 2FJ0A 1GNSA 4CL3A 2CHVA 1W4RA 3RU3A 1UAGA 5FOSA 2I1VB 4G3XA 1Z3IX 4TV8A 2H65A 5IF9A 3MTDA 2NTJA 1MB0A 2EBFX 1A4IA 2C96A 4YBRA 5FTWA 4MARA 1QZXA 3MQ2A 4KGXA 4LA4A 3R3VA 2X7XA 3K06A 1NPYA 1H47A 1XWWA 3HO6A 2PGXA 1HDYA 4BW5A 3U3ZA 5JJLA 2PAAA 2IOYA 3EW7A 1PT9A 3DE6X 1X7PA 4TROA 4GHWA 2BKEA 3RTEA 3LY7A 2XJ4A 2W0XA 3OF2A 3IKTA 1KI3A 2HA4A 1Z4QA 1HSZA 2L42A 1L8OA 4EHDA 3V1UA 1P3DA 4ZQHA 3LGXA 5LFAA 1M6WA 3RE3A 2CXQA 1TZMA 3ZGXA 1YRBA 3DKKA 2PVPA 2O7QA 2OB2A 1ZXBA 2YMLA 4DCTA 2BPOA 3E05A 1RZVA 3SG0A 1HNZO 3N27A 3AXSA 3IDFA 1XMOO 2QG9A 4CU2A 3HU5A 1W1IA 4MHSA 2Y0PA 5DXJA 1JDPA 4JKIA 2FSFA 1IZ7A 1EH5A 2DOKA 4M7WA 2AOWA 2ZBPA 2LGJA 1NG9A 4MVJH 5FA6A 1VHJA 3RBAA 4AB1A 3S02A 5CW2A 1NR5A 4O6VA 3Q10A 1E0DA 1NULA 2NO6A 3QVUA 1E1KA 3IEPA 2RH4A 4F92B 4PSKA 1ZK1A 1X14A 1X7YB 3V6MA 3O3NB 3JWEA 2Q4PA 1MC8A 4IKOA 1T5IA 4J75A 4L8LA 1EB8A 3LUTB 2HFKA 1WY7A 2QEQA 3LX6A 4X62O 4TZTA 2YRFA 4BASA 3CE9A 3TZEA 4DILA 2HVJC 3QY0A 2PRZA 4AIRA 3FYUB 1XUQA 1EFRA 4PIPA 3WAJA 1PX0A 3BWDD 4J7JA 3C7DB 2WJAA 4Q3DA 3PYXA 4MZXA 3VU3A 2PSSA 3UXEA 4P9PA 3WC4A 1P2FA 1SU7A 3N4YA 3PNYA 2WMYA 3D2LA 4BDSA 1DTWB 1LRKA 4HQKA 1MIOB 4QEDA 1VSUA 1S72V 3EAGA 2EP8A 2NLOA 4UU7A 1E1QD 2ZDGA 1YBFA 1ZRSA 3S44A 3KETA 3SR0A 3TD9A 5JRDS 5C31A 4KDEA 1M3SA 1QJCA 4HYOA 5HY2A 1ZN9A 2GETA 4EGCB 3RARA 1X7HA 3L1HA 2CL5A 2PCJA 2BO1A 3T5AA 5A0TA 4BMPB 4H77A 2QG6A 3DZBA 4D45A 1Z2OX 1L9XA 5DLQC 1N0WA 3RHZA 1KGSA 3LWNA 4OXIA 4OAQA 2KTUA 1I3NA 4JR1A 4EMBA 4Q01A 4Q1DA 1Z37A 2FEPA 2Q2VA 2RI1A 5EQFA 1XD9A 3QLVC 2A9FA 1CZRA 3ZHTA 1E59A 4OHFA 3WK9A 1X80B 4MHOA 1YUNA 1NJIW 3RYFA 1ZM9A 5CXXA 4RH1A 4RXTA 3FYIB 2O3TA 3QVMA 4FZ1A 4KNYA 4X95A 3O2SB 4UEQA 2IW5A 5U9CA 2WIKA 4ETMA 1DQSA 1UBOS 4HRAA 3BDIA 3UA3A 4YT2A 4PX9A 3P45A 3U37A 2IV7A 5KTRA 2QXUA 3OE4A 5H2FZ 1PDVA 1E2DA 1H2NA 1EX7A 1II9A 4MQUA 3HYSA 3P9PA 2B9EA 1E99A 3Q3JB 5L6MB 2ZBUA 4I4NA 4QTYA 5J9FA 4G09A 2PXXA 1T1GA 2Q0OC 2V1UA 1DG1G 3NRJA 2FNAA 1MH9A 5IXJA 1USUA 4FFBB 3GHZA 4KYVA 4ZCLA 3DTVB 4BLUA 2IPAB 1NTKH 4L8FA 3AEUB 1XTQA 4AKTA 4XIIA 3AWDA 3TXAA 3MJDA 4WWHA 1TUIA 2RHTA 3NMUF 4ZT5A 1XMXA 5J23A 2ORYA 1O4VA 2M6LA 3ANXA 2LVBA 1OAKA 2WKPA 4CUJA 4NU8X 3RQIA 1Y6ZA 3SICE 1SK9A 1JEQB 1V8OA 3PE4A 4D79A 5ALIA 1PKEA 3BGVA 5ECDA 3TAHA 2JFYA 3CSSA 4YCJA 2ZSFA 4DY6A 4P4SB 4Q1VA 3R09A 4QYTA 5DKFA 3HN6A 4URFA 1MG0A 4EENA 4V0SA 4GKKO 3AZQA 1KR5A 2AJ8A 3O4VA 5EPUA 4U6NA 2ODWA 4G5RA 3QX9A 1DGQA 1GFWA 3WK8A 3ICCA 4OXNA 1S2IA 3WLPA 1Y8QB 2ZE6A 1MX3A 3ADKA 3Q3IA 2H07A 3PWZA 4Z0HO 4YXWA 3ODPA 3GW8A 3CNHA 4QQKA 3UMYA 2W2LD 2JB9A 3IR5A 1MGPA 3DAGA 2VTEA 2HSWA 3N86A 4X3LA 4LRTB 1Y1SA 3A11A 2GUZA 2E4ZA 3WE7A 2O8FA 2IHKA 1L5NA 4BP9A 3AL0C 5LGNA 2KSQA 4QTZA 3DC7A 4J16C 1JHUA 2JJ1D 4X6UA 2BGRA 4DV2O 3G13A 5IXYA 4FLZA 5DNWA 4AFNA 3TR5A 3QK7A 4BLPA 1MO3A 2FZKA 1CBUA 2H8KA 3WJAA 4NFSA 4IRUB 4GZ5A 3KUXA 3OTOO 1ZUQA 4GRDA 1YMUA 4RA9B 1HGXA 5JBNA 5AM4A 1J00A 2FX3A 4B81A 2WDPA 2QSZA 3QTLA 2R1VA 3FCOA 1DX4A 1LB1B 3QITA 1PR6A 4D7AA 4CIVA 3BREA 2O05A 1JR4A 3IAXA 3KTFA 5E4FA 2UU9O 4UFNA 2FR8C 2BTQA 4DCMA 3ENQA 3QOXA 4MDFA 3RWRD 1T3HA 1WUIS 4X8LA 5AP9A 1MPXA 5C32A 4BO5A 3LSTA 2GSDA 2CC2A 1CUHA 2QTMA 2R11A 3O4IA 2PR7A 3L7JA 4UUAA 1S3IA 3K70B 2P77A 1GUYA 3ZMUA 3B7WA 2GQ0A 2I4LA 1WXFA 4FJ0A 3VH1A 1MZPA 4JL6A 3THXB 1TZCA 1U31A 4FMTA 4WKBA 4ON9A 5ALXA 4TQAA 2NX2A 3KS9A 4G67A 5DCLA 3OMIB 1ZD1A 5LP6F 4WQMA 5LOVB 1EFPA 2BGNA 4XQCA 5E2AA 2R6R1 3A6HA 1M5UA 4RVSA 2QT0A 4K0RA 3HY6A 1ZCZA 4X9XA 3ZKAA 3F3SA 4BE7B 1Q91A 2BFOA 5B1IA 5CD1A 4W1PA 1MC1A 2B83A 1C4OA 3RT9A 4LYYA 1XVUA 2VUUA 4N5DA 5ELMA 5AYVA 1G5PA 2SBTA 5KX5A 1E2BA 5JRJA 1H2LA 1KZGB 3OKAA 5LMZA 4F4IA 2C9MA 3ZP7A 4M54A 2QD2A 2HJVA 5M7EA 3D6UA 2L82A 3GFSA 3CT4A 2VHEA 4IH9A 1RHRA 1DPGA 2EIKB 4NXMO 4US1R 1ZM7A 5BUQA 1YE8A 2ZVZA 2R6CA 5TQ0B 3OU2A 2GRUA 4NCAA 2HK7A 5BMOA 2EL9A 4E2LA 3CH5A 3GUZA 3PGA1 4MQFA 2VWKA 3UM9A 5IWAB 1WXHA 5C4GB 4RETA 1VIVA 1BE3H 1NJIH 1GADO 5IY5C 4X85A 2RK6A 4UM5A 5EL0A 2KPOA 4U8GA 4ZC8A 2QPAA 3NX4A 4U2EA 2P2YA 3O8OA 1QHIA 3LT2A 1JLHA 2O57A 3L8EA 2A1IA 1AUXA 2C7BA 4ZI7B 3HACA 4OQFA 1NXPA 1P2UA 4RZXA 4DM3A 4IXMA 4BKQA 1X9GA 4MRVA 3V8RA 4HT3B 5AK0A 2PH3A 2IU0A 3PWKA 5AKZA 3X1WA 2C2OA 5HZMA 1GYQA 4FLXA 3I45A 3ABQB 4J7XA 5C8DA 2FE1A 2O1EA 2R7AA 5JLAA 1ICEA 3QXXA 5DRYA 3TSZA 5JWHA 1ZWLA 3CW8X 2IH2A 3ZMVA 1I7PA 4XGKA 1KZ7B 1G3QA 3TSOA 3ZD8A 3ZPXA 1LUVA 5EZSA 1QLHA 5D7BA 3ESRA 2GAAA 3QLEA 4NX2A 1YI8A 4N65A 4QIHA 5K4AA 4A0QA 1T5BA 4ZOLF 4C7XA 3TEJA 2WPDA 2BGLA 2BV3A 2PQ0A 4RW0A 3WDLA 5BRAA 5FL7G 4CM8A 1NNI1 4RKWA 1BGYH 4C1NA 3Q9SA 2W4MA 4YK7A 3KJQA 1QONA 4WY8A 3DAPA 3LNNA 3T99A 5AH0A 3ANTA 3VVLA 1MR3F 2LDXA 4Q9KA 4QQNA 1AXRA 4UTZA 2F3PA 4YQYA 2FZ4A 4HB4A 1N9GB 2BFEA 3DTYA 3RC8A 4XDLA 1ZGJA 3OECA 4Q9HA 2BOCC 1D2AA 2XT0A 4ER0A 1QAHA 3WNDA 4ZTZB 2WAXA 3JSAA 3TLGB 2OZKA 1CUBA 1PZGA 3IAFA 1RVDA 4Y3UA 4K9OA 4RMNA 4PHTA 3LNTA 3HRKA 4BMZA 5GINC 4IHJA 1V11A 2EFJA 7GPBA 1PWXA 1CULC 4Q21A 3VR3A 3Q87B 4PU0A 4EYQA 1K4YA 4OHZA 3W2HA 2AOVA 4TVBA 4HGQA 2D2IA 1OV6A 5GM2A 3PU6A 3DBVO 3BPZA 3IRUA 4KR9A 1Z2EA 3K2EA 4QX6A 1BXZA 3IVRA 3FGPA 3RC3A 1PDWA 2RGYA 3Q4GA 2D1SA 2CWDA 1FTGA 2DBQA 4LZZA 2HA5A 1S72F 5I45A 4FGSA 2GYVA 1QV9A 4L72A 1L9KA 1NP3A 4M1EA 1ODTC 4Y6RA 3QVTA 4A6EA 2NZJA 5JH7A 4KZKA 4L5JA 1EDOA 1IH8A 5CCEA 1DT5A 3ND6A 3FI9A 3O91A 3T52A 1NJ8A 1R6KA 1ABBA 1K1EA 1DTEA 5C46F 4MCHA 3SPJA 4W99A 1QM5A 3EXFA 4G6ZA 3OTIA 1DFIA 1YQNA 3GBPA 1KC3A 4JQYA 3T1VA 4QBGB 4XR9A 4EKDA 3HBMA 2P3QA 2AZ4A 2RDMA 3WGLA 3RQSA 4Y2GA 1R5OA 1E3EA 1W29A 2G4CA 3O82A 1J1IA 2OCIA 2QU7A 5BVHB 4HWSA 5AJVB 1XLTC 1M72A 2WSSG 3FKJA 5EMJA 3EQZA 3V7UA 2QLTA 4RH0A 4O02B 4BZXA 1YFLA 3OR7C 1GA4A 1FAFA 4RS4A 3WMFA 1AUVA 4L5YA 4K6KA 4OBXA 1Y3DE 5T7BA 2JJ2A 4FZ5A 5HUJA 1K7XB 4IOLA 4ZJZA 1EFAA 2ZT7A 1B3QA 1NSFA 1B2RA 2EHJA 2A58A 2Q5IA 4TTAA 1W0KD 4MI1A 4S3MA 3G2HA 1TDJA 2R0QC 4JU9A 3R3HA 4TL8A 3GUHA 2NNUA 1QOQB 4A23A 1G19A 3H9QA 5KJFA 4JNKA 2JNBA 2IS6A 1DAKA 4NE9A 3D43A 1Z56C 1T9ZA 2HO4A 3LP5A 1A96A 3MELA 1LLDA 2CTRA 3RT7A 2VOEA 2BSKA 5AESA 4Z51A 4ZICA 2GN6A 1VQ6V 1I4TD 1EQ2A 3OFND 4NZZA 5F12A 2C99A 3I0MA 2Q8VA 1B26A 1ZKMA 1WDTA 3UG6A 1NQ5A 1EX6A 3CLRC 4ND8B 3DSRA 3C8LA 3L4KA 2V3WA 4DLLA 5FWYA 1IZ0A 3QVKA 1WSDA 4JAVC 4AQYO 4FW9A 1D0VA 4OL9A 3QU2A 4L51A 2B1GA 4XEHA 2NPFA 1D5NA 5HCIA 4K3UA 2H52A 5A05A 1PN3A 2VH5R 3DCJA 4A8HA 3N7TA 4QASA 2HWKA 2PNFA 4ZQGA 1ODCA 4GKBA 4WD3A 3MD0A 4H6VA 5BSVA 4P93A 3G67A 1J23A 5D6OA 5MDHA 2V9CA 3QU5A 1UP4A 4MV9A 2WTXA 2FB9A 3AK4A 1SUCA 2C00A 2QDKA 3W8EA 4IIJF 2BSXA 2Z5VA 2OAQ1 4XFJA 1I4OA 3L05A 3MQ4A 5FULA 3R7NA 4RKRA 3L7CA 4CKBA 3Q15C 8AT1A 2M9MA 3CE2A 4AULA 5K2OA 5I7UA 4B73A 1HT3A 2OGWA 2H1RA 4CGYA 4OMDA 3HVKA 4TXNA 6GPBA 1VQ8V 1H4SA 4OHUA 1W59A 3ZP4A 4DMCA 3ETDA 4IFTA 2D1TA 3RLFA 2H3HA 1BHAA 2XQFA 1LEHA 5FPTA 1AF7A 3WWDA 1FB5A 1ONPA 1KYQA 2XUGA 1GAXA 4AY6A 1EP2B 3Q8HA 1QFYA 2EFGA 1F5SA 3BJZA 1W75A 1LI7A 2IBTA 1CFZA 2JIDA 2NN3C 3I53A 3EUEA 3RT1A 2O1XA 2JGRA 2CH7A 4IMPA 2J6HA 3VNBA 4MYTA 4G86A 1Z6ZA 2KLBA 4CIXA 4OX9B 1MG1A 2DYSB 2CJFA 2BWJA 3FDZA 4FI3F 3P19A 2CK3G 1S5JA 2W83A 4PEVA 4ZAXA 1VARA 4TQDA 4CMAA 4MYHA 4DRYA 5SY4A 1SETA 2RC5A 1FXKB 2OBXA 4K3AA 3FD9A 1V4BA 1ZI8A 2PMCA 1I1QB 1BE6A 1IZ3A 3JQCA 1PQPA 1Q2XA 5LQDA 4UKDA 1IZYA 1QV6A 4IJ6A 4MQ5A 1VJCA 5K1ZA 1YZBA 1PCXA 3AJ9A 3FMFA 4PTYA 1OT5A 2GRJA 2EFHB 1T6ZA 2UXBB 3CWCA 2J9FA 5K45A 1WB6A 3P4XA 1GKYA 4DWJA 1BEUB 1RABA 1ZZEA 4PXSA 2J4CA 2ODEA 4AILC 1KMCA 4HDSA 4HLCA 2I78A 4KC0A 5B3SB 2MYUA 1GGJA 3QPAA 5JMPA 2A5JA 3ZN2A 2C7GA 1G21B 4EYOA 2J87A 5T8KC 3NDBB 1OLOA 3IEQA 2IQ5A 1FDVA 2WI8A 1X1TA 4FHCA 1HBJA 1W87A 2NTNA 2NU9B 2CLSA 3VR2A 3GAFA 1UK7A 5JPCA 5JSFA 1Q19A 2QVLA 4CTMA 3PCRB 4BR6A 3TEMA 2OEPA 1QK4A 5C8ZA 3I28A 2NSDA 2UXCO 5C8YA 1CT9A 5DGXA 1DJMA 2AR7A 3SYAA 2H2HA 3GEIA 2ZVDA 4RK0A 3SR3A 4HNHA 3OETA 1BHJA 4TKUA 4KBFA 4I1SA 5AVTA 1P4HA 1K5HA 3VH2A 4J1TA 1Z29A 2HGZA 3GP8A 2FG7C 1FUUA 3PIRA 4ZYWA 3KB2A 2XUDA 1E3DA 2IEBA 4CV1A 2WJYA 4LF7B 4H08A 3UJNA 1T1JA 4NFYA 5CDGA 2BCCH 3BEOA 4ESEA 4GP7A 2LO1A 4HGOA 4MVUA 1NN1A 1VMDA 1UFKA 3M33A 2V74B 2YIAA 1TZBA 1H0RA 4A1FA 1I51A 1PEKE 2W98A 3SZLA 3FMGA 3ZHRA 4HDCA 1OPXA 3WDMA 1GPLA 2FF5A 3EF3A 4A8PA 3BGWA 3AEYA 2HHHB 1AMUA 2ZJBA 4KW7A 4TLMB 2I65A 1KAMA 2YH2A 3JQQA 1CUDA 5JVDA 4UUPA 1NXOA 1RT9A 2JGJA 1SH7A 1ITZA 1U0OC 2XMZA 5DI9A 3O21A 3GLFB 1Q1GA 1VHQA 2Q8NA 4XTRA 2GZ2A 3IUBA 4UC0A 3DBRA 1LPMA 3OMLA 3FRIA 3VHLB 2ONJA 1R3JC 3SMQA 3GH1A 4LWSA 2QQEA 1S3GA 4Q34A 2VFAA 3PTAA 5TMPA 4JA2A 4TXJA 2J7PA 1VIAA 2GLUA 4NXNB 2R6DA 5KSPA 1NR1A 3B36A 1IPHA 2PZKA 5C7LO 1EKXA 2PMKA 1W44A 2L2QA 4FGJA 1Y82A 1JFRA 3IUPA 5IJXA 1TEVA 1LTHR 1NN3A 4HN2A 4IEIA 1RMTA 5TX7A 1BOOA 4EFBA 5EJ5A 3HCCA 3N0WA 2FN7A 4ZYXA 2A86A 2RK4A 4LK2A 1U1DA 2EEPA 2XB6A 4R8MA 2PKYX 2FSUA 1VE9A 4JYPA 3C6BA 5MHTA 4YWJA 4TL7A 2R44A 2C4VA 4C30A 5B6PA 3ZRWA 1JJVA 5CLIA 4J4TA 4GQAA 2XTZA 3PGMA 4DFDA 3G2KA 4E2FA 2PGNA 2AE1A 1M6HA 1XZKA 2BGTA 2QPLA 1I5YA 1TZJA 1MEJA 4GPBA 2RK3A 2CB9A 5EP3A 3WOHA 3MT0A 4BKOA 3KZMA 2PUTA 2RHMA 2V7QG 3TOCA 5HUQA 3U0ZA 4BTEA 2AI2A 4NDZA 1GLGA 2AGVA 3M1XA 1P9OA 4JUIA 4QXMA 2PTGA 3ZMTA 2VT6A 4PPQA 1GG2A 4KO3S 2JLQA 2CGNA 2V97A 1QU7A 1K0UA 1IFXA 1T9DA 4RMIA 2DYRB 1E1MA 4PGAA 5FBKA 2Z8YM 3A1NA 4E4EA 1E66A 3CRCA 5C1IA 3KLBA 1SZPA 2P4EA 2BFPA 4QVKA 3LRTA 2C07A 3A7EA 1E32A 2E6UX 5FQOA 3EEYA 2JZOA 4D25A 1RQLA 5D5PA 2AWOA 3K9AA 3TEFA 2P5YA 1BD3A 3SR4A 3OEHG 1UIRA 4BIMA 5ERXA 1Y80A 2VYFA 1VQPV 5FA8A 2QLJA 3CT6A 1IRIA 3D3QA 2QLNA 3Q40A 3BICA 4QPZA 1LI5A 1FRQA 3LPCA 2QP9X 2I8CA 3OURA 1P2VA 1JNXX 1B6QA 1DCFA 5IU6A 4LN1A 3IMPA 1N2CE 1YC2A 1F8FA 1O57A 3UM7A 1N3YA 2GBFA 1JVSA 1NQOA 1SQ5A 3LYHA 2Q7GA 1N2HA 2BIFA 3EIHA 1CR0A 3UT0A 1VMGA 3LOPA 3S3XA 4XGQA 6LDHA 5CFLA 1FDOA 2MSNA 4FSDA 3CYQA 2CDYA 3A1WA 2FWNA 4RHYA 5B7PA 1NAIA 3B6MA 4H15A 1JIXA 2ZR9A 4OGQB 3LECA 5IVHA 3TZKA 5T4HA 4X1YB 1YKGA 2JKZA 3W77A 3UA4A 3ID6C 3ZIUA 2W37A 4WGGA 4JT9A 2AFHB 3UPUA 3KHNA 5GZ6A 5LZ9A 1TK2A 2IH5A 4GZ6A 1T2NA 3GJTA 5A9RA 4KOAA 4KQWA 3B60A 3A9UA 1C7FA 3JD3A 2PUWA 3L7LA 5A9GA 2NMVA 4M0DA 2BJWA 1II0A 2RCNA 4Y18A 4P3OA 1NXXA 3HWWA 4Y30A 5CN0A 4BYGA 3C8MA 3SQLA 4LOIA 3P94A 1SA0B 3P9IA 5L40A 3RTCA 1TD1A 2ACWA 1DHRA 4MKFA 4RVCA 3SFZA 4F4DA 4IDFA 3E1SA 1Y5LA 1AK1A 4DC0A 4PI2A 3HUDA 2XWSA 5C4IA 1UC5B 4XUDA 2B69A 1O5IA 1RAAA 3GEDA 3ZCXA 4RH3A 5JANA 4LJRA 2VSNA 1YKFA 1NHGA 4QUKA 4C2BA 5TT1A 1ZGHA 2XUOA 2VGNA 1HNWB 2YYAA 3FNRA 4EG5A 5DHTA 1N25A 1SVUA 1XAHA 4RQOA 3G6EF 3STUA 3ENKA 4Q4HA 3BMCA 2PZSA 2FZEA 2MSDB 1YB5A 2W2QA 2PL5A 1JYSA 3EG9A 1KEWA 2PX2A 4OK6A 2HA7A 1AROP 1FNNA 5DXFA 2IDMA 3BGDA 2P67A 4WXYB 1D9XA 1JAHA 2AEJA 4P38A 3UTCA 1LLCA 3ABRB 3WKBA 3L1UA 2PR2A 5B3KA 3PYLA 1COMA 3GLIE 3I3SR 3B09A 4MKRA 2YWGA 1BL8A 2AOTA 3LA8A 2EP5A 3TSAA 1E6CA 2C0PA 2YN4A 5KAMA 4E33A 3WK7A 4RPJA 1RJEA 3LGSA 1PZFA 1VQ8F 2UKDA 2W6OA 2YXYA 1GN9A 3K0AB 1E9AA 1QU3A 5AI8A 2P9HA 4RLHA 3N2YA 1GAWA 3UKMA 1I0LA 3EIXA 5A3QA 3EGDA 4Y6PA 4WOKA 2B6NA 4BNGA 1YUBA 2PUDA 2NZ8A 4QWWA 3LTNC 3AEKA 1EXDA 2F9FA 3ZS9A 5EVCA 4ZCSA 3MTQA 4ZA2A 5LQJA 5EB0A 2O2IA 5J5CA 1YJXA 4ZU3A 1POWA 2AT1A 2QTWB 4F6RB 3NV7A 1KU6A 4IHAA 4EARA 5JFGA 2P4UA 3BHIA 2DY1A 1UBLS 1N34B 2O3UA 5TQ2A 2QTBA 4X89A 4MR8A 1QAMA 2ODAA 3DMTC 2I7DA 5G53C 1SCIA 3ZWYA 4C4ZA 3OZEA 3K15A 1TKRA 5ITZA 1VGVA 4EGAA 3IB6A 1WP8A 3F5SA 2VNAA 3A9RA 1A8QA 1J33A 2H7YA 2V7QA 3M2TA 2WYWA 1SY7A 4JI0O 1C3XA 1XPRA 5ALJA 4YUZA 2WHPA 3EGEA 1GN4A 1O8CA 1N36O 2P2GA 2LXNA 1XQ9A 1KNXA 4EAAA 3HCPA 1CU1A 4HXGA 2DT4A 4L6CA 4O1IA 5CTAA 3IQIX 1D2GA 2H0AA 2PJZA 2O4UX 4KB5A 2E3CA 2VXCA 3A4MA 4U9UA 1EZ4A 1U5BB 3K5NA 1JG4A 3NATA 5AT1A 4LJ4A 4DV7B 4B3SO 3PD0A 3LT4A 2AXNA 1SIWA 3LQQA 3II6X 1OD6A 4FFKA 1OLXB 1ECJA 3BFVA 4U7NA 5JS1A 3P2JA 4DR3B 1JDZA 2ZRKA 4NZNA 3WV5A 3U62A 5IANA 2ODBA 1NVFA 5A2QN 2CNDA 3G2JA 1Z0JA 3OEHA 3P2EA 3FH0A 4HUQB 2QTNA 1ODJA 4GC9A 4JQOA 1KPIA 2A8YA 4C7VA 1WZUA 1M34A 3ETCA 2E3JA 1AI5A 1HEIA 4RMHA 1FTYA 1MEEA 3ZU3A 4H16A 4WI1A 1NKTA 3DMDA 3QXCA 4Q48A 1YZYA 1M10A 1OCRB 4K8ZA 1CY1A 2DHCA 5KNCH 4E5KA 2B2XA 4BN4A 1FJXA 4HSGA 3ZTTA 3AI3A 5FLYA 4L28A 4NONA 4UPDA 4E4TA 4FEEA 1TCAA 2O8DA 4GS5A 3L7KA 3AT1A 1T4CB 1XVAA 1DWPA 1L4LA 1X9IA 4UVAA 3RWMB 3RKUA 1R0KA 5CW1A 4IIUA 4CJXA 1R12A 3SX2A 4D4MA 3KQPA 1VG9B 3PUJA 3D3KA 5CYOA 4UMDA 1OQAA 4B33A 4GQIA 4G1UC 4N0PA 4DAOA 1QFJA 2AR0A 4QOSA 1E1CB 5AW4A 1CQIB 2GFIA 2OR3A 2RHCA 3UWOA 3ZBPA 2R96A 5JZ9A 1JEYA 4DLWA 3NH6A 2ZRPA 5DZSA 3DJFA 4AY2A 2QN3A 4M9UA 2FRXA 3ILXA 2PCLA 2RONA 2WLSA 4BGVA 1SXJD 2JKYA 4G0OA 4R4JA 2G71A 2QZPA 4YHHB 2DE0X 1TVMA 3NM5A 1BJRE 2BP7A 3NORA 2C9YA 1E2JA 3TIFA 4JEMA 4NR0A 1JVMA 4UREA 2QR4A 2R9RB 4QXOA 2CXSA 3ABSB 3OM3B 4LP8A 4BYMA 3PF8A 4TS1A 1UPCA 1SZQA 5FTKA 3JQ6A 1MC4A 2O50A 1RTTA 2QKYA 4QQ8A 3WLRA 1CB0A 5L7YA 3MG9A 1MXFA 2OORC 5HY4A 1JXQA 1T5OA 5HXAA 1OH5A 4H27A 1E6KA 2EIKC 3KQTA 5BOSB 1K27A 1YDFA 4GPZA 3T3OA 1UKBA 3IA2A 2W7TA 3K3WA 5HXUA 4UHCA 4LFCB 1Z4MA 1XE3A 2RMKA 3I30X 3W5IA 2B1IA 3CKYA 1KSGA 2G1JA 1TPYA 3BDVA 3GH3A 3C5VA 1KGDA 1E18A 4YCSA 2V9PA 4UMEA 4Q12A 5DBIA 4GQBA 5EWRA 2CVQA 3VYRB 5LL6Y 1P75A 3ZEAA 3WL6A 5JLJA 4ROTA 4XWWA 3THWA 3CWBH 4X44A 5MN6A 2O8VA 1Y8AA 3SQOA 4RTLA 1QAQA 1PTJC 1YMVA 2II6A 1F06A 4BNFA 5H3LA 1UPTA 3CVXA 4F71A 1NYLA 1W49A 3E7FA 4M9ZA 1H5NA 3D2CA 2YKGA 2DM6A 2A9QA 1QQ7A 1US8A 4CUZA 2WD8A 1JS1X 4BKUA 1J0EA 2ZZNA 2JEXA 4O4LA 1K08A 4E1BA 5FPRA 2GTPA 4O4IB 1X8JA 4LF8B 1C80A 5LQSA 1WDWB 2A9OA 4NENB 2HV9A 3HDYA 3MHTA 2PZMA 1ESEA 2D8AA 1NNSA 3B6KA 2J4FA 4ZRMA 5TXGA 2F55A 4YJHB 3L7AA 4DEYA 4Q0MA 5HFNA 1BH6A 1KWKA 1SGWA 1VQPF 4RELA 1NZDA 3HJBA 1F2TA 4NOLA 4R83A 3VA7A 2A92A 2I80A 4ENRA 1ZRHA 5FPPA 1C1HA 3IJEB 1C1YA 3HDTA 3F5WC 4JF3A 1IN8A 4JR0A 4F4HA 4C2TA 1PG2A 4AWAA 3UJ6A 1RQXA 1US6A 3GTZA 5FR2A 1JXAA 1PW7A 4MT8A 3CZAA 1J9GA 5KKNB 4KACA 4M9QA 4R9UC 4R2HA 1LV8A 3PXUA 4M86A 4B6PA 3KIZA 3KFXA 1EM8B 4MSWC 4Y6OA 4JU8A 2C1ZA 4OB7A 1D1SA 4J8PA 4DADA 2OBBA 3IC9A 3KTDA 2RJNA 4BGIA 1EUQA 3TIIA 4ENUA 1G17A 3B2EE 1AGRA 4EFEA 3UQYS 4LRSB 2D1FA 3Q8XB 4Z4CA 3A6DA 2BFNA 2GYYA 3K8ZA 1Q0HA 4CKWB 5IE9A 2NUTB 3L7BA 3RJZA 5A4KA 2WU0A 1ZUD1 1QC5A 4B46A 1KOFA 2F48A 3O65A 3OE5A 4MTCA 4OUDB 3S7TA 4JV5O 5HA5A 3JRWA 1E6WA 1ST3A 2GASA 2QZZA 1D09A 1YJCA 4OSPA 1PT8A 4MLDA 2AZXA 1G38A 5EJ8A 5BW6B 3E1YA 3Q7QA 1ZM3A 3OIUA 3U7JA 1AKEA 4E31A 1V5FA 2A88A 5KTNA 1QCCA 4AZVA 1W94A 1DLJA 2H7VA 2O8BB 1NBMG 1IMJA 2WU8A 4P3YA 4PLVA 2NZVG 2ZB4A 2HRRA 3D81A 4QGFA 1TF2A 1EGQA 2J3EA 2CNWA 2OZLA 2RGEA 1ZU5A 4BKMA 4IDHA 3OZ7A 3B1YA 3RRJA 1E9SA 2I7TA 3WBBA 1YR1A 1Y3HA 2JFHA 2CZWA 3KTOA 1ROPA 4WK4B 1RQPA 3Q1KA 2ZSIA 3LLUA 4C1BA 4B3RB 2PRKA 4IF4A 4IH1A 4KBGA 2ECFA 4J3NA 3EXHC 5GJCA 5LQRA 1L5GB 1V54C 3BIFA 2X5XA 4BHTA 3GVXA 2XUZA 2BDEA 3T1QA 4LY6A 2WK1A 1UXKA 1QX4A 1MAHA 4M36A 4FFWA 2HJHA 5A3RA 1C8BA 1V8PA 1U8UA 3M9LA 5SYAA 5D01A 4CFYA 3BWBA 1TEXA 3A05A 4AN1A 4A4DA 5GADl 4QDKA 2EIMC 2PFGA 2WR8A 3CISA 1FRNA 5HCUA 2QX8A 3VR0A 4B3TB 4D43A 5D3MB 4S1WA 2DJIA 3SHQA 3PUWA 3IEUA 1E3SA 1SKMA 3RK4A 2F00A 3IHTA 3ETHA 3SYTA 5FEUA 4UVDA 1RI2A 1TJNA 3P9QA 3O9MA 5JHGB 1O89A 2H18A 3MNFA 2HEGA 3I9OA 4YBZA 5JXJA 1GCAA 4W4KA 3L8FA 2CCGA 4UFOA 2OTMA 3BWVA 1HY3A 4OFBA 3GI1A 2IJIA 4A0SA 3T80A 3G7SA 5A1JA 2C8LA 3HLKA 2DQSA 3P1JA 3M4ZA 1SQXH 3WRXA 1TEHA 2IKSA 2QAGC 1OX4A 5A7GA 4IIHA 5ESRA 3CHYA 3BAZA 4FPPA 5K7SA 5DN6D 3OWOA 5JNTA 3WWCA 3GGJA 4BRZA 2UVPA 2BI4A 4OQ4A 4X1IA 1U11A 5EWJA 3CP1A 4C78A 2G04A 3JTMA 1YS4A 3EHEA 3ZVNA 4EGJA 2IE8A 4FNOA 1PFGA 2IEYA 4WCFA 4NCKA 3CCJV 5B2EA 4DHWA 4FBLA 4EJSB 3U5TA 2ZRCA 4HH4A 4M7OA 4B32A 3SSMA 2VWPA 2HMAA 2NO1A 1P4RA 1SCUB 1KMHA 5JISA 3BTVA 1APBA 3EIFA 1MVNA 3CMAV 5F7JA 2QKAA 4UDOA 1AI6A 2ACVA 3MCAB 4BLOA 2BSAA 1NVKA 1UM9B 4UUMA 4CH6A 1LPSA 3TOVA 4WVFA 1GGHA 1SOUA 1HOXA 3OHPA 3H16A 2W90A 3I3OA 1FDSA 2V9ZA 5CBGA 4M55A 1QMPA 5AVYA 2ZAUA 3R4CA 4M9SA 3QO8A 5JR3A 5C35A 2O8EA 3F0TA 5CG1A 1HLGA 1RM3A 3CR3C 3E20B 4X3CA 4TUYA 1A88A 4LDQA 4ZVRA 1EINA 3IAAA 2JH3A 2Z8ZA 4CKCA 2CGOA 3T1YO 1M6VA 5LYJB 4FYJA 3AKYA 1D4OA 1LSOA 1JJIA 1U81A 4O29A 2JK0A 3B9RA 5HQJA 2Y9MB 1N32O 4N21A 4RV9A 2Y0BA 6REQA 1USIA 3VZSA 4G9GA 2ZQZA 1E5DA 3C6YA 1NZJA 2LR0A 4KPFC 3ACBA 3NDRA 3FMIA 3PBKA 5CNIA 4C0WA 2CFRA 2CMHA 5TF4A 4RF5A 5EOVA 1TC1A 1IY0A 3KQHA 2CUTA 1R4MA 1CYDA 2LCQA 1W36C 1ZIOA 5IT4A 4MV1A 4LBZA 1GQFA 2Y77A 3BSFA 2PH5A 1IVNA 2DYSC 1R3LC 4HGRA 1CEYA 3L41A 3N70A 1NP6A 2UZ1B 2A3NA 1MOFA 2HF7A 4IMRA 3FZEA 3OUFA 1BTOA 2XDYA 2QTZA 3EA5A 2AXQA 1UKVY 5AFSA 1Q1QA 4MSUA 5F7XA 2I54A 2BFBB 5A1TA 1CUJA 4TV9F 3C6KA 1T2CA 3ICEA 1VJRA 4IZIA 2P9GA 2Z9CA 1WA8B 3CZCA 3ZW9A 5LDDC 1JNYA 2YZ7A 4YQFA 3KYCB 2YXDA 5A9TA 4TQUS 4JVSB 3UKJA 3DC6A 2NAPA 1DB3A 4LVOA 2J0UA 4OGWA 4UE2A 1ATZA 5HP7A 1NAHA 1RI5A 1M83A 1M0TA 5DEOA 3TMAA 4QJ3A 2WNSA 3PCTA 1NBMA 1A8IA 3CUVA 3ZU2A 3IPXA 4CV0A 1WQ1R 2HU5A 2ZBGA