3E22B

Tubulin-colchicine-soblidotin: stathmin-like domain complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1C chain
publication title Structural insight into the inhibition of tubulin by vinca domain peptide ligands
pubmed doi rcsb
source organism Rattus norvegicus
total genus 110
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3e22B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3e22B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3e22B01
3JAKA 4ZI7B 4FFBA 4HNAB 4EI7A 4U39A 1JFFB 5LA6A 5BMVA 4O4LB 4LNUB 3HKCB 5EIBD 2VAPA 5LXTB 3VOAA 1W5BA 4TV9A 5IJ9A 1TVKB 4EB6B 3N2GB 4TUYA 4TV8B 4I55B 3C8LA 3VO8A 5IYZB 3JALB 5KX5B 1TUBB 2RHJA 3WGKA 4WBNB 3N2KB 1FFXB 4O4IA 2RHOA 3UT5B 4IIJB 5CA0B 5J2TB 5GONB 3JAWA 3RYIA 3WGNA 1SA0B 5LOVB 4O4HA 4I50B 3RYHB 1W59A 3HKBB 3WGMA 3RYFA 4EI8A 5JCOA 5IJ0B 4YJ3B 4ZHQA 2GVIA 4X20B 4F6RA 1W581 1W5EA 5J2UB 5EZYB 5FNVA 2VAWA 2BTQA 3CB2A 3RYCB 3JARB 4KWEA 4I4TB 4EI9A 5CA1A 5EYPA 5JH7A 5LYJB 4YJ2A 3JAKB 3HKDA 5CB4B 5LP6A 1RQ2A 1W5FA 3JASB 5EIBC 4ZI7A 3HKEB 4HNAA 3V3TA 1RLUA 3ZBPA 4O4LA 4LNUA 3HKCA 4X1KB 4O2AB 3R4VA 4O2BB 1TVKA 4EB6A 5KMGB 4TV8A 4DRXB 4I55A 2Q1YA 3WGLA 1Z5VA 5JVDB 5IYZA 3JALA 5KX5A 5JQGA 1Z5WA 4WBNA 3N2KA 5ITZA 4O4JA 4U3JB 4IHJB 5C8YB 4X1YB 3UT5A 5CA0A 4ZOLA 5J2TA 4XCQA 5GONA 4DXDA 5LOVA 3JATB 4X1IA 3RYHA 3E22B 4ZHQB 5JQGB 3HKBA 5IJ0A 5LP6C 4FFBB 4B45A 4X20A 5LA6B 5BMVB 2R751 2VAMA 5J2UA 1JFFA 4E6EA 5MN4A 4TV9B 5EYPB 5IJ9B 3RYCA 3JARA 4TUYB 4I4TA 5LXTA 3M8KA 5LP6B 5LYJA 3N2GA 3M89A 5JCOC 5CB4A 4O4IB 4M8IA 3VO9A 1TUBA 3JASA 3WGJA 3HKEA 5MN5A 1FFXA 3JAWB 3RYIB 4O4HB 1RQ7A 4IIJA 4X1KA 3VPAA 1W5AA 4O2AA 3RYFB 1SA0A 2Q1XA 2R6R1 3ZIDA 3RB8A 4O2BA 4I50A 4B46A 5KMGA 4DRXA 4F6RB 2RHLA 3ZBQA 5ITZB 4O4JB 5JVDA 2RHHA 4YJ3A 1OFUA 5FNVB 1FSZA 4ZOLB 2BTQB 4U3JA 4IHJA 5C8YA 4X1YA 5M7EA 5EZYA 4X1IB 5CA1B 5JH7B 2XKAA 4YJ2B 3HKDB 3JATA 2VXYA 2XKBA 3E22A 3VOBA 5MN6A 2BTOA
chains in the Genus database with same CATH superfamily
2RCNA 5B3JC 4DY6A 5CHEA 4X00A 2CJWA 1P6XA 3ZDDA 1K68A 5LDHA 4A1OA 3ISTA 3CTMA 1NKVA 4UTRA 4RZSA 1XMVA 4KQWA 1NJIH 5CFLA 3BIWA 4C4TA 3JYQA 2Y1WA 5FQOA 1K6EA 2H0AA 4M9UA 2DHRA 4WY5A 5BOVA 3OLQA 3HDGA 1MMMA 2VK8A 4S35A 3IP1A 5K6AA 1ABEA 3LHDA 5E9JA 1VPVA 3UAYA 4MVWA 1Z35A 3AI1A 3E48A 5F12A 1SQSA 2X2EA 1DFIA 1L0BA 3F6CA 3WTBA 3NVKI 4GX2A 4FKBA 1EJ2A 4CMGA 3MPOA 4DOMA 1TKCA 5IS2A 1SXHA 2AWOA 4J29A 1XBTA 5DBGA 3TI9A 3B4SA 3QNMA 1FP4B 1U8ZA 2OBYA 3V8NA 5JY6A 1Q0HA 4W1SA 8ABPA 1H2NA 5FNZA 3I04A 4BYMA 2P2ZA 5G40A 4HYYA 2X0KA 1T0AA 1ULAA 1V1RA 3N74A 2QEXF 2PFKA 3QLVA 4BW9A 4ZOBA 3SYNA 4WMLA 3WGNA 2VC2B 4QU0A 2C95A 1G8AA 3O03A 2JIQA 4X8OA 5AM4A 1JSLA 4N9QA 5DKFA 4GPTA 1IBLB 4D45A 4LRSB 5DHFA 2BH2A 4YRSA 2CMDA 1NVPB 3H2ZA 4DWWA 1FW8A 4R83A 1TKBA 3RHTA 2Z3VA 4UAJA 1B0UA 3GR6A 1UBLS 3RK1A 6GPBA 1IPEA 1C8LA 5AVWA 1KMNA 1U3VA 1V0JA 4EYSA 2Y3IA 3AR6A 5AOVA 4CIYA 2X6QA 1EVQA 3D3IA 4JDUA 4C6SA 4IHJF 4MKGA 3AF5A 3R7LA 3FFBA 1KKUA 4TTPA 4EBFA 5DWDA 2O48X 2J30A 4M89A 3I56V 1A2KC 2C04A 3BRCA 2GDSA 3GYBA 5BR8O 3GVIA 2C99A 3F74A 5F52A 3NHMA 4MPDA 5EJ7A 4FEAA 1E79G 1A4RA 4BAUA 1VKRA 1QZ3A 2ZSBA 1N32O 1DEXA 2H57A 4JODA 1QG6A 1R8QA 3TQHA 3C24A 2ORYA 3T1YB 5GAJA 3QVMA 5FI0B 1J7HA 3IBTA 4PTLA 3BJMA 3PR1A 3RFXA 2HQOA 4XD7D 1RD4A 1LR1A 3FWZA 4AXXA 4E13A 1VLMA 1E0AA 4JT9A 2KG4A 2Q8PA 4W8GA 3JATB 1WE2A 5AKGA 3ZD6A 1LI5A 4YUAA 3L7DA 1OX5A 2ZI9A 1SCJA 4JHXA 1J90A 4DK1A 1FQJA 3MIZA 2LGJA 1Y4ZA 5TC4A 4HR7A 1PJ3A 4OQYA 2O2JA 1M2OB 2BF7A 1CETA 1Z88A 5KTTA 4W5JA 4LVNA 4R2MA 1SMKA 4OYRA 3GMIA 1JN0A 3K9QO 2XUIA 3ZU2A 3TZ6A 4I9FA 1GTSA 4L28A 3SOPA 3N53A 4DR7O 3CCRV 3PFKA 1RZUA 3PUKA 1I7PA 4D9EA 3VNVA 4LDAA 2O3TA 2D5IA 3FB8C 4E1BA 2G77B 1OBOA 2EZTA 3BWDD 2AI3A 2C9MA 2DR0A 2H7VA 2ASEA 2YS7A 3TQRA 4ECEA 2EGGA 1E4VA 2IH1C 1IB6A 4DA6A 5FWYA 4IYIA 1JB1A 1RI3A 4QOIA 2NTNA 3E7FA 5FWXB 1VCHA 4BL5A 1UDBA 4M9SA 1GCAA 3KT0A 2ZKOA 1THTA 3A7EA 4F3CA 2Z5VA 2BMJA 1SXQA 4B5LA 4B44A 3EDOA 5CM2Z 4RADA 4CTNA 4WXEA 2WFZA 1VJ1A 1TPZA 4GLLA 4CS3A 2J45A 1E4OA 1KVUA 1LC0A 2AMYA 3ESYA 4G0NA 1IEXA 2XQIA 1MH1A 2IVFA 4IKEA 1GSIA 3KLNA 1CZUA 3UGJA 4UNSA 1J8MF 1AQIA 1F4VA 4JU9A 4HH1A 4YMLA 1QIFA 1C9KA 2GF9A 2QNIA 3ITKA 1C3OB 1JXMA 4TWIA 1VYHA 1ESZA 2JGEA 7YASA 4XI9A 4J7KA 3TW8A 2AFIE 4HZ3A 5I3ZA 4P2ZA 2NGRA 4J11A 1WLSA 1MQAA 2XXJA 3NAGA 1R8YA 2PSJA 4MQEB 2V7WA 4JAVC 4K6MA 4JVNA 2WIAA 2QTGA 2Z2XA 3BCSA 3MTGA 2VWPA 5LWQA 3PBKA 4FYIA 1XQVA 3TM5A 4IO0A 4AWXA 2ZIZA 4FWBA 4YS6A 5KNDA 4ZYTA 5H3LA 1JKIA 2GZMA 2XMZA 4R3NA 4BFYA 3VBCA 5AVXA 4JOSA 3C3JA 1K8YB 3PUWA 2EG9A 1XIVA 1T4CB 3WRVA 5JT1A 3F3YA 3VO2A 1WXGA 2C2MA 3TPCA 3IUEA 4DLSA 4M86A 1LZKA 2NUAB 1LLQA 3C43A 4OLFA 1KI1A 5TPWA 3H99A 4MVRA 2J08A 1PG5A 4KQGA 1OD6A 2BEWB 1ZCJA 4FUQA 2G4LA 2OGTA 4ENUA 4XWOA 2YDEA 4KZPA 4URWR 4S1NA 2J3HA 4M7RA 5AXDA 3CRZA 3T1CA 4R0NA 2XVMA 2WSMA 3DCJA 3RTCA 1F8GA 3HSSA 1H8ED 3N4ZA 4G28B 1YA6A 3TNJA 3G0GA 4MQBA 4JUCA 3IESA 3HB7A 3KDSE 1N4DA 4EB0A 3H0KA 4DV7B 1V4VA 5CGQB 1IQ0A 4A0SA 5EESA 2QM8A 4O2AA 1IAQA 1GU7A 4MZDA 4GQIA 5BQXA 5BWLA 5KYTA 2O6HA 2XF8A 3B2EE 4A8JB 3HK2A 1O6GA 4N7BA 1NS1A 1QU3A 4BKUA 2YJ5A 3LCVB 3I6YA 3RUEA 3SQWA 2AN4A 1BYIA 4ZI3A 1I3KA 1ZJ6A 4RWZA 4CUZA 4DQXA 1XFDA 5AI6A 2OHOA 2R1VA 3IPYA 4YRAA 1ZK1A 3OM1A 4OLJA 1BDBA 1QE5A 2OYRA 1H65A 1PR4A 1KSHA 2PANA 5LPNA 4EL0A 5JDCA 2ONZA 2QMEA 3IV6A 4OF4A 5KWSA 5EIHA 1F51A 1OBHA 4MWDA 3TECE 3D4OA 4PA4A 1MXFA 1V5EA 1MEJA 1G5PA 4QM7A 4BT7A 4L5YA 1Y7TA 2H07A 1KDYA 3KG2A 2A33A 1WQ4A 2FK7A 3QLTA 1T5LA 1O6ZA 4M22A 1VGRA 2DT8A 2HS4A 1FDTA 3HMQA 2CMGA 1TZKA 2XOKA 1LBIA 3O9OA 1DRUA 3FPCA 2Z83A 1JKJB 3WL4A 3H7IA 1VQPF 4GI5A 3AEQA 3M4YA 3N6XA 1EUZA 5JROA 2A5GA 1MG5A 1ICEA 3ZHZA 1WULS 1SA0B 3KYCB 1VIAA 3T2MA 1T3HA 3L6EA 3RK0A 4RDHA 3K5HA 1VGQA 3RFCA 2EWCA 4IHKA 4HAXA 3KL4A 4EHKA 1NZJA 1M1NA 3LRTA 4EHIA 1UFIA 3PT9A 3WVNA 2QIOA 1E9AA 4HDKB 4QPJA 3U17A 1LKZA 4HGYA 5BMVB 4F7DA 4KO8A 2O8FB 3LUFA 2N3ZA 4ZQHA 2A3NA 5MN5A 5BV0A 1BL8A 3Q6IA 1U8EA 4CF5A 1PAUA 1XG5A 1UBJS 2QP3A 1TW3A 1Y6GA 4CQMA 2VPXA 2JHAA 3ZZ0A 1R66A 1K92A 1FFYA 2DERA 3TQTA 4F9EA 2R6JA 3I0ZA 4US2R 5CBPA 1L8LA 4KK4A 2AN9A 3FF1A 1NU8A 3ZR4B 4GPIB 3PUZA 4GUDA 1RHRA 2WINI 3KQUA 2QR3A 1IEVA 4UFZA 2O8VA 3CMEV 1T8WA 3ZWNA 1XJCA 2QRJA 4NZYA 5B1YA 3BEDA 4H31A 5KTMA 1OLSB 2FA9A 1RSZA 3FBGA 2IPNA 4V39A 4P6VF 3K9HA 4BAYA 1QHFA 3EVFA 1PR1A 1MU0A 4KQKA 2V6JA 4ALMA 2F4VO 2R8OA 3DTTA 1PSWA 1ORRA 2FPIA 2PTHA 1R00A 2YY6A 1AM4D 5DGTA 4Y9TA 5LBQA 1CF2O 5HZHA 2A9OA 3VR0A 4R2HA 1P2UA 3CMMA 3WRYC 1U28A 4ZVUA 3QE4A 2RCYA 4NZOA 5HKOA 1UJCA 1OQAA 4D9IA 1J49A 4WFEA 4JLWA 2OV2A 2UXNA 1WAZA 5FBVB 3ZTTA 4KL8S 4S04A 2CSLA 5LHIA 4PSVA 4CZ2A 3WXBA 1KYIA 3CNQS 4NF2A 3O9ZA 4RIEA 2CXXA 4RF3A 6REQB 1LS1A 5SY9A 4LF8O 2HU2A 2I78A 3OCCA 4YUYA 3MCAB 2PKXA 4U8HA 1MJNA 1IWBB 4DMFA 2O1EA 3B8HA 1ZOLA 3ZGLA 5I8ZA 1UOOA 1F7YA 1K63A 2YVKA 2Y76A 4TL7A 4F93B 2XUAA 4Z7OB 1MG1A 4DV1O 4WVLA 4FZJA 4G09A 2P2CA 1QBZA 1PO7A 1YD7A 1VPDA 2C4MA 3BM5A 3ZWWA 3VQVA 3DXZA 5F2NA 2F90A 4F6LA 1CUGA 3AETB 5FL7G 1XU9A 3HE3A 3C7TA 2X42A 2RN9A 4XOUA 3CWZA 1A7KA 1RAAA 4MPJA 4ZHQF 3BD6A 4BZXA 5CYGA 4FBMA 4AJ4A 2HTEA 4IGKA 4B09A 1GH6A 3CCFA 3CEHA 4KK3A 4MCIA 5T4FA 3ZVNA 4QFBA 3RANA 3FB6C 4JMPA 4F5DA 3RBVA 1R6KA 2ZITA 3GJ7A 4RMJA 2O2ZA 1K8AH 4B75A 4D3DA 2GZRA 4XGQA 3OPYA 4ZD6A 3DDWA 3SU8A 4LHVA 1RLUA 5JE8A 1EX6A 1FVXA 2EJRA 1ODEA 3ZRWB 2HP0B 3K4PA 2GARA 4J0GA 2JW5A 4H4CA 3IBGA 4GKAA 2O20A 4EMSA 1YNSA 3S3WA 4CMIB 4LTMA 2NSHA 3AI2A 4BZZA 4QZVA 2A9FA 1IV1A 2X4IA 4YHHB 3WNVA 3D4LA 1VLZA 5BRJA 2WFLA 3NKLA 4W1PA 1E1RA 3OTOB 1RPOA 3E5RA 1DO8A 4RH1A 2PJRA 4OP1A 2BTQB 5C8YA 1XWFA 3GP3A 5KAIZ 5CG2A 3UOAB 1H48A 3MTQA 3ILYA 4ER0A 4U7DA 4N5DA 3VYUC 5CDHA 1D2NA 1E5LA 1VQ4V 1ZRNA 3LC2O 2BGLA 1TQDA 5K3SA 4Z49A 2C77A 1W8DA 2Z2YA 4UOZA 3D8HA 1KC3A 3HLYA 4XM0A 2Q6VA 4TWBA 5EFOA 3F6RA 1CQIA 1XMOB 2A35A 4UD6A 2KE5A 1BD4A 1KJ9A 2C88A 4J0IA 5JWOA 4YIOA 2PRSA 4AK9A 1F5NA 4P0QB 5EQDA 2GHTA 2OILA 3O26A 4L50A 4BO1A 2X4DA 3TQSA 3TIFA 2GTIA 5IWCA 3L0YA 1H2GA 2GFHA 2EVWX 1A4IA 4UPEA 2I6QA 2VCYA 3DVAB 5F9FA 3DTVD 1EDOA 4P9PA 1F5SA 3M6LA 4B3RB 4D6XA 1T2NA 4HB0A 2B9VA 4NWOB 2BFMA 2PL5A 4BWFB 5HBRA 1SUPA 2HBYA 4YJHA 2EAUA 2JIZD 1Y3HA 2BRUC 4G0XA 2FDRA 1GSHA 5CT9A 1TVKB 5AVMA 1SCDA 1TKAA 4O08A 4DMGA 4HDAA 1LQUA 3L8HA 4JI3B 1KY4A 3U7FB 3HYCA 3CUYA 4NOMA 4TSFD 3OKPA 3E9ZA 4XD7A 1XRRA 5IT4A 2KB0A 1SNYA 4IV8A 3L1JA 1COWG 3ZP7A 4C78A 4DV5O 3LIPA 3NGXA 4PSDA 4YN3A 2WB4A 3G3EA 1V35A 1C50A 5KQSA 5HXAA 4TLMB 5CVUA 1W57A 4Q4LA 3DKVA 5L3QA 2RH4A 1GOTA 3VYRB 4FPXA 4R9NA 3AY3A 1Q7TA 2R5WA 3RU7A 1YQGA 1H9AA 4NYIQ 1PR9A 3MTJA 4WCFB 1T9AA 1KDPA 2K87A 2ZR8A 4O4LB 5JCZA 1OV6A 3AJ9A 4KR2A 2ERYA 5K5EA 4ER6A 3KPJA 5C3MA 1K2WA 3EZLA 4HUQA 3UCFA 3D9QX 3R41A 1TTHA 3WZ2A 3GG2A 4RS4A 1F0KA 1KEWA 4Q1AA 5FULA 3FRJA 3GIWA 2PLAA 2H4XA 3F6BX 3NHKA 4HQNA 1F7UA 3SG0A 1V8BA 2FHPA 3AUYA 3D8UA 4KQXA 1TMGE 1E9BA 1YBHA 1NF8A 3CLRD 3G1UA 4PLTA 3B13B 4KAJA 1IXYA 2HDOA 1R27A 5B5SA 4JKIA 3VHXA 1ECCA 1I3LA 1VE3A 5KIAA 4LHXA 4D9JA 1VG0B 1Q7BA 4PHCA 1P4RA 4CS2A 5AM3A 1DEOA 1QVRA 3LP6A 1YJBA 4JWKA 1H4VB 3KPVA 2WMYA 3IBCA 1O94C 1D5WA 4DGSA 4M7OA 2GKOA 1MP0A 3N2IA 1KJQA 2NU6A 3W7TA 4IRUB 2GFIA 2EF1A 3G67A 3I73A 3K94A 2XPCA 4MKHA 3MM4A 1DIBA 1DPFA 2HV8A 2G5TA 4CU5A 3DP7A 4YXWA 5BPFA 4E30A 4UTXA 4JLPA 3TRHA 1Q1ZA 1XEWX 2PS1A 4FLVA 2ZWMA 2UYCA 5C8ZA 3GCGA 4AXBA 1EK0A 2Q5ZA 3HJHA 4LYGA 4B3MO 4BLSA 5KAFZ 1G2IA 1U98A 5HKBA 1YUBA 5J1TB 4V2UA 1NC3A 6CHYA 5A1JA 2D2VA 3GJZA 3P0HA 1GN6A 3G0BA 1WJGA 2Z2JA 2NP6A 1IIRA 4GRAA 1QFSA 4YJFA 2XI4A 2A67A 1D6NA 4ERHA 1GEGA 4HX2A 4PZ9A 3VU9A 4LA4A 4O63O 2JZCA 5E4JA 4EMUA 1PRYA 1UM9A 2WA3A 3BWEA 3OBWA 2ES4A 2XBMA 5JWHA 5JFOA 2L26A 1HETA 1RKQA 2B4YA 3W3AH 5JSUA 3HB1A 4UXJA 5EA2A 1PYGA 4HVTA 5GADl 1Y0BA 1K66A 2EC5A 3S99A 2Q4TA 2QD5A 2DH6A 1WPBA 3M1AA 1W6RA 3OT4A 4KE6A 2Q2NA 1ND6A 5GJCA 4EMTA 4EG3A 4CL2A 1HEUA 3U3ZA 4EFEA 4BX2A 4OXNA 1R16A 3L0PA 2FG5A 4G85A 5JSQA 5FF9A 1Z6TA 4DV4B 4MVXA 2HIAA 1P9LA 2I1WA 5AOBA 1GGEA 1SZXA 4GRIA 4LE0A 2XA2A 3CJHA 1B6RA 1HDGO 4LZWA 5LNK6 3FPSA 2IYTA 1H2LA 3BE5A 2KX7A 2QP4A 3L8EA 3FPIA 3RU3A 2W2LD 3VCZA 3I2JA 4IXWA 4KXYA 1BJRE 3GAMA 5KTNA 4J1NA 2AZTA 3K0KA 4QUEA 1E6EA 3B36A 5HUJA 2ILTA 2E89A 4ZEOA 2RGRA 5GINE 3M8AA 1PJ2A 4EY5A 3CCEV 1X92A 3GVMA 3F0FA 1FU8A 2FRVA 2C2KA 4R1LA 1WZUA 4MROA 5EHZA 4OYLA 5CTJA 2PBRA 1EBUA 5B58T 3ERCA 1FP7A 4WNCA 3QLUC 5JD4A 1UEXC 2WM3A 3X1KA 1NUUA 3PZRA 3T6KA 3DGFC 4GICA 1XL4A 2OG2A 4D1YA 2VN8A 3SS9X 4G0VA 4HS4A 4RTNA 5D01A 3UHOA 4DBLC 5EP3A 2V6GA 5MGNA 2X5KO 3E5NA 5G1OA 4YH1A 3BPZA 3MGAA 1KEUA 5GJVC 3SF0A 4DABA 5HFLA 1Q7CA 1XPJA 2C0PA 3H1FA 3KQTA 4EW3A 2FE1A 2OCLA 4WVFA 3JD3A 4Y2RA 3QWHA 1N77A 4F8EA 4L16A 3HDHA 1KO7A 5KSYA 2J5QA 5KJCA 5DYYA 1CERA 3PQ2A 1H0HA 2HA7A 1GUFA 3PAFA 4WPGA 4ZHWA 1O95C 2ZK7A 4UHEA 1AE1A 4B17A 3URKA 5JMWA 1WP8A 1IZ7A 5U4XA 4K9RA 5AVUA 1YXMA 4K0KO 3LECA 4BHTA 4XIYA 2ZXWB 5FB3A 1NBWB 3VBEA 5LIRA 2HRCA 4UQLA 1A4XA 1QHXA 4Z7NB 5H4HA 5DHQA 3B09A 1K4MA 4LXIA 4HWSA 1A97A 2FW1A 5F3RA 2NUTB 4QT4A 3LPLA 1W49A 2ZJZA 4B62A 3A1VA 1X3LA 5DBEX 1RDFA 2FB9A 4ZT7A 1R2QA 4S0XA 4XUDA 1PEDA 4AS3A 2ZYIA 2QYTA 1PFGA 5AQ1A 4TL9A 4BVHA 1ATZA 4L5CA 2CXTA 3A37A 5E4FA 3VVCA 4XJXA 3TD3A 5GMOA 3QFHA 3RHSA 1OB5A 3G8AA 2CK3G 4ITRC 1YGPA 4TQGA 4AKHA 2YVAA 4E2FA 4KLRA 4F06A 3VKFA 2EBWA 1NTMH 2JAOA 4N3AA 1LI7A 3S8EA 3UEOA 1MJ5A 2F17A 4F71A 3DD1A 2ZNJA 1X1EA 1YI0A 2P30A 3NO4A 1JKFA 2HSGA 2YV3A 3OQPA 1I4LD 2V65A 3A31A 4OFXA 1NJ2A 3MS4A 2X5JO 5DXFA 4OOFA 4NEGA 4RJJA 3NVMB 4A8JC 1UC8A 1L1QA 5LXTA 2L82A 4XJTA 4D56A 3TD9A 3I9OA 1VLVA 4FS3A 4MV5A 2JCVA 3AUTA 2CGOA 3RRNA 4M76B 9LDBA 2AKEA 4TKZA 4U2DA 1ZOIA 3S2EA 5EMHA 3N8IA 2HEIA 3L4KA 4R8SA 3N8NA 2Y77A 2ZYHA 4HQRA 4C2AA 3UUFA 2XZTA 4C88A 2DMXA 4DLZA 5ADVA 5EP2A 1XTPA 4QLOA 4CM1A 4BVQA 2JIDA 4BNVA 1VJCA 2G36A 1QR9A 2WYUA 4RUFA 3MWEB 1ZX1A 1P73A 4NJMB 1O9GA 2HJDA 3HKCA 3HCEA 4IL6Z 3GK3A 2BR3A 3ZHSA 1LWOA 2WR8A 4YPVA 4UHHA 3QFTA 2YZNA 3EBPA 4HLQB 3R75A 3N5KA 4J43A 4QM6A 4WWHA 2VYND 3A06A 3SZRA 2ZJ6A 1FAFA 3WJ1A 1XALA 2J0UA 1AG9A 1TL7C 3GDFA 2AN1A 2HLPA 3V7FA 2R79A 3Q7QA 2IYWA 1S8NA 2YWJA 3V8BA 1VMIA 2VUIB 2C57A 1R0RE 4P82A 1YIJF 3CXCU 4I3GA 2XKAA 3H6KA 3IMKA 1M2HA 2CFRA 2HXGA 4N82A 3B1YA 1N2CB 2O59A 3OTWA 5DBOA 1Z16A 2IX3A 4FOOA 1TIBA 2V7BA 2PWYA 3VNRA 5KTRA 3K70B 5I8PA 2O3QA 3WFIA 3OZGA 1KL7A 3PDIA 4IDOA 5L8VA 1R1MA 3S81A 1YJXA 3UPTA 3UC5A 1QLWA 3GLUA 3P2IA 2WPDD 3V4OA 2VPQA 1SBIA 3D64A 5L3SB 4FFBB 2VDVE 1J95A 1VRWA 3REOA 2ZUCA 4RY2A 3CT6A 1KDRA 3C9RA 2CCGA 1GNRA 4V3CA 2L0XA 5I7AA 4WW0A 4KKXB 4P34A 2NO9A 5L45A 4QFMA 1GAXA 3ZK9A 2GHQA 3VZSA 2V4MA 4OHZA 3IQEA 2IJKA 3L0CA 3UF0A 3WKAA 2FKNA 3IALA 1DIHA 3FWPA 5AI4A 3F73A 2GEJA 1V95A 1GZ4A 5MFPA 1XD2A 4GBGA 5LLDA 1JHAA 4IYJA 4E5YA 5HF9A 1NKTA 1DJLA 4LBEC 2A84A 2Y93A 1U6KA 5JCJD 2H1VA 1WUIS 3E7WA 5TQVA 4DMRA 3V7YA 1NM5C 1ZGBA 1YB2A 3RUPA 5EWJB 5AJUA 2A5FA 4N47A 2Y0DA 5K3BA 3M6VA 2ZJBA 3D43A 4BY9D 3CZPA 3E2PA 1FSGA 4HAOA 4II7A 5LZ9A 1JOYA 1NVEA 2FWJA 2F1RA 3ABLC 5HFMA 1YL7A 2DVMA 3T3MB 1Y7IA 1XLTC 4L15A 1A9ZA 5KNDD 4YAGA 1HR0B 3QX7A 4S05A 4M8NE 5FA6A 2JEOA 4B3SO 3IUQA 4Y6PA 4QAQA 1CIJA 3HPQA 4IV5A 4BO6A 4GMKA 5IEBA 3DW1X 3KWLA 3KR2A 3QVGB 5DN6A 2ET6A 2QRKA 1U3FA 4G1UC 4IKOA 1I14A 4R2WA 3KQWA 4MRAA 1M5UA 1XVAA 4HN2A 1UJ6A 4TSFA 3GNQA 2Q9LA 4FLMA 4F4HA 4XM2A 2PMKA 1DTWB 4QATA 2V6BA 3GNSA 4IIJB 1Z3CA 5BN5A 1OGIA 1SERA 3EK2A 2PHNA 1GARA 3CPWU 4D0GA 1T1SA 4P7KA 4BVAA 1WZIA 3L7YA 5AT1A 821PA 1C3XA 4L3OA 1J9EA 1KK0A 4DR1B 2X5NA 1BMQA 1EM8B 3U40A 3FYDA 5A6SA 2G9VA 2F4NA 3H97A 3MHSC 2A86A 3ED1A 4DM3A 3NT5A 3E61A 4R5HA 4JGIA 4D6YA 4Q21A 4GO1A 5KHGA 1Q7RA 1CS4C 4LOAA 5B1DA 3JAWB 4H7PA 4MW8A 2ZUEA 1GY8A 4J3JA 3KTAB 1X1CA 1NJ5A 5BMVF 3TVYA 1H0SA 2YNMC 4AZ3B 4ZBMA 4HB2A 2JCSA 3CYPB 2H54A 3LLUA 3L01A 2EX1A 2YQ4A 5FBKA 3RJ5A 1OE0A 4X9XA 1XVLA 4I36A 4YV2A 4QUKA 4ZEWA 3F8WA 1ZM7A 1URFA 2AXEA 4HN9A 1WV1A 3HB5X 3LC7O 4HRYA 5K0FA 3C48A 2QJ1A 3K57A 1N6RA 1BFUA 5DI3B 2RGDA 4N6GA 3HP4A 4TT8A 1DKLA 3D00A 4N5LA 5JXGA 3IT3A 4I55A 1YRHA 1QTNA 3SD7A 3VM6A 2FEMA 2WWIA 3RYHA 2REXB 4AZSA 5F1PA 4ZODA 1U0HC 4Q9LA 3U9SA 2PH5A 2E4XA 3A3OA 5L3RA 2AFHB 5ALVA 4AJLA 1XV2A 3F0EA 2XOKD 3L82B 4OLBA 5TMBA 3MHPA 3LC0A 3RYFB 2XQFA 4O02B 3C2QA 1CEQA 4C0QC 4FR2A 1UFVA 3H6HA 3B6ZA 3ON5A 4LUCA 1MJHA 2EV9A 3MGBA 5K3FA 2ZUSA 4AG5A 2VF5X 4NTYA 3NOXA 4FJCC 4IGGA 2YIDA 2YWHA 4XZ3A 4HY3A 4C0HA 1TJNA 4QYXA 5HX7A 2Y05A 1XYVA 2N1BA 2C2HA 2EIMC 1HFJA 1S4QA 2WTNA 2IGTA 3V7QA 5EKUA 4QE7A 4JV5O 1OC2A 2HFKA 4UHFA 1A95A 1YBMA 3H2GA 4G4XA 5E1AC 4CV0A 1ZLXA 1DXOA 5JS7A 2NXWA 1XCMA 5GP1A 1HMPA 3ZO8A 5B1HA 1M2WA 1HC7A 1V6AA 4RM3A 3K58A 1CNEA 4BFCA 4XDKA 1MAUA 4J1TA 5P8WA 4D44A 1JI3A 1F9EA 3L4EA 1EMDA 3PXUA 5ULLA 4YMTA 1V45E 4A16A 2HY7A 1Q81W 4DG5A 3OFND 3LKZA 4KB5A 3S2ZA 1N5DA 4RTRA 3T41A 3NTQA 2VLBA 1GKYA 1T91A 5B6JA 4KUGA 2A2ZA 1Q2XA 1XAIA 4HI0E 1F9AA 2O3SA 3OFVA 3LDCA 4N6OA 3DC5A 4TTTS 3TLGB 2OENG 3TE6A 2XNSA 4D8UA 5DIFA 3L41A 3LY9A 3B1ZA 3LK7A 1R3UA 5REQB 3SFTA 3OF5A 4O1HA 4FM2A 1TU4A 1MOPA 4PICA 4WCFC 4HXGA 4LJLA 5F7OA 3BH6A 5TISZ 3JR3A 1HNZO 4TMVA 2Q5CA 4AQYO 2UXDO 3EFBA 4FSDA 1ZC4A 1G2QA 2L42A 4IEIA 1JPXA 2JL1A 3I5XA 2IEBA 3ZIDA 5THQA 1CFZA 1Z39A 2QNRA 4ZAFA 5EERA 2YC4C 1HGXA 1JLSA 1EXDA 1OSNA 4XGKA 4EG1A 2IXGA 2LUOA 3L9DA 2R65A 2ZSFA 2OZBA 1KYYA 1M1XB 3OTHA 3PFFA 2V58A 1FMJA 1MW8X 3PFHA 3MPUA 3AK1A 2CZQA 3U2QA 3ESZA 5J4HA 2Z5FA 1SC5B 4K3AA 2XDQB 3RG2A 4WERA 1X2BA 4KGDA 4QEDA 4ESVA 3IC9A 5ECDA 4MARA 4NXMO 4MGZR 3CQ9A 4X64O 2WP0A 4EIWA 4G0MA 5DLEA 2X0EA 3IQDB 3E8FA 2YWGA 1OOEA 2I99A 1EK2A 3PQCA 1KXJA 3IE0A 4EGAA 3OR6C 1CC1S 4EFNA 2PWAA 2CJYA 4QJFB 1GAJA 3EZFA 1U2GA 5DHUA 3M99B 1XLUA 1JAHA 3VR3D 1DC7A 1X87A 3K0CC 5IMBA 3E9CA 3UO2A 1OBFO 3T9DA 2I22A 3AF3A 3PDWA 4LC1A 1IEWA 5K8LA 2FR8A 4XARA 3OLZA 2ZQMA 1P0IA 4YDHB 2XE4A 2OQRA 5PNTA 2BI7A 5WRFA 1LK0A 2P3SA 1AI7A 2OBMA 2MK3A 2ZNIA 5AK5A 5DT2A 1PFWA 1MA3A 4AJJA 4ETIA 1CP2A 4L4XA 1GXSB 4MP6A 3VR5D 1DC8A 3G9XA 2BSKB 3AJEA 2CW5A 2FSPA 4H1WA 2XQGA 1QRSA 2QUKA 4RK0A 1FYVA 1D4AA 2JI8A 4KFTA 1E1RD 2PX3A 4HNUA 3PN1A 2OE2A 3EGIA 4JBYA 1G19A 1W41A 5HCIA 3LLVA 1V9LA 4DJDC 2ZYAA 1T8YA 4N18A 3W5UA 4TXLA 1EDEA 3LDAA 4XUGB 1JFFB 5TSDA 4ZVVA 1I2DA 4ALNA 4DMKA 4TV8B 4R0VA 2J0QA 3FB5C 4QRDA 4LK2A 5BP7A 2F43B 1S0VA 2ZB3A 1E2PA 2ZUDA 3ILXA 5JADA 1SQFA 1P74A 5DXAA 4NU6A 5EIFA 2HQRA 4PLZA 4ZYLA 1NX6A 3FTNA 4DA9A 1S8FA 4O4LF 1ODIA 3OCXA 3DUWA 3ERNA 1EVKA 2XWSA 3JVIA 1MLDA 1US8B 3IQHX 1EUCB 4IWNA 3T9EA 4RETA 3LHSA 1YTUA 2DQ0A 1EJ0A 2ZYGA 1E2UA 3I2FA 3TIIA 1TAQA 1T5EA 3OPNA 1NXVA 3FROA 4QOSA 2DJ5A 1AJPA 1GA6A 3IAUA 4UM9D 4YYZA 3ZMTA 2G7ZA 1L5HA 3RDPA 2R6ZA 1XYYA 2GCNA 4BO3A 1SM4A 5JZBA 1XJWA 2BZ1A 1NN5A 5IX8A 4BATA 1L1FA 1CX9B 4DM7A 5JSZB 5E3JA 4UU1A 1EFVB 3FZQA 3ZU6A 2HGZA 1FOEB 2JI7A 3GRKA 4ASUG 2YRWA 3EIOA 2PVCA 4UV9A 1L7AA 1N2BA 3R3UA 3KZOA 3ZXIA 2CUKA 1M7GA 2ITCC 1GQQA 2YXDA 3HJUA 1THMA 1FDWA 2DBZA 4M8LA 1X7ZB 3CLSD 5DBFA 3L4BA 5LB2A 4TXJA 1I1HA 3ZGNA 2V7QD 2VYNA 4ER3A 4M9XA 4LJ4A 4MO9A 3Q10A 1DAOA 5A9SA 1EYZA 3NLLA 5CDTA 4IIGA 2XNHA 1EZJA 1CP9A 1TAGA 4JEMA 3MRVA 3BA9A 2EBHX 1ESEA 2KG7A 3GDWA 4Z4FA 4M8IA 2G8LA 3DKKA 3TTWA 2Z3YA 4X8MA 4FMPA 3PQFA 4RFLA 2DFVA 1FNCA 3KWJA 3E9QA 4RXMA 4ESOA 1U0LA 3AUXA 4WOPA 1ECGA 3INRA 3TETA 4II2A 1G21A 3VHRA 2ZXWC 3ICXA 2ZT5A 4TN1A 2ONJA 2JJ1G 1J56A 3FOFC 4OX9Y 1KO8A 4X9QA 3ZQ6A 5BMOA 3RYIA 5KHIA 4KIWA 1Q1AA 1W2BF 1NONA 2WD8A 1ODFA 2IHUA 3SC4A 3O7MA 2BHLA 1ZJYA 1Y74B 2YHAA 4I9NA 1MO2A 3E84A 2WPDA 4P86A 4V02A 2BEKA 5AJHA 3ZWKA 1BOFA 4DDUA 2HCBA 1YT5A 5CK5A 2OHHA 1P33A 4K5QA 3MCVA 2VRCD 4FK5C 2RAVA 1PD3A 4PWTA 1U3LA 1W46A 3HR4A 1DK1A 3UCSC 3UN1A 5TMEA 1D1PA 4V0QA 2PS9A 2GPSA 3QKRA 2PBLA 1I0ZA 3AHHA 2GM4A 1Z5GA 2C3OA 3NBUA 4JSYA 3RC9A 1PN3A 1QGUA 4QULA 2FMLA 3BVPA 3DSRA 1FP1D 1V25A 2H92A 1KHHA 4YI5A 4XQ0A 4Q3EA 3QWAA 4OJKA 4R8MA 1Q6UA 3M6MD 2EJVA 2VZ8A 3BCUA 3G49A 4IS2A 5JCJA 1TM5E 1KTVA 4LMAA 5B3AA 3U44B 1G3IA 2VCHA 1K73H 1XFAA 3T4DA 3VAYA 1V4BA 4U9IS 1SG6A 3MHTA 4YXWD 1E1MA 3W5JA 3T0IA 1XTQA 4RX1A 3WB0A 1YUMA 2O4UX 3AF2A 1XDGA 1X42A 3TQOA 2E5LO 4WNYA 2BGMA 1L7BA 4PPNA 4FIDA 1MA0A 1RAHA 2B0CA 2YHUA 3EDQA 3QBDA 1QYIA 3G1TA 4UFOA 4MDYA 5EBMC 3IAYA 4HNRA 3H1GA 2D5LA 3IVGA 4F4LA 3UHFA 2ZG6A 4JKOA 1ZL8A 3NC1C 1CN7A 2BEVB 2WDPA 2VSXA 3ICCA 1QQ5A 3O8QA 1ADYA 3ZTWA 1M0TA 1CHNA 3D54D 3UQ8A 1IUPA 2VPWA 1Z0KA 3C3TA 2GD0A 2BZSA 3OQIA 2XYQA 4KXNA 5K0TA 2JJ2G 5F35A 1WF6A 4B85A 3EPPA 1I10A 1Q7YW 1R0LA 2AEMA 3A11A 3WJ2A 4CM5A 3G2JA 1TGYA 3RC7A 4TLDA 5FUYA 3BL6A 1AKMA 2YS6A 1Q83A 2LTAA 1QHGA 2VATA 4UDNA 1JMVA 1A71A 4PHHA 1ZCFA 5K0NA 5KHJA 4LC0A 4BQFA 2BWJA 1R3JC 1D4ZA 4MW9A 4BVFA 2YZKA 5K8JB 3RIGA 1QX3A 4B7XA 3NDIA 1M10A 4COKA 1M34A 1JR6A 1F2TA 2GRUA 4LJYA 5CH8A 3MUEA 4Q7EA 3NG1A 2Q5OA 2F48A 5J3JA 1Q50A 4Z3KA 1OAPA 3L79A 4NEQA 5KQPA 1EXNA 4O5OA 4DDTA 1E3LA 1PGNA 4PY2A 2C29D 3G0HA 4KU4A 4ND8A 2RD2A 1P1IA 1L4EA 2C1EA 3T9AA 3BK2A 1DIAA 4JQCA 3CGGA 3FNEA 3BPSA 3I9V6 4V0ME 1KMMA 4RENA 1PFQA 1K33A 5JOQA 3D59A 1YQTA 2P9HA 4K8OA 1E2QA 3K70C 4E14A 4U6QA 4FE3A 1AR4A 1YXBA 4UPVA 1N5KA 3R0JA 3QU2A 1PPJH 2JLRA 5IXJA 3P1JA 2OXEA 3A4MA 1KZGB 1UODA 1ZCBA 2F9MA 6YASA 3T5AA 1FDVA 3GH3A 5IVKA 4P81A 2RJZA 3O8LA 1JH9A 3SYKA 1YZBA 1KH2A 4BP1A 10MHA 4PIPA 4U1RA 3U81A 2A4MA 4MQUA 4ZCQA 2MR5A 3B6MA 3HTNA 1P5JA 4DN6A 3L71H 4UMVA 2MYNA 1M3SA 3SZUA 3TTSA 2LGWA 3FMOB 1OVGA 4I0XB 4X65B 3EQ7A 3G2NA 3A2NA 4I1OA 4FGJA 1G3UA 3H17A 2IE0A 1QHHB 3RS2A 4IVQA 5DN9A 2VP5A 5BSVA 1WHSA 3FCOA 4EI2A 1EK6A 1WHTA 5BOSB 1M90H 4EUHA 4BTLA 4GMFA 3SJBC 1XU7A 2ZVDA 5EWLB 2V7GA 2OIGA 3G71F 3IL2A 3PQ7A 4B7ZA 3OESA 3N5CA 3VOAA 4IG4A 4DLWA 2DLCX 5TX7A 3F9RA 1J0AA 3TM4A 3I1JA 1C1DB 3AKCA 4WBSA 2NSLA 1Z6AA 1A8PA 1N6OA 4HN4B 2XDYA 1JQBA 2HMYB 2CJFA 3C4VA 3WMRA 2H8GA 1E1NA 3TLEA 4KP4A 4QSHA 3WL3A 4LZJA 1X7XB 4XVUA 4RQBA 3I8SA 2ZI3A 5KQRA 2WFMA 2CLEB 4KTVE 1LFAA 3PHIA 1ETHA 1D04A 3M2PA 2D62A 4BN4A 4UU0A 3RSQA 4B4KA 2PUDA 3D4IA 3MRSA 3VMFB 2ZR7A 5K4HA 4PZAA 1C0IA 3F7VC 4FFPA 4QUAA 2QRHA 2AE1A 1DV2A 3OFNA 5AICA 3OM9A 4XAQA 3QJGA 4LCEA 4YFVA 1Y6XA 2NNLD 4GXRA 3PXAA 4LOLA 1CPYA 3CJQA 5D87A 4G5QA 4PYRA 3K73O 2H1CA 1ZLYA 2IYVA 3ROQA 3ZLBA 2N46A 5I9IA 1T3GA 2EFEB 4B6QA 1KVTA 3AU9A 3RVBA 3BDVA 1P84F 4IXNA 1AMNA 4ACBA 4YRCA 1PV4A 1PX2A 4OHOA 2CZCA 5E3IA 3D8NA 3WLSA 3RCBA 5CMUA 4TTVA 4D96A 3W3AA 1K5DA 5JIBA 1Z2OX 1JRLA 3WYBA 2B83A 4REQA 3ABLB 5CT4A 3O1HB 3RJMA 4E1AA 1BVUA 3IV9A 2HQ1A 5EAZA 4B8WA 3ENKA 1RACA 4Q9KA 4Q7JB 1F38A 4PA6A 1K8ZB 1V8ZA 2VYQA 5B1BB 4LF4O 2ZYSA 2FEOA 5TT0A 1VCIA 1ZEMA 2UKDA 2YTZA 1OCRB 1AF7A 5JW6A 4BZWA 4M1ZA 2GBCA 2K2WA 5DHPA 3E7DA 5BWCA 2BTOA 3U7RA 5DBHX 4D43A 1E4EA 1IDOA 5A0TA 1RP7A 3GWGA 5FEMA 2PH3A 5I7OA 3OCVA 2C3UA 2ECKA 5JMPA 3OWOA 2I4OA 1V7QA 4LHEA 1VQKV 4YRFA 5IVHA 3BZBA 3P9NA 5EYPA 3KFVA 4M60A 6AT1A 3H9GA 4ON9A 4D4GA 1BWSA 4PC1A 5E6RA 5L3VA 5JLAA 2HRZA 2C7PA 4TWZA 2Y1GA 4RF4A 2YS8A 4BN0A 2B9ZA 2O0MA 4OD0A 3OO0A 1FLNA 1NXOA 3VSDA 4RPCA 1SD1A 3H84A 3K9NA 1G42A 1FXVA 1ZMOA 5E8JA 2I34A 3VR3A 2GBFA 1MO6A 4DADA 1X1DA 1OZ0A 2WF5A 3AOGA 2FPGA 4DIEA 3PTLA 3M3DA 1JU4A 1T15A 1XQXA 3WLIA 1Y5NA 3CCQV 3ZE1B 1M6WA 3A9VA 2L2QA 3HVRA 2WHRA 3OEYA 4D6PA 1KQ3A 5K20A 4Y3UA 4UBIA 3T5CA 1MO3A 1BVRA 3SC2A 3KTFA 1Z8NA 3WIBA 4KQJA 5CG1A 2E21A 2WIJA 3WICA 1Q57A 2HKOA 4QBTA 3VR5A 3LO8A 1Y8QA 4ISBA 3V5NA 3W9UA 4ZEVA 4K9DA 4IIJF 3OC0A 4W1QA 1IPHA 4MKXA 4J16C 2QJFA 4OH7A 2OQVA 4ZI2A 3S06A 2F1KA 1ISRA 1M9NA 3WLMA 2QZJA 3WNBA 1AQNA 2FF7A 3T5DA 4KMRA 4QGGA 2VHWA 4Q01A 5EHIA 4TXHA 4UNPA 2V55B 1P2SA 3L7IA 4HQ6A 2PGNA 2I1QA 4PG5A 2P91A 3ZX6A 1WVMA 3B85A 1LVHA 2CXSA 1IY1A 2Z1FA 4AWBA 4D74A 1UQUA 2CL0X 2H5EA 4B3IA 3UM7A 3ECSA 3O8DA 4YUXA 1EFAA 2Y1LA 5C8DA 3JS5A 4I9UA 4BVSA 1X94A 4X60A 1JILA 3NIFB 3S1AB 4YUWA 4Q24A 2QTOA 5T4BA 1EEXB 3I37X 3LBNA 1M73E 3PHGA 1T34A 5LQAA 3V4LA 2LRHA 2O2SA 1RI4A 5D3MB 1XZBA 3F7OA 5EIBC 1LSJA 3SIUA 1MV8A 4MP3A 5C8VA 3QX9A 4Z2YA 4K87A 4ZAGA 4LP8A 4FIZA 5EIEA 2QLTA 3T5TA 2EIMB 3F5DA 1DKPA 4OFWA 3ZC3A 5F78A 3QF7A 1S6YA 3CRMA 2AFHE 1CY2A 1X8LA 3JQAB 1YU6A 5J2UA 3UFXB 1JNXX 1P9OA 4MUIA 1HE8B 4QPDA 2VF7A 1VLLA 2DOSA 3HR8A 1Z34A 2NLOA 3MUNA 4PYLA 5DN6D 4IMJB 2IA5A 5BXYA 4RPGA 1IZZA 1RM0A 3CLKA 4FQ8A 4X92A 4XWGA 5ALWA 5CVCA 4RUEA 3U3DA 1VI6A 1BEUB 1RWBA 5B64A 4DUZB 2GJSA 4E5KA 2NZXA 3NBKA 1P1RA 3V33A 2W0XA 1XX6A 3CEJA 4G56A 1ZH4A 3PR3A 5IDWA 1YR3A 5JBIA 2L6LA 4RAIA 3FF4A 2EP7A 2V7QA 3AR8A 3NPMA 3PQ6A 5BN3A 1QUEA 2PJDA 3IE1A 4GKBA 3VDNB 3V7EA 2QDKA 1Z5VA 3NASA 1QE3A 4KLNA 4EHAA 1PL0A 3V2IA 3ZRXA 2ZWPA 3ES9A 1NXWA 4GC5A 2QWQB 1R4AA 2EKQA 2HWUA 2X1VA 2FW8A 2VPZA 1GD1O 5K4AA 1RE0A 4TMTA 4NZPA 1M8PA 4ZOAA 5LYJA 4HZIA 3GQBB 3T1TA 2WPNA 3RTDA 4A6PA 2RHHA 4CKXA 4PYNA 2VHVA 2UVDA 4AUNA 2WWHA 5FUMA 5FBLB 1SCQA 4JZKA 3U4QA 3G5AA 2PKQP 1JWBB 3OW2U 4YRBA 2MR6A 4BMZA 3H1BA 4DDKA 4NYJR 4C87A 2BO1A 4GM1A 4M7WA 3B3JA 1GKKA 2IZ7A 3OZAA 4M49A 1YGYA 2O19A 2BD0A 3DNFA 7REQB 1TJYA 2PDAA 1UXJA 3D7LA 3UWSA 1I08A 2YOFA 2FL4A 4Q20A 4D9KA 2REOA 4KRGA 2VRCA 3GNLA 4RIHA 4C0SA 3NM6B 1R9JA 1E6UA 1MB3A 1DG1G 3G8DA 1IV4A 3G7NA 2RHDA 4ZAYA 1UINA 1XNGA 2X6TA 2VPYA 2WD7B 4O2LA 2HG5C 1WP4A 1M2GA 3OMNB 1GZ5A 2A57A 3IR5A 2WLLA 1AJEA 4NX2A 1HO3A 3EGDB 2OZKA 3G2QA 1BXGA 4FDTA 5CJPA 4L8FA 2ZR9A 2AE2A 3WHLA 1KBHA 4LXUA 2I6TA 4LVOA 3FG9A 3W4IA 4F6CA 1VRCA 3U3KA 1JFRA 4XCVA 3RVNA 3PENA 4JI6O 4JLKA 4PC2A 1JR3D 4NNPA 4FVMA 4TKLA 1UT5A 2AOUA 1ONOA 3D2CA 3CLUC 1XEXA 1MC5A 3SX0A 3QELB 4ZO6A 1YF3A 1C0KA 4CPDA 5HFNA 1PFVA 5A2GA 1BE6A 1OV4A 3BREA 2QMUA 4BC0A 4ALKA 3A4IA 4ND7A 3L5OA 4MVJM 2XUMA 3EEOA 1IHOA 4G67A 2PXXA 3D54A 2HA2A 2JGRA 3MJRA 4X63A 2P1DA 2FQWA 3PGKA 1DCTA 3KR1A 4DJFC 4BLWA 4G5FA 2HT1A 2OKGA 1IONA 1E2KA 3H5WA 2WTAA 3FAKA 3ZDEA 1R10A 1ZIDA 2JBAA 3VV2A 2KHZA 3R3XA 1T1EA 3GZNB 3I5UA 5BNFA 1QHIA 4ZV4A 1SUDA 3A58B 2HMSA 4CLOB 1BVHA 1BCRB 1QQAA 2QPOA 5KTYA 4JLJA 1O0BA 5C8XA 1E7MA 3DMNA 1FX0A 1RAEA 1PS8A 2SECE 3VVMA 1XGKA 2YRFA 1WZCA 4JQSA 1ORVA 3D0OA 1X6VA 4WE3A 1R15A 3FGZA 1BOOA 1NMYA 4MQ4A 4EPYA 3O1IC 5BWNA 5H1YA 4LX0A 2AHRA 3P27A 1VHLA 1NNEA 4BCDA 2XAAA 3D1LA 4W6ZA 4RZIA 2W48A 3H5IA 2EW1A 4RQUA 1NMZA 4YLYA 2ZIXA 3I0MA 2IDZA 3FFWA 2JASA 3F5FA 5A04A 5KKAA 2P3OA 4GUAA 5LQJA 2QYOA 3M8KA 3F7NA 3NETA 4I7EA 3SYQA 2ISQA 2O8CB 1S8OA 4WZAB 4ATNA 1RI5A 2HJVA 4HK4A 5DASA 2DKFA 2X14A 4C4YA 1X7GA 3N7TA 1ZUQA 1NKSA 1NYRA 4DYHA 4BRUA 1BHAA 3AP3A 4XB1A 1U8UA 4XPIA 1N8KA 1P77A 1YO6A 2RGNC 2W2QA 1SG9A 1TUBB 1E9EA 2CVQA 3D81A 3LUJA 4B87A 1L4FA 2VH1A 1NBMG 1KY2A 2D06A 4ZDKA 5EJ5A 1YHQV 5KYKA 1BHO1 3OZFA 3DPSA 4UVDA 4TV8F 3FETA 3GT0A 2SICE 4RPHA 3K04A 4DCGA 3PI7A 3L6RA 1ZYUA 3B40A 1X0VA 4WXPA 3PPXA 2JC3A 3LPAA 5TQ2B 5FBRB 4WECA 4LEIA 4MR9A 1OXUA 4JY7A 3ESDA 5KC8A 4F2WA 1SULA 4GWLA 2W6JA 3KTDA 5ERYA 1REQA 3M6UA 1P3Y1 2IH4A 4MTXA 4QPKA 3IUJA 1OXSC 5H2FZ 4TQUS 4D3FA 4RA6B 3FUUA 3HJNA 4M9RA 2PWBA 4TKVA 3ZE0B 4EVQA 4ARZA 4X66O 1UT6A 3EFOB 3ZGVA 4PA9A 4GZ5A 4RCYA 1U0RA 1GJRA 1FDUA 2FPOA 1L4NA 1RBYA 3C9UA 3TH5A 1OAOA 4JH0A 1VKNA 1DI0A 1X3SA 5DOZA 4TRNA 3GVXA 1E1QG 1C3EA 3DYIA 2CDCA 3O93A 1DKOA 3I9LA 2FZLA 4UM7A 2VQEO 5JXHA 5CVJA 2QRLA 5DM60 1QQ7A 5JJNB 1MGPA 2GBOA 2AEJA 2NQTA 4K26A 5IANA 1T35A 2JS3A 1EH5A 1OPRA 3GBVA 2ZTSA 5TDHA 1O8BA 4R41A 2WW8A 4X6XA 3C3DA 3R65A 1X7WA 1VMGA 1J2RA 2BFAA 1VQ7V 4Y2TA 2CSUA 2Z0AA 3C4QA 1I6KA 3K1AB 1JG7A 3Q9NA 4R0MA 2HCFA 2CVPA 4AMZA 3OR7C 1YJ5A 2G04A 4FJ1A 5T6MA 4LXYA 3HBAA 1UKYA 4R2KA 3HKDB 1LBHA 4IIHA 4X44A 3SSNA 1D5NA 4BX9A 1XVUA 4QEZA 1OC4A 1V2GA 4AO6A 3IIJA 4IQ4A 4K6KA 4FEGA 2PM8A 1CE8B 1H5UA 1KJZA 4OVKA 5G4VC 1LK7A 4OYYA 3LMEA 3FRIA 4JIMA 1P72A 1R6NA 1JPNA 3JPYA 3HCWA 1AR5A 2J07A 3P2KA 3PXBA 3U4HA 5TY0A 4H27A 1W8IA 1MH9A 3ETNA 4U63A 4TYYA 1YMVA 2E82A 2EYUA 3C3MA 4LNAA 3K8QA 1X8XA 2AJCA 4G5HA 1BRMA 3GZJA 2BTUA 4YCJA 5JJBA 2J6BA 1MF7A 3HZRA 2JIBA 1MABB 3WX0A 4E2YA 4LR3A 2OMEA 3DEKA 2WHYA 1H2KA 1INLA 3T5GA 4YIKA 3COJA 4DBLE 3B9RA 1DJPA 5IK2A 3OSUA 3GUHA 2VNKA 1YJAA 2HWYA 3RRBA 2RBKA 2RHLA 2BR4A 5IJWA 2ZANA 1T10A 8MHTA 3V1MA 2H4ZA 4PAQA 5H70A 3PLNA 4Q7KA 2W2NA 3BAAA 2P9FA 2YJNA 1I2CA 4GOXA 3N2KB 1JQKA 2OB1A 4D25A 3KZCA 3MUOA 4OHKA 1KGDA 1KR5A 4JJIA 2RH9B 4IL5A 1ENOA 1RYBA 3ZHOA 4C0JA 3DLPX 3E8BA 3FW1A 3WYAA 1II8A 4MYDA 3P2JA 5SV2A 1YVWA 1UI9A 2VSNA 1WB9A 1ZWIC 2P0YA 4KVFA 5JRJA 4ED9A 3W5HA 1U3GA 2XBLA 3QXXA 3P2MA 2JHFA 3NUQA 2V5UA 2YZMA 3ZMVA 3GLIA 3JWIA 4FFDA 1ZSNA 2OEPA 3I45A 5FAXA 4RFSA 2EILC 2PA3A 2VQ6A 1GGKA 4BNMA 1KMHA 4UUJC 2YCBA 1DADA 2R47A 4M1MA 2BKAA 1LV8A 2FQXA 3AL2A 2WIKA 3KU4A 1NIJA 2X6RA 2W0MA 4KSCA 2ZPUA 4KWCA 4J0CA 2QWOB 4RTKA 3SBXA 1GITA 1XROA 1I7SB 3O83A 1CUYA 5AI8A 2GERA 3AG6A 3EZ9A 3KQMA 1GZVA 4C2BA 3QNWA 3WG9A 1CQJA 4NECA 4Z0HO 5JHGB 4JNKA 5AUNB 2PRKA 3A6FA 3FN4A 1JKXA 3AW9A 1WKBA 2IELA 1SOMA 3PNMA 4JT8A 4ANFA 2Y92A 3DS8A 3HYSA 4BMPB 3WSVA 4I3FA 4EYOA 1IWPB 2B6NA 1L7MA 3VVLA 1JLKA 2VHJA 2IJHA 4XOIA 2XUGA 1LC3A 2ZOSA 5AVQA 4FM0A 2P11A 4I4IA 4IGFA 3KNZA 4KO2S 4ZZ3A 4RJLA 3D7MA 1MX3A 4Q4HB 4FCTA 3UA3A 2H3OA 5EZYA 1P1JA 4GWKA 1EGAA 2PAAA 1H1LB 2QY9A 3VTZA 2Y6UA 2QT1A 4YO8A 1IM8A 3PPIA 4YR9A 3W2TA 1KKDA 3ZXUB 2ORED 3MGGA 3P9YA 1CZRA 2H1IA 5BQPA 3F4LA 2AUTA 4OPMA 3TTTA 4OHXA 4HADA 4KDCA 1VOTA 5FIUA 1FNKA 4K9KA 2I7DA 1I2BA 1OXKB 2Q46A 1KWKA 1K86A 4IYHA 3PX7A 5B1BC 4H08A 1UXOA 4FBLA 1T13A 4OBWA 1YBAA 4BFSA 2I2DA 1OCRC 3BDAA 3OUZA 1A5ZA 4DR4O 3ESXA 2XUZA 2NVWA 3CCUV 4N76A 3VH3A 1PF5A 3WB1A 3U3MA 4RL6A 1N34O 3L8FA 1N6LA 4E51A 1KI2A 4UC0A 1XDCA 2PUJA 4U2EA 3LWQC 4RTLA 4EA9A 2IXAA 4ICIA 4RIGA 2WJGA 4HAVA 3ET4A 2D1QA 5LMUO 3T5MA 4GI3A 1O89A 1C8VB 5L95A 3P2EA 4COOA 3KJXA 1BMFA 1NT4A 2JH9A 2KQXA 2ENWA 1SN7A 5I5EA 3QFFA 3HPRA 1GFZA 1AI5A 3T3IA 1KJWA 4LVUA 2J46A 3DFIA 2FDXA 4YAIA 2PSFA 2WIDA 1WU7A 2BFNA 1SC9A 2M2IA 3SZMA 3FJOA 2FW0A 5B4VA 3SZGA 1SUCA 4KXRA 3AIOA 2Y4UA 5DT9A 1T9ZA 3KSRA 2AN3A 3B51X 5CM9C 1V54C 3I2HA 1Z4KA 4C2TA 4TZ6A 4DZTA 3AEXA 5TQ0A 1G8FA 1OI2A 2DXIA 1IQRA 3CF4G 3SJUA 3QP9A 3CONA 3M4XA 121PA 2BFDA 3WA7A 3HL0A 5LQMA 3VO9A 1XRSB 1RTKA 3WDSA 5I4KA 1FFWA 1KEEA 3HV0A 2XASA 5M7EA 2XE7A 4X1IB 2VZEA 4BZPA 1CJBA 1PS0A 4OHRA 3BMQB 2PYLA 3IBSA 3CRRA 3RS0A 4QHSA 3DKPA 3OMAB 4K9QA 3A9WA 2WWFA 3PX3A 2H1OA 4PA7A 3C15C 2ZVZA 2EKBA 1KH1A 4LOJA 3KCYA 5EINA 1I7QB 3LP5A 4FXPA 3RVZA 4NESA 3TCXB 3TW4A 2V7XA 2IQQA 4R7TA 2ZYVX 1I7NA 4QDKA 5IKXA 1II0A 5JDIA 1KZYC 2PF4E 4JI8B 1VQ6V 1OGJA 4MVJI 3F49S 4UE3S 4L9WA 1IJBA 3G85A 4QVIA 1M6VA 3ASOB 4AP6A 2HHJA 1XZAA 4AI8A 3KHSA 1QONA 2Y1FA 1EX9A 5FR1A 3RWMB 4H60A 4IGIA 2QG6A 1B4DA 3PK0A 3AMVA 4OB7A 4YRKA 3HLTA 3TTYA 1JR3A 2YY7A 5K6AC 3CCJF 3V1UA 4XB6B 2CV0A 3IBYA 3CNOA 4NYJQ 1RYNA 2R9VA 3MT8A 5F5XA 4JYAB 3ZVLA 2G0NA 2V45A 2F9FA 5KX5B 4ZXPA 5BR1A 1IM2A 4YP6A 3LWRC 2PMBA 1LXCA 2XVYA 2CL7X 2GO7A 4HQLA 4CG2A 4QG7A 1YI2V 1GVHA 4NR1A 2LDXA 1DC5A 3ONEA 3UMJA 3HO6A 2V4UA 4X7MA 3IQIX 3MINA 3ITDA 3Q1LA 1HDJA 1Z0ZA 5CH5A 1XRJA 5JYCA 3HRKA 2BHRA 4L5IA 4OGWA 3PVZA 3ZQKA 2XVAA 3LYAA 1NBHA 5DNCA 1ZAYA 1AP5A 1G38A 3EVAA 4E07A 5LYYA 4DLBA 3LT4A 1JPUA 3ZKWA 1YONA 1JDPA 4YJ3A 1CUWA 1X19A 3V32A 1ZPDA 5JSYA 3HL4A 2DEUA 1Y63A 5DK4A 4C7VA 3G2IA 1A8QA 3LSUA 4N3BA 4KXMA 3L40A 1APBA 4UZFA 3AVPA 3CLTC 5ER9A 1WXXA 3HJCA 1GKUB 4JLNA 4PC7A 5DV9A 2YBDA 2W00A 4RQOA 5B6IA 1OWMA 1SCKA 5AW4A 3HR0A 2PRZA 2IHTA 3W3AD 1RT9A 5CCDA 3HM9A 5A0FA 1GPDG 5GGXA 3RBAA 3HCPA 4R1SA 3KQNA 5H5JA 5IJ0A 1XTUA 5D85A 3HAXD 2RJNA 1AGNA 2CLKB 2PLRA 1AB5A 4DC9A 3ZXXA 3K9CA 3UKOA 2P40A 2ZLBA 2SCUB 1PWXA 1Z73A 2FHSA 4NWIA 4P3PA 4L7QA 3OQBA 4TROA 4RPIA 3GWOA 2C4VA 3GJ6A 1TO1E 2D1FA 2A0KA 2IZOA 3CC2V 3TNDA 4P93A 2CH7B 2ID7A 5B8FA 4LBVA 3SCZA 3T80A 1GPYA 3DHVA 5K9ZA 5IYDO 3QXGA 2X6CA 2HBRA 3ND8A 2X41A 4PPYA 4TSRA 1JCHA 4YRZA 4PTZA 2Y1EA 4JYPA 3CY6A 5B4UA 4YT5A 1GHTA 3LUCA 3PPVA 3VBBA 3LT5A 2ZM5A 3LX5A 3LFOA 4YAWA 1SCUB 5C2JB 1MAVA 1LJ8A 3P0EA 1GO0A 3SYLA 2CNWD 5FO1A 4TV9B 2NTJA 2Q4OA 1E0KA 3L0ZA 2OR3A 3PHJA 2FH5B 5DHAA 4UMFA 1RQ7A 1FJHA 3H9QA 4JS0A 1IBMO 2KWIA 1FS0G 1LLDA 2G3YA 2I9KA 3M6AA 5H9WA 1RRKA 3BFRA 1PGOA 1USVA 3W2GA 2HJ9A 3DULA 4L22A 3DUFB 4JENA 1KPHA 1OXXK 2QVXX 4BO5A 1G9SA 3QMPA 3FNGA 2GVDC 1YZGA 3NGMA 4Q6WA 2OCIA 1TCBA 2VJMA 5KOHB 1GV0A 2RK4A 2YKGA 5JD6A 1GQRA 2ZUBA 5IT9A 1P4JA 5GAPK 3BMOA 4JPRA 3T7RA 2O2XA 4E08A 3KQYA 4FC6A 2XIQA 1HTTA 1H0RA 3WOHA 3OT1B 1WXIA 2C7GA 1XXHB 5GTDA 2QXYA 4L5JA 4IXTA 4Z6KA 2VQFB 1XZPA 1L5YA 2H1RA 4R6ZA 3SE7A 2ZYUX 2NACA 2QBYA 2AN5A 4PWZA 4MEJA 1CKEA 1JU3A 2C7VA 4J7CA 3AUKA 1S5LZ 1DX4A 3UMYA 1JE0A 5IHXA 1FRFS 2QSAA 5JS2A 3FTCA 3EORA 4MVJG 3FWYA 1NI5A 3WV5A 4Z9AA 2PGGA 2QWRB 2GTSA 4RYDA 2CUNA 4KBYA 2BCEA 3L7QA 4QYSA 3NBZC 4HSEA 2UZ0A 2X8WA 4HFRA 1SUBA 1L4KA 1KDZA 1M5IA 4QTXA 4HB3A 5B2FA 3VFDA 1WRBA 2EFGA 1O6CA 3ZVKA 2GYUA 4CFYA 1DJQA 3CEAA 2IRWA 3LF1A 3NH9A 2D5BA 2ID4A 2CWWA 4QJ4A 1M1UA 4FFVA 1KYOF 3CCVV 2RGWA 3O38A 4RZ3A 2D3OW 1GCGA 1X80B 3KJHA 5LQUA 5EPUA 3SZ3A 4KQ1A 3QOYA 2X7XA 1GAWA 3T1NA 3GQVA 3V4PB 4GP6A 3AKYA 1K4DC 5A62A 3DJYA 1BH6A 2KB1A 3KJGA 3NBMA 1YR9A 1YVEI 3W5VA 2DPLA 4LMPA 4Q9JA 1RM1C 1GPBA 4MWEA 3WKEA 4BLPA 5T7BA 3KAKA 1LCIA 2X6AA 1E7SA 2JAHA 3PC4A 1OASA 2Z2ZA 5CA1A 2GK4A 1TK3A 4O6VA 1WW3A 5IUNC 3L1HA 1L4UA 2Y69B 2VZ0A 4QUHA 4EPXA 5KSPA 4BMVA 1Q8IA 4OHPA 1B6QA 2OBFA 3WNQA 3OLXA 3TQIA 3R20A 1G63A 5JISA 2GX6A 4CUJA 1II9A 2IY7A 4KYVA 4N8EA 3ZWXA 1JEQB 3RUFA 4PBTA 5JFTA 1LUVA 4ALIA 4XQGA 4XYLA 1S72F 3TIGA 2J33A 5CFPA 2HF9A 4U3JA 4L4UA 1FU4A 5LZ2A 3T7DA 5JCXA 1XCJA 1WQ1R 1T9HA 3E03A 3E3NA 5K3DA 5IJXA 5KOJB 4RS3A 3HJWC 4JP8A 4OQNA 2C92A 1A27A 4YASA 3QEMB 3V42A 3OHMA 1G66A 3MB8A 2AEEA 4C21A 1Y4UA 3VAZA 5EXDA 1PV1A 5C31A 2JCYA 2XODA 3ZRSA 5BORA 2BR5A 1HA3A 4ZDWA 3BRWD 4RANA 4LTNA 2ZJYA 1JJIA 1XTIA 3AL0C 5MFZA 2MMGA 3C6YA 3FDFA 4C4AA 4E2WA 1Q0TA 3C9TA 4IZIA 3TGWA 3FFMA 4ZHSA 2RIPA 1N7IA 2DFTA 3BXGA 4RF5A 3ZGZA 1RHQA 4V0SA 2SKEA 1M7BA 1EG7A 4Y2XA 3P3NA 1FVOA 3K16A 1HTBA 4QVKA 4NENB 1T3SA 4BVJA 1LW7A 3NNNA 2XCIA 2Y99A 4W9MC 3Q3HA 1M4UA 2X23A 2DUNA 3C3YA 2ISCA 3WOVA 4YRMA 2CVHA 1PX0A 2Q7OE 2ZATA 5E6UB 1RLMA 3BEOA 4D6TH 3RREA 1ZM4A 1JE1A 1FMLA 2Q5JA 5C80A 3K2EA 2FWBA 4OHUA 4YJ2A 4BNTA 3STXA 3CUKA 3CSSA 2DAPA 3A6KA 3RE1A 2YIMA 1FEZA 1J8FA 3IR9A 4ZU1X 2GNPA 3E22B 3GGPA 3ETGA 1POXA 1NI4A 2J3EA 3I4CA 2EFYA 3FPFA 2GYWA 3WK8A 5KZMB 2PWZA 2NVUA 1T36B 3ZDXB 4GOND 1O77A 1AKTA 2QPLA 1A96A 1NF2A 2AT1A 1POWA 1RJ9B 2NYVA 3HY4A 3H4MA 1JAXA 3CUSA 5JNUA 1EK1A 1GL6A 3SPGA 1N0NA 3MWLA 4F8YA 3BEHA 2HRUA 5JYDA 1JIQA 1FA9A 4LJ8A 3I1YA 4BJ1A 2GUWA 4FCVA 1QNLA 5CA0B 1X77A 3SBOA 5LGTA 3YASA 2Q28A 3RSLA 3ZS8A 4L8LA 4QPPA 3V2UA 5FOWA 1U28C 3ANSA 4AFNA 3BE6A 4WX2B 4R6WA 5A3QA 1WG8A 2OCYC 4IIBA 3CSXA 5TEWA 4WDRA 1CQXA 1PQWA 3B9BA 1U2DA 4BV8A 4JCCA 1JAIA 4LXXA 3AONB 2O0HA 1U9ZA 2EKZA 2V8OA 4F84A 1GFSA 1BDIA 2ZRIA 4M1KA 4EYKA 3LL7A 5EIAA 2HR3A 3OKCA 2H59A 3I2IA 1NT2A 2HRBA 3P45A 4BQQA 2JLAA 3QH4A 2GCOB 4C07A 3BYQA 1ULSA 3M9XA 1NVGA 3IURA 5C4GB 4WDQA 2PT7A 3LY8A 4M9ZA 2H5LA 3D8TA 3IP6A 4FX2A 4HKTA 3Q41A 4NC9A 4RZUA 4ZPJA 1QV7A 2FN3A 5B1SA 2G4CA 4PR3A 3K1JA 1U6JA 1OX4A 2PY6A 4HSGA 1JHUA 5FL7A 4L57A 1RFYA 2PE5A 4LRXA 5EEHA 3TKLA 5BYBA 2DTDA 3IV7A 2CXPA 3IMEA 4M6WA 4L8JA 1A69A 1SJ9A 2QHXA 5JCPA 4BV9A 1B04A 4C3VA 1XPRA 4Q9DA 2E76B 3UIEA 4RKRA 1IZ8A 2W4QA 1XRGA 1O7JA 1NJ1A 2RK3A 4EAQA 1CY0A 4C0KA 1KAQA 2W6JD 1I1NA 4EABA 1SQ5A 5JAPA 4MV8A 4L73A 1HE5A 1DAIA 3P9SA 5JEEA 2RIRA 1YCIA 3T9BA 1FNBA 3BTOA 3IUYA 1NRJB 2EILB 4TWKA 1QIMA 2WLIB 3HHEA 4LCBA 2QX6A 4BQOA 2ZKLA 4G0QA 1P1HA 1SRRA 4R2LA 4LMRA 3AR4A 1BDHA 4OQPA 1J5EO 3PVSA 2OK7A 2BHTA 2QX8A 3ITNA 4CL8A 3Q4HB 1DUIA 2O7SA 4F9FA 4PIMA 1C29B 4NJEA 3KDAA 3OQOA 5BVGB 3B70A 3ENZA 1ZNQO 4CCYB 3IHWA 3LDTA 4W63A 3G2PA 2VWGA 4XDJA 1ENVA 1SUSA 1PP4A 3VPBA 2J3LA 1HDXA 3H9CA 3UENA 4Q00A 2XZLA 1WA8A 3V8RA 3H75A 2VUTA 4GBJA 4OP2A 4TLAA 2V3VA 1LSOA 5I4BA 4DT1B 3TXYA 4G8JA 2PTMA 5FH9A 3U26A 3ORSA 4JROA 2IITA 3DLIA 3GX1A 4D92A 3CXUA 1JX9A 1N2CE 2R6HA 4U7FA 1XT6A 4PX3A 3PEWA 1QFYA 2BMAA 3NHUA 4XWWA 2W71A 2BI4A 3NXSA 1D7AA 4ML3A 2GN0A 1TTQB 2XXAA 4Y2HA 1F3OA 1VIDA 2ROQA 4PWYA 1GGVA 1W55A 4OHCA 2HPZA 4H6VA 1L7DA 1AUXA 3PC7A 3UO3A 1FTYA 2HMAA 1YE3A 3JQ7B 3CX6A 3D6HA 1CQZA 1UPUA 3H1IH 1RJGA 2EEPA 1UMBA 3K72B 2EU8A 2YC2C 2XOEA 4JC8A 1YRAA 4G81A 4FX5A 2LCQA 2IOFA 2QV0A 1CB0A 4MI9A 3TK1A 1PD0A 3GFFA 2H1WA 3ETEA 5DLPA 4M1QA 2HK6A 4DMLA 1FYDA 5IT9N 4DRXB 1GAEO 2O8DB 1SDSA 2DSNA 5DVZA 1FRVA 2WSSD 5K09A 5FLXA 5LOVA 3T4EA 3PIRA 5IK2D 1CNFA 5DMXA 4WN9B 1N33O 2FE4A 3K0FB 2XUDA 1EAYA 3Q7TA 4AF6A 1V5FA 5TLSA 5C7YA 3JQ9C 4YRTA 2MQEA 2XGSA 3ZY5A 1RI1A 4JP5A 4BGEA 2I6DA 4UCXA 4LFBO 2IUTA 3AIMA 1GL7A 3CT4A 4KUEA 2C4KA 1SZJG 2SHKA 1NVFA 2NUPA 2ZAMA 3DZHA 1P0PA 4CDGA 4XDZA 5C5EA 2I6SA 3V4DA 2ZJOA 4GWGA 2LCFA 3UT5B 1G18A 3AM3A 4OU5A 4NMMA 3WGMA 2WRZA 3ASOC 2E55A 2AF3C 2QT0A 3C8MA 4LJ6A 3AK2A 1ZK3A 1FUKA 1QH8B 3EIXA 4MXDA 3TEFA 1P17A 3DZJA 2GASA 2X5OA 2P3QA 2UYQA 1H6DA 1ZK4A 1SVNA 3UMMA 3W05A 1Y7HA 1YB4A 3CKLA 2Q3DA 2CNWA 2J3QA 5AUPB 2RHCA 2GJ4A 2ZR0A 4PEVA 4JR0A 3K06A 3EVBA 3KUXA 1KQGA 4DDWA 3ZKAA 4YCAA 1V54B 2ZRAA 1NLUA 4XQ9A 3WWPA 1FUEA 4A92A 3T3PB 1FXWF 1RRMA 2VDRB 3GV0A 3EAQA 4DS3A 2YC0A 1FFGA 3RIHA 3MERA 1GTJ1 3LY5A 5E4YA 1EHYA 1U96A 3ZI7A 3UG7A 3DLHA 1JA0A 2X9LA 5LQRA 2XCRB 4RKQA 1Y1QA 2VDLB 3I8OA 2GAIA 4JB3A 1HYQA 4LBYA 1IDSA 1Z2EA 1P7BA 3CR3C 4OA8A 5SZKB 5F7XA 1R0KA 4C0BA 2A6PA 2W5UA 1GM7A 5K51A 4KR3A 1XB2A 3HYLA 3T95A 3UAZA 4C4PA 3WRXA 4GKKB 3EGWA 1PFUA 2GD6A 2H9YA 4K6CA 2N04A 3FWKA 4WESB 2A79B 1C9DB 1A8HA 4DV0B 3FR8A 1YQWA 5DCYA 2MWMA 1A9RA 4F91B 5FEUA 2CJWB 3ICEA 4L51A 1XCOA 4OATA 3LDGA 1OR8A 1JBKA 2PX5A 4DA4A 2B35A 4EYGA 3TLBA 1WO8A 1H69A 3G5LA 3R3JA 1KZ7B 5GY7A 2GN6A 1S1MA 3IVAA 5KPDA 5IVPA 3CMAV 1CUSA 1I51A 4XYEA 3AG7A 4I1YA 2VJQA 5IZ4A 1FLDA 3T38A 3LWBA 3VPDA 2YW9A 5H81A 1WDMA 2X0NA 3EYWA 3DOCA 4ZKEA 4OQFA 4U7WA 3NBYC 2NTYC 2OAGA 2UVQA 1QWSA 2P6MA 2CXUA 1GO2A 4RULA 1SKQA 3DF7A 2WNIA 1GTL1 2OV4A 4N49A 3RC8A 3AHGA 2OHGA 4KG7A 1V1RB 5A4AA 3NNDA 4ZVMA 1IBCA 1C4KA 4AJNA 4MCJA 3U5TA 2I6UA 1UFYA 1V3UA 2GNOA 4RLQA 1YMQA 4TKUA 1QDLB 2PBZA 1V37A 1J25A 3OF3A 2QLBA 2VJAA 1BMFD 4N0QA 5EXSA 4MPPA 3PA8A 4INZA 4KQEA 3KKMA 1JLLA 3MVEA 2W2OA 3DZIA 2M6YA 4RFVA 4HAIA 1TD1A 4XQEA 1ID8A 2JCXA 1U02A 5LQNA 4WOKA 4ZARA 4RSRA 1WBDA 3Q7SA 5ED0A 3SBEA 4YIHA 2IAFA 3FYHA 3O4GA 3LOQA 1Z7GA 1WCXA 2Q5FA 3C6ZA 1KQFA 1BCSA 4BAZA 1KFBB 4HJRA 5KX5F 5TGZA 5AVYA 1NW3A 4RVUA 3IC5A 4QDJA 2HIHA 3AXTA 1XNHA 4BECA 2X1LA 4PSUA 4ZGWA 1HT0A 2QW1A 2I87A 3DV0A 4GLXA 4W5TA 4JF3A 2IUSA 2NIPA 2DTEA 1XOUA 2X1HA 3WE7A 1CS0A 1G17A 4LHSA 4CI0B 4QT0A 2GEVA 1ROPA 4R31A 1IURA 1G1XB 1PZMA 1J97A 3LGXA 1LGYA 3N07A 5IDQA 5H9CA 4E15A 4IDQA 4FB4A 2Z95A 3IDSA 4AZ0A 5IYCO 2KTUA 3CX5F 1TEXA 3DSQA 1W34A 1RZRA 3CH6A 5C4IA 2EW2A 1V7PC 3K5OA 1O5TA 1Y3FE 4J9ZB 1W4ZA 3R2JA 2NQ8A 3RC3A 3KVNA 4JSRA 1KP3A 3R7DA 2ZGVA 1ZI6A 3BRWA 4G23A 5BSGA 2ZRPA 4RDIA 1HLFA 2CY0A 4NL4H 4C0WA 2OC4A 4K2HA 4YROA 3NVDA 4J0QA 1QP8A 1ARZA 3P96A 3J7AU 1H6BA 3MNFA 2XQVA 3NFRA 1VQLV 2QQEA 4DXDA 2DT5A 3AI3A 4ARCA 3RRXA 2WLHA 3IQFA 2OTCA 4RBNA 2B36A 2FMFA 4ZRMA 2HHAA 3EPRA 4LY0A 5E7MA 5D3ZA 3SM3A 3JD0A 2X5XA 2O8BA 2C8LA 3MCQA 4BKPA 2GPJA 1ZGCA 4B8YA 4FEYA 3DV9A 2DWCA 3OFJA 3P9RA 2VAPA 1QR2A 3QUAA 3UWOA 2XTZA 4QL3A 2Q0XA 1WUTA 3DA8A 3I72A 1FU7A 2PJZA 5FWYB 2D59A 1E2IA 1HEYA 5EJIA 3TMYA 4JZGA 3E8MA 4G5SA 1TTTA 4M21A 3FYUC 4B6FA 2W6NA 4C6RA 1NVVR 1QG0A 1JA8A 4Q4DA 1YHYA 3V4SA 2Y0CA 1V1MA 4RD4A 3OJFA 3UICA 3AB3A 4JA0A 5HP7A 4V0RA 1AIPA 4EG6A 2YYYA 1KNQA 3WJRA 4HZGA 2J67A 5K7SA 1OTYA 2DN9A 2JVDA 1MB4A 2K9PA 4DG8A 4IICA 1DQNA 2D7DA 1MX9A 5H6RA 4DSTA 1FCJA 4JXZA 4HL6A 4EJ2A 1JMYA 2NO7A 2NU7A 4OAQA 2ZI6A 2VDKB 3OU2A 5IRCD 4K40A 1Y9ZA 1SEPA 4EKWA 2X3FA 1KZ4A 1XKTA 2OIEA 1NG9A 1EE2A 4TOIA 1WB7A 1IXKA 2UVPA 1A7JA 1L6RA 3VPAA 3LH5A 1Z06A 4B46A 3GFVA 4K0RA 1VKOA 4TV9F 1KOJA 4IVPA 3I56F 4IIUA 2Z1DA 4U4AA 2WU3A 2Y69C 3SMQA 4M4SA 4CH5A 5GIPC 1WXHA 3R24A 3UW3A 2Q69A 1ILWA 2O2IA 3K0EA 4JVMA 4Z1MG 3VKGA 5AVJA 3KWFA 3SICE 2ZJ2A 3KZVA 3I01M 3W2HA 2OHIA 2QLLA 3N0VA 4FFKA 1U2ZA 1E79D 3ZNOA 3T61A 4PZPA 3R8XA 3MTEA 2FTKA 3F0DA 5CDGA 1I94B 4OUDA 5J40A 2O0LA 1YR7A 4TTJA 4QREA 2GAAA 1VYTA 3ASVA 5TPWB 3GC6A 2QN7A 2VJLA 4OM7A 1GYQA 1SFRA 3OY2A 4PX5A 2XRFA 4AYTA 1Q20A 3B82A 5JVDA 2KPOA 1N8RW 3KV1A 4UUAA 4ZMBA 3PHLA 5B1IA 3C7CB 1R0CA 3CFYA 2M6KA 1AUQA 5C1BA 1KPGA 2A0YA 2P67A 2X7RB 5JANA 3PB3A 4D4LA 1Y82A 3CC7V 1T29A 2VNAA 1RM1B 2GUGA 4RH0A 3EARA 3IBFA 2NG1A 3WMFA 3CCRF 1R0ZA 3WL8A 2QTHA 3LYUA 3VPCA 1OBVA 5FNVA 1DO0A 5KJ6A 1R9GA 1RM5A 4IZOA 2AC7A 2FW9A 4IGEA 1MZPA 2OC9A 4ZEXA 1RP3B 4X7BA 4IOJA 4ZO7A 1P1BA 1XNRB 4O2AB 5FJIA 1AZWA 5BYJA 1O54A 3S2YA 2BF4A 1O96A 2RHRA 1OU0A 3MSCA 2NN4A 3V4RA 2Z8ZA 3V2GA 2YMPA 3ICWA 4YRLA 4DDMA 5FLXN 1L4GA 4CIVA 2ZTMA 1D1TA 4C9BA 2O6LA 3U7QB 2WF7A 2EL9A 2C54A 3PNLA 3NB0A 4PNEA 2R1VB 4E12A 1RNLA 1PL8A 2V6IA 1PZGA 1RYEA 2OESA 3MB5A 2PYJA 1AUPA 2CHFA 2IJGX 1CUUA 3WK5A 1AGYA 1JJ7A 3G88A 2XA9A 2I1VB 4RA9B 1AHIA 1FJGB 4CWAA 1LNQA 1BEZA 4XR4A 4AY3A 2ZT9B 3AUFA 3ML0A 3CURA 5GIPE 1YRQA 3PCXA 5I45A 5TB5A 6PFKA 5FPTA 3GCZA 4CTJA 3HUDA 4P58A 3FSJX 3CVUA 3FX7A 4LX8A 2CXRA 4EB6A 3BX1A 1XWWA 2R70A 1MO5A 2BEUA 1YASA 4OIMA 1PZNA 1H38A 4YRPA 3AQ4A 5IVDA 4K9MA 1QR8A 4H13B 4RVSA 3DLCA 1YJ9V 3AEQB 2YV2A 1LPOA 5EQJB 1G6Q1 1NOIA 4RY8A 3KKOA 4R9UC 2GILA 1NYQA 4R8RA 3EZ6A 4IXDA 4MUFA 1T2DA 1G6HA 4WK0B 4MQMA 2CV2A 2NV0A 3KJIA 4C04A 1NV9A 1E6CA 5HCNA 2JGMA 1JZQA 1B8NA 4PGHA 4US1R 4A3SA 2VH5R 1NTRA 1HKUA 1WAMA 5GOZA 3BFKA 1U8AA 2J1LA 1K75A 3UJBA 2Z8YM 3H1AA 4PO8A 2AB0A 4S1PA 5FTWA 4IINA 2H4YA 1J23A 2GK7A 3RTGA 3ZLUA 2KJQA 4JI7O 4DO2A 3O91A 2WSSA 2A5LA 4UZEA 1M1YA 1JUDA 4JBNA 3CWBH 5FT9A 3WBFA 3DT6A 3R7WB 5EWRA 5DSXA 3PJDA 5F73A 2HKIA 3E2MA 4JIGA 4CQMB 2VTBA 4R2IA 2YOHA 1SKBA 1HORA 3T8YA 5B1NA 1MOFA 2B21A 5CBPB 4MRMA 3BQMB 3FLBA 5FI3A 2FZWA 4IVNA 2VJBA 2YDXA 3LP8A 3WK7A 4AICA 3LMKA 2FG6C 1T1JA 3F5MA 1QNFA 3AG1B 3KT6A 4YY3B 2YZ7A 1R6BX 1JLRA 4P3KA 1IQPA 3BGVA 4H18A 3P0FA 4J7XA 2NT3A 3M82A 1SAYA 4BKRA 4UAUA 4YCLA 3DAGA 1GG5A 4Y1FA 2F23A 3BY6A 1FYEA 3E1GA 2PD4A 3IAHA 2VFAA 1GTG1 3THRA 4MHTA 1IK4A 2VWHA 2FPIB 3LUDA 3EMBA 521PA 2VJNA 1EM6A 1R0YA 1NXTA 1I6WA 4ZZ0A 1RMYA 2YVUA 2ZM6B 5A4IS 4KE8A 4MW0A 3KB8A 1DXYA 4O0MA 4PZCA 3KEOA 5A05A 3TAUA 1UK9A 3BSYA 4U2BA 4FYXA 3S1LA 4R9VA 1PUXA 4WJLA 4L4RA 2FN7A 4DGQA 1RFLA 5BSEA 2BJVA 3IQZA 3MOGA 1DRJA 2X2PA 2IF0A 4MPTA 4XWKA 3D36C 1XPUA 3OU6A 4UCQA 2PZEA 2C96A 2WNSA 4KFMA 3RVLA 4HD8A 3CLRC 4IJMA 3MJEA 4NV0A 2R7NA 3JQRA 4KN6A 1WUYA 3F6EX 3BGOS 3SJZA 1RXYA 4WLEA 3BXHA 3Q0EA 1WZEA 2V03A 2BPOA 2J3IA 2F62A 5IM5A 3OQHA 1YAJA 4FDAA 3PCTA 2X8LA 4WACA 1DT3A 5HSGA 4DFDA 1J8VA 1Q6ZA 2ZSIA 2VXCA 1FQKA 2FPUA 5FUXA 4WEQA 1P80A 4KIGA 3SPHA 2O14A 5CA0F 2ACKA 4K3VA 4GL4A 3W7XA 5C7LO 3SQXA 3J81M 1ODTC 2CFIA 2MSEB 4RV9A 5FR2A 2IEZA 2A06H 2MTBA 3LXUX 3VH2A 5GV8A 1IN5A 1IZ9A 4LJAA 1M8GA 2HU7A 4LJ5A 3ACDA 1VQMV 5EMKA 3E83A 1JJAA 1W5AA