3E22B

Tubulin-colchicine-soblidotin: stathmin-like domain complex
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
427
structure length
419
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1C chain
publication title Structural insight into the inhibition of tubulin by vinca domain peptide ligands
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 110
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3e22B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3e22B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3e22B01
3VO9A 3JAKB 4EB6B 3WGKA 4I55B 5ITZB 5CA1B 5JVDA 5JQGA 3UT5B 3V3TA 5LA6B 4I50A 5KMGA 4B46A 2BTQB 2BTOA 1TUBB 4DRXB 5IYZA 3E22A 5LXTB 4FFBA 4I4TA 5CA0A 4O2AB 3WGLA 3N2GA 3HKEA 5JCOA 3JATB 3VO8A 4X1IB 1Z5WA 4I55A 4TV9A 4X1KB 4F6RA 3JARB 2RHJA 4O2BB 5GONB 3UT5A 4IHJA 5LA6A 2XKAA 2RHHA 2BTQA 1TUBA 4ZOLB 4TUYA 3RYCB 5LXTA 4ZI7B 3JAWB 4O4HB 5CB4B 1OFUA 4O2AA 4HNAB 1W5BA 4B45A 3JATA 4X1IA 5IJ0B 4DXDA 4WBNB 5MN6A 5JH7B 4O4LB 4O4IB 4X1KA 5IJ9B 1W581 4O2BA 5GONA 3HKCA 1W5AA 3C8LA 3ZBQA 1W5EA 1RQ2A 5BMVA 4ZOLA 2VXYA 3RYCA 2VAWA 4ZI7A 3JAWA 5LYJB 4O4HA 5CB4A 4HNAA 2VAMA 5EIBD 1TVKB 3JAKA 5C8YB 2RHLA 2R751 4EB6A 4X20B 4WBNA 3R4VA 3ZBPA 4O4LA 4IIJB 5J2UB 5IJ9A 2GVIA 5ITZA 5CA1A 5KX5B 1SA0B 5LP6B 3RB8A 4DRXA 3VPAA 1FFXB 5LYJA 3ZIDA 3N2KB 5EYPB 5J2TB 3VOBA 3JALB 1TVKA 3HKDB 5C8YA 4X20A 4M8IA 4IIJA 5J2UA 4TV8B 3JARA 4EI7A 5EZYB 1SA0A 5EIBC 4LNUB 2RHOA 1FSZA 3RYHB 3CB2A 4U39A 4YJ3B 3HKBB 4EI9A 3N2KA 4XCQA 5EYPA 3JALA 3HKDA 5IJ0A 3RYFB 3JASB 4X1YB 4YJ2B 4O4IA 4TV8A 5JH7A 1RQ7A 3M8KA 5MN4A 1W59A 1W5FA 3M89A 1RLUA 5M7EA 4FFBB 5CA0B 5LP6C 1Z5VA 4ZHQB 3HKEB 5FNVB 2R6R1 3RYHA 5LOVB 4E6EA 4YJ3A 3HKBA 4TV9B 4U3JB 3RYIB 4F6RB 5MN5A 4O4JB 4IHJB 3VOAA 3RYFA 2Q1XA 2XKBA 3JASA 4X1YA 4YJ2A 2Q1YA 4TUYB 1JFFB 5KX5A 4KWEA 5LP6A 4ZHQA 5FNVA 2VAPA 3WGJA 1FFXA 4EI8A 5LOVA 3WGMA 4U3JA 3RYIA 5JVDB 5JQGB 3HKCB 4O4JA 5J2TA 3WGNA 4I50B 5KMGB 5BMVB 5IYZB 1JFFA 3E22B 5EZYA 4I4TB 3N2GB 5JCOC 4LNUA
chains in the Genus database with same CATH superfamily
3GEBA 1TUBB 4FMDB 1LK0A 3GPDG 3QUCA 3ESBA 1UEXC 1CRPA 4BYGA 2J9ZB 2R00C 3HYCA 1YDEA 1PFUA 1GUBA 1XU4A 3L41A 2MINB 1JALA 5I9MA 4D42A 2YWBA 3WQRA 1E2MA 3R8FA 3BCRA 5EPUA 3C7AA 5H9CA 2ZJZA 3RFVA 2PUHA 4L3WA 3B6JA 4X61A 1AX9A 3O9MA 3RG8A 1CFZA 2E6KA 1QLEC 3S4YA 2H0QA 2FPXA 1SKYE 5BYBA 4FYWA 3K14A 1A9SA 4GG1A 1QGOA 1HFWA 1WV0A 1NT4A 3W05A 1Z6YA 2CNNA 2F95B 4QREA 2XCLA 2O0MA 1FF9A 1KK1A 1XBTA 1H2SB 5KAPA 1GKUB 2GR9A 2HMYB 4R1LA 5T4EA 1R0CA 3L1KA 4GVLA 2FCAA 4IJVA 2TYSB 1MDFA 4FI3F 2Z1TA 4B74A 3QBEA 1G0NA 1CRWG 3D43A 3NANA 3V3TA 1EDBA 5A4FS 4BB6A 2FWPA 3V9AA 4AB1A 1CUIA 2P7HA 4X7RA 3NV9A 2YUAA 1TT7A 4IOKA 1YTUA 1T3TA 1H23A 4IM7A 3CVXA 3RRJA 4D4MA 1BE1A 1V0JA 4KKVA 5FYDA 2JVJA 1QHFA 3RIYA 1IVYA 3ER9A 2CFIA 1GGJA 5T4FA 3P20A 1AGPA 2VUIB 1RBMA 4KBGA 1F20A 1OAOA 1BSVA 2E89A 5DHFA 4BO6A 4C07A 1OV9A 4J0HA 1MAVA 4X64O 4EL5A 3OE7D 3TFQA 3NWBA 2VFAA 3GG2A 621PA 2XKJE 4FTWA 4KI0A 5BV7A 4LGYA 3OBBA 2I4IA 3IUNA 3LTNC 2Q8NA 3QWHA 1OHHA 3FTNA 1WSBA 4PYOA 4XPIB 3AG2B 1J5EB 1MJGM 3ERNA 3BMOA 2FRDA 3IBSA 3KWFA 3RFCA 4QFBA 3EY9A 1O5TA 2L18A 2QG4A 2A9KA 3AJ9A 3FZYA 5LD2C 1SNYA 5CBHA 1PK8A 4R9RA 2O8DA 3IHWA 4RE6A 1ILEA 1VQNF 3M7MX 3D3EA 5E9JA 4JJKA 1IE3A 5JCJA 2WTNA 3ZJ4A 2GVDC 1AF7A 2A6PA 2FC3A 4X6XA 3F6BX 2GNPA 3TLEA 4RSRA 3FNIA 3THYA 2WQ7A 3AF2A 3VR1A 1R88A 4V0LA 5E6SB 2X0JA 5IKEA 4W9NC 1MTZA 3B77A 1SCBA 4N3BA 3O2NA 1C3OB 4OUDB 3NBQA 2YVAA 3OZBA 1X87A 1HDCA 5EKUA 3HPQA 1C81A 4BASA 3JR3A 2IYFA 1TKCA 1S6YA 3KZXA 3OOWA 3IJRA 2WWVD 3H6HA 1T6XA 1U2PA 4N0EA 3ZCPA 1EXDA 4RBNA 2WLLA 3CNQS 3AEQA 3IQDB 2I1VB 1N9ZA 5LQSA 1ADBA 3UAGA 2GA9A 4BMPB 2EFEB 2YYAA 3CKMA 3IO3A 4YDRA 4LI0A 4BNXA 4F91B 1NP6A 2YUIA 1R9NA 4B34A 3IBGA 4ZU3A 2GF9A 2HKIA 3FYUC 2L82A 1WW8A 4U5XA 3ZTYA 5D87A 1D2AA 4F12A 1W1WA 1NF3A 4F4UA 2E82A 1GGNA 3BBLA 4I9QA 3FB7C 4ZVNA 3KQNA 3PT9A 4HNVA 2JKYA 4GWGA 3FB5C 3RIHA 3K1AB 1E3EA 2IH3C 5CNKA 3D8HA 2VZ0A 5EUMA 1G5IA 3AEUA 4MS1A 1X80A 4GQAA 4KNWA 4IKPA 4EG4A 3HV2A 3SHQA 4AVYA 4BRSA 2YXEA 5K05A 1P45A 1G6UA 3A1DA 3J81M 2Q0SA 1V48A 3O4IA 3UANA 3R9XB 4JOCA 4M76B 2OGZA 1G9XA 3IAXA 4L72A 2OXEA 2R1TB 3IVGA 3FETA 5K5EA 2N3ZA 5DKFA 2WU0A 2GBGA 4B87A 4WY5A 3RVQA 4FZ1A 1YBAA 4UOEA 5KNBD 1O6CA 3I55F 4ZCSA 5M7EA 2OMKA 5ALUA 5B1HA 1IHPA 2ZRHA 4CFZA 4RFLA 1E1MA 2FL4A 3K09C 2DXIA 3R0JA 1R74A 4MVJI 4FC6A 4IVNA 4MMXB 4UVGA 3L4JA 2BH9A 2HL6A 1P9RA 1I4LD 5GINE 4FONA 4P4SB 2V7UA 2AJ8A 3K2BA 3RUIA 3LBFA 3QP9A 1NBEA 4PD4F 4RETA 4BVGA 2BUBA 1V7ZA 5EHZA 4L02A 4UZFA 5ESRA 2X4IA 5EBLC 1RWVA 2GPTA 1OJ7A 1G3MA 3Q2IA 3M81A 4AC9A 4WBNB 4Y1GA 1NTMH 1DAIA 2UVPA 3O8OA 3ZEAA 4NBVA 2XVAA 1DKPA 1VA5A 1OIXA 8GPBA 2AUTA 1VPTA 5IDJA 3BEOA 1O0BA 3OKPA 1SUCA 2C5EA 3W7TA 1W73A 3DB2A 2ZPUA 2Z6QA 2IE0A 4EYSA 1GA6A 4LGVA 3AR2A 2D5AA 5HF6A 3OWXA 1CDOA 2R87A 3TPCA 4UOQA 5PGMA 4KBFA 2QZ4A 1G6KA 5LQKA 5L3QA 2JLRA 2RE8A 1WPBA 1JR9A 1TPYA 2P6UA 5AKLA 1I13A 2E76B 4US1R 1PCXA 1LI5A 4H7IA 3C3SA 2JI8A 2GJAA 1QD9A 2QAIA 4HH3C 3K5HA 1JJOA 1V25A 2AA3A 1XIVA 5BUQA 2XCRB 3ZNQA 4CQMD 5FTNA 3D5EA 4KLRA 4RK6A 4PHHA 5FOXA 4ACBA 2F43B 2PFGA 1VP3A 3D6VA 3PKZA 2IK8A 4B3HA 5GONA 5DI3B 2O5VA 3RD5A 2XQIA 3VVMA 2JGRA 1G8JA 1R4AA 2CNOA 3EH1A 4OCZA 3DCJA 2Q0XA 5ITSA 1NJSA 1X1RA 2M6RA 3R1IA 2WTEA 5AOVA 3OPNA 2CE7A 1TX4B 4IZ6A 2JNBA 3JQGB 1D6MA 4EYEA 4Z7OB 3W9UA 2QS9A 4MTGA 4D7SA 4DV7B 2JEOA 2GEBA 3IERA 3G2MA 3DOCA 3AFGA 5K3CA 1DQNA 3LQQA 3H9UA 1FFBA 4ISCA 3WK8A 1N5MA 3FBGA 1UP6A 1SVIA 3ETGA 1P1FA 4JLWA 3B2EE 2FSUA 4QQFA 1JLKA 2H52A 3B5EA 2Z0AA 5A9SA 3DHWC 2FG7C 4TTIA 3K5IA 4U7DA 1FYVA 1WXHA 1YZTA 2V6FA 5KPJA 2ZTMA 1J24A 4WI1A 3ECSA 1Q11A 2DUNA 4JB3A 4PLZA 5HE8A 2B30A 3W8RA 5TF4A 1YE8A 2HS3A 5EJ7A 3UOAB 3A0HZ 3AK1A 2ORWA 1A1SA 5AVXA 2CBZA 1NXSA 4TTVA 1R9MA 2ACWA 4TN1A 4YBRA 4QOHA 1MIHA 4YJKA 3I1JA 3F49S 3CUUA 1ZISA 3KFLA 4G0QA 5E1AC 3FZNA 4Q3AA 2PKEA 3CW2A 2GEFA 1YBFA 2ZJ3A 1L5KA 2QLMA 5E7QA 3D4IA 5LDHA 1DXQA 4M8NE 4GPTA 1EFLA 1NVVR 2E9SA 3W2IA 3UAOA 2VTBA 2CAZC 4FX2A 2R8PA 4G24A 4BXOB 4UVCA 5LQUA 4W63A 4RL6A 1QGAA 5IKMA 2IEGA 3Q15C 2OC4A 4V39A 4KPEC 2OENG 4KTVE 2UKDA 3F2VA 2C7VA 2HT1A 3C8LA 3KVOA 3PIRA 2I87A 1JR3D 1FP6A 5AMXA 1KR2A 3HWX1 3LF2A 3DLAA 1HSOA 3QSYA 1KNKA 3D3JA 4CIWA 2GD2A 3PDJA 5CMUA 2EX1A 1W3EX 3PTLA 2AJBA 1WEHA 1JHRA 2C8JA 3I04A 1TT5B 4JB2A 2OUIA 3M6UA 2AG1A 1QONA 2R79A 2XWBF 3U3JA 3H1TA 1Q91A 5EZQA 5CUQA 4LYJA 3Q6NA 2QG6A 5FWXA 4HFJA 1T9BA 2QG9A 3LI2A 4C14A 4C0AC 5MN5A 3KVYA 1K73W 4LZOA 4LOJA 1I2ZA 3ZY3A 1WNTA 5EIAA 1TTTA 3E9ZA 3W5JA 4OLJA 4MKRA 1CKEA 4MRMA 3SOPA 4ZMRA 2PUEA 3RQSA 1K8AH 5EE9A 5LA6B 1CRLA 3NHPA 2ITCC 1F8GA 1UBSB 3D8NA 2GJ8A 1ECLA 4TTTS 5KTSA 3AEKB 3N0TA 2A86A 2HMAA 3LO5A 5G02A 1UMCB 3T1NA 3RG2A 3HNOA 4M8KA 4GVPA 2XECA 2FE4A 3RSHA 2R1ZA 3L84A 1V8BA 4ID3A 3K0FB 3L9WA 4E3ZA 2BI7A 1IBSA 4NPCA 1NE7A 3WPWA 4JT8A 1VHAA 1E2DA 3UK2A 4CM4B 1M90W 1YGPA 1X42A 1OYWA 3DEKA 3ILVA 4G0YA 3P52A 1D03A 5CEEA 4ZVMA 1GKFA 2GYUA 1VMAA 4ICGA 2ZXWC 3E2PA 4HATA 5FPYA 2WNHA 1U65A 4R5MA 3R9KA 3H1KH 3P96A 4QTZA 2DAPA 2JFPA 3HDTA 4Z4EA 1YNSA 3LPDA 3PTZA 4BQSA 5IYDO 4HGOA 4Z4QA 1TFRA 2XF2A 5HMLA 3VV2A 2YJ5A 2R48A 5JMWA 1ZW1A 2NAFA 3FF1A 3U7RA 4GECA 6GPBA 4URFA 1QO0D 4ZZ1A 4NBTA 4ZHYB 2IU3A 4R40A 3WP0A 3OPYI 4XLZA 4B4KA 2OHXA 2ZBGA 1UJ4A 2ZKIA 4MTOA 2WAYA 1EUYA 2O2SA 2AI1A 5CA1A 1XNQO 4A8JA 2ZDHA 2EKZA 1TRKA 2C7GA 2WLIA 2CL0X 4O08A 1ZD3A 1RMYA 3HB3B 4Q1EA 3Q8LA 1K97A 5A2GA 1XDUA 3MTIA 1P31A 3KHUA 1ZGAA 4OP3A 4DC1A 1W7AA 1QFZA 4HEA1 1Q77A 1UFVA 3RKUA 4AI6A 1W59A 3KAKA 3WGQA 1XPOA 1VQ4F 2NU9A 2XUHA 4XUDA 1Z47A 3C15C 3IEUA 1U9IC 4IINA 3BD6A 3I12A 3WS7A 1N3IA 1V5WA 2ZVQX 3H5WA 4ZK6A 3FCSB 1KJZA 2GF0A 1W87A 3DMRA 1RWNA 1T9HA 2BFMA 3IB3A 4NMMA 5JCOC 1W2BF 4JYZA 3OIWA 4EH1A 5BWMA 5KAMA 2JJYA 2H57A 2JFOA 3G2PA 4HC4A 2CV0A 1CRQA 4PGMA 1THMA 4F3RA 1AZLA 5L4LA 3QE2A 4IQFA 1PYGA 1V7PC 2Q5FA 3FPHA 3OIUA 1V43A 5LZ5A 4LFAO 2NNWB 1R0KA 4BJ1A 4GLJA 2VH1A 2ERYA 3HR7A 3HJBA 4BAZA 2Q7DA 2XLBA 1F1BA 3SFZA 1RKBA 1R3KC 4LXGA 4EDFA 1K9SA 4WSOA 3HR8A 4B3SB 5LBTA 3CHYA 3DKIA 3CIOA 4D8XA 4PVDA 4UTXA 4COOA 1X7PA 3IQZA 2WRZA 2AFHB 1DEKA 3A4IA 3JASA 4DUPA 1Q92A 4H1WA 2P6OA 4BNLA 1UFRA 1U9JA 1D2GA 3QO5A 3TOZA 4R16A 2IPMA 4OQQA 4RFVA 3TGWA 4EHJA 4CG2A 3PGXA 3C8DA 2R00A 4JHXA 4UV8A 1XWFA 4JV5O 1DO0A 4XWTA 1A4XA 5BR1A 3PQ7A 1YZBA 2G4LA 4R50A 5KDLA 5U4XA 4BP3A 1XX6A 4LG1A 1UDBA 1S5PA 1JY8A 3NNSA 4YRAA 4G27B 2R7LA 4OBEA 1R0SA 2GV9A 1JDPA 2FKNA 1C3VA 2Z5GA 5LJLA 3EC7A 2GKSA 4CKBB 2JIQA 4KO2S 4NRDA 1F17A 4B62A 3OOSA 1UXOA 3GCXA 4LQLA 3ABZA 1F2DA 5EZYF 5CFMA 1YR3A 3MIZA 1TF2A 4WQMA 3L7YA 3F9CA 4WK6A 2HF2A 5AHKA 1UBMS 1CY7A 5CCBA 4KVAA 1VHJA 2C88A 3BL5A 2VUSA 3E2MA 3CSDA 3ZI0A 3WMGA 3ASOB 3PVSA 3UHFA 3WK4A 2WTMA 4AF7A 5FD8A 2RHGB 2WB4A 6ADHA 4PJ0Z 4ZFNA 1EFAA 4IIDA 2QB5A 5HY1A 1JTFA 2M7WA 2ILTA 4GD3Q 3RBAA 1XNRO 2GNAA 4ZIRB 2QTVB 5H81A 2Y4TA 3NIGB 3KHNA 5IN4A 2H4ZA 3ZX6A 5AM2A 3IJEB 4MEBA 1C80A 5IJ9B 4OKNA 4YWHA 2VAWA 2DFPA 4M88A 2IYEA 1H8EG 4EJFA 4WADA 1PJZA 1GITA 2ODAA 2ZWAA 5JAPA 3E3MA 5KTKA 2PQ2A 1M0TA 3CCSF 2IBSA 3GMDA 3OPVA 3W6UA 4LW8A 3TSYA 1W76A 1YQXA 1T36B 2XNKA 3LQ2A 5J63A 5KYGA 4I66A 4E5PA 5CIWA 1N2JA 3V4DA 1Z38A 3COWA 3CT4A 3LT4A 3BB4A 2PMEA 3CMMA 3WHKA 2GHIA 1XRMA 1Y63A 1N5DA 1TAEA 3H0EA 3HRHA 4MTXA 3WOHA 4Q4CA 4P1ZA 4AFNA 2NX2A 1I3KA 3SSMA 3KB6A 5D5PA 2AS0A 4IDNA 5ECWA 1SXJD 3L0CA 4M7OA 2BISA 4X45A 4Q02A 1F7UA 1YEWA 2O9JA 2FA9A 3ETNA 1DARA 2OBXA 2ZTSA 2WYHA 1UZUA 1T2DA 1BEZA 1YHYA 2FK7A 2Y66A 3JATA 3KT6A 2IITA 1GEGA 2JJ2A 5J5VA 2EQ5A 2GEUA 5AKYA 2RGBA 3PNBA 5C8YF 5AM4A 4LY3A 4QO7A 3WLAA 2WTXA 3ZHVA 1GNTA 1DQSA 2D1FA 4F2GA 1ZW6A 4NCAA 2HP8A 4PN3A 3IAM6 1KQSU 3B12A 3I32A 1K92A 4IDOA 2YVLA 4OA8A 4NXNO 4L0CA 4UATA 2O1SA 4YRFA 4G8JA 2PXAA 1JR2A 4LBEC 2ZJ1A 1Q0QA 2EP8A 1E2BA 1Y9JA 1FX0A 4YNBA 4RHAA 1IQUA 3AERA 3IXQA 3ZUPA 2W11A 2R6AA 3CBQA 2FFHA 2ZM5A 1JLLB 4J4TA 1NMQA 4UJ5A 1RQXA 1JFLA 5CFLA 1P29A 2IYYA 1IJKA 2AYYA 4I9FA 2QBYB 4KP7A 1R3DA 2NSJA 1G8MA 3ZGYA 2R5NA 4N7JA 2Q46A 3CS3A 1GD1O 5TJHA 5JLAA 1UXKA 5HIIA 1MZVA 4ZQCB 4DLYA 2C78A 3NHKA 4MWDA 2GTPA 3PEUA 2BEVA 4MPDA 3VAYA 1M76A 5JPCA 3BFVA 3LDFA 4JI7B 3RIXA 5FLXA 3D1JA 3O8RA 5CVDA 2ZWPA 2N0SA 4YRBA 2XUMA 5J2TB 1RZRD 3TEFA 1PNQA 2Y1WA 5J2UA 4F3KA 2BKAA 3CVJA 1FQWA 1N77A 1IY9A 4V0SA 2J5BA 1MV5A 3H4VA 4FJCC 1IJEA 1WEKA 5JY6A 2IXEA 1FP4A 4ID9A 4YMUA 2FWJA 4Y9TA 3KKPA 3LL4A 1Z8DA 2XEDA 1LBIA 4I36A 4H7EA 3JWHA 3WU2Z 4XD7A 3LOPA 4BQRA 4NOJA 5LMZA 4Q16A 1O3YA 2JHAA 5G1PA 4ZTUB 4BT4A 3VVBA 1DUVG 4QODA 3OWHA 5IJXA 1J25A 4LDNA 4QE7A 4U2EA 1F8YA 5PNTA 4ILEA 2I91A 5HRAA 1P1CA 3G17A 5TGTA 4LI3X 1Y1SA 3AINA 3B1WA 4UCVA 3ZDXB 4QXAA 2FZGA 3TBKA 1WXEA 4N82A 2LE0A 4YACA 3L1UA 1UFYA 1OXVA 1L4HA 1JI0A 1JU3A 4JEMA 3TKYA 2O5CA 2OO3A 3OOYA 1GFWA 2GJ9A 4HAWA 2A5LA 3C85A 2IWHA 4EO7A 5HF8A 4B9AA 5DLDA 2GAIA 4Z4HA 3DG9A 5C4IA 2DWEC 4AKSA 4JIGA 4YAIA 4JYAO 1NKDA 1X8KA 2JF0A 2N1BA 4ENWA 3VU3A 4DE5A 3LWVC 1XLTC 1A50B 1I7DA 1FOEB 3M9WA 3SEZA 2ZETA 4OU5A 1VA4A 1NPYA 1SCAA 2EP7A 3M6MD 3QA9A 2ZG6A 2W7TA 4L4RA 4JD5A 2A2ZA 3VBEA 4N0DA 1FFYA 3W5AA 4FCTA 1LI4A 5I5EA 3OZVA 4OXXA 4C5CA 3UV7A 2I2AA 3ER6A 2PMCA 4ZIBA 2YKGA 1F8UA 1DG9A 3C5CA 2QTAA 3DL7A 1XZKA 1DDGA 1BTOA 2QTMA 4Q66C 1DJPA 3H5AA 4PANA 1T5IA 2YV5A 2QIPA 2OVBA 1EZ4A 3OZTA 4MVOA 4O2RA 3AZQA 3V80A 4QYXA 1Z5VA 3OMIB 1NFQA 3IV6A 3V7EA 3IDAA 3I73A 4PYNA 1SCUB 4G0OA 1J2RA 4BKUA 1CS0A 4CS3A 2X3FA 2AJTA 3QIAA 1F51A 3GLQA 4QBHA 3TKAA 3OQIA 4ZOQI 3VR2D 1CEZA 1P17A 2E4AA 4XIJA 3CJQA 1M1YE 1ZUIA 4KP4A 2BEUB 3NG1A 2VOJA 3IAAA 3ILSA 3LQ1A 3PYMA 2K1EA 2VG8A 3PVCA 4NV0A 3U13A 3DGFC 4XJTA 3T35A 4U7GA 4NPHA 2ZJOA 3WNBA 3SYAA 5GVRA 5HOEA 5MFPA 1KYQA 3MTBA 3KKQA 1BDIA 3PT5A 5DW3A 2CN1A 3OF2A 7REQB 3F46A 4XLTA 1O96A 4NCIA 2C4HA 4ZQIA 4G3XA 3EDMA 2DQ4A 5JG7A 2VR1A 3RUEA 3UXMA 4DY6A 1R6DA 3ZV6A 1R5NA 1F0KA 3GY0A 4CLXA 4GPAA 1KJJA 1S0VA 2P4HX 3PFGA 4YJHB 1NSYA 2AKEA 4EA6A 4ZV7A 1USIA 5CK5A 1VQLV 4WHMA 1BX3A 1PT5A 1Q1BA 2A9QA 4FBMA 2NLJC 3C48A 3QWBA 1E2UA 1H2RS 3SDSA 1U1DA 2POQX 5IM4F 4FLWA 3BQ9A 2RHLA 3MD9A 4X20B 1WOMA 3SJCC 1JPVA 4H13B 2FZWA 2IQIA 3SEQA 3PC7A 1S5HC 5AJZA 2XB8A 4DNQA 3DKKA 2IF0A 4PG5A 1NXPA 3ADOA 2O23A 3P0HA 1V95A 3FOAA 3M1YA 1OSNA 1EFVA 3TE6A 5FEMA 4RIHA 5BW4A 4LSGA 1Z75A 2ZCEA 1UPXA 3NMUF 2WZQA 5AQEA 1JR6A 5FPTA 3UY4A 1GIAA 4GXQA 4OJMX 3RYTC 4RTPA 1N3YA 4G09A 1L4GA 1XYGA 1YULA 1FW6A 4RIGA 1SZJG 2DY1A 1V9LA 5D3KA 5HR5A 1Z2GA 1Y3CE 1K3FA 1JKJA 2EBOA 2ALEA 4HNRA 3ZDBA 3V2IA 5IWCA 4OVKA 5EJFA 1HR0O 4R1NA 3QJ5A 5B37A 4Q5IA 4GOXA 4BJ6A 2BTQA 3A2KA 1QHXA 4MW7A 1H38A 1VE1A 3AR7A 4B79A 3B7GA 4TT8A 2F43G 1TUEA 2UZ1B 1EHCA 3SYLA 1AQIA 4EVQA 2IDJA 1P0QA 3CR8A 2LBXA 1Z12A 5T4BA 1I6LA 4AZ3B 4MINA 1NT2A 2BI4A 3N2KB 4Q4LA 5C5IA 3D7RA 5D85A 4IKEA 5M2QA 2FX3A 4II3A 3GUVA 4R8MA 1WBBA 3CH5A 4BLOA 3AF5A 4HWSA 3PUWA 1I5OA 4IKOA 3SQNA 1MZEA 4QDUA 2A14A 2NP6A 3COVA 4B85A 2QRQA 4MA0A 2HX0A 3Q3VA 4EUNA 2JDIA 2B0JA 5JJBA 1G4HA 4IS2A 4LF5B 4C06A 5ED0A 2WJJA 2IUTA 4LV5B 5CHEA 3AWDA 1OWOA 2FEXA 5E8RA 5K0TA 3WLPA 5J47A 3FPFA 4K9PA 4G0MA 1DF4A 1TRHA 4R1TA 1NIPA 3EISA 2M1ZA 2YQ5A 2IBZH 5K3BA 4IW3B 1TECE 2CE2X 1ZK1A 3G3EA 1A97A 3REFA 4MQUA 3SOZA 3PPXA 4OKSA 5JFGA 2XMSA 4BHTA 1QP8A 3GJ3A 4M2LA 1OB5A 4Y2YA 1QFXA 1U98A 1YFKA 2RKWA 5EKTA 2PJZA 2OFWA 1F7YA 3G23A 3DBHA 3TNFA 2H54A 2GBIA 4G0XA 3KLMX 3N70A 4JVMA 4C05A 3NHZA 1UC9A 2EINC 1K4MA 5F52A 4DCVA 3K15A 4OGLA 2XGSA 3LUKA 3ERCA 4OOFA 4FYHA 1ZXBA 1G5HA 1JPJA 1XEWX 3ACBA 5HA5A 4R31A 4DMGA 3RC3A 4YMVA 3EVKA 3OLCX 4M6WB 5INTA 2QJTA 1JX9A 3WGJA 3AG1B 4CLOA 1SBYA 2QGFA 5F9HA 4OQFA 2PL3A 3OA2A 4TWRA 1R64A 2J67A 1BA2A 3JW8A 4KMRA 3AVOA 3SYCA 3LFOA 3UGKA 3CCVF 2G04A 4OV6B 2XUAA 4IV5A 1IEVA 3A28A 3PQ4A 1JQLB 4D5EA 4E31A 3HUEA 3FD9A 3BK1A 3KCNA 5DB4A 3Q11A 1XDBA 2VXBA 3NM4A 1PW7A 3EOBI 1A7KA 1GFIA 1ZM2A 4WZBE 3QFRA 1VJGA 1GMGA 1IY8A 3JQ7A 1IUNA 4JYYA 2QA4F 5LQRA 5BPFA 2IC5A 2PGOA 4EW1A 3PA8A 3T5CA 4ZRDA 1E7QA 3O94A 3LGSA 8ABPA 4O5AA 1ZKDA 3PFWO 1Q0PA 4KIFA 4YWJA 4IVRA 3PHHA 2YXBA 3GPBA 2FLKA 1R9JA 1A4UA 2AQ8A 2PYDA 2P90A 1RWWA 1NW6A 3K3PA 3L7AA 3ZLTA 4D4HA 1ZH2A 2F8SA 3UAZA 3C39A 3V33A 2OCKA 4RTQA 1G59A 1BMFG 3A6ZA 3OIVA 1JXOA 5F35A 3P9NA 2IDMA 1GZSA 2B20A 1Z5WA 3ZH9B 2BFFB 3IEKA 2B21A 4KQIA 3RK4A 4D0LB 4FK8A 3WYFA 421PA 2X40A 4MVXA 3AJAA 3ZTTA 5LUBA 4F2PA 1ND5A 4XIGS 5LZ2A 3JAKA 3ULKA 1XG5A 4MUGA 1DAGA 1MO5A 4FMCB 4ESVA 5DP2A 5AI8A 4D3FA 1ND6A 3NHMA 2CSUA 1TVKA 3MMZA 4GYJA 1OQAA 2H7XA 1RADA 3ZU4A 2MIIA 1SU4A 3HA7A 3QYAA 5IJ0A 4KPUA 2WVAA 1UL1X 4WESA 2ZWIA 3PC3A 1WOYA 4OQZA 3MILA 1K4YA 2CCGA 3H8SA 4W1SA 1M6EX 2Z58A 3O4JA 3CMEV 4K0RA 2OTLV 1LBQA 1TNDA 3R0VA 3T5PA 5L6MB 1FU4A 2VQEB 1ISSA 4DDHA 3BXZA 1NMEA 4H9GA 3VISA 5IYZB 3KDPA 1KI9A 4G1MB 2VXOA 4TXLA 5ELMA 3VJKA 4ZT4A 2XV1A 1ZWKA 3G2QA 1KMHA 1EZZA 2HMVA 5HKKD 4LVNA 4RADA 3WIUA 1U04A 1G98A 1L5VA 2WK1A 5DHQA 3KRTA 2NUTB 4NP6A 4PZPA 3SXJA 4MUHA 3SMVA 1TUGA 3CF0A 3EVEA 1NN3A 1N57A 1L0BA 4ZHWA 2NUAB 4G8CA 4MHOA 4P0PB 4FQ5A 4INPA 1MNGA 1N1DA 1SVSA 2YOFA 2JHFA 2PD6A 3SBEA 4NZZA 5AESA 4RD0A 2IYXA 2IL1A 4X1YB 2NM0A 5G3ZA 2XD9A 4YQEA 1Z4OA 1YRLA 3C3AA 4NEQA 3AVVA 2PCJA 1X3SA 2BHTA 1MW8X 4I1SA 4BPBA 1H1TA 2OV4A 4I19A 3ZHRA 1W88B 2GO1A 1FQJA 4NYJQ 1IQ0A 4UDXX 1EEXB 2UUBB 2QW0X 2BOBC 4ARSA 3B9QA 3E6AA 1P6UA 2V1XA 3R5TA 3ND8A 3TRKA 4HNHA 1NBHA 3PP8A 3K71B 1M57C 4O2AB 3QFCA 5FPQA 4XDYA 5FBKA 4F4FA 2WMYA 3QW2A 5COBA 4GZ6A 1PJRA 1AI5A 1E79A 3G0CA 1NY6A 1S5JA 4RK4A 4KRFA 1VE6A 2A4KA 2DFLA 2VHCA 2YIDA 4UQPA 3STHA 1NV9A 2C9BA 2NVOA 1XEAA 4GI3A 4L3OA 5B3SB 2WIGA 2UXNA 2FZVA 1SZTA 4JLJA 1P80A 2FZLA 4BDTA 1NDHA 1BOOA 2J9RA 4R81A 1Z5GA 3MCUA 3RV4A 4NBUA 1DRKA 1FYEA 1IHYA 2XNJA 1Y0BA 2FUEA 2GPAA 4BBPA 1STOA 1DBSA 1JA1A 5H6QA 2DBZA 4JJIA 4S1TA 3SZ3A 4EX7A 4OPMA 5HCUA 3ZBTA 1QUEA 3H9VA 4P81A 3RR2A 3WYDA 4HWPA 1AQYA 1FRZA 5TY0A 3U40A 2G70A 1ISIA 1BD4A 1RRKA 1BN6A 1X7WB 2B4KA 5IAOA 2H2HA 2IZZA 1W9MA 3G9ZA 2Z1EA 3C97A 3A3OA 2GN6A 5ITVA 4B40A 3RVOA 3KQHA 1UPUA 2OORA 3EEFA 4DMMA 3KFXA 2IXTA 3TZQA 4BVLA 2ZYUX 1JYEA 1AXEA 3FD5A 2FLVA 4LOHA 4A8JC 3U10A 5E9WA 3ZQJA 3G82C 1DQZA 1G21B 2KBFA 3DTYA 1O4WA 3HCNA 4DRYA 3ZD6A 1H0KA 3UG7A 1EWQA 3LU1A 3UH1A 4Z9FA 4G2TA 4GPIB 1ZNWA 4HP8A 3W5SA 1JJ7A 5KVQA 4GOKA 4MQLA 2IOFK 3PNPA 2YRXA 2QN7A 4NE2A 4V24A 2ZJ7A 2IZ6A 4HQNA 2B1IA 2HA3A 4LECA 1ULHA 5BNIA 2I76A 3A3NA 4CC6A 2ZT8A 1L7AA 3PWZA 5C0OE 2AN9A 3PF9A 3NC0C 1SD2A 1OH5A 3G67A 2LGQA 1QO9A 1HT0A 4YMWA 4MCIA 1L7QA 4MDFA 3NRBA 1PV1A 4MUEA 3ROKA 4D4KA 5B36A 4E14A 3IPRA 4WKBA 2YDYA 1S72F 4CH3A 2ZUTA 3DQQA 4MK4A 1N1GA 3A3KA 4JJEA 4AYXA 5I4KA 3BICA 3R9IA 3ZKAA 3UMCA 4PTZA 2B8TA 1AT1A 2G9NA 1M6VB 4HQOA 4M9UA 2ZIEA 1II9A 2JBWA 3AL2A 5I4CA 2WR8A 4Z49A 3NOVA 6ABPA 2V7QG 3ZCRA 4XDZA 5KX5F 2YJZA 3NTXA 2HRZA 5DVZA 2X8BA 1GUYA 2YYEA 2I6QA 3ZDRA 1PW5A 4GMGA 4QYSA 3M3HA 3H0CA 3QEKA 5AO9A 3FWPA 3IE0A 1XLTA 2E4UA 4GYYA 2B0CA 3IPLA 5LOVA 4A91A 3GLHA 5DZSA 1UK6A 2OFOA 3AI1A 3II6X 3TTYA 5IDYA 4I7ZB 1C41A 1DBQA 4NLLA 3DOOA 1Y7IA 3BL8A 3EPKA 4O8CA 3CWQA 3O2JA 1W2HA 2C9YA 3ASYA 4FNOA 2WWWA 3RF7A 3VZCA 1LBHA 1ICIA 2PGXA 2GD0A 3O85A 1FFEA 1WVIA 3NETA 3ANYB 1OY1A 1D8AA 1HF3A 1O97C 2D3OW 1Y8RA 3W0LB 4A6EA 1I4DD 2BSXA 3IMPA 3SHOA 5M34A 5G40A 4UE3S 1QB8A 4HRVA 1NUTA 1ZM3A 3LQ4A 4JX9A 5KS2A 2EOAA 2CHEA 3KBOA 4AKTA 2NVBA 2ZB7A 3GLVA 2WWTA 1Q86W 2PR2A 5EMMA 4PGGA 3L40A 5G41A 5B7GA 5LP6A 4Q3NA 2Q3CA 4AHCA 3AFNA 4WACA 2QVYX 1RWXA 1C4KA 4C8EA 1SCNE 1XCPA 2DERA 3DBLA 4IT5A 4EW3A 5CYFA 1NW7A 4LXQA 1XD2B 3IVCA 4KGXA 5FLKA 2UXBO 4BQFA 2XITA 1ZNXA 3IT3A 4PPFA 1P1KA 1FBTA 4PDRA 5LB4A 1BQ4A 4IIUA 3C3CA 4B6PA 3TKLA 3AOEC 2EGHA 4Z8XA 5LU8A 3IEPA 4HNAA 2R751 3C90A 3NVKI 4BIUA 3BORA 5H68A 4OI2A 4ETNA 2WDPA 4X65B 1UBKS 1QTNA 3UUWA 2C9MA 1WW3A 4CXMA 1UJ2A 3GAAA 1GQOA 4BJ5A 3MJFA 2BH2A 3KPJA 3UJBA 4DHEA 3ZWKA 4BLWA 2OZVA 3LO8A 2M6KA 3Q4HB 3G5AA 5K3SA 2QTWB 2V54A 4ECAA 3H87A 2YY6A 2FSVA 1W85B 1USVA 2HC9A 5KHOC 5CCEA 1A7AA 1HG0A 3CIFA 3WV4A 3VNUA 3H7AA 3QHAA 3E5NA 2QK4A 4EFDA 2BOVA 2UYQA 3R5JA 3NKFA 5I9SA 3KYJB 3CCEF 3WBKA 2XASA 1CIJA 1D4FA 3E58A 3PL5A 5TPZD 1R50A 2W6ZA 1KAOA 1ORDA 1S2GA 1H7MA 2WZBA 3P9XA 1TOAA 4CU2A 1AY0A 3SJCA 1PF5A 3OHPA 2Y68A 2FLWA 5CYGA 3S81A 4PELA 1YONA 3UMJA 2OCCB 3ITEA 3CYQA 2OIEA 1YR1A 1SKVA 1K27A 3GXOA 4Z4CA 3ZDZB 4TV8B 2NPOA 3DDWA 1W4LA 3NHSA 1HDZA 3QKSA 4OM8A 1PD1A 3OLYA 1XZ8A 3AP2A 3LUBA 5BSTA 1QYRA 3J7TA 1MC1A 4UUBA 1JVSA 1TM5E 2Z6UA 3CA8A 4PFQA 4UDNA 2WHYA 3KT8A 3W9YA 2JLZA 3SR4A 2AG0A 3SYTA 4BNUA 4MYSA 1EDOA 5I3CA 3LWOC 4M1YA 3LT0A 3S2IA 5EE3A 3HUDA 1WQ4A 3FMIA 1V16A 4V0QA 1YMQA 3QVXA 2O7RA 2XWSA 3KG2A 1DT3A 3P0JA 5D5QA 2VH5R 4UUMA 3N0XA 1RYYA 2KG4A 4UCSA 3RQIA 1KIAA 1XA3A 1K4KA 1CQZA 1U1GA 4B31A 3VU9A 4YK7A 2R65A 1H48A 4D9EA 4HDMA 1YHNA 2XWJI 1N1EA 2NVUB 4CTKA 1U7HA 1NW9B 1CNMA 1FFGA 1QKJA 1S1MA 1MPXA 3A6DA 1MQ9A 1HRKA 1H9AA 1P4JA 1T1RA 1ZK2A 3ONFA 1PVVA 2WJYA 2AMLA 1WRBA 1HKHA 1SQBH 4FLVA 1R4MA 1QTQA 1T4BA 3FYIB 2HHJA 5EWMA 3RTBA 3R0ZA 3AETA 1ZGCA 3A9SA 5GMOA 1GPJA 2C2ZA 2E18A 4Q9AA 3DMFA 3ABIA 4FM0A 1PG2A 4WUVA 4KXNA 3SKXA 1E8MA 4ZOLB 1XQ9A 5KNLA 1JJIA 1IV4A 4Y3UA 1NJIW 3ANSA 3TMAA 2PWZA 4Z4IA 3F96A 3GJXC 2PRSA 1V26A 3BE6A 4J76A 4KQKA 2QAGA 4U7PB 3ABQB 4C3VA 3DAOA 3OTOB 2JIMA 1C3LA 3CC2V 1GGHA 1M8JA 4Y1FA 1JDSA 3NJ8A 3F5TA 3PFBA 5J58A 5B6IA 1OV6A 1P84F 4KSCA 3Q3EA 3RABA 5EL0A 4W1PA 4BUZA 4MV3A 1Q3KA 1O95A 2QP9X 1OT5A 2R6R1 3EVNA 4BV9A 3DWGA 2K87A 1G5RA 3JVHA 2QT9A 1E1QA 4Q3LA 1KC8H 1TAQA 2ZEJA 3GEDA 3S3WA 1KJNA 1X6VA 1PWEA 1OFTA 3NPMA 1IIRA 5LKRA 1OLSA 2A06H 2VPWA 4MP3A 2Y1XA 1ECGA 2J9FA 2ZAOA 2AX3A 1H47A 1Y5NA 5CB4F 4B48A 3V4SA 5ALRA 5M04A 4RD4A 2BI8A 1YFLA 3V42A 1C4XA 4DWVA 5AICA 4FHFA 2XGMA 3EBLA 2ALJA 2Z2JA 2DPXA 2IQ5A 2FW9A 4KITB 2EP5A 3LBIA 4I6JA 1S8OA 5FPKA 3FMVA 2PFKA 1TJNA 2ATCA 3IUEA 5DWQA 3E2IA 2HVJC 3WIOA 5JSQA 1JH9A 2X8LA 3U4IA 4AKEA 2H3OA 3IKFA 1OWPA 4UCXA 3MLAA 1VQ9F 2VCHA 1R12A 4CMGA 4DJAA 3ZIAA 3O4FA 1VXOA 3ZH2A 4EG0A 2VPPA 4URHA 1CW2B 4XXHA 3AKCA 4B5CA 3O95A 2ZRAA 2GRUA 3K9GA 3F3MA 1OCZC 1VQOV 1R00A 4RSHA 4C0KA 1DHTA 3VKVA 3I6YA 3P0ZA 2HQSA 5AKKA 1ISRA 4MA5A 1IBKB 3AFOA 1YI0A 3ZWPA 3OHSX 3CO5A 1KJWA 4O2BA 3B2EA 5HDQA 2VDVE 2F9ZC 2XYGA 3G6EF 3L7OA 4ZCRA 4JUCA 1AQ6A 2VJCA 3APOA 1YRYE 2Y0PA 1Q0SA 1SVLA 4RABA 3AMVA 4MB2A 2PNFA 2ZJ2A 1JAXA 4PAQA 4WTOA 3LG2A 2J3DA 3G0BA 3FMGA 5EG5A 5C1PA 4UREA 3WADA 2E74B 4C4ZA 4C82A 3WMRA 2WLJA 5B4UA 1HURA 3LV8A 4YX9A 3RT9A 5DO9A 2BMFA 3BAAA 3X1WA 2RGRA 4LN1A 5ETJA 4YAGA 1KKDA 1QJCA 4PAGA 3V00A 3DE4X 2HBRA 1WB8A 1AR4A 4DLRA 5LZ8A 3UWMA 1QQ7A 2PV0A 2ZJ0A 1LH0A 4B73A 1TJYA 2IM9A 2CWWA 4MOWA 4MAAA 1RXCA 4DM3A 1WB5A 3O21A 4X3PA 1OX5A 5IBCA 3QIVA 2ZSUA 2VJMB 4Z7JA 4WLFA 3L70H 4LSMA 1XVVA 3DUFA 2WFLB 3M49A 1C1XA 4WBSA 1M2VA 2VQDA 2F17A 3LC7O 2O7SA 4EVRA 1MPTA 1V2HE 3BMNB 4HFMA 5FV7A 2GJ4A 1K5GA 1XKLA 4IIXA 3HEMA 1MW9X 3H8VA 3UAVA 5FWDA 3F6CA 2C0CA 3L18A 4OAPA 1VFNA 4LRQA 1D1QA 1DC5A 2HXGA 1A4IA 2HJ9A 1MX1A 5FI3A 1BGVA 3CT6A 3WLNA 3TXYA 2GYYA 1P0PA 3H5OA 3MTGA 5K4HA 3T3NA 3MCQA 1DV2A 1KOGA 1LZLA 4M0EA 1FSGA 2ZYAA 5F7ZA 1BXGA 1Z2OX 5H6RA 4W8OA 1J1IA 4U5QA 4INZA 4TZ0A 2PA0A 3X2SA 1NUHA 1LFDB 3D3IA 4RMGA 3ZIDA 1DAMA 2O3QA 1NV8A 4UTVA 1YDMA 4ZI2A 2JGKA 4EI7A 2W6OA 4EGQA 3LX8A 3D8SA 3K1YA 2PYZA 4MYRA 3ZLUA 4YDSA 3TDMA 3B40A 1Y33E 2NG1A 3L05A 1PS0A 4BN5A 3ZXYA 5F73A 4OPAA 4FDTA 2CHGA 4TUYB 5EHNA 4M1MA 1VF6A 5AHXA 1VKZA 1KQ3A 5AG2A 1VKOA 3PHCA 1GO1A 4G25A 1UIRA 3K9BA 3PHLA 3Q7RA 3JQRA 4QEKA 4AN1A 3CCLF 1ESDA 1R37A 1EFDN 3TIXB 2PKWA 2IRWA 4E13A 2RARA 1JIKA 1H2BA 1G8KA 4Q93A 3NT5A 2HHAA 3U62A 4OXQA 5CBFA 1BYUA 2YWFA 5B64A 2ZUUA 3QY9A 2WC1A 4K3AA 4UM7A 5BQOA 3GX1A 2HEGA 4AWXA 3WLJA 3RVSA 3CF4A 1GL3A 1NOIA 1HDRA 5KSWB 3OIFA 4E12A 2YXDA 1DQPA 4GL4A 3UCEA 2X5OA 3QJGA 1R8QA 2G3YA 1G16A 2WABA 3N8HA 1WUTA 1NQUA 2HSDA 3EFBA 2ARKA 3ZWQA 1LLQA 4LYHA 2WF8A 1MX3A 4KPGA 5BW8A 4E5VA 1PM9A 4OX9Y 1CF2O 1P3Y1 2A9RA 2PI4A 1J09A 3WA7A 1L7EA 2YW2A 5I01A 4KFTA 1R10A 5AW2A 1ICEA 1XPRA 5AM0A 4QL3A 4YFYA 3NVMB 2YTZA 1B3QA 2H0AA 1YQNA 5FFMA 4YRRA 3TRDA 2W48A 2WKQA 3DNPA 1SVUA 3EJ6A 4GOND 5HCIA 3GYBA 2Z8YA 3F7VC 3KHTA 3BCHA 1P2VA 3SZMA 4L8LA 4MP8A 4MPRA 3DXXA 4ZK7A 1G5TA 3M33A 4X3OA 1QCDA 3AB3A 5I7HA 2O7VA 2C7QA 1LBTA 3FTCA 3IP7A 3AY3A 3TLCA 1UKBA 2PQ6A 4NQZA 3UGJA 4LYYA 1W5SA 4E0BA 1K7XB 4DMFA 4BU0A 2PU7A 4JK3A 1QOPB 3M34A 1OB2A 3JRWA 3ELUA 2B9ZA 4D2IA 4WZ6A 5YASA 4N5NA 5TC4A 5BNWA 3HXTA 4DR5O 2X0LA 1AIPA 4NATA 1CZLA 4YMTA 3MTEA 1DL5A 1Z0KA 3CLUC 1SUPA 4BZPA 3UTCA 4ZJUA 1IZZA 1UIMA 4W1RA 3EMKA 2OK8A 4G4ZA 3Q0EA 4B17A 2FWBA 2PGNA 1AZTA 2IHBA 4P08A 1Q90D 3TZKA 1GY8A 4NOKA 5JCXA 3G6KA 3UGQA 1WUKS 1TQ2A 3UV6A 2AEJA 4IXTA 4DV2B 3KPWA 1BHAA 4MVRA 3PLAE 1CY1A 1OFUA 3OTFA 3WJ7A 1DC8A 3VMMA 3T06B 2H65A 3PTAA 1TW2A 3JS5A 1Q82W 4MIKA 1IPFA 5FULA 1LNQA 1TMGE 4Q1VA 1AS0A 1I5RA 3MRTA 4WCFB 2BFCA 1Y9AA 4ESOA 2HFKA 4EHDA 4K6CA 2ZI3A 3MAAC 3K0HA 1O77A 1JIUA 3O6VA 2QUBA 3ZW8A 4GOOD 3KELA 1H4SA 1WA8B 3G5MA 4Q01A 3WGZA 4LDJA 3KSAC 3QG5A 4LSWA 2ZRCA 3P2EA 2BELA 1M1XB 3V1UA 1BCSB 3DMTC 5EWLA 1DHRA 3TYXA 3MC1A 4QQ8A 3MK31 2JBAA 4MQFA 2W6NA 3HO1A 1Q7RA 4QDTA 4AX4A 3GZJA 2FW6A 4EYQA 4Y2QA 4BT3A 3L74H 4Q00A 3HJUA 1H8ED 3AOEA 3OE1A 4W5QA 3AYZB 3C3JA 4X62B 4BTVA 1I0HA 3AI3A 3RSQA 4ROTA 4N7RA 3O4RA 1NQOA 4KYIB 3CSUA 1LLDA 2A88A 2J48A 3RARA 4WJKB 3EY4A 4NBSA 2WINI 4AQYB 3MUNA 4BFXA 4FBLA 5FJJA 4KUEA 1SELA 1H2FA 2JFHA 3F5DA 5DGXA 1UBJS 2Z1MA 3HJFA 1CN7A 3GDHA 4BV3A 4BMYA 1G4UR 3NDIA 3N0VA 4IOMA 1P33A 2RAPA 1D4ZA 1WZCA 3R5KA 1Z62A 2HP0B 1JVMA 4FMBB 3OONA 3VBCA 4U7HA 1N7GA 1XCOA 1IATA 3KUXA 3TGLA 2QORA 4AKGA 2BEWB 2VK1A 4D4LA 2EKBA 1EFTA 4JTAB 3ANXA 3D7NA 3S7TA 1PNRA 1A9XB 3BXGA 4O3MA 2BMAA 1PQYA 2FRVA 3QOFA 3W3ZB 4N3AA 4DAEA 2VHTA 1A72A 2PRIA 2CKMA 4BBZA 4N5HX 3AJDA 5AW0A 2VDMB 1Z7EA 5GAJA 3FFWA 4ETWA 3W5CA 1KDVA 3AIOA 4LRXA 4UM9B 3WAKA 3LDUA 4L4UA 3CLHA 3VMFA 2QLJA 4BB0A 3LSTA 1QV9A 2D5CA 5K0GA 2HUNA 3L4BA 3C9SA 3W2TA 4JKIA 5EYPA 1NBOA 2NXCA 4S05A 3U3ZA 3TR5A 3UK1A 4WKNA 3V46A 3JVDA 2ZAUA 3DEYX 5IU6A 4A2QA 2XDQB 4ENVA 4BS9A 2LFRA 5C1IA 3D8CA 1EP9A 3O47A 2YN2A 4Z53A 1PPJH 1OYYA 4P4LA 2IP2A 1MA3A 3AGPA 2IPLA 5JWOA 4FPPA 2FEMA 4ZWNA 4WA8A 2OORC 4NYMQ 3PN1A 1Z9BA 1R1BA 3MWGA 4J9ZB 3SBDA 1YSCA 1RHJA 4TV9A 3W5BA 1VK3A 1MAWA 5AUNB 3IAS1 1WMDA 1UQRA 2YN4A 2XB9A 1SR8A 5IY5B 5A1JA 4MVJF 5AKJA 2NMVA 2VDQB 3SFVA 4BC0A 4ITRC 1P2UA 3M82A 4A73A 4B4UA 2ZYRA 4DUYB 1EPUA 3KKMA 2ZUEA 1HV8A 2AF3C 1Z2NX 3KQTA 1K5QA 1N36O 5F1YA 4KE8A 5DCWA 1P0IA 2FX5A 4FGLA 4RA6A 2BIFA 5G4KB 4NENB 4Q03A 1GPKA 2OO5C 2YIVX 4IH9A 2WUEA 4HK4A 3ESAA 2O2EA 2XW6A 4RV5A 3S2FA 1VLJA 4FEEA 3LOUA 3PXDA 4JLOA 1ADCA 3SK0A 2QM7A 1CDZA 3G80A 2H5LA 3TEJA 4Q1BA 2YH2A 2HK8A 4B82A 2EX4A 2QN1A 4S2EA 4OXKA 4F6EA 2YQ4A 1I5XA 3ZWXA 2R8OA 1BSMA 2GBLA 3N87A 3E89A 4CM1A 2LNDA 5JH7F 4FYIA 1KXZA 4MR8B 1NHWA 1YK1A 2NO4A 1SC6A 3I01M 1P1RA 3U7IA 3P9KA 3VH4A 1XFAA 1EE2A 3M4SA 1AKWA 1E4OA 1XQ8A 3TCXB 3ZY5A 4UU7A 4EJ6A 3KTAB 4MI1A 2WD8A 3DKPA 1PBNA 4R8SA 1GTMA 2IH5A 1XU9A 2XHBA 2AZXA 4FDUA 3SHTA 4X6LA 1NJGA 5EBMC 4HY3A 1FXHA 1UEIA 1R8YA 5DBHX 4U7JA 1KY4A 4BCDA 1U4OA 1JEYA 4WFHA 4RCVA 4TOIA 1JG2A 1HT2E 2NXJA 4D8UA 2WTUA 4FZ3A 2WF6A 4NVPA 2EKDA 1UUFA 3KZ1E 3RSSA 3R40A 5AHOA 3VRHA 4IHJF 4RDCA 5KWEA 1LFAA 1XU7A 3EVBA 2A0UA 4J0FA 3FA2A 2XT9A 1R5JA 1X14A 3N0RA 2J1LA 2W2KA 2BFWA 1TJPB 2IS2A 2WA3A 3TSWA 1WN7A 1TVMA 1P2DA 4DCGA 4XFJA 4FLFA 5A4AA 2XVYA 2HFEC 3PC6A 1ONNA 4LBYA 5LLSA 5CVVA 3R7AA 2ET6A 3A9UA 4KYTA 3LPMA 4B3XA 2RH8A 3USES 3SJQC 4ZU6X 1P9OA 2BDTA 3Q5EA 5LIPA 1CHNA 2VYNA 4DMUB 1V6SA 1XN1A 5IT9N 1MIOA 3K31A 5LP6C 4R7CA 3PJGA 2QTSA 4JCCA 3HCPA 3F6RA 1N6IA 3OOEA 2XE8A 1YZUA 2GZAA 4X54A 1JVNA 3MFQA 4ENTA 5AFSA 4FQ8A 2P35A 2ES4A 3MT9A 5L9AA 3K4HA 1EBBA 1E7YA 2P78A 2CF5A 3A6EA 4JJGA 2EGUA 4ARUA 2XTAA 1B8UA 1ZCZA 3ZOKA 5B5EZ 4C78A 5EUCA 2I55A 3VTKA 1X92A 1TKAA 7MDHA 1OXKB 1KBHA 2JZCA 4HWOA 1J2EA 1Y9ZA 2B4QA 3KOUA 4MRAA 1NY5A 3AFHA 4E33A 2ENUA 3MD0A 3R7DA 2BM9A 2JCSA 4BMXA 1CR4A 4CDMA 4X44A 4QZVA 1J6UA 5CX4A 2FSVC 2FEWB 4JBLA 1JG1A 3TD3A 3WJRA 1M6WA 1ZI9A 4WECA 2X5JO 1FPQA 2XIJA 4Q4JB 4DDWA 3IRUA 1QVGU 2IJJA 4DDVA 2GVNA 4I9UA 5CDFE 1WP9A 3B51X 1O9BA 1VJTA 4X7BA 1U8UA 2WSSG 1YIAA 2PIAA 2WSSD 1H2ZA 1WTAA 4GLFA 3D5QA 3E5RA 4N3NA 2C5AA 4MVWA 3HB1A 4QPJA 5I7SA 1LF5A 1JWLA 3QO7A 1G9TA 2P4VA 5B2EA 4DUGD 4C7OB 3CQ9A 4YHBA 1YFJA 4ER3A 1JR4A 1GDDA 1YB6A 3FYCA 1RWKA 3S03A 1EN4A 1Y1PA 5IARA 4RESA 1QE3A 1QCEA 1E0SA 1GZVA 4A6DA 2W9XA 3FWYA 4MUNA 5E3JA 2O1XA 2B7CA 1L4UA 5CIYA 4NEHB 1SB9A 1W2GA 5LR6A 1I6MA 4CKXA 1YR7A 4MJ7A 3OOHA 4P5DA 1A5TA 2I6GA 2LD4A 3VR3A 4EL0A 1PEYA 1YE3A 1H8HG 3TNYA 3FB8C 2R72A 1H8HD 1EZ1A 3GGGA 1H93A 5FB3A 2BGRA 3WL5A 4IGGA 2R3SA 3LUJA 2D1RA 2JC3A 3ANMA 4QWMA 5KYUA 2Q5JA 4NTXA 4UM8B 2P67A 2CUNA 4NYJR 2JLYA 4CZZA 1B3BA 1C4WA 1DDOA 2Z1DA 2BGWA 4E46A 4NG5A 3SJUA 4UVDA 4HZ3A 3K5LA 1WDKA 5JFTA 4JOBA 1QOZA 1NU8A 3ZJTA 1X19A 2V59A 4RAIA 4DRXA 1LPOA 5NLLA 4JENA 1EG2A 2RN9A 2UXDO 5FI5A 2QVZX 2EILC 3TSZA 4R2KA 2ZB2A 2ZITA 1GPAA 2WWFA 2K5UA 3SNKA 4EFBA 2FW7A 3SSNA 1T0PA 3VOTA 2Q1YA 3IL2A 4ZZ3A 1J23A 1XD9A 3UFXA 2WPNA 3VOUA 1GNSA 2Z2XA 4GFDA 5F3DA 4J4BA 3T5BA 4BGUA 5IYCO 3CZ4A 2BKLA 4K9NA 4W7SA 4IXMA 3ZXUB 1NL3A 1ZCJA 4AY6A 2P9FA 4LF6B 5GINC 4DIEA 1PJ3A 2EJ7A 3QJYA 1Z22A 4CM6A 3FPSA 4IV0A 2QAGC 1EUCB 3NGMA 3KLOA 3HN7A 2NU7A 5HHTA 5ERGB 1NTZH 1PIWA 1RFGE 2W6IG 2QVCA 2O48X 4P3PA 2W6ID 3BSYA 1ZN9A 3I23A 3H11B 4RZ3A 1TZKA 3JQ8A 1X7XB 3RVRA 1XJWA 1EXWA 1KMIZ 5E7IA 1O95C 4N8SA 4Q9NA 4MKHA 3PUXA 3ZDYB 1EM1A 5BOVA 3L4SO 3VYVA 2GZDA 1W42A 1B6RA 3RS2A 3Q10A 4ZVSA 2GCOB 4PG4A 3P2MA 2B3DA 1NKSA 1CJTC 3UB3A 3HWSA 4D9BA 3RRXA 2GM3A 3JYLA 1D3AA 3HKCB 3E1KA 1PR3A 4Y2HA 4EW6A 3OLXA 1MNQA 2F1HA 3DOUA 4WXRA 5J40A 3T94A 5MGNA 1BE8A 1TYBE 1OZAA 4S1PA 1I3OA 3HYTA 1KDRA 4M87A 4Z2YA 3BRWA 1Y8CA 5BOSA 3FVTA 2HR1A 1FRQA 5AW9A 1P4AA 4TM7A 4TKVA 1PI3A 1WHTB 3D8BA 4ALIA 4HZIA 3OCCA 3HJWC 2Z3YA 3GI1A 1K7EB 3MERA 2R1VA 3B38A 1WSAA 4RZSA 3S1LA 1V3UA 1XMJA 4RKRA 2GO7A 1CQJB 4Q9JA 1S9HA 1VRVA 2Q5QA 4XH9B 4R9SA 1AUPA 3WMFA 3WK7A 5TR9A 4GC5A 2EBFX 3DZBA 2P9YA 5DMHA 5SYMA 2HV9A 1SQVH 1BMFD 3P94A 1P9NA 2JEXA 2DJIA 3SY8A 1E3JA 1KAHA 3ABMB 1M56C 1BJTA 4Q1AA 2CV2A 5JSKA 3DO5A 1P4HA 5L3ZA 3K4PA 3B6KA 1KZ7B 4DR4O 2A58A 2HQSC 1EK2A 2WALA 2WA2A 4DXWA 4KQEA 3WGLA 5SZKB 3D7KA 1YHZA 4BP8A 1EZJA 2RGWA 1V55C 2FUKA 1QYDA 1EYZA 1ISPA 2PT7A 1R8XA 4YCJA 3T4ZA 2TMGA 1QDEA 1AK2A 4DLXA 1OCRC 5ALPA 4QJBA 3BD7A 4H15A 4RMHA 3VZRA 4IXDA 4I1OA 1X1DA 3V1TC 1CUZA 4BO5A 4YMGA 5JS8A 2EKQA 3FUWA 2PS9A 3WJPA 3PWKA 1I1HA 3SJZA 1XQXA 1OH8A 5K8LA 3P97A 1MG0A 4UNNA 2OK7A 3DMTA 3GQVA 1EX6A 3HKEB 3HABA 3E53A 4J41A 3TECE 2Y0CA 1XMSA 1G7CA 2BZ0A 3C7TA 2WLTA 4DIKA 5B58C 5KAFZ 3K0EA 3JZDA 1MOFA 3GUCA 5L3RA 3HM9A 2RB9A 4RTOA 3B6ZA 2WUGA 2AFVA 4HYTA 3AXSA 5ALGA 2SCUA 4ES6A 4FNAA 4ZO4A 1EP2B 4U02A 2XADA 3WLHA 3PQDA 2C96A 1ZWIC 1T8RA 5AW8A 4WOJA 3ROEA 3LW7A 4QHYA 3WL7A 1CR1A 5J4KA 1VCHA 1KYZA 3K1ZA 5THXA 1IY0A 2GERA 4IJ5A 1ZCAA 2D00A 4QBGB 1OASA 4ZK2A 4NDNE 4QJFB 5DOZA 4N5IX 3V6MA 1HEIA 4RQEA 2J4DA 3TR0A 2EYUA 2RBKA 2JAUA 4TROA 4NBLA 3LCUA 1H3NA 1GDHA 1AJNA 4BFSA 1P1JA 3G0HA 4DLZA 1GH6A 1U2EA 4ZHQA 1GZUA 1ODJA 1YCDA 1MH1A 3ESQA 4XDKA 2AYZA 1L7PA 3LVBA 3IOMA 3ZD9A 1JTVA 1XP8A 1J0BA 3VO9A 1K2VN 4U3FH 2VPXA 3TZLA 4YXWA 2O1EA 1VQ8F 3PNSA 4YPOA 5SZJA 2PUAA 4NIMA 5DNVA 2RAFA 1TIBA 3OUSA 1IURA 1HORA 2ERCA 1SCDA 2YBEA 5AP9A 2DWDC 5EGSA 3A25A 1F2TB 2B5WA 1ECCA 4QDZA 4UTPA 1KFCB 1ZRSA 1YRBA 2R47A 3JYCA 2VEOA 4V03A 3F8SA 4IF6A 4Q21A 4RF2A 4PO8A 4NDZA 1L5OA 1QVVA 3F90A 3LTEA 3Q8KA 5IS2A 5C81A 3V9PA 4JAAA 5D6OA 1U9CA 3UPTA 1U8TA 1VF6C 1YOVB 1B16A 3FSGD 3MB8A 2RMKB 1RS0A 1GADO 4G07A 1M0WA 3EXHC 3UQYS 4DIDA 3Q87B 3TW6A 5J9FA 1XQ6A 3CGGA 2FMIA 3O65A 4RQOA 3TN7A 2HRYA 2IYQA 4DLLA 1ZWZA 1LQ2A 4D3XA 4IL6Z 1X39A 2SECE 3DSQA 5FIUA 2CW4A 1EVLA 5FA8A 1X9HA 4O6VA 3MDSA 3S44A 4MDHA 5CNMA 5ECYA 4URVR 1MV8A 3LCRA 3RBZA 3FTFA 4RZIA 1UMKA 4PY2A 3ZZNA 3LWRC 4IFBA 1IV1A 2YWRA 4C6RA 1P1IA 3HDYA 3IQGX 2ZIUB 3GH3A 4A2PA 2OO5A 2OLKA 1J9GA 2ZINA 2IYTA 4TYQA 3SZUA 5C7LO 3CZQA 4TRMA 4BKPA 4DQDA 1DWPA 2WSIA 4YJFA 3BHJA 3HTXA 5KVSA 1ACJA 3COYA 3SG0A 2YIJA 2VF5X 4DCMA 3FYUB 3NNNA 1K0FA 2LP4Y 2JA2A 4YCDA 1BHO1 3GEIA 1QF6A 3KXKA 4NAVA 1FU8A 4NCXA 3HVHA 1H1LB 2P8JA 4HX9A 4F2DA 2O1WA 4OHWA 1MOSA 2VBCA 1UBGA 4MS4A 2A7WA 3MCVA 2PY5A 4AF8A 3CXRA 4Z7NB 3AF0A 2H29A 1G8AA 4JN6B 2GM5A 4MV8A 1QFYA 5JD4A 2FMLA 4P8RA 1BWPA 5FAKA 2XRFA 1N8RW 1HSZA 4BLTA 4M54A 3WDSA 4B4WA 2V7QD 3I04M 1XTZA 1SEVA 3JAMA 3O2SB 5TT1A 3IQIX 7ABPA 2X13A 1X52A 4PA3A 1JBQA 2WIBA 4EA7A 1D4OA 1DS6A 4KRYA 4OHXA 2H1VA 1W6UA 4JASB 1FMFA 2IYRA 2BGNA 3ASNB 4MVUA 4LE1A 3G7UA 4LCEA 1DG1G 3UTDA 1PZHA 4LZLA 1T5EA 2KG7B 1ZOOA 3CZMA 5ED4A 4U7NA 2YJGA 2ZM6O 3TUJC 1AS2A 3H1AA 4HPXB 4CLRB 3QELB 3TPZA 4EY5A 4O1IA 2Q27A 1PU2A 1XQVA 4KYVA 5COAA 5JPDA 2CCKA 2K1SA 3TB6A 1E2IA 3M5DA 1FJXA 4OB8A 3GP8A 2ZRJA 3NC1C 2D59A 1WS6A 3DR3A 1CVRA 5EXEA 2BJWA 2H8PC 1F3OA 1CJSA 721PA 5K8CA 3EEYA 3LQFA 1GL9B 1REQA 4G36A 5L3VA 1PEDA 3DNMA 4I9WA 4BO3A 1R15A 3BD8A 3Q40A 1ULBA 1T5SA 2FPPB 1RRFA 2RDMA 4IMPA 4CFYA 3OA0A 2YMLA 4UM9D 2CLCX 1L4NA 4HDKB 4PC3A 2XNCA 2R8YA 3OX4A 4ALJA 5GPBA 3QMVA 1IZ0A 4HZUA 4P35A 3TQTA 2Q6KA 3BXFA 1KFBB 2C2BA 3DW1X 2X8WA 1C14A 2ZRPA 3CJTA 1BCRA 3E4CA 3CLVA 3L1HA 1KOJA 4B44A 3FG9A 2P1DA 4C4WC 2QYTA 3EG5A 3SE0A 1JIXA 2QTNA 1FSPA 4QT0A 3M1IA 2EX3A 1D9XA 3T9DA 4H59A 4G0WA 2QL9A 3GLTA 3RFTA 4C21A 2QRNA 2PZAA 2PKRA 4KE9A 4NZOA 4HNQA 1ZP6A 1CXZA 3AUTA 1U5BA 4JI8O 2FPIA 1Y6GA 1VQKV 2CHQA 2PVPA 4LYGA 3C5VA 2CDCA 3AR3A 4HO1X 1O8CA 3TUZC 2DT8A 4B1FA 2W2TA 1O6GA 3Q3CA 3H2JA 1XV5A 3K9NA 4Y1RA 3KTDA 1G2QA 2YCLA 2B82A 2H85A 1L8LA 5B66Z 3A2FA 4UHDA 4KLCA 3FUCA 3ROXA 2UUPA 1U2RA 1APBA 4CIXA 2V4ZA 1B6GA 2QSJA 4FYYA 3FAVA 3WDMA 4IY1A 4O63O 4QFCA 5C5DA 4WLVA 5CLGA 2ZOSA 4EOGA 4FZJA 4OHFA 2I99A 4LWSA 3U39A 4X24A 3R6TA 3AKDA 1N1MA 2WMDA 3T95A 4CI9A 1EVEA 5MN4A 2EW1A 2XTZA 3HJGA 5KWVA 5CB8A 4A9AA 1ZIPA 5LXTB 4MV4A 1X86B 3Q1LA 3Q5GA 4BVSA 4KQ2A 3OFNA 4PGHA 5KDOA 3Q3HA 3BH0A 2H8CA 1PJBA 2R8ZA 4RD3A 5KTTA 3QPVA 3U0OA 1AH2A 4R8RA 1WUHS 1Q50A 3CEMA 2CLIB 3LNTA 3X44A 3CVYA 2PPLA 2FWRA 2GEJA 1DQRA 4CC5A 1YS7A 2Q6OA 2VAMA 5L53A 3ED5A 2ZR3A 3E9EA 3L4BC 1IBMB 1A8IA 3UKMA 5J5CA 1SRQA 1W36C 4KQCA 2NTNA 4M9SA 4CVNA 1P5FA 4KN5A 2CFSA 2JD2A 3WLOA 1T5BA 3W8FA 1KECA 2HNKA 2C61A 2FAXA 1CJKC 5ULLA 4LF4O 2FWAA 4UNIA 4BRWA 4BNDA 1FLNA 1VZ3A 3DNFA 1JKXA 2QF7A 4JJ7A 1GT91 5AI0A 4TKUA 4QUIA 1SB8A 4KQ9A 5LQDA 4TLLB 5EMJA 3EYAA 5BUZA 3U80A 2M2IA 3GLIB 3AU9A 3WPXA 3F78A 5DYTA 1AJEA 2W0FC 1A9OA 3M6WA 4WKOA 2YZ2A 2NMUA 1VB3A 1LC0A 1KYVA 5I47A 2UXXA 4HWTA 4X5OA 1SOMA 1EQAA 5T3YA 1UDWA 5IP5A 4BBAA 2QIOA 1QG2A 3UWOA 3Q98A 2X41A 1J4AA 5C8ZA 4G2KA 1R8SA 1ESCA 2DUWA 5CU7A 3K9HA 3DMYA 5C37A 2JRCA 2X9QA 4YJ3F 4LK3A 3NRCA 1S3SA 5BN1A 3JALA 4ZT7A 2ZB8A 2RI6A 2ZUVA 3RGGA 2AOVA 4GUAA 4BKQA 3FFXA 2I7XA 2I2FA 2WJIA 3ZR4B 5CDHA 3I8OA 1PN3A 1UR5A 3NHFA 2QEXV 3S02A 3FOEC 4OGFA 4H4DA 2C3MA 1E3WB 4HNGA 1EVKA 1HDIA 4JZ2A 2QN6A 2GBLC 2XXAB 5LZ4A 1HNXO 4RVFA 1L3IA 3VR5H 1MAUA 4EEXA 4IG4A 1RRPA 1VLQA 5A6SB 5AH0A 4CU5A 3M3DA 3BCSA 3BHPA 4Q9HA 2M98A 3L06A 3KAQA 5EBWC 2Y67A 1J0DA 1WA5A 4PQFA 1V5GA 1YZVA 4IILA 2Z2ZA 1E2GA 1EWRA 3CUVA 2AOXA 1J2YA 2A1UA 4ZD6A 3R9WA 1KS9A 5FOQA 4F6CA 4JC5A 4ZO7A 4TXJA 1BDJA 1BXRA 5HYVA 2LWIA 1MU0A 1TEVA 3HDHA 3BMQB 3WSVA 1P18A 2EWVA 2ZXWB 2Q0HA 1KDZA 4BWYA 3T7AA 4A0GA 3TCUA 1UI9A 3NORA 1JEOA 2JFNA 4F3YA 2PGDA 4RVDA 1ZJ6A 4L08A 3VDRA 4ZGWA 1V1MB 4JR0A 4LTNA 2JAPA 4ATNA 4CF6A 1AVTA 4F2WA 3MCAA 3F9RA 4RKYA 4KXRA 3K92A 4NNJA 5IXYA 1I3LA 5JVDA 3E3AA 5KTOA 5FDFA 2W4MA 5ILQA 1XZJA 2QXYA 3MS7A 1XRSB 2ZYIA 3F5MA 3SFTA 3PKIA 3O9OA 1XRLA 1EI9A 4E2FA 2CYAA 3ZLBA 3L5OA 3RWMB 1DRVA 3BSSA 3UO8B 4H2DA 2FN9A 3GRYA 4FNGA 1SVOA 3FUXA 5GM1A 2W6MA 1WLSA 2ETVA 2WE8A 4PLVA 5HOQA 3MS4A 3EDCA 3B3JA 4S1OA 4L8GA 4DMKA 2J0EA 4MX8A 3CLSC 3CZ5A 1W25A 4UTNA 1P5RA 5B7NA 2FR8C 3NFYA 5HP4A 3GYQA 2P0YA 1B04A 1QORA 2GSWA 1L5WA 1FS5A 2HHLA 1YITV 1YCIA 1KZ9A 4FWIB 4UASA 4QXMA 4JQOA 2VAVA 2X4LA 3T7KA 2QZJA 1YNOA 4AL4A 2AG5A 1F6WA 5JJKA 1Y3DE 3BE5A 3CN9A 4RANA 1ODSA 1ZJJA 4JZYA 5TLSA 2BMEA 1XL6A 1VLMA 3KIZA 1KO4A 3TW4A 2I54A 1R8JA 2VNHA 2ZF8A 3HXOA 1MEJA 4X1KB 4JELA 1A2KC 5A4JA 4LFCB 1L2TA 4ZAWA 3K58A 4IV8A 4RL4A 5FLXM 3NUZA 3DAYA 5EIWA 3V7YA 4MGHA 2YWCA 1RM0A 1VQ5V 3MYYA 2EKPA 1XDSA 2YW9A 4TT3A 2VT2A 1QYVA 4YY3O 2Z1UA 1UOPA 4C20A 1NXTA 3DC5A 2QWRB 3KEQA 1WCWA 2C92A 4EHIA 3PGJA 1VKHA 4F5EA 2L17A 1K89A 2X19A 5JJIA 1SS3A 3U7JA 3EHEA 4YJ2F 5DXFA 1T34A 4N5MA 1JT2A 3HFGA 3DVRX 2F90A 1B2LA 1JI3A 5HG0A 1H2KA 4U63A 2ONYA 3CCQF 3U5TA 5ADWA 5DM60 1E3IA 1QIHA 4WOKA 2VAPA 2O8EA 3PRKE 2X0DA 2FPMA 4LOAA 4BT2A 2KTVA 2PKQP 4I50B 4ZXFA 1JZTA 1FSSA 4CMIB 1JKIA 1PWYE 3D7LA 3KLNA 2L0XA 2HVYD 2O2XA 2E4VA 4QPJC 1QWOA 4M1EA 4QE9A 1G18A 2ZKOA 1QFJA 4LTDA 3WXBA 2DQ3A 1K88A 2DEUA 3VR6H 5G53C 2FU5C 3GLFB 2I7CA 4KFSA 5DGHA 3LBYA 4NH0A 5F23A 3EVFA 3SC6A 4BIZA 3L1JA 3R7BA 1DDIA 5DGCA 5AXCA 5IMBA 3SGIA 1HY3A 1FDIA 4JT9A 1K9MH 5EJ6A 1C4OA 4EBFA 1DXOA 2FZ4A 1U40A 1V39A 3IP8A 4OXIA 3DOJA 1HK7A 3EG9B 4BVBA 4PCVA 2XNDA 3IR6A 3BYQA 4BVJA 1DX9A 3C5EA 3HDVA 2E5LB 3LS2A 3QNEA 4C4PA 2IS4A 1GTOA 1U0GA 5IAKA 4MUXA 3SZOA 4DV5B 3HO8A 1CERA 5ALXA 2FF5A 3ZU5A 1XZMA 3KJGA 3UMVA 4AY4A 1PFYA 2AG8A 1XK7A 3UT5A 1A5BB 4L7QA 1JLHA 3UJPA 2HDNB 3DMDA 3MSXA 4KFCA 4PC1A 4RMJA 3OT7A 3GRZA 2XUKA 1BZKA 2VDWA 3IQFA 1RYEA 3RADC 4QPCA 4R51A 3W90A 5J3JA 1J00A 3MUFA 5JADA 4P6VF 4FYPA 3E82A 3BXOA 1M1UA 4B2LA 3QKRA 2XTNA 2XJ4A 3JD0A 1PJ2A 3HJNA 3EXHA 2AEFA 4HB3A 3CD6F 3KUUA 3QPBA 4BRZA 1H2NA 1I9GA 2H1LA 5SZHB 1QE0A 1C9DB 3Q7SA 3GVPA 4BLRA 1XXHB 5KBYA 2Z2YA 2QTBA 4FWTA 1ZQ1A 2GBPA 1TFUA 3H5TA 2D1TA 1W4RA 1HZZC 1RAGA 1M2WA 1BDMA 3OR6C 4HQ0A 5I7UA 2EZOA 1KDYA 1X7ZB 2IYLD 5HFJA 4G56A 5KMGA 3TRHA 4UBNA 5AVWA 1H0HA 2VWPA 3LRXA 4EYKA 3FPKA 3C3DA 1RXVA 3J81N 4GQIA 4TQDA 1W57A 1NUPA 1BVRA 4TLCA 4NYMR 4YP7A 3K2IA 3OE4A 5ES4B 5E2BA 3GEGA 1L5FA 1ECBA 4C6TB 4JBYA 5JS2A 4P0QB 3DDOA 5L95A 1V8FA 3EIXA 2Y93A 2FUCA 3TFWA 4RQAA 1VBMA 1VQ7F 2P6NA 3FVRA 3WK5A 1N2GA 3VSDA 1XZBA 1KKUA 5FUVA 2DYKA 4LF9O 5GIPE 2JLWA 1G8HA 4DB2A 1OLUB 2LBWA 4ZKIA 1IUKA 1NYQA 4KV9A 1BHJA 3NIWA 4C0QC 1US6A 5IUNC 5K0JA 3D6HA 1KYOF 1VP7A 3HEAA 5LMUO 2HJDA 4QUJA 3W4IA 3E8BA 1F2UA 5DTMA 2AHRA 3CHXA 1CETA 4HDRA 3NVIB 1BNCA 1ZU4A 4ZXPA 3QU7A 4EG8A 2GKGA 3DYVA 3R6GA 3AHCA 1JIQA 4OSOA 3U9SA 3WRYC 4KIWA 2PS0A 2FSIA 4ZICA 4E4EA 1RAEA 5EAZA 1PNKA 1F48A 1CZNA 4Z4GA 2BGMA 4LBWA 4FGKA 3E23A 2BCJQ 3KXPA 5BN5B 3QI7A 4B8YA 4WJZA 3MTAA 2QUKA 4INJA 3WB9A 1VPDA 2KQUA 3IEIA 1R1MA 1KH1A 3DL0A 3RRFA 2P6YA 3R5FA 1USWA 5A71A 5JC1A 1ESMA 4RNDB 3RU7A 2D4HA 4A1FA 2X0IA 1W0JA 4HS9A 1U97A 2EC5A 4LV8B 3ZGNA 3C9RA 3SYQA 1E3LA 3WY9A 5EINA 4DR3O 3UMRA 1GHTA 4D5GA 1QGUB 4MS3A 1UFOA 1FP2A 4OMFG 1OVMA 4FUQA 4KQGA 2OFXA 4JBNA 4D8TA 1Q3EA 5EY5B 4C4TA 4UUPA 4B80A 4R6WA 5A06A 1Q1GA 2CYBA 2VNIA 4BNWA 1P9WA 2OQRA 3OTQA 1C7QA 4ZTZB 2PCLA 4FB4A 3STLC 1E0JA 2RCNA 1WF6A 2CL7X 1CULC 1ORWA 2C98A 2GVZC 3N5KA 5KKCA 3FDFA 4GS5A 1RHUA 3H1BA 3X1JA 1ZIXA 3MVEA 5A4MS 2ZBVA 1PDOA 5A5EA 2JIZG 2P2ZA 2JIZD 3OCVA 4BEWA 4MQMA 4IL5A 1BXKA 3KYDA 2WQ6A 1OXBB 4HVCA 3HRKA 4JI1O 2WHRA 2A3NA 3CLRD 1AJPA 3L4EA 4DDUA 4XFDA 4PHGA 1WPXA 4ENSA 4RJ2A 2Q5LA 3WWYA 5B30A 1Z34A 4S04A 3P3NA 3SX0A 4ZYVA 1DRWA 3ILXA 3ED1A 3I1YA 1ZNQO 1E1CB 3QX9A 3QXGA 1PSZA 2AVDA 2D5IA 1NPTO 4GU5A 5JS7A 5DH9A 3EQ9A 3K2XA 1JG3A 3T5DA 5DRYA 1LSUA 4YUVA 2C29D 4P2BA 2EBUA 2JLUA 1LR1A 4UFNA 1RIIA 2ZGVA 1P5ZB 1C0EA 3CRMA 4BFZA 3NDBB 2XKBA 3WGYA 3PRYA 2HF9A 3K6RA 1E1YA 4FYXA 4YRIA 4JNKA 4R1QA 2FSPA 3B9BA 1MC8A 1ML4A 3V7FA 3FPAA 2AXQA 1CJCA 4BO8A 4KO4S 5REQB 2QY6A 1RLIA 2C2GA 3ZV7A 2Y1LA 4P7JA 2JW5A 1BWSA 1BX1A 2TMYA 1RCUA 1TU3A 5E1MA 1SZCA 1E6MA 4YA6A 4KL8S 1UPCA 2Y1DA 2WT9A 1GNPA 1DOAA 4NECA 2X7RB 2BE3A 3K9CA 4K35A 9ABPA 5JJNB 4PSAA 4XDGA 2EW2A 5EUBA 3UJAA 2W2OA 3IP1A 1JQEA 4R9VA 2QPLA 3BMOB 1FJHA 2J9XB 2AX4A 2UYKA 1NS1A 1PZGA 4KXLA 1RE0A 3RU2A 3PNMA 4MDYA 4HADA 1UBRS 3EW9A 2ZS7A 5HK9A 1IM5A 3C8UA 1LX6A 3MRSA 4EY8A 1X7OA 5IMSA 3OFKA 2B69A 1IIBA 1W48A 2NZWA 4BAYA 3TGPA 2LDXA 1EVJA 4HYOA 5LUAA 1G4YB 5C31A 5HIAA 3E05A 3NBZC 3THYB 1DCFA 2X22A 3NDPA 2I3AA 4DM7A 3T0FA 2Y9MB 3G4SF 4D6XA 5DM70 1AMNA 3HM2A 3N2GA 2QTRA 2FHSA 3BC1A 1HL7A 1FXSA 1XZHA 2AZTA 4LS3A 5JBIA 2GZMA 3DZDA 2GCGA 4LYAA 3WE7A 2O4UX 3C6KA 2LCAA 2WLLB 2BDUA 3DMHA 4EB6A 3AEQB 1AU9A 2GEKA 3ROMA 5E1DA 1V54C 4C9BA 4Y2PA 2PNJA 5KO2A 2IVFA 1Q43A 3ZDFA 1M74A 3PENA 1K6XA 2GRAA 3WTBA 4BKMA 3GAMA 3DP7A 3U17A 3PFCA 3KKOA 4ZT5A 3IURA 4H7JA 1WY7A 1B3RA 3RYFA 1XB2A 3WHPA 2CGEA 2R9VA 5JQGF 3LDCA 1BQEA 2VJDA 3FUUA 3NVAA 3Q9LA 4ARZA 3UYKA 4TWJA 1N8NA 2PZBA 3KR0A 1OE0A 4HTFB 4OSPA 3IFSA 1Z0IA 4BV8A 4DA9A 4MS1B 1X80B 2NQ2C 4RO0A 4OHUA 1PZEA 4NBWA 3GNTA 1SCIA 1CYDA 1RYZA 4QSMA 1SC3A 2HIHA 2LKDA 4BLQA 2YOGA 3WNCA 3RLFA 3V1MA 5AXDA 4E4TA 3I2GA 1ZWLA 1T1SA 2B4TO 4D80A 2CGNA 4JC0A 4C6SA 1W4CA 5H0IA 1V11A 1UBOS 2EIJB 3CSXA 1FMLA 4U39A 4QFDA 4GKJO 4IGIA 3BABA 4JF3A 2AI3A 4FFBB 4FIDA 3LKZA 3AJRA 2Q49A 2BHRA 5E4FA 1V5FA 4RXMA 1R5BA 1T43A 3JSLA 3VKFA 4DV1B 4FJ1A 3A10A 4CS4A 5ALOA 3E18A 3V55A 1AHHA 3I56V 5TDHA 2R6GA 1QAHA 4CTJA 1GYQA 3TO5A 4HX2A 2WP0A 2P5YA 1WXDA 2PG3A 2H11A 1T8WA 5DFAA 2EVWX 1CY2A 2QDKA 4DV3B 3E8HA 1SOUA 4PFSA 4KXQA 1I7QB 4ETIA 2QPTA 1I3NA 3URMA 3LHFA 1VKJA 3DAHA 4NTZA 4M0LA 5BNFA 2ADPA 3ZS9A 2IEYA 2CBXA 2QY9A 4JMPA 3VHRA 1HEUA 3FNGA 1Z33A 4L4YA 1M6HA 1EU1A 4N9WA 3DLBA 3GXBA 4D45A 3JQQA 3DTTA 4UCTA 2VC2B 1AI7A 5EN4A 4ZKEA 1GN3A 4DV6B 3SPIA 4LHXA 5AHRA 2KBEA 1DCMA 4FDVA 2X86A 4G4SP 4GI2A 3M2TA 2FR8A 3R3XA 3I9KA 1CP9A 3ZEDA 4YMSA 1LJUA 3EIWA 5L3QB 1PRYA 3D81A 3OM0A 2WKWA 3FLAA 4KUGA 3L6CA 1A04A 3A1NA 1FDVA 1KQOA 4KVGA 521PA 4TMKA 3I5DA 3MGBA 4P22A 4WGFA 2CJWA 4S1WA 1HO3A 4ZCLA 5B53A 3RVYA 3A32A 4BYMA 1CUJA 3AM3A 1KEVA 3LPNA 5EZ5A 1I32A 1QHIA 3RVLA 5KJ6A 4I2VA 5BNTA 2ZPAA 3U4GA 1B23P 5CCDA 3NEAA 5GONB 3HFRA 2XGGA 5A7GA 5KOJA 2IHTA 4TZTA 4EKYA 5AM5A 3TJZA 3RC7A 3I2KA 1M1YA 2HHHO 4MCHA 1B7GO 4FUTA 3R7SA 4LP8A 3HV0A 3VZDA 3NT4A 3VKWA 3R75A 4YRNA 3E7FA 1UOQA 2W93A 2NZJA 4RIIA 1DXYA 3ENKA 1OH7A 2V45A 2XAHA 3LC1O 4CT5A 2FZ5A 1Q7TA 3A8TA 1L9XA 1Z2CA 1LTQA 1VOTA 3R66A 5KOHA 1EFPA 1QM5A 3AFIA 1DG3A 2X8JA 9ATCA 2H7VA 4XVRA 4C4RA 3W6ZA 3LSSA 3SQMA 3DBRA 3TE7A 3OW2F 4HRAA 3FMFA 3QBVA 2R2GA 3ESRA 1Y6XA 2IPOA 4GE3A 4I55F 3LX6A 2FOLA 2H2DA 4MTCA 1E99A 1PWHA 1U0OC 2AI2A 3D7MA 3KXDA 1LI7A 2IBMA 1V8ZA 3UQZA 1BRMA 5B5SA 1XALA 3WI7A 1Z08A 1ZBDA 4PIPA 3IDZA 4GP9A 1ADYA 3HY4A 2PD4A 2B36A 1Q3HA 4PPGA 4PA9A 2GPBA 1SRYA 3DVAA 2Z1FA 4JWKA 3FVQA 1MT0A 1ESNA 3ZRWA 3FLBA 3K53A 1SWWA 3IQXA 1CUYA 2DJ5A 2PGLA 3BXPA 3JARA 3PEFA 3OCUA 3TMYA 2N75A 1BVYF 3I1FA 1UPBA 3QA3E 2ZT6A 5MF6A 2AD5A 4MVSA 1EQ2A 2W71A 3JYNA 4Z4FA 1N2CB 2C8KA 2W2VA 3Q3IA 4EY4A 3GYGA 1OCCC 2ADOA 3KZMA 4AU1A 2VTBB 2YZNA 2QYSA 3DD5A 3C3WA 1V2GA 2WAOA 1K33A 1M7HA 2NQ8A 2BZSA