3E22B

Tubulin-colchicine-soblidotin: stathmin-like domain complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1C chain
publication title Structural insight into the inhibition of tubulin by vinca domain peptide ligands
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 110
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3e22B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3e22B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3e22B01
4DRXB 1JFFA 1RQ2A 5J2UA 1W5BA 3VPAA 1SA0B 1SA0A 4YJ2B 3RYFB 4F6RB 5LP6B 3RYFA 5LP6A 4YJ2A 3VO9A 5LA6A 1RQ7A 4E6EA 5EYPB 5FNVA 5EYPA 4O2BB 3WGLA 4O2BA 1Z5WA 4X1YA 3N2KB 3WGMA 3N2KA 3JAKB 3JAKA 3HKEB 4TV8B 3VOAA 3HKEA 4TV8A 5C8YA 3HKBA 4WBNB 4ZOLB 5IJ9B 5IJ9A 5LXTB 2BTQB 3WGNA 5IYZB 2BTQA 1TUBB 5IYZA 5LXTA 1TUBA 3RB8A 4EI7A 1Z5VA 4IIJB 4IIJA 1JFFB 5LOVB 3ZIDA 5LOVA 2RHOA 1RLUA 5J2UB 5JH7B 4I55B 5JH7A 4I55A 3WGJA 3M8KA 3HKCB 5MN5A 3HKCA 4I50B 4I50A 5J2TB 4EB6B 5J2TA 4EB6A 5JQGA 4O4LB 5FNVB 5KMGB 4O4LA 3HKDB 5KMGA 3HKDA 4X1YB 5JVDA 1W5EA 2Q1XA 4B46A 5BMVA 3HKBB 5EIBD 5C8YB 3M89A 3V3TA 4DXDA 2VAMA 1FFXB 1FFXA 2VAPA 5EZYB 3ZBQA 5EZYA 4B45A 4EI8A 3RYHB 3RYHA 3JAWB 4ZI7B 5JCOC 3JAWA 4ZI7A 2GVIA 2Q1YA 4FFBB 3JATB 4HNAB 4FFBA 3CB2A 3JATA 3JALB 4HNAA 3VO8A 3JALA 2RHHA 3VOBA 5GONA 1W5FA 5LP6C 4I4TB 4LNUA 4I4TA 4U39A 5JQGB 1FSZA 4IHJB 4IHJA 4YJ3B 5CA1A 4YJ3A 5JVDB 3RYCB 3RYCA 4TUYB 4TUYA 2RHLA 3JARB 3JASB 3JARA 3JASA 5BMVB 2R6R1 5MN4A 2XKBA 5CB4A 3UT5B 3UT5A 4M8IA 2R751 4TV9B 4ZHQB 3E22A 4TV9A 4X1IB 4X1IA 4ZHQA 1TVKA 5KX5A 2VXYA 3WGKA 4XCQA 4DRXA 3C8LA 2RHJA 5EIBC 3N2GB 5LYJB 2BTOA 3N2GA 5LYJA 1W581 4O2AB 4O2AA 5MN6A 4F6RA 2VAWA 3R4VA 4EI9A 4O4HB 4O4HA 5GONB 1W59A 5M7EA 5CA0B 2XKAA 5CA0A 3RYIB 1W5AA 3RYIA 4LNUB 4X1KB 4X20B 4X20A 4X1KA 5CA1B 4WBNA 5ITZB 4O4JB 4O4IB 4U3JB 4O4JA 4O4IA 4U3JA 4ZOLA 5IJ0B 5ITZA 1OFUA 5IJ0A 3ZBPA 5CB4B 4KWEA 5KX5B 3E22B 5LA6B 1TVKB 5JCOA
chains in the Genus database with same CATH superfamily
4LH7A 3I45A 2BVNA 5K99A 1SCQA 3HCFA 3DMFA 4EMBA 1AGRA 2EZ8A 3LFOA 1ML3A 2HA2A 2IYVA 2M6SA 3LUPA 2V7UA 2PANA 2ZCVA 3TW4A 5KLVH 1G64A 2IGBA 2IH2A 3F5TA 4WACA 5J2UB 1YL6A 4P54A 4YP1A 5DNVA 3TXQA 3J7AC 1ZSYA 2PA3A 2G80A 4PLVA 1VLHA 4UAUA 1MVLA 4E51A 4CF3A 2BFBA 5G0TA 3HRIA 2A9VA 4OI4A 2XRFA 3GOQA 1BKSB 3HS3A 2BZ1A 4V03A 1JNXX 3L07A 3DMTC 4DWOA 5COAA 1NN3A 4PAOA 2KI5A 3F0DA 3R0QA 3UB4A 5JCXA 5GZ6A 4ZCPA 3EVNA 4LJKA 1CDDA 3HL4A 4FCWA 1HR0B 4LE2A 3ZWBA 2X0RA 4AY2A 4QUKA 1W46A 1UZMA 2AJBA 3ME5A 1F06A 1UF9A 3UXEA 1AKNA 2VPWA 4FGLA 1GAEO 1N7IA 4UCOA 1QAMA 4U7HA 3I9OA 3CUTA 1JHZA 4DYDA 4P4SB 1BS3A 5AHXA 2D1QA 2AQKA 3C7CB 3HB1A 1RQNA 5DTQA 3UUFA 2ZBQA 3M4NA 2C5FA 2UYQA 1BHJA 1N2CA 5J43A 1S9HA 5K3FB 5CX4A 5FUYA 1XDUA 5FBHA 4CM9A 1XYYA 2UYPA 5ALJA 3ERCA 5CRIA 1PJZA 13PKA 4I5DA 3SPCA 4PZUA 2GTPA 3KCQA 1UFQA 3S1LA 2BFPA 2L69A 2C03A 1PT6A 2M7WA 2XE8A 3SNKA 2ABWA 3VYTB 1Q0PA 4QO8A 4OGFA 3VZQA 4MGYR 3GMIA 1K6EA 1W36B 3ABLB 2KTUA 2GI4A 5M29A 2O07A 3NAZA 1NUUA 3BZBA 1RWPA 4BCCA 2FN4A 2C5LA 1ZNZA 5KQRA 4IYJA 1K8QA 3OR6C 1P9RA 2X8LA 2W2TA 1J8FA 4ZT6A 3FKJA 4DRZA 2H0QA 3FUUA 2JGIA 1PS9A 5J4KA 1XZGA 4WEOA 2HLHA 5IE9A 1IWBB 1X1QA 2I4TA 4D3ZA 2D1TA 5CFMA 1V8OA 1XZNA 1EB8A 4ZMBA 3DFIA 4B44A 3QJ5A 3ITKA 2Q9BA 4G4YA 4KNWA 2J45A 4IILA 2F43B 2JIRA 2QG6A 3FOAA 3DDCA 8AT1A 5CCBA 1MRSA 4X0EA 4KTVE 4EA6A 3MVEA 1XO1A 4ZHYB 1P44A 2JD0A 3CC8A 3I56V 4JASB 2QKAA 3A9VA 3PFFA 1OX5A 2X8JA 1Z37A 1SXJA 5DKFA 3QUSA 4ZHQF 3L7YA 1TCAA 4X9XA 2AHZA 2C8VA 2BTQA 1AN0A 4GXRA 2IY8A 1R15A 2XPCA 2DR2A 3ETNA 3VR6A 4IDBA 1ULBA 1Y74A 3ACCA 4WZ6A 4R7ZA 1QDUA 1XK6A 5BR4A 2FPPA 3HB5X 1CS0B 1RYMA 4FEEA 1M56C 3P3NA 4G89A 1AUXA 3ZIAG 2W4MA 3ZV5A 1F60A 1BQ0A 3FPGA 4TWJA 3P0FA 4LQLA 1UKVY 3UJ3X 3R74A 4QTYA 5IY5B 4DV2O 3ZVMA 4AI8A 1FIUA 1FJHA 2WJ4A 3KSZO 3MELA 3AUFA 2C31A 4EUEA 2PX4A 1QVGF 3PNOA 4PX9A 3IAS6 4DA4A 2IT1A 3N6VA 3X1DA 2NUAA 1FLDA 3CRAA 1O87A 2VT7A 3KQWA 5LP6B 3KSRA 1NF8A 2GRUA 4P82A 3NHKA 4LJ8A 2Y4NA 3T5DA 4WFAV 2AV6A 3TOVA 3DZGA 2P67A 1NZFA 1OD6A 2QQFA 4MVJH 3D6FA 3WYCA 5AM5A 3VU3A 4U2CA 3ZN1A 3A0UA 1EM8B 4HTAA 2GAJA 3CZAA 2WHEA 4M86A 4BKRA 4B7EA 3ESQA 2FW8A 4M8KA 1I10A 1R4MA 3CURA 2ILTA 3GGDA 3ZWPA 2V03A 1ZX1A 2JHCA 4S1NA 2O2JA 4FMCB 4C4TA 2AGVA 4ZRDA 1E9CA 3M4SA 4TKUB 3SF0A 3COSA 3WRWA 1OFGA 1CJVC 4MRMA 1G0NA 2Q9AA 3ASVA 4RUEA 3RFVA 4FVTA 3TZQA 4REOA 2WVJA 2HLPA 3FI9A 4HNHA 5EEGA 2Q1UA 1F23A 2BKUA 2GASA 2J9ZB 5B6JA 2QVLA 5FTWA 4YR7A 2VDWB 2H7CA 1YCFA 1YI8A 2DFNA 3UV7A 3RRXA 1C14A 5HGXA 1KYTA 2V98A 1J0BA 2OKGA 1N2HA 2VJDA 4H7EA 2ZT5A 1E2EA 4Y2TA 2GXQA 5AVRA 2YINC 1CEZA 3BDIA 3RABA 1V41E 1TCVA 3MTJA 3FOZA 1KO8A 5H9CA 3HBMA 2UVDA 4QSHA 1J9ZA 3SIPA 5JAQA 1EE9A 4RW0A 1TYAE 2C1EA 4WH0A 2ZRFA 4LF7B 1AU9A 3RSGA 4A6PA 5CGQB 3EVAA 1MSWD 3GFQA 1M7HA 1XDDA 4NZ9A 5ESRA 3RC8A 3RYTC 4EYEA 3VYRB 2VBFA 1C1XB 4BHTA 1TRKA 3PIIA 3TKAA 1S77D 4KSCA 2A14A 3K0TA 1MTOA 4US2R 1SR8A 5C8VA 3HO1A 3AM1A 4NTZA 1QYXA 2HNAA 1P75A 3GA0A 1TRHA 3MMSA 3I55V 2O2ZA 3QMMA 5HE9A 5BRNA 3KPJA 5LD2C 3MDSA 2BAGA 1YE5A 5G3YA 3K70B 2HHCA 5CFPA 2UYJA 3K15A 3D8RA 2C98A 4NPCA 2NYUA 4Q3LA 2WJAA 5EMHA 4X65O 5MDHA 2GQ0A 1KB9F 3SR2C 8ABPA 3V2HA 5GONF 4JB8A 2OY0A 1HTWA 4LJ5A 1FSPA 4B08A 2H4JA 5COBA 4C3OB 2H1OA 5BN3B 2Q6OA 4HF7A 2XMCA 2ZQMA 3EXAA 2BY4A 4EAQA 2CMHA 2ONZA 3D54A 3W2EA 4DA7A 1IZZA 1XQ6A 1Z2CA 1Y66A 5EE5B 1DB3A 1VQNV 1MX9A 4B8WA 4MVMA 3E2MA 2XHZA 3QGMA 1N0JA 2CB9A 4FLVA 1VZ3A 2H1WA 5DHPA 3QTCA 5AVWA 4OA5A 4LBZA 2OBYA 4I4LA 4X3OA 4KFUA 3WB9A 3ZXXA 5CUQA 1N9GB 3AI7A 4KBFA 3HCCA 4AILC 2DFTA 1NN5A 3GR6A 2A59A 2FN7A 2F8MA 4W1RA 4HGZA 1ND6A 4OI0A 2HMWA 3F0TA 1A4IA 4GKJB 1BSMA 4BQNA 2A0LA 4M22A 1F6DA 1DBWA 5ALHA 5HY0A 1SQ6A 5DHSA 2LXNA 3UJ9A 1OGIA 1P0FA 1CP9A 3BHPA 5GIOE 3KUCA 3O90A 2P41A 4UE2A 3BDVA 2FZCA 4CMIA 4IV5A 1UFIA 2H1LA 4I55A 4OX9O 2X0NA 1BWQA 1WP9A 4FLFA 2H2HA 4CZZA 4ESHA 3KLNA 2XDWA 1CYDA 3BQ9A 1ZHFA 1RE1A 2W9XA 3FZGA 2HFKA 3IV9A 4ODIA 1KARA 3O91A 3WYNA 3SVZA 1O95C 5JAMA 4RAQA 2B36A 4JI8O 2HWUA 3F6PA 4NHEA 1Z06A 3CCFA 4KUEA 3WL7A 1QIFA 2BHTA 1VHLA 9LDBA 2H4WA 3DYIA 2WQ6A 2CN1A 2NUTB 5H80A 2GF2A 3ILYA 4YMGA 5KHLB 5JXWA 1QH0A 3MEQA 2O8FB 4TTSA 1OCRB 4JQZA 3SJQC 1VE7A 1TM4E 2IH1C 4Q7JB 2HVKC 1R6NA 2PX3A 3MBOA 1IJEA 4LC9A 2FEKA 1TTPB 5IKEA 1Z4PX 2IXFA 2J07A 3OEYA 2KX7A 1S3SA 1QGUA 4RTLA 3OPYA 1CP2A 3UW1A 3N2IA 4S2EA 3GVMA 5EBLC 1XJWA 2CGOA 3OZEA 3MCAA 1CUGA 2Q62A 5TVGA 4D43A 1HNXB 2BGIA 2WHQA 1UZAA 4L5JA 1H8HA 3ICXA 3NORA 3G2HA 4B3SB 4JOSA 4WIAA 2J8ZA 4L6IA 4C6HA 4IJKA 2N74A 2F64A 4F72A 4BKQA 2NP6A 1UJCA 1GZ4A 2DFVA 3N2GB 5ABPA 1P2TA 5LP1A 1D09A 3WSWA 1W5AA 1M66A 2P06A 4RZ3A 5K1ZA 1LDEA 1SZDA 2F3TA 2QR3A 4IMIB 2QE7A 2H08A 4AQ7A 5EXTA 3TPZA 3B2EA 2NYVA 1V43A 4Y18A 1RP7A 3VQWA 2D6FA 2H8CA 2JAQA 4U2DA 3H2ZA 2WSMA 4MP3A 4U9IS 4QNHB 1LUVA 2AD1A 5ILGA 5DWVA 3HA3A 3NHYA 4CI9A 4EI7A 3EISA 5LQSA 1ZBDA 1X52A 2IEZA 5HTOA 1KO1A 1V54C 1QHHB 2AXPA 2W7TA 2WUFA 4TX1A 4JENA 1PNMA 2EHDA 3GHHA 5ES3A 1SZXA 1D04A 1AROP 2XR1A 5I48A 3B89A 1TYDE 5AXDA 1LSJA 3V1TC 1GO3F 4K40A 2CHSA 1HKHA 4U2EA 4A0SA 3N2NA 4FWIB 1QYCA 1IC6A 1SHZA 5BRJA 3CYPB 2EKZA 1OIXA 1GSHA 5LCXA 1NH2D 4DJAA 1P6QA 2C2OA 1W1UA 1ZL8A 3ITEA 1ZJ4A 2OQ2A 5CNIA 5AK5A 5LA6B 2V8BA 4CIBA 1YS6A 5B1NA 3MAJA 1NF9A 1GAJA 1ZZEA 3L0PA 1VPDA 4NKRA 1XA3A 3U49A 1GU0A 3Q12A 1JLRA 1EK1A 2YS7A 1CDZA 1KECA 1JCHA 3D3WB 1NMEA 1A5SB 1Y67A 1TKBA 4AU1A 4ZZIA 3R9IA 2G25A 2E7ZA 3KS9A 2HSGA 2NTVA 1TMKA 4GMKA 1OFTA 2LIVA 5TNXA 4IX9A 2BBSA 5I4CA 3OFND 2CZQA 4FLTA 3A0RA 3JQGA 1M34B 1QYRA 4GMXA 1MG5A 4E30A 4PTLA 4HJRA 1SQ0A 2JIZA 1VYUA 2AOUB 2IGTA 1LPBB 2FG7C 4K9SA 4M1OA 4ZYVA 1ORIA 3C70A 5AH0A 2PCLA 1KJJA 5GWXA 2IYOA 5J23A 2DECA 3L9DA 1EQAA 2WK1A 3A4VA 4YCMA 3LGSA 4EJSC 4DXWA 4X64B 5ALXA 1ISFA 1ETUA 4K9QA 3AKDA 3U4IA 3A11A 5FTNA 4LVUA 4HZGA 2AJTA 2WU8A 3L0BA 4FDMA 4PO3X 5TPZA 2LW7A 1J7HA 2ZROA 1P0IA 2WE8A 1DMSA 3FYUB 2AT1A 4I46A 2VSYA 2WOJA 5TGDA 2BELA 1A8IA 3ZMZA 1YCIA 3AVVA 3RODA 4KIWA 3LIPA 1NNI1 3WXBA 1NE7A 1MBZA 1WUJS 2WKQA 2VIIA 1Q0RA 2OG2A 4PICA 2GS9A 2FSFA 4BNZA 5IDQA 2XDAA 4N01A 3EGVA 1FTGA 3K3PA 4MPTA 4Q9IA 3IB3A 2E85A 1VBFA 1VFNA 3H16A 4J1QA 4O2AB 1SG6A 2ZXEA 4ZK7A 3B77A 4CKWA 2AZXA 1HE1C 1HH4A 1PBNA 4YCAA 1UDCA 1H6DA 1YZTA 5LKAA 3QKRA 4A1OA 1I94O 1IBRA 2XEXA 3BSWA 1DX4A 4D0NA 1H2RS 1J09A 5DEOA 5K8IA 2Q3BA 2XCUA 3UJHA 2ETXA 2FVYA 1U0HC 2FH5B 4HYQA 4L7QA 1YVPA 3PT9A 2H9IA 5CVDA 5E6SB 4FS8A 2IS6A 2DTXA 5CT8A 2X7RB 4UBKA 4X93A 3NHZA 1P45A 2CHVA 4PXSA 1TU0A 3JSNA 1G2QA 3MJ4A 1PL7A 3AHIA 4XH9B 4YAUA 1VI6A 5JBIA 3LWVC 2IC5A 4QXRA 2ZG6A 3FSJX 3VYTC 4F5YA 1OZGA 4DV1B 1TFUA 3SVLA 3ZH2A 4KYTA 1W36C 3ABLC 1B2LA 1KAMA 2JH9A 4HQFA 4Q4AB 4CZ2A 2I7CA 2KQXA 1ZUIA 4LAFA 4KAXA 2X2PA 3D2BA 4OREX 3B7PA 3ZE2B 4ALKA 1Q2UA 1PF5A 2EBUA 3FPAA 3C6KA 2JLBA 5FYQA 4DUZO 4ZO7A 3GC6A 2EWCA 1XV5A 3PE6A 1MCZA 1GYRA 1RP1A 3K6SA 3DOFA 5HSGA 4GXQA 1G1MA 1U2QA 1DEXA 3NLLA 3OH8A 2C94A 2I66A 3HNRA 1GNTA 2Q99A 4J10A 1FAFA 1RI3A 3TW0A 2XUZA 5IC5A 5F9HA 1E5TA 1RWOA 2ZR8A 1JKXA 4IG4A 3MUNA 2YMMA 1V0JA 2A9KA 3AHFA 2JARA 4B7XA 3HXLA 3C5WP 4B45A 3U11A 5FUBA 3QBJA 3OONA 4I1PA 4OU5A 4O1IA 1HG0A 1FLNA 4CIAA 1LLFA 3WDMA 2Z1MA 1U99A 3PFGA 1QVGU 1OKKA 4BTVA 5DTEA 4UCFA 1JQ0A 2HLDA 2I3AA 3MZ0A 2RAPA 1AURA 4JIMA 3KLOA 3BIFA 3WNDA 1IN5A 1P49A 3FF1A 5C7LO 1TJNA 5EQFA 4TYWA 2RGNC 2OAQ1 2PX8A 4KE6A 2P9ZA 3PUXA 3UV3A 3DYBA 1N36B 4ILEA 3HXTA 1E8MA 2QQ0A 1PG2A 1VQ6F 4D0RA 3PRKE 3ENVA 2P2NA 3P71T 3RVLA 4A0RA 5IY5C 5JLJA 4QE7A 2YWJA 1EH5A 3Q88A 1Z25A 5KTRA 4XGKA 1ZCZA 1L4NA 2VBCA 1VQ5F 1GQOA 3DD1A 1YJ9V 4X91A 1K6MA 5B7PA 2Z2JA 4I9WA 4KHPB 4OHPA 5LZ7A 2WIBA 3URKA 2PD4A 4KLCA 3F6RA 1Q7GA 4UD6A 3BG5A 4KQ9A 3WA7A 1ZSVA 4M1SA 3E8BA 5LMNB 2TYSB 5LP6C 2XD9A 3W90A 3U17A 3OTFA 3ZTYA 1BMFA 1W87A 2BCCH 1FQJA 2UUOA 4K9PA 2RGBA 4PLHA 3HPLC 4PSAA 3A6JA 2PRIA 1VQ4F 1WA5A 3RYIA 3KPWA 1NN0A 5F1YA 3U4QA 2Z5FA 5HW0A 2Q50A 4V02A 1M1ZA 3KLMX 5AJZA 1SCDA 1G7CA 3I30X 3ROXA 3OLYA 2Q28A 5HK9A 4BT5A 1N2CE 5AW5A 3RU3A 2PEZA 4EHJA 1MT0A 3A32A 1JJVA 3P9CA 2IH5A 1US6A 5JHGB 2JD1A 1JDSA 3NEJA 2Y1EA 3VTKA 4I3GA 4BIZA 1JZSA 3V8QA 5JDCA 1YFKA 2DETA 1Z3IX 4AMZA 3DEYX 2MDTA 3GCXA 3CB4A 3CLVA 5IDVA 1NJIW 4HZUA 1J1UA 3IQXA 2JD2A 2HPHA 2B8NA 1VJGA 2FWPA 4AN0A 3O7WA 4P34A 4LYEA 4BKOA 2WHYA 4ATNA 3JALA 4TL7A 3OCZA 5D6OA 1P4AA 5IBQA 4BLWA 4U7PB 4JR0A 2D7CA 4G0OA 3JQ7B 4J7XA 3NFYA 3UUWA 1I7PA 1KE1A 1YC2A 4UUQA 2HRYA 1REQA 1TI7A 4WWHA 4ZYXA 1D2AA 1THGA 3FOWA 2CHQA 4M9ZA 2RHGB 4DG5A 2MMCA 3W2TA 2OLJA 3HM9A 4Q39A 3DDOA 3ZBTA 2VXBA 4FFSA 1LV7A 4LIPD 1UBKS 1SHUX 3L0CA 5EP1A 2YIMA 3DMTA 4C2BA 2ZUVA 5BSGA 1PLLA 2AIZP 3BRQA 3HZOA 4BFVA 3FLEA 2BCJQ 4TLDA 2VQFO 3DE6X 2RG1A 2VDUE 3K70C 2RJZA 5ERGB 3GGOA 2EWVA 3ZC3A 3OJLA 1IRXA 4IP0A 2EP7A 2BJWA 2VAXA 1ZD1A 1F7UA 4X62O 3MMNA 3ZYCA 3WR5A 1P7WA 2O0LA 2CFCA 1CUDA 1E4EB 3EVBA 1SXJE 2BEVB 1A2QA 2FG6C 2FJ0A 2UUCB 1RYZA 1TM5E 5AI0A 2BRUC 4LYAA 1DCMA 1FFWA 4YMVA 4Q24A 2XOEA 3HPRA 2HXGA 4F5EA 2R5WA 4BUZA 4CS3A 2QYSA 1TO2E 2H4ZA 4GDMA 2CUTA 4NPAA 1ZVVA 4MWBA 1PQPA 1TVCA 2N47A 3B2NA 4DAOA 4REQA 3F4LA 4WXEA 2CXHA 3G13A 5DGHA 1SUIA 1V5GA 1ZMTA 3E9ZA 4N9QA 1T3HA 1UZLA 4L27A 2V9PA 5A2QM 4I36A 3TSOA 3GPLA 1XDZA 1ODKA 3M8KA 4LXGA 3DJFA 3N76A 3SXPA 3NKFA 1MNGA 4XIFA 4Y6GB 5EE1A 2H29A 3BWCA 2COUA 4MJ7A 1BXRB 5KNBA 1RQXA 3RT9A 1G2OA 5TT1A 5BURA 3QE9Y 2PMKA 3IIEA 1I8TA 4LJYA 3QVWA 1RVV1 4G8JA 5LFAA 3BFVA 3I2KA 4I55F 1J2TA 3JQ8B 4X24A 3B8MA 5AVKA 3UGJA 2PGJA 4Z1MD 3PICA 3SPJA 3CW8X 1CC1S 3QUQA 1H4SA 4G2NA 4F6RA 2FMUA 3BRWA 4G0QA 3S0HA 3JAMM 2G1UA 1T9GS 5BY1A 3VH1A 3BHMA 3VU8A 5JSHA 1APBA 1VKNA 3U3ZA 2Q2OA 2EFGA 2DB3A 3UUGA 5ECGC 1GTZA 2QM3A 3SS9X 1IDN1 2QBYB 1QLEB 1GK9A 3QNMA 5TR9A 4KLNA 3GVPA 1K7DA 4RVNA 2HG5C 1QVZA 3PGLA 3FM9A 3PEFA 5BSRA 1LI4A 4G36A 5L3RA 2MYTA 2QTRA 3ZLTA 3Q4HB 2G6TA 4MZXA 1WEKA 1M6WA 4JJZA 1MJFA 1NJ5A 1TQ8A 1XK7A 1OCRC 3IKFA 1Y9JA 3RFRA 4CQJA 4H3SA 1WCXA 3DVRX 3PA6A 2P6MA 4BVGA 4X66O 2R8EA 3UAGA 1KNQA 3Q98A 3DZFA 1L4BA 3X1MA 4C0KA 2SCUA 3Q11A 2HFJA 3KIPA 5MN6A 1FQWA 1R9NA 1W59A 3CCSV 2ZSIA 3E8XA 1Z2PX 4MB0A 2CTQA 3IMPA 1GT6A 1ZW1A 3MINA 1GO2A 3WXMA 1I3KA 3EH1A 5DLPA 1AQLA 5TMPA 4H6VA 1L5YA 2VNSA 3TZBA 2NMUA 5JSYA 2O5RA 3FDJA 3AM5A 1RKVA 4W5NA 4PG7A 2HA0A 3KQLA 1I01A 5IBCA 3R20A 1H65A 4IDQA 1FDVA 4HXYA 3TL2A 3KALA 2BEWA 2FEAA 2ZU0C 1W2HA 1VYTA 3GT4A 4PWYA 3EXIA 1YE3A 3CM0A 3CJQA 3G1UA 4ZC1A 2JFUA 4WK6A 1NC3A 3CF6R 2Q67A 4J9VA 5LA6F 3W6NA 4DIFA 1WXHA 2PFGA 2NQ8A 3K4HA 2FKAA 4G8DA 3PXUA 3ELBA 2QA5A 2PGDA 4QPCA 4JT8A 5A3RA 1M8FA 4HRXA 4IXNA 1ZI8A 4PNZA 4UPVA 3RQSA 3L4JA 4PRYA 1QGED 4N5MA 3ZNOA 1QBGA 1NQOA 1Y8RA 5DHTA 1LK5A 3STYA 2I9PA 4F5ZA 2I8AA 4EHDA 1NUQA 4TQFA 3GNQA 2OSVA 1FDOA 1ZRMA 5P21A 2IIVA 2DLNA 5EWLA 3ZLBA 5CB4F 2UU9B 1HDXA 5J40A 5LZ4A 1J8QA 4BJ5A 5IARA 3TPFA 1RPJA 3GQBA 1Y5LA 5K8LA 3BS4A 1ZVQA 4IT5A 4L8WB 2P5SA 3DE5X 3OZGA 5IVKA 4NVPA 4NKGB 1BEEA 4BW9A 1GQ2A 4EA7A 4FSDA 3HCAA 4O3MA 5B53A 1QZ3A 4FI3F 2NTEA 2JA2A 4DR6B 5T5QA 2FVXA 3F6EX 2R1TB 3HQ4O 2QAIA 1ZVJA 5DWDA 4BO2A 1SUFA 1VMKA 4DNOA 4KLRA 4IF6A 1EX6A 4OHRA 1USWA 3DDSA 1M2NA 4S3MA 3UK2A 2C9YA 3I5YA 3PPYA 4EQ6A 3PLAE 4ALNA 1WNSA 5AUOB 2Z1UA 3U44A 4H1VA 5B1EA 3FCAA 2XH8A 4JDUA 5SICE 2ZTSA 4J11A 2A9PA 1JIUA 5JNWA 1XLUA 2WUEA 4Z1OA 5KOYA 3ED1A 2A5LA 1F2VA 2JAXA 2YYYA 4D4LA 5JJEB 1NVGA 4MI3A 4BNLA 1DKMA 4PI0A 4HH4A 4KUHA 3OPYI 4OQ4A 2P35A 2ZR9A 1OBOA 1UFVA 3WGHA 4NJEA 3FUWA 4EUSA 4GFDA 1WQ3A 2FR1A 4YQFA 5SY4A 1P61B 3DNFA 1P7BA 4QAJA 2OV2A 5TS3A 2PRZA 4BLSA 1TKCA 2PJZA 4DDUA 1FP1D 3LJKA 1W94A 4TUYB 2Y4TA 4TS4A 3ROTA 1P5JA 1XGKA 5F73A 4Z9XA 4B6RA 4FN5A 2QWOB 1QWSA 3CVYA 1O7JA 3F2IA 4U5QA 3S5JA 4QEKA 4GOXA 1DC6A 4NR1A 1LJ8A 1CPYA 2COEA 3FYUC 1PO7A 4OQZA 4U7TB 3I01M 4NE7A 4BO9A 3HGMA 1SGWA 5KU1A 4DO2A 1C3OA 4FM1A 4ZEXA 1HL7A 4QODA 4NECA 4YAOA 3N2KA 4KTTE 1YMUA 5D5PA 1Y42X 1KS9A 4GI1A 4QGSA 4LF8B 3FCXA 2P2GA 4HB2A 4LZZA 3LT0A 2I6TA 1FA9A 3WLPA 4YTEA 1VP3A 4BIIA 1YVRA 5E1DA 2A0KA 4BO0A 3PC8A 2GEBA 2BSKA 2EJTA 4X5OA 1M2WA 1G17A 5TARA 5IN4A 2VZEA 4DR7B 1ZJ5A 3ANLA 1WSDA 3FW1A 5GONA 1IHUA 3UICA 4AP6A 4UFPA 4X3CA 2CGEA 2ZWVA 4BB0A 3B2EE 3RYCA 2OHXA 2WILA 3JQPA 3A9UA 1QU7A 1KI6B 2EEZA 1J8MF 3JWGA 3OJ0A 3RIYA 1K3FA 2AMYA 1J5PA 3QZUA 1UOQA 2B5VA 1ZH2A 5JARA 4ZQFA 4OSOA 4DT1B 2IK8A 2DQYA 3BMQA 3I1JA 3KR0A 3T7JA 3T99A 4FJ0A 2DLCX 1PLKA 1O95A 1L4EA 5CN0A 3M6AA 4B48A 3CKLA 3ZXYA 1OE0A 3K58A 3X1YA 1H5NA 1PDVA 3C3JA 4PNHA 5JROA 4I7ZB 5C1OA 2P9YA 3AGQA 4WA7A 2FFRA 4GH5A 4EB6B 1TK3A 3TNYA 1LPAB 4AICA 3H5TA 3RFTA 2IG8A 4DPMA 3V4SA 3RU7A 3G9TA 5CFZA 1T4BA 2DUUA 4RTJA 5D84A 1DKNA 5EKXA 4M1KA 1I6LA 2BR4A 1WOMA 2YIJA 2W6OA 2WBLC 1IE3A 1DJOA 4JJ8A 3K0AB 3DZHA 3E4CA 3ONDA 1NRWA 1ZNYA 4EYGA 2ZTHA 2WDZA 1L8LA 3DDWA 3RVSA 1EJ2A 2GN0A 4BE4A 5G4VC 1E0SA 3QJYA 3JX9A 3FFAA 1I08A 2JVDA 1OF1A 1TJ3A 4J4HA 3SJ7A 3QVLA 3DE3X 1YB1A 4ZQEA 1N6LA 4IFEA 3UUEA 1CTQA 1K0FA 4RDHA 4JI3O 1ZHHA 5FT9A 4GCZA 1N2OA 3FNRA 4EF5A 1DAFA 5JS2A 3MC1A 1NI4B 4JV5B 1JIJA 2YSUB 4N54A 3K05A 1N7JA 4OHFA 4ZPXA 5AJXA 1WETA 3ACBA 2W83A 4QUGA 3WHIA 1JN0A 1AA9A 1S8OA 2ZJ8A 3WQHA 3H83A 1BCRB 3GEHA 4GX0A 5AW0A 3UAOA 1X1TA 4A91A 1FJXA 4BNHA 3AFNA 3TIVA 3C8HA 3KJEA 3JAWB 3ICQB 4MHTA 1XMIA 4YASA 1NBMA 2IUUA 1FP4A 3A9RA 5JWRA 4Q9DA 4DJJA 1SVOA 5I9NA 4UQPA 1OTXA 3BFXA 1TMYA 1RCUA 3FWPA 3SC3A 2ZM5A 2VXYA 2C0QA 3OEHA 4QEDA 4EKWA 1Z0IA 3G2MA 5BN1A 4DR1B 3ID6C 3TL6A 1CZOA 5HZMA 2YIBA 4KV7A 3PZBA 3SZOA 4MAAA 3UJBA 5K09A 2FN9A 1HE4A 2YIVX 3VNRA 4IIGA 3H17A 1UANA 1P3Y1 4J29A 4J0GA 1CYEA 3VJMA 4BX2A 4RLFA 4MQFA 4YT8A 3J80M 1S3JA 1N3YA 3QEOA 3LDTA 1AKQA 3KZOA 4PYOA 4DR2O 1QP7A 1Z0DA 1SBNE 4GZ5A 4B2IA 5FNVB 1N7GA 5HJ5A 3P96A 2BCEA 3UHAA 5F2NA 2R8OA 1XOUA 3E7FA 4GLJA 1PBTA 2QM8A 1U94A 4L95C 1UCFA 1CY7A 1JG1A 4U2FA 4RVOA 1HLFA 2X0EA 5ICEA 3LSTA 3SQMA 3VU0A 3ZMSA 1ZXXA 4IFIA 2YY7A 5K6RA 4BLPA 1Y48E 2ID4A 2YMPA 4TV9B 3UJ8A 1V8DA 1SOWA 2HU5A 4PSUA 3NOXA 4OGLA 4BFZA 3MHTA 2FA9A 3D36A 3H1GA 2H5IA 2RH9B 4LUCA 4P4GA 3ZCPA 2AL7A 1R3UA 5JAZA 4PBRA 4MDEA 4DV0B 3UH1A 2XA1A 5DT2A 1GFIA 1V8FA 3NH6A 3PVZA 1DMRA 1BXGB 1FLAA 5F4ZA 4AMYA 3RS8A 1N5JA 4HAIA 2WQ7A 4F2DA 4W82A 3FWKA 3VNVA 4BYGA 1E20A 1AH2A 1N2XA 3NYRA 3DLBA 2ZSEA 3LQYA 2G1PA 2NAPA 4F71A 2EFEB 5FIUA 1RNLA 4KO3S 1EQ2A 3G1TA 3TTSA 5IDWA 4L72A 3AEYA 2OZLB 3IQEA 4L57A 3MD9A 5CLFA 3W04A 1JHYA 5IHPA 3WKBA 3M7IA 4ANFA 1HDEA 3VPBA 3BGWA 4BEBA 1BIFA 5HBGA 1FF9A 1K2WA 2OECA 4BUCA 3WGGA 5JI2E 3EPHA 4LNUB 5FUMA 3WL8A 3VR0A 3S2YA 2YWFA 3B7WA 4DYVA 1F0PA 4PG6A 2YXDA 1C5KA 3LWPC 1U3VA 221PA 1FRQA 1GCIA 4ZDIA 4LV6A 3SFTA 1AX9A 2PUBA 3ICVA 3IEMA 2JKVA 5H6QA 3OEWA 1ESNA 5GTIZ 3FHTA 5IAEA 1KZGB 4BDTA 4N0PA 4EJSB 4WCDA 4GVLA 1ONIA 4B6QA 4FE7A 4P4SA 1CJSA 2EOAA 2X2OA 4S12A 4F6CA 1L9KA 3U09A 2NU6B 1QR2A 1IEQA 2KKWA 3H1AA 5K3FA 4UTXA 3LPAA 1BCSA 3UJCA 4AWBA 4EY6A 4F1JA 1ECCA 3KZKA 4C08A 1C81A 1KETA 1T2FA 1QQTA 3G23A 1VE6A 4K6KA 1BEZA 3VZDA 1RLGA 3OX2A 5AOCA 4FLEA 1MA1A 3E15A 4DLAA 3L7QA 3TCNA 2XLBA 3BGDA 1VQOV 2QHXA 3K20A 2F1IA 2EKLA 1BTOA 3TNLA 3IJ5A 3VHXB 4F93B 2PUAA 1C7IA 1R6KA 1JB1A 3ZDDA 4F56A 3EXHB 3QLUC 3JCZA 2FOIA 3R3HA 4LBYA 3GWZA 2H1HA 2YUTA 2IU6A 4EX6A 2BGRA 4F9TA 4PZCA 1QANA 2BP7B 4JBYA 3FHCB 4LYGA 3KYIB 3DDUA 4Y6OA 2Q7EA 2HVYD 4GLBA 1DWUA 4QDXA 4Q1VA 3UF0A 1TA9A 4OXKA 3TLXA 1SVSA 1OYYA 1QLEC 1HTTA 3TIGA 2F43A 4S24A 1QNFA 3F5QA 4AZSA 3RKRA 1EB9A 2PWPA 4FOSA 5TQ2B 2AKYA 3O26A 2UUAO 4I2VA 3ZEDA 1F8YA 4Z99A 3KQMA 4NV3A 2EIHA 1YRYE 2V74B 3IQIX 2MSDB 1L4HA 4OI2A 2C9CA 4FPXA 2WAAA 1MT3A 3LHDA 4JX9A 1Z62A 4ZV7A 3EE6A 1UT5A 3R0ZA 3AIOA 4WXHA 1CUHA 4E2FA 4P86A 3GJ8A 2QX4A 1X19A 2XT6A 1IY2A 2QT0A 2CHUA 3ZNQA 1E9EA 5I5EA 2F4VB 1H2WA 3B9PA 1GG2A 2IU3A 2CJXA 2JFOA 3KFXA 1VZ2A 2E3CA 2D3TA 1A5AB 1E9DA 1WMFA 3C74A 1J2JA 1BOOA 4ZDJA 1HC7A 2C2GA 4N40A 1R8YA 3DZJA 5AJYA 5AVTA 1FFXB 1CS0A 4YB8A 3L7DA 4Z4GA 3ISTA 5A5EA 3ZHRA 2HK8A 2BE7A 1SIBE 1NQWA 1BXZA 5EC1C 1R0BA 1N4AA 3L46A 1NBIA 1AO0A 2P6UA 2AN4A 4KITB 1YR6A 3MDOA 3F6SA 1UP4A 4JJAA 3EVKA 3PVSA 1R4ZA 4F21A 4QTZA 3CUKA 1IX9A 4RKQA 4MUYA 4D6YA 2H5LA 3UMRA 1TM2A 3OZSA 2HK9A 2Q8NA 2GBLC 1WF3A 1FYWA 2UZHA 4QVKA 4TSFG 4U7WA 5LP6A 3AKZA 4YUWA 5DVZA 1TAQA 1PTJC 3PWSA 2A9RA 3KQUA 3EVTA 1IAVA 4OPAA 4L9RA 1V47A 5FUVA 1VXRA 2R9VA 4Q4CA 1NOIA 2QZ9A 2CFRA 1S8AA 3EY4A 4B6PA 4N6NA 5AFSA 3BGIA 3LXUX 4BC0A 1LZLA 3GJQA 1O5IA 1Y76A 4WOKA 3MLEA 4RSRA 4Y2VA 5DM2A 1T13A 5F7XA 1L7EA 3KCNA 2NAFA 4BVKA 5H02A 4WOCA 3OWHA 3M6XA 1CWUA 2ZYHA 3ROEA 5FJJA 5F64A 4NJMB 5FD8A 3PHHA 2X6TA 3VZRA 1DO8A 3L82B 4CDRA 2J4CA 1LPMA 1H4TA 4OEHA 3IKVA 2VDWA 1ZCBA 3EGXB 4LXHA 2R4UA 3THSA 1WWKA 3L6DA 1RYFA 3D1VA 1O5TA 4ZGWA 3MRSA 3M5CA 4ZT4A 4Y1FA 2HSWA 2QPOA 2C4VA 4MARA 4Q6BA 4Y2GA 1YUMA 2G63A 4WY8A 2ZWOA 3E53A 4J07A 1ETHA 5EIOA 4X60A 4QBIA 2JNBA 1WEHA 4KMSA 2D1FA 3CUWA 3FIJA 4CT5A 1QCCA 1YK1A 1WTAA 1ZZGA 3QPVA 1WULS 2DWPA 4YO7A 4A82A 3TTVA 2GNAA 1C1XA 1RWKA 3OPXA 1M2KA 5EKSA 2GBCA 5IC6A 2GK3A 2WLJA 1XVUA 1P3JA 4JI5B 1G8AA 1OX4A 2VDMB 3JR3A 4DBLC 2ZNIA 5LBUA 4QVGA 1N3BA 5FO0A 4H16A 1HY3A 2L18A 2KGWA 3PFNA 3F7VC 5D2CA 3E7WA 2IXAA 4DDTA 1GDTA 3S70A 2PMBA 5LZ2A 3T1OA 1U1DA 4KVGA 3VDMA 4X3LA 4YCLA 3CEIA 1SETA 5FLEX 2D7JA 5LXTB 1LVHA 3E83A 2GN4A 1QF9A 1XDCA 4WMLA 1WV1A 2BRUA 5BN3A 2KW5A 4XAQA 2JCSA 4GX5A 4MW3A 5CYGA 3SJAC 5H9VA 3D6MA 1NLYA 3U3KA 2ZYRA 4GZ6A 2X4LA 2ZUTA 5TC4A 3QVGB 4Q4LA 4CMJA 3U80A 3R7NA 4RJJA 1E59A 2VQEB 3OCVA 2Y99A 1I14A 1U8UA 3LPNA 1NUTA 4LF4O 1QP8A 4QU8A 1N9GA 1DQRA 3I8SA 3W9YA 1PFUA 4HWRA 1JG6A 3KT0A 3LKVA 3JYOA 2AI1A 1ZCFA 3LRPA 3NHSA 1KIAA 2V9YA 2GAIA 4BRZA 1FVOA 1VIMA 1GOTA 3JQBC 3VR5A 2FW9A 2J6CA 4DLTA 5IASA 3H65A 4IOKA 1EX7A 3LDCA 5IF9A 3SQXA 4CL0A 1IOLA 1BYUA 1K92A 3RJ9A 2PAFA 4L78A 5FYDA 3LCCA 1W35A 1VK3A 2I6QA 1TMOA 2DQZA 1PT8A 4ZODA 3EAFA 2JS3A 3MWDA 4GICA 2ATKC 5K9ZA 3O93A 2CH7B 1ODEA 1BS1A 2ENWA 4LMBA 3K2XA 2YVQA 4HFNA 5HE8A 4NLLA 4C4ZA 1OWPA 2PS9A 1AK9A 2HBYA 1XBLA 4GUDA 4H7IA 1ID1A 4QULA 4RULA 2NUTA 1UBSB 4YMTA 4NV1A 4XB1A 4IIBA 4YEDA 1II0A 3CZMA 1G4UR 5K0CA 1DU4A 2O8FA 4U2KA 4ZJPA 4RUKA 5F1PA 4BDSA 4FUTA 1C0IA 4PU0A 3IVXA 1FRFS 1CZRA 1K8XB 1VQ5V 4FDTA 1CIVA 1S89A 2GILA 2FRDA 3PLNA 1Q6UA 1Q0TA 5U4QA 5IXSA 3F74A 5HZHA 3FVVA 4QD3A 1AOXA 5E4TA 5I6DA 2QRVB 4N0DA 1WDWB 1IXKA 5CBHA 3EG9B 1CUIA 4TZTA 1QU2A 4KC0A 2QE6A 2A1UB 3NCHA 3GJ3A 3TFWA 1J99A 3CRRA 2EX1A 1QF6A 3KKLA 1IULA 2GNOA 1S76D 2P3QA 3NGMA 2Q8QA 2BMWA 4DN6A 3PCTA 4RE5A 5AW3A 3N2GA 2EW8A 2GWHA 1K33A 1QRDA 3TIIA 2Q9CA 1N6OA 3MWLA 1A50B 2HQSC 3OZAA 3T2MA 1B6GA 1KEWA 1TCBA 2O2XA 3KZNA 4EJ2A 2PSFA 2KPOA 3L0OA 2Q9LA 2WAXA 1G3MA 4RF2A 1HRDA 1IB6A 2C78A 1D5WA 1HE3A 3WIOA 1QXSA 2IHBA 3L7IA 1VHQA 1KORA 2B5WA 5K0LA 4TV9F 4F2GA 5DX0A 4F4HA 3R5KA 1QHHA 5EJFA 2IYSA 4RGYA 2JLQA 5D3KA 1US8B 4BJ1A 2HU8A 2GSWA 4Y6PA 3CG6A 4FZ1A 2IYRA 5A0VA 4EVIA 2YHIB 3KX2A 4Z4CA 1XTTA 1M2OB 2YS6A 1N4CA 1SCUA 1G6Q1 4COKA 4LMAA 3KL2A 5FA5A 4TQAA 1DBPA 5CTAA 4H33A 5SYAA 2J9GA 2UXNA 2XTNA 3CP1A 2MK3A 1WXFA 1IY0A 2O52A 2FOLA 2PRSA 1T8PA 2R97A 4YP6A 2F3UA 4H31A 1G21B 2IVZA 3LP6A 1E32A 4NATA 3J7AU 3ZDXB 1IQRA 2I3GA 5LA6A 3L73H 3CSXA 3QG1A 2FWBA 5AM0A 4GU5A 3D6TB 4CMCA 2YIAA 1R8JA 2AR0A 3ZD9A 2XMRA 1EEHA 4ASUA 1DUSA 1T8TA 3RW0A 2J9FB 3D3WA 3M49A 4HAVA 4P5EA 4GKVA 2IPAB 5LB2A 2C2HA 2W37A 3V42A 5DNAA 4EGSA 3T4UA 2XD4A 5F76A 4AXXA 2PGNA 1WXEA 3TQIA 3RVBA 2OPBA 1M34A 1EGQA 1M67A 5JSFA 5J2UF 1CRZA 3QIVA 2ANBA 5CB4A 521PA 4BRSA 1HBJA 3G3EA 1U3TA 2H4YA 3DHEA 1RCTE 2Q0QA 1WVIA 4K26A 3T7EA 4C4PA 2EP8A 4JLSA 2Z9CA 4O08A 4C4OA 3GD7A 3DC2A 1AMNA 3I32A 3X2SA 5I51A 5FLXM 2PZEA 3F6BX 4LOAA 4GSYA 1BQEA 2AFHB 3A70A 3RAGA 1XRQA 3B5JA 3V48A 3T3DA 5KINB 3TXSA 1XRNA 4I99A 1AGPA 3GVHA 1C3XA 3MJFA 3FYUA 1YTFD 2MMGA 1C2TA 4JAVC 2NXCA 2PWBA 3EGWA 4B3FX 4HMPA 4LN1A 4OJNA 1PNRA 3K9AA 1UADA 3HZZA 4KYUA 5AI5A 3T7KA 1WVMA 4Q12A 1L5VA 4ILKA 5ES4B 3QNWA 2Z5VA 1D0VA 4KQIA 3QFSA 4WESB 4ZJYA 3V2UA 4FYXA 4O2AA 1SOAA 5I7RA 4PZYA 5LQDA 1QKJA 4ZQIA 3HBNA 1KYZA 2I1VB 3CYQA 4AJJA 3ZE9A 5AUQA 2AVNA 2VHXA 3ZDEA 4ENTA 4NVRA 2PKXA 1DJLA 5FF9A 1T3TA 3R7FA 4G4WA 2X0KA 3BDAA 4WJKB 2RG7A 3WL4A 1XXHA 2N46A 2IY7A 1KJQA 3C1OA 5EA2A 3GJTA 4WUVA 4L1KA 1NBME 4Q7LA 5JBNA 3QVXA 3G02A 1XDBA 1DEAA 2O0JA 1TGYA 4C43A 1VQ1A 1PNKA 1WSWA 3CEAA 4C5AA 4XDLA 1UKYA 4B5KA 2EQ5A 3BCCH 5DFAA 3JVUA 3DEAA 2QU7A 2GVIA 3BY6A 1QGOA 2JJMA 4JJKA 4KLZA 1EWVA 5BSEA 4RK4A 1EQUA 4Q4AA 3OKPA 4UVBA 3EXHC 1SQBH 3BL6A 1M1KW 6ABPA 3QPUA 2APJA 2QRZA 5JISA 3CCEV 2XKKA 5EXPA 1M8JA 3K96A 4CM5A 3NYQA 4W1PA 5EXDA 4H6XA 2D5AA 2HRBA 4PHTA 4I1RA 1AK1A 1XQXA 3DL0A 3EAGA 4ND1A 4RFSB 4ZVTA 3OM0A 1ZOOA 2Y1KA 3CMMA 1FBNA 3GH3A 1ONBA 3OUUA 3WK7A 3V8RA 1Z7WA 3WIUA 3WMRA 2W70A 4AJ2A 4MA4A 4JYMA 4JY7A 2HHHB 2WJYA 2P2ZA 1NVEA 3AC0A 3T1HB 3ZHZA 4RHFA 3F0GA 3M5PA 1ZBQA 3T9AA 3MT8A 3GRUA 5H16A 1BWSA 4YRIA 3BX1A 4P0QB 1IM2A 3MT9A 5KHHA 2FPKA 2G8LA 1O9HA 4YLGA 4QDUA 4AJ1A 5CT9A 3PP8A 3LTNC 4R81A 4L02A 1RPAA 5FBQB 1II8B 1LBEA 2ADFA 1WZUA 4FDUA 1M2FA 3LLCA 5HIAA 4ZCQA 4GS5A 1BD4A 1WB8A 1TCCA 4UMFA 2H07A 2RAFA 3I6BA 4L0CA 1S5PA 4NYIR 1YO6A 3UT6A 3FKSD 4NRDA 2BO1A 3BAFA 4AKEA 3RADC 3T7SA 2BKEA 2IIQA 2GRAA 4V0KA 4MUXA 1OV6A 1U0BB 1UL1X 5I9MA 4NX2A 2KBEA 1SK8A 4KIJA 4L9SA 4MWEA 3CCMF 4CKBB 2HWKA 3IKEA 1R4NB 5DT9A 4RS3A 5LP6F 2ZZNA 4BN0A 2FDXA 2WTBA 2ECKA 2LW1A 3CUUA 2XUHA 4R51A 2BFDB 3I9V6 3O84A 4FHGA 2V65A 3RASA 1UMDA 4BVJA 2XZDA 1TC1A 4EG1A 2EXXA 4UEOA 5F1KA 5A2QN 1V4BA 1ZWIC 3B1ZA 4ZQBA 1ZKMA 1ZIPA 1NVPB 3R77A 1SN7A 2ENUA 3IKLA 3URMA 5NLLA 3GA5A 1ZS9A 3AVYA 3QOWA 5BSTA 3HFJA 3HVIA 2IIPA 4E4YA 4NONA 3DEKA 2HRZA 3MGBA 3K71B 6REQA 1FNSA 2ODNA 2NZJA 4OM7A 4NMLA 2B94A 4FMCF 3QVKA 4ZVRA 2X86A 2XTMA 4UM9B 4JZ2A 1GV0A 3B53X 3KFVA 5I9TA 2ECFA 3U48A 1IY1A 4BNIA 3TZEA 2I87A 5C1BA 2IH3C 1GEEA 1Y1QA 3FYCA 1J97A 2QENA 1T9BA 2O8BB 4PAQA 1R8SA 4IICA 1VH8A 3UBMA 2YHAA 3JSAA 1Z0ZA 1RHMA 3H8VA 4KN8A 2J3LA 4PJ0Z 4PANA 3C4VA 3EQ7A 3F4BA 1AILA 3FTEA 4G65A 2Q2WA 3K16A 4BX3A 1SESA 2A67A 3K1ZA 2I2FA 3CJRA 3L43A 1OXBB 1I5RA 3JQ7A 5B30A 2CCGA 4IW3B 1FNCA 4K8RB 1Z38A 1L7BA 2GDSA 4UULA 2P3LA 2ZJ5A 3PHBE 1QTRA 3I04M 1FX0B 4XD7D 1OPRA 2E87A 3PFBA 3B1XA 4OGKA 4HNVA 2YJ6A 3ZD6A 5CHYA 1Z4QA 1YIDA 3GEBA 2ET6A 1QVWA 621PA 4ZOLB 3VQVA 3GX1A 1G20B 2OENG 1R9JA 3EWIA 1SC1A 3RVYA 3VBCA 2G4CA 3VR1A 4AI6A 2YUIA 4LBWA 4O4LB 4OXYA 2Q1XA 4IKEA 1XYVA 4DVGA 2CMGA 3CUYA 3V3TA 4I2NA 1FK8A 3BB3A 1ZNWA 4E1VA 3SX4A 1VKRA 4P1ZA 5DCWA 3I7TA 3M6MD 5KYTA 1T36B 4EEZA 2NG1A 2HSZA 4HHEA 2VK1A 3W6UA 4KGVA 4GM1A 1RZRA 4MRRA 1E4EA 2BEVA 1YJNV 4D0LB 3UGTA 3QEBZ 2V6FA 3GLHB 1R0ZA 2Z5LA 3P2YA 4MKXA 1PL6A 3NBKA 2PX5A 2GEJA 4BVSA 2UXCB 1QNMA 3CF4A 3H1KH 4QVIA 3WLQA 3EVCA 2G8NA 4JI1B 3CSDA 3CH4B 2B99A 3L7CA 2GO7A 1KVQA 2CHFA 1Z2DA 1ECPA 1UUFA 2DYKA 3IP9A 3DCNA 4IJQA 1YIOA 4FS3A 3ZBUA 3MN1A 1KGDA 1H8HG 3N8DA 1GFZA 4W5TA 3S81A 4XLZA 4DLXA 1KAOA 1BXRA 3FAKA 3H6GA 1TYBE 5LMUO 4K03A 3AEQB 1UBLS 3LTEA 3QLUA 1XCGB 4R1TA 3IQFA 5AJUA 3AF2A 3JQ8A 4UAVA 3H5OA 4EB3A 3X3HA 2Z3ZA 1ZD4A 2JW5A 1FQKA 2DHEA 4EW6A 2AFRA 4ML3A 5DSXA 3LUJA 2QE7G 3AERB 2PMEA 3VC7A 3SBOA 3COVA 3FPEA 3H0EA 2WYVA 2XB6A 1DE0A 4RA9B 4TZKA 4AL4A 1QFJA 3TS1A 1RE0A 3T80A 1SIWA 3UC5A 5GZ3A 4R9UC 3LHIA 1I51A 2QBYA 1NHWA 5HP8A 4N03A 1PJQA 3IV6A 3RTDA 2ZP1A 3ASYA 2ZJAA 1KY2A 2JAHA 2WB4A 4DMHA 3HVJA 1IWPB 3C5HA 2NW6A 1ZOPA 2QAGB 1S2OA 3AVOA 1V2HE 2BUCA 1LU9A 2IZ5A 4ZVPA 1D2RA 3GDGA 1ULTA 1R73A 3V1UA 4ZZ1A 1WNTA 5CB0A 1XVIA 3RBVA 1L5LA 4QYWA 4LC0A 5AKJA 2LE0A 4J9ZB 2C83A 3QIAA 3DC7A 3AUTA 4O1HA 3VYVA 4D9NA 5FR1A 3OFKA 4JMLA 2PLAA 1FCJA 2VDQB 1VMDA 4AJEA 1CUWA 2AFVA 1GN6A 3ZYZA 5H7XA 5JNLA 1MHPA 3M4XA 4MK4A 3ELWA 2Y1WA 2PQ0A 3DXFA 3WLSA 2VDLB 3QVOA 3IEUA 1N57A 5A4AA 3FCOA 3GRYA 2W5UA 5IBPA 3GBVA 3D8BA 1EA5A 3SI7A 4KFTA 4KQXA 2PSDA 4MGZR 1E2MA 1DAIA 2WF7A 2IXTA 5K2OA 2PDAA 3HDJA 2ZAMA 1P4RA 2E55A 3H9UA 1EHYA 2VQFB 6GPBA 1MSDA 2ACKA 1IJFA 1ABFA 3AF0A 2O6LA 2GZ3A 4WAUA 1IM5A 3ZK8A 2CNOA 3OJCA 2JIZG 2OYCA 1LBQA 4X62B 1PTJA 4HAMA 3IUQA 4GVPA 3NBUA 4LXYA 2YUAA 5E3HA 3CVWA 3QTYA 4FW9A 4EPYA 2J0UB 3CWBH 3FVTA 1BGVA 2VR1A 4G2KA 4N65A 2B3TA 5KDLA 1P7YA 2CL6X 4JC4A 4RXMA 4EFEA 2JJQA 3QOXA 1N6HA 1VJDA 1QORA 4LF5O 4RELA 3H5RA 3ZTWA 3CYFA 3OD4A 4BV9A 5EJ8A 4EG8A 4LW8A 2F3PA 1IZYA 2QDXA 3GUUA 1DELA 1L7VC 1WB4A 1Z15A 3AMVA 5KMGB 2X1MA 2WZDA 3R9KA 5JD4A 1FTNA 3WG9A 2EX3A 2FSSA 3GCZA 2XECA 2EULA 4GECA 1C80A 1JHPA 4QGHA 2ONCA 2ZSJA 5EKUA 1NE2A 3VR4H 5CD1A 3SC2B 2GN9A 2R1TA 3P7MA 1CULC 2IHTA 2JIDA 4Q4JB 1V55C 1Q3EA 3E1YA 1JUDA 3LRTA 5JV5A 4IJ6A 2E0IA 1B15A 4N3GA 3LY9A 1UP7A 5CVJA 3U4MA 3HYTA 3GQVA 1ICIA 1IBMO 2VGNA 3K1AB 4DQXA 1U2TA 3HUUA 3CRVA 5EWJB 2ZAOA 3GUZA 4DR5O 1T26A 4RUFA 3OT1B 2XUKA 2WHXA 3SHWA 3QVVA 4PPNA 2X5KO 3K5WA 2OHVA 1MX1A 3A3YA 3INNA 2JDIA 5AJHA 2AR7A 4D42A 5HF8A 3KQNA 5NULA 1QE3A 3IAYA 4YMUA 3JRXA 3LCUA 5FWDA 3RANA 2NIPA 5FAKA 3IAM6 4OCZA 4MTGA 2GCIA 1YRAA 3LSUA 4MUGA 3Q7QA 1MOSA 2Z3VA 3FPSA 5HHTA 2BE3A 1AGYA 4CDGA 5GTDA 2NPFA 3QO5A 4YI5A 1BMDA 3DT9A 1SC6A 3R5JA 3BHNA 4TUYA 1Q1AA 1V1RB 1E1RD 4B6FA 1W9HA 2CC2A 1Q20A 4AB1A 4DNPA 1ZD9A 3SJAA 3V34A 3UENA 3HMQA 1NBAA 5H68A 3GGPA 5AMXA 1GZDA 4KXFB 5C93A 1OFUA 1ZOIA 5IWCA 3ESCA 3CWQA 3CZ4A 1EUZA 1DT9A 3CTMA 1QRAA 5A9RA 4IEIA 3E8MA 4O2AF 3EA5A 5T4FA 3KOWA 2IV3A 5KYUB 3TI9A 1JHRA 1XWIA 5AD1A 5B6IA 2VEOA 4WZAB 4DA9A 1A5BB 3ZHBA 5GJBA 4RY9A 3V7FA 5LHGA 1IL0A 2NSYA 3NHBA 3F90A 2QD2A 1LNSA 2ZR2A 2R84A 3H1BA 4F5DA 2X4IA 4KNYA 3OJOA 3IC9A 6YASA 3DVSX 2P78A 2F9LA 1D4ZA 2Z9DA 3AYZB 5IK2A 3O0TA 4NYMQ 4E33A 5DE3A 2HLDG 2GM9A 1O8CA 3TK1A 3W3AD 4C22A 3HCPA 5DNYB 3W2HA 3OOYA 3TEMA 4PBTA 3WGTA 4LGYA 2UZ3A 3F5MA 3H3JA 3T9CA 3KT8A 4WVLA 3G67A 3JS5A 2FEOA 4JI7B 4QNMA 4IVRA 3WDSA 4GR4A 4JK3A 4RETA 5BSHA 4UXNA 4KXQA 3AI3A 4R1SA 3V00A 3EC1A 4DMKA 3OJEA 4EECA 1BN6A 3JQ9C 4LX0A 4JP5A 4LOKA 5ITSA 5CPBA 3TUJC 2E82A 1BH6A 4XLTA 1N8KA 1Q7YH 2PQ2A 2CK3A 3IDAA 4EB6A 3BEHA 4RF5A 3LC2O 4DV4O 3H6HA 4D8TA 4BMNA 4Q3CA 1L4YA 4FOLA 1NY5A 3P3PA 1GO1A 1BMFG 3K0AA 1JHDA 2OCIA 2R6R1 2XQKA 4JZKA 4GW3A 4IIEA 1X7XA 4E3ZA 4Q9HA 2YFHA 4CR6A 4N48A 4AJKA 2BSAA 3PHCA 4X7MA 2WWIA 3N75A 5G1NA 4CYMA 2JATA 2WAOA 1I3LA 2EL7A 4KN6A 4Y6RA 2RKOA 4P3OA 3BSYA 4R2KA 1Y5IA 5HJEA 3IBYA 1URFA 1RYBA 5AKKA 1JU9A 2B33A 5KNCA 2Q1TA 1NUPA 4QARA 1UBMS 1Z39A 5DEIA 3TOXA 5EP4A 1VQPF 3BYZA 2HQSA 4HDSA 4NZOA 1OV4A 1BCRA 1HLDA 3R44A 1U0SY 4EEQA 4B31A 4NBWA 1SBCA 2Z5GA 3A9TA 3JAWA 3CVUA 3JATB 1MAVA 5L9AA 4I1IA 2KSDA 1C29B 2W58A 5KSZA 1NY6A 3OLZA 2XI4A 4UV9A 1P84F 4J9YB 2AN1A 2GFQA 5G0SA 1W4BA 4B3JA 1QBKC 3RSZA 3AQ4A 4HXEB 2XMZA 2WD7A 3CC2F 4JKYA 2EGGA 7MDHA 4YWHA 2VHVA 2V3CC 3OMWA 4CM7A 5BRAA 5HS4A 5LWHA 2OWEA 3KQYA 4R6XA 1IIBA 1QQ5A 1AZWA 3SBXA 2ERYA 3RREA 2ZBPA 3E4DA 2IVFA 4S1PA 2RJNA 1UK9A 2ROQA 1T5LA 1CETA 1ZK0A 4BPBA 1JXQA 3Q6MA 1JPUA 2QM0A 4IKOA 2LZ0A 3WV4A 3D1LA 4FBMA 1G8GA 1V9SA 5BY2A 2A5JA 1C9JA 4RZUA 1NJGA 1NVAA 1OC2A 4TMTA 3OPNA 3MIIA 4PR3A 2QVYX 3ZKWB 2JGDB 4DCTA 2H9AA 2ZETA 1SUWA 1CDEA 3NNSA 1SOMA 2JBAB 2RHHA 1YJBA 2VRCA 2HK6A 2NN3C 3P45A 4D82A 3APOA 5HX7A 5KHAA 1BDMA 5IT5A 1BZYA 2ITDC 1AQJA 2VK8A 4TV9A 3JQDA 1XXHE 2W4QA 4PCAA 1X7YB 2I80A 2P5OA 1KMQA 9ATCA 4Z4FA 1CFJA 1BDBA 5LZ5A 2A35A 3STHA 4CMBA 4X61A 2RHTA 3OSZA 1U0JA 1WO8A 5HWSA 1N34O 5DX1A 4MJ3A 2AMFA 2GX6A 1BRMA 1KEKA 3K8QA 3RH0A 3E7PA 2ASEA 2C7GA 1BXGA 3DVAA 3CG4A 3GLIB 2H1IA 4PYIA 3ZRWA 4BWYA 4C6RA 5KC8A 4HUTA 4UTPA 5DHAA 2IIBA 3TQFA 4DREA 9LDTA 4RV9A 4GL4A 5G0WA 4RAIA 1Q0HA 2NT4A 2I7XA 2WC1A 4JI6O 3CEHA 1G55A 1ZA1A 5WRFA 3DL7A 4UZFA 4QUEA 4Q01A 2C07A 4R8RA 2X7JA 2OZLA 4URYR 1UPTA 3WX0A 3EIEA 2QN3A 4B6OA 1KO7A 2OCXA 2YN2A 3RRZA 1UBFA 5CDGA 1SVWA 3UWSA 4D4HA 4K3UA 3D5TA 3N58A 4XJXA 4G4ZA 2QTAA 4KBGA 5GPBA 1BFUA 1EINA 1GU7A 1YZYA 4EYKA 3PQFA 4K9DA 1EFRD 4MT8A 3OZRA 4JAVA 4R2IA 1WUTA 5DRYA 5CM9C 3DKIA 2X5XA 4DA8A 1YXMA 3D3QA 2RN9A 5J2UA 2XCLA 2FPXA 5AXAA 5JPIA 2GD0A 2WJPA 4ZEOA 1EG7A 3APQA 4EJSA 3LFUA 3QP9A 4DDKA 1AP6A 1ESEA 5EIWA 5JXGA 1Q1BA 1NOKA 4N8SA 1K6XA 2BH2A 1TIPA 1F4LA 1TOAA 1B06A 2JLWA 2ZKLA 2A2ZA 2GPBA 4LR3A 2YY6A 5G0UA 4Y67A 1NSTA 1C1DB 1LLQA 3JU3A 1C9DB 4KX3A 5F3WB 1AI6A 5JZVA 4S1TA 5BV2P 3I12A 2WSYB 3FYEB 3IEXA 4PELA 3OJWA 3GB9A 5BW6B 1RWBA 2V6IA 3AILA 4WJZA 2Q4BA 4D02A 2QJWA 3C8DA 3PNSA 1YZ3A 3NM4A 1SS3A 3CU5A 2JVJA 2BBTA 4R2LA 1YZFA 1KTVA 2V7QA 1JD1A 4JXJA 2JI4A 4JNCA 4N18A 2HCFA 1MB0A 4RD0A 1YB6A 3O9VA 1QC5B 3KWJA 3VHXA 4TYMA 5TDHA 4N0MA 2R6ZA 3E27A 2RBEA 2X3UA 5C4IA 3EXHA 3ILVA 2P30A 2I4MA 3S8YA 3F7NA 1JBQA 1VP9A 1NONA 4OD0A 5CVTA 3P2JA 2JGKA 1L6IA 2R7MA 1IUNA 4Y6QA 2OYRA 1PJ2A 4H13B 1JEQB 3KTDA 3O8DA 5T4HA 4P80A 3GJYA 3IP8A 2Q5FA 2BKVA 1ZA2A 4II7A 3RRBA 3WQBA 2HCRA 1VQMF 4LHWA 1T9HA 4QDJA 1X9GA 3KM0A 1B8VA 3TI7A 1GLNA 4NXNB 3VOSA 2QAGC 3A4IA 5FUWA 3BZWA 3Q8KA 1SZCA 4OAOA 4HWKA 1X0XA 1QG6A 1PL0A 4ZOAA 3SZMA 1K8AH 4LDJA 3KSUA 1WQ4A 3A2FA 5LJIA 2ZIGA 2FOXA 3GFRA 2XVMA 5CITA 1TC2A 2IYXA 4QYMA 4NXMO 4H7JA 1PEKE 2CHTA 1Z6YA 1PI3A 1Y4MA 2PUVA 4N47A 2D13A 3FCCA 5H1YA 4LF9B 1C7FA 5FB3A 5DGCA 3DZ8A 1RXVA 4NNOA 4GHWA 2NYRA 5AVSA 2VPTA 5JMWA 2C4TA 3VIUA 3AY3A 4DBZA 4OSEA 2K1SA 1WB6A 1FFXA 1D3AA 4BUJA 4C2TA 1NQAO 2DWUA 4B75A 3QW2A 3MQ4A 2HKOA 4J0CA 5ELMA 4U02A 2OV4A 4HWOA 2MSWA 1P1HA 3BH7A 2OT5A 4QE3A 1ZUWA 4JASA 4R2WA 4KFCA 1E4VA 2VTKA 2K9PA 3ER9A 3SY8A 1C2YA 4OQNA 3W6PA 4MIYA 5DPMA 4R41A 5K6AC 4V0QA 1W1IA 4UNQA 4MYSA 3A4TA 3IT0A 5FL3A 5GP1A 3PGVA 2ZE7A 3T7DA 4ENVA 2RGNA 1Q3KA 2NQ2C 1LDBA 2FZLA 3TRHA 3MB8A 1NLMA 1XZLA 2AYZA 1FDUA 3EVZA 4BZWA 3E2IA 4R5MA 4A15A 1Q6HA 2ZDGA 4OYRA 2JFWA 3G7UA 5KNLA 3GTZA 4HL6A 3V4ZA 2A94A 1QUFA 4I5GA 2QX7A 2JJYA 1SUPA 1ZH4A 3ROFA 5CX1B 5HRUA 4XGNA 4JLWA 1Z6GA 3S3WA 1JPNA 4KOAA 3BHIA 1GHTA 4GXNA 5EIBC 4PX5A 1GH6A 2AA3A 1GSOA 3T1YO 1W47A 2YCLA 3G71F 3EGXA 4J75A 1SPBS 5DNUA 5E4YA 1EM8A 4PLZA 2QN7A 4RHCA 2QZZA 4MUNA 4XI9A 3OY2A 5CDSA 1CR1A 1T2NA 2Z6QA 4MWDA 1YQUA 3E1SA 3NV9A 5IWAO 4HO1X 4PIMA 1ZEMA 2JJ8A 1B16A 4TKUA 1ZOLA 1HL3A 1ZGZA 3EF0A 2PKQO 1Q81W 1HM5A 5F23A 1PS8A 2RAVA 4RF4A 1K4YA 4OYHA 3ANMA 1P8JA 2Q3JA 3I76A 2ALJA 2WVGA 3I23A 4NFSA 1KC3A 1NIPA 3MS2A 1NDUA 3NASA 1T34A 1NBWB 2OCBA 3I3FA 1NW3A 2VF8A 3ESXA 1E0KA 4JT4A 1I2MA 2CZWA 4DLSA 3SKVA 1OTHA 4IDFA 5CA0B 1SXIA 3NFRA 4UBOA 4F92B 1SVLA 1ZD5A 3A0BZ 2VHWA 1N0NA 1PWZA 4TUYF 1RXIA 1E6LA 1SXHA 3OIWA 3FJOA 3E9DA 2SKCA 4LHYA 1CW2B 4JA2A 5GM1A 3SYRA 2IZZA 3JZFA 5BNZA 1H66A 5LXTA 4MR8B 2XGGA 5ARDA 3S99A 4CKYA 2HD4A 5FI5A 3FH0A 1HZJA 1UK7A 1J2YA 4AX8A 4ENQA 2FMHA 1P72A 2WLLB 4G5GA 4EMSA 4P6VF 2CBGA 3NZEA 1XD9A 2PMFA 3UNXA 1PGNA 3DHNA 4EHKA 1UKZA 3L71H 2BV3A 1W41A 2XWBF 1F5NA 1VE1A 2HY7A 5H3CA 4RK1A 3L77A 3N8KA 3B3FA 2R2GA 5G53C 3IC5A 1FFGA 3GDFA 1HT1E 1E2QA 2VJAA 3HYLA 3FDFA 2HR1A 3VR3A 3PQ3A 1YS1X 2WRZA 2IBZH 1GKFA 1JHXA 2C8LA 2BM0A 1NYRA 3UJDA 4J0EA 2JLVA 4FFMA 1IV4A 4J0DA 2YZ7A 1GNRA 4JTCB 1BS9A 4AMBA 3N7TA 2RFLA 4BP3A 5IJ9B 4YQZA 4BNWA 3L01A 4OQYA 2PZFA 4XBFA 3E20B 5AVJA 1YI2F 1KFBB 1LNQA 4OQXA 2PCJA 1SUCA 4TQGA 2ICAA 3BCUA 1AJQA 4RKEA 2YWBA 4DV2B 2G06A 5KO2A 3GELA 3HYCA 4P81A 1RMYA 1NBMG 1XBIA 3M4ZA 4DPLA 2HMUA 3AB3A 1UJBA 2CH7A 3T6KA 3L7MA 5G4LA 4QJFB 4ZVNA 1EVJA 4ZQHA 3OEHG 3KTFA 3QX9A 3NJ8A 3ONVA 3G80A 4Z2YA 4B4DA 3BERA 4XCVA 1IG0A 3O85A 5CYOA 2B6NA 5AI8A 3T12A 1RI1A 2ZUUA 2CLHB 3P9IA 3A1SA 2P90A 2X0IA 4ND2A 1V1MB 3UWDA 3U4CA 2XNDA 1C0PA 3BEOA 1EP9A 4YAKA 2VUSA 3K03A 2PL1A 3BE5A 1Z74A 1N5IA 4L08A 4J91A 2XASA 2QM4A 2W0XA 3ETEA 5IZ4A 4QYTA 1H8ED 3A6KA 4Y7DA 5K0JA 2OZKA 3F3YA 1K5PA 4MR7B 2IQQA 2QRVA 3AXSA 2SBTA 3SHTA 3JWHA 2BMJA 3N2EA 2JLXA 5LB4A 3R8FA 1XOIA 3F7MA 10MHA 2A1UA 4BNXA 5HFNA 5EHZA 1VQ6V 2Y1CA 3G6KA 2L2QA 2A06H 3U4HA 2I2WA 4J16C 2EWWA 3DOEA 1NL3A 4QL3A 4URHA 1PIWA 4D0GA 1X7PA 4F85A 4H0LB 4YV7A 2FZ4A 2PUHA 5KOJB 2LVBA 2JI9A 1RHJA 1ZWLA 1P4JA 1JEYB 1KU9A 2OFFA 2PZLA 3GHYA 4BP1A 1P7ZA 3UG7A 4FMTA 1BE1A 4GLLA 4KDEA 1YAJA 4NAHA 3U3DA 2NSHA 2FEXA 1VQ4V 3JWEA 3MYYA 3SNHA 5IKXA 4WCVA 3JVVA 3R6DA 1GPH1 1JVMA 3LCRA 1US8A 4E4TA 5JJLA 4E31A 2VCYA 3QI2A 2YHIA 2R6JA 1M2OA 4FXPA 4Q9JA 1VXOA 4IEEA 1YJAA 3L0SA 1E99A 4YJ3B 3BK2A 3WO1A 4W1QA 5ALLA 4NNPA 2GZ1A 5CLGA 1HFJA 2XHEA 5FNVF 1CY0A 1C0EA 3ND5A 1FMLA 1V7ZA 1GPDG 2MSLA 4X65B 2Y68A 4IOMA 3R9WA 5DSTA 3DZIA 1ADBA 4L4RA 2IUYA 4PX2A 3Q7SA 1CQXA 4NBSA 3UKDA 4UE6A 3D43A 2PJRA 1GPYA 3QE2A 1U8EA 4QXOA 2HX0A 5I7VA 2N0SA 1JR3D 3QEAZ 1ZGAA 3K1TA 2QN6A 2BFAA 1Z73A 4AECA 3EX7C 4JLOA 1UOOA 1NBOA 2H5JA 4BO7A 5B3LA 1BJRE 3A6EA 2GLTA 4QDZA 1CEYA 2XJ4A 3G8DA 3HP1A 1H0SA 1B43A 5EIEA 3BH0A 1R12A 1Z8FA 2IHYA 5E9JA 2AXEA 3OE7D 3GA7A 4DIDA 4FVMA 3AHDA 5HXAA 1RI4A 4YAFA 1PV4A 5I7FA 4AHCA 1W4AA 4FTWA 4L2IB 3H97A 5EG5A 2VKQA 3SHFA 4DCJA 2GARA 4U39A 2QEQA 2Z04A 3L8DA 2I3BA 3NKLA 2ZTMA 4MKZA 2CLIB 3H8SA 4A2PA 2CVQA 1TAHA 4K6MA 1WKVA 3UCEA 5F2OA 5GZ1A 2TMDA 2YRWA 3NHFA 4KOEC 1E1DA 2OBFA 2Y1XA 1V55B 4G27B 3C45A 3BSFA 4OX9B 1Z0UA 2NNUA 3Q0TA 1Q6YA 2CZCA 3B4SA 2JBWA 1G8HA 3GOHA 3A1UA 4RPIA 3V8EA 3TQRA 1OXMA 2AFHA 1TL7C 5JY6A 4RPJA 1UINA 1FW8A 1ENVA 2ZK7A 4YRKA 2JFNA 4JI8B 2W4IA 2AOUA 4CG2A 2XLCA 3FHOA 2ECPA 1OFUX 1YITF 3R3ZA 1J06A 3UHFA 1SG9A 2B98A 2GT1A 5J5VA 3VVBA 1UMKA 5C8DA 3VVMA 3Q5EA 2F43G 3PFHA 4WKGA 5DBOA 1FS5A 1W44A 2NO7A 1KQPA 1AKEA 3HYNA 4WESA 2JANA 1J6UA 2P40A 5DGTA 2CUNA 2DFDA 1K73H 2R8YA 1V26A 4OPMA 1NR1A 3PUJA 1E5DA 2REXB 1IZ3A 1SIOA 1E8DA 4H4DA 5JNVA 4IXDA 2Z83A 3BTUA 4H0FA 4UUPA 3D3KA 3UMMA 4BC1A 2QRMA 1CX9B 4CQMD 4E5VA 2AE2A 2WLSA 4LHXA 3F98A 2PXXA 4TRJA 1XX6A 5JH7B 2Z57A 1BHO1 4LHVA 1VLJA 3Q87B 4Z7OB 4NYJR 3T3HA 1X80B 1T0IA 4M0DA 2P9GA 1X15A 4GWLA 3AX6A 4XWTA 2YH2A 3U0ZA 1KOFA 2CV0A 4E88A 3T3MB 1NSFA 4QKQA 4LWOA 3HDTA 2OE2A 5EBWC 4LZOA 5M34A 1ULHA 2X0LA 3QU2A 2PZJA 3JQ9A 2VNJA 2WY2D 2Q07A 4YY3O 2O5VA 5MN4A 3EFHA 2CXOA 2D1YA 4RHYA 2I3DA 6AT1A 3IJEB 1MX5A 2BFEB 2GTHA 5JYBA 2ODEA 1N5KA 3FDZB 4LNAA 2VGMA 5E6SA 4V39A 3KEQA 3LUGA 1SQFA 1LLCA 4MHOA 4Z3KA 3T95A 3EC2A 3SZLA 4TS1A 3Q3GE 4RFSA 2VHQA 2JJ2D 1T8SA 5ALZA 5HCIA 1KYYA 4JC5A 4XGQA 1K8YB 3RGGA 5DSZA 4PHHA 1OU4A 4OB8A 5A4FS 3KYDB 2BLNA 2KTVA 4JX8A 3SYLA 1B41A 2QZJA 2WM3A 4KPGA 1QSGA 4AKIA 4P5DA 4HH1A 5M04A 1K89A 4NZPA 4IS2A 3DFKA 3FJ1A 5ELLA 4XWKA 1X9HA 5JMOA 1VQLF 3ZCQA 4DQKA 1QIKA 5FRDA 3LNTA 4MUHA 1SBTA 3C15C 3P0IA 1CE8B 3KB8A 2ZUDA 5EP2A 1N2BA 3EVDA 1II8A 3IVGA 4RVDA 3OMNB 2ES4A 1E6EA 3EPRA 2KB0A 5HIIA 2ZBDA 4E5DA 5HYVA 3EZXA 1KFCB 3LQFA 3PYMA 4D92A 3WQQA 1R7RA 2BGLA 2GZDA 3HBFA 3AKCA 3PR3A 4JJIA 1GRJA 4TMXA 2H06A 1T8UA 2GBOA 5EPOA 3WICA 4F5WA 3H1JH 2A9JA 5JHHB 4M37A 1MJHA 1X77A 4XQ0A 2IP4A 3OJFA 3K0BA 1Y3FE 2ORIA 3K1JA 1D2CA 5DXAA 4CKBA 2Q5IA 4O6VA 4QQFA 4CETA 5KB3A 3FNEA 1R4NA 2COKA 1CY4A 2ADPA 3QKIA 1FDWA 2R66A 4KIGA 3EXG2 3HBAA 2K7FA 1QHTA 2PG3A 3WHLA 4I9GA 2CCJA 4MS4B 4M46A 3G2LA 4BVRA 1NQUA 4MW1A 2XOKD 1GXSB 3V7NA 3O1IC 3VA7A 1OB5A 3NK6A 1M2EA 3J81A 3Q3HA 4E5SA 4BMDA 1PUJA 4J41A 4PE5B 3LMEA 2XB2A 2GCOB 2EINC 3ITNA 1E60A 3PPWA 3GAZA 3TLMA 4R9RA 2M2IA 3ZD8A 4L8JA 2SHKA 3DTVB 3X0DA 3G0HA 3UMYA 3KJIA 3ELUA 1Q12A 1CJCA 1YULA 2DT4A 4GD3Q 3TUIC 3DE1X 4DNFA 4OAPA 2O8BA 1X8KA 4C87A 1WMSA 3K5PA 4XXHA 3G9ZA 1E3LA 2BUBA 5CA0F 1KI4A 4HWGA 1MMMA 1R3DA 3GV0A 4P3YA 2VDRB 3LNCA 4EPTA 4XDHA 4Z9BA 2GEDA 1SD5A 2AWOA 5CDFA 3ZJYA 2XGMA 1I94B 1L8QA 1TQDA 3CTPA 1ATIA 3RE1A 4HBNA 2QGZA 1TLFA 1SKUA 2ARKA 2G67A 1RHKA 3ADBA 4UE3S 1RP3B 3JAMN 2XMSA 2CZGA 4YPFA 1YJQA 1IHYA 5I7AA 3EIUA 2QTMA 4YRCA 2RE8A 4HT3B 2A78A 3DWIA 1LSOA 5LLSA 1PSZA 4N3BA 4RHXA 4Q3AA 2WABA 4NU5A 3H8WA 1MFPA 4EP1A 5D00A 4E2WA 4B7CA 3HR8A 5E6UB 1G20A 1VPTA 2R6GA 4EH1A 2CXQA 1OBFO 4RXTA 3V9AA 3FYHA 4R0NA 2FR0A 4O4LA 2I7VA 4YRJA 3W1WA 3GT7A 3DAOA 1F14A 2ZWPA 1T9ZA 4CMHA 2QGFA 2WPDA 1WPXA 4FOPA 5LXTF 4DUZB 1T36A 2NO6A 5LBTA 3SPXA 5I3ZA 4I0WB 2OZPA 5JO0A 1I9GA 2JZNA 1P5RA 2PTHA 4MS3B 2J3MA 3RHTA 4MWCA 2EARA 1NR7A 1DXHA 2IUFA 3GLHA 5A3JA 1COWA 4YCNA 4TTIA 3O4GA 3QFHA 5H9WA 2NV6A 1HA3A 4DADA 1E2BA 4ERHA 3K32A 4XWYA 1PP4A 5A4DA 3VH4A 3K79A 4M60A 5ALWA 2YV1A 2IRWA 2GTIA 2YWRA 1XMVA 1PUIA 2AW5A 4OKNA 1CLUA 1GGNA 2ZRGA 4CGZA 3LX8A 3AR4A 1DG3A 3GLVA 4HNQA 3S68A 3BVOA 3WYBA 2QTGA 2PLFA 3QYJA 3AUJB 4CCAA 1LPNA 5AM1A 3N59A 4JVOA 2IJGX 1X8LA 1SNYA 1Z5UA 3G4SF 1CQIB 3DB1A 4B34A 3AEQA 4UAJA 3K5NA 2HA7A 1P0CA 4GX1A 2PLNA 1A8UA 1HDIA 3D0OA 4JU9A 1FXWA 4X84A 1AS2A 1XZPA 4ZJUA 1KC1A 2XT9A 2EVWX 4ZZ0A 1J8DA 4FLUA 2EQAA 5KREA 2FUG1 1WE2A 3A0HZ 2CE2X 3AERA 1GKUB 4AQDA 3G0GA 3PDJA 4OMFG 1KKUA 4RA9A 2Q4PA 5TPWB 5JJIA 4PGMA 2PBLA 2MYPA 4TT3D 4UATA 4UVIA 4MEJA 4OLHA 5AW2A 1X14A 3SR3A 3FDIA 2A0XA 2QMEA 4EO4A 1GCGA 3HLKA 3RK1A 4JI0O 3K57A 4WFQA 1SH7A 3HUFA 4YT2A 2C5AA 3BT7A 1ECFA 2QAGA 2R8XA 4E5MA 4L6AA 3KE1A 3UFBA 3OHMA 1CJTC 4MQLA 4ZKEA 2DWQA 3ZVLA 5A4JA 2GZHA 2B3DA 4U9HS 1IY8A 1NXSA 3WSTA 3LX6A 4KXWA 3VX4A 3PPVA 5HWEA 2O1SA 2XV1A 3CC2V 5FI1B 2B30A 5HPYB 2FPGB 4LHSA 3WWYA 3WLLA 3WL3A 2VJKA 2V9ZA 3BJEA 1RIFA 4HSGA 2J08A 2DVMA 2MW2B 3F8WA 4QOEA 1L8XA 1UBRS 1YB5A 3M6FA 1GAWA 3RUPA 4UMVA 1AB5A 1EFKA 2Q2QA 4PN7A 2YXEA 4B9EA 2BEKA 5ICCA 3HLTA 2HP8A 4E70A 4PPYA 2QQGA 3IALA 4QPNA 4BBAA 1QWOA 1NW9B 3AVXA 4JU8A 1VQ9F 3Q4HA 2QWRB 3LSYA 2HQRA 4ASUG 3K5LA 3D02A 2E5FA 4EJFA 2WM8A 2IHUA 3IP1A 2XMGA 2HT6A 1Z34A 2RDMA 4QOHA 3IT2A 3T7IA 1IHOA 1VPEA 4TYYA 4EF4A 5K6AA 1IBCA 2YCBA 4LHZA 2WF9A 2REQB 4LRSB 1E6WA 2F67A 3OUTA 2KG7B 4O02B 1MLDA 3GZJA 3CPHA 2ZI6A 4RD6A 1G42A 5ALVA 5JVDB 2B0CA 4ITUA 5IKMA 3FMGA 5K8TA 3OQPA 1D2HA 5EJMA 4DL9A 5EQDA 3MJVA 1W52X 4RTOA 3GLGB 3H9JA 1WSBA 5C7YA 1XPRA 2FMTA 3I4FA 4YRSA 3WADA 1E7QA 2J0UA 5FOQA 3IUYA 2OCDA 2VSXA 4DV7O 3TMAA 2CGNA 4A03A 1PJ3A 2A8YA 2DEUA 2R86A 1PL4A 5REQB 1JDBC 1FXUA 1UK8A 2FPMA 1XRGA 1QPZA 1G3RA 1D8TA 4PQEA 2GBLA 1Q1GA 4P30A 2YDXA 5IVPA 4J0JA 4R16A 3I1FA 4GGOA 2XOXA 3GGCA 4D79A 3TD4A 1JFFB 1DC4A 1VMIA 2BHNA 2XE6A 5FO1A 4CDNA 1U7OA 4LGVA 2O3SA 1BN7A 5KMGA 5DP2A 4WFIA 2O8CB 4C8GA 4JJEA 3F0EA 1Q92A 4W4TA 4BQFA 4RA6B 3R0VA 4XB6B 4ZZ2A 5ADVA 5ECWA 2QSZA 1GM7A 2H8KA 3O2SB 2PH7A 1E5VA 3UWOA 3WNQA 3SC2A 3K8ZA 2VJOA 4Q4JA 2F9ZC 3EPLA 4Z8YA 4DS3A 2ZAIA 5F4BA 1V4VA 1XT6A 5LMZA 1RQPA 5AESA 3EZ6A 1S0UA 3OCYA 4RHUA 4XRRA 2WF5A 4L5CA 1TEZA 4IUCS 2WIGA 3H2JA 4B8YA 3EN0A 3UO8B 1CK2A 2JIOA 1EU1A 4HS4A 2BZSA 3HRHA 3GROA 3B6MA 4BFWA 3GO4A 3NHWA 5EWJA 1CUSA 3JR7A 1SUBA 2TMYA 2ZI5A 2V4DA 3OT1A 3W7TA 2BR5A 3GFBA 5H82A 3PIDA 3GCDA 5IHXA 5FWXB 3J81k 2J31A 3MAQA 3KSAC 3KR2A 2FSIA 2PTGA 3MHSC 3E89A 1ES9A 4TS3A 4AZ0B 4I4TB 2FWAA 2BGTA 3V97A 4X6UA 1UZUA 1CJMA 1RAAA 2XUFA 1H2SB 4PA4A 2FW6A 4GQAA 3AR7A 1V1RA 2HR3A 1ISGA 5DM0A 1QGAA 2YNMC 1H2BA 2GWRA 2IZ6A 2XB9A 3ZMVA 2JA1A 2ZTUA 2P9CA 3QXGA 1UPUA 1E6UA 3NVKI 4EO9A 4MVRA 2AC2A 3V33A 3UHOA 3FB7C 1KJ8A 2HIHA 5A06A 3AK2A 1C8KA 3F78A 3VKVA 4CW7A 1VYVA 5KYUA 5J9FA 2QEXF 5KWEA 5HDBB 3TZHA 2TS1A 4I50B 1JZTA 2DHRA 3N2YA 2AG0A 4X66B 4EEXA 3AL3A 1E3QA 5EMJA 3VGPA 4V0RA 4F60A 1N78A 3ZG6A 1SHLA 4XDYA 2XQVA 5CH5A 1TXGA 5A62A 4D4IA 2C00A 1JA9A 1QFZA 1C7JA 2ZJOA 5ALPA 4X3PA 3C1UA 3WYDA 4MMYB 3ZHYA 3LWRC 2H31A 1OI4A 4C0LA 2G17A 3LWOC 1VGRA 3FX7A 2H59A 3DPUA 3ENZA 1RBMA 1Y5MA 2GERA