1T0KB

Joint x-ray and nmr refinement of yeast l30e-mrna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*CP*GP*GP*AP*GP*UP*GP*UP*CP*C)-3'
publication title Joint X-Ray and NMR Refinement of the Yeast L30e-mRNA Complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1t0kB00
3CMEF 3RA5A 1X7PA 1RA4A 3G4SF 3CCLF 3WXMB 3O85A 1VQ6F 1GZ0A 1VQNF 3HAXD 1NMUB 4BW0B 2KG4A 1E7KA 1YITF 1YJ9F 4BY9D 1YJNF 2QA4F 2OTLF 1S72F 2LBWA 3FFMA 3NK6A 3NK7A 5EWRA 3CMAF 2LBXA 1X52A 1Q81H 1K73H 5FJ4C 1DT9A 3JAMM 1SDSA 1YI2F 3N4ZA 1JJ2F 1IPAA 3VI6A 2ALEA 1K8AH 1T0KB 5GAPK 1N8RH 1ZWZA 5EO3A 1YJWF 1GO1A 3NVKE 3LWVC 1Q7YH 3HJWC 3I56F 5G4VC 2FC3A 3N4YA 3LWQC 1RLGA 3CPWF 5GINC 1CN7A 3CCVF 5A2QM 1QVGF 3CG6A 1M90H 3CCEF 3V7QA 3LWPC 1Q82H 1YIJF 3ON1A 3CCQF 3SIVA 3RA6A 3LFOA 3LWRC 3G71F 1YHQF 1H7MA 3J7AR 3NVIB 1W2BF 3OBYA 5GIPC 2HVYD 1K9MH 3OBWA 1KQSF 2AIFA 3PLAC 4X3MA 2VGMA 3E1YA 4TZZA 3CCRF 2QI2A 1VQKF 1W42A 1KD1H 3JCMM 1KC8H 1M1KH 3V7EA 2CZWA 3CXCF 1VQOF 1VQ8F 2WALA 3SIUA 3GYQA 3CCJF 1VQPF 4LCKA 1VQ7F 3J81M 1VQ5F 3J80M 5DCVA 1QVFF 3CC4F 4X3LA 3CCMF 3CD6F 1X7OA 3CC2F 2I6DA 3CCUF 2OTJF 5GANK 4C4WC 5IT9M 2KTVA 3G6EF 1VQMF 2OZBA 3AGKA 3LWOC 1GO0A 2JNBA 5FLXM 1XBIA 3CC7F 5GIOC 1VQ4F 1PXWA 2KTUA 3PAFA 1W40A 2QEXF 2VGNA 2BO1A 1Q86H 3VMFB 1CK2A 2OHWA 1VQ9F 3OW2F 3I55F 4NUTA 3IR9A 5G4UC 1NJIH 1W41A 3E20B 3CPQA 3CCSF 1VQLF 1W3EX 3MCAB 3NMUC
chains in the Genus database with same CATH superfamily
4C82A 3JASB 1RA4A 1VQVA 1FNJA 3RYHA 5JH7B 3VCZA 1FFXB 5EAZA 4X1YA 3WGJA 3NMUC 1YJ9F 4BY9D 5EB0A 5HP8A 4FFBA 1S72F 4PWTA 3UT5A 4EI7A 3FFMA 3HWUA 5GONA 4I4TA 1X25A 1Q81H 2QTPA 5HY0A 5LYJB 2UYNA 3TD3A 5IJ0B 4E6EA 1T0KB 5EO3A 3VTIC 2YYEA 3NVKE 4X1IA 5EZYB 5ITZB 3LWVC 1Q7YH 1Z5WA 5JVDB 3RE3A 2FC3A 1PF5A 1U3LA 1R1MA 5FNVA 2ZF8A 3N2KB 1QVGF 3HKCA 1TUBA 3V3TA 3F6MA 3V7QA 1NQ3A 3C9RA 1XHOA 4KWEA 3C8LA 4ERHA 2HP3A 3E22A 3G71F 1H7MA 2Q1YA 4BT7A 5HWEA 1W2BF 3OBYA 5LXTA 3TD5A 1KQSF 4O4HA 5B8FA 2Z01A 3JVHA 4TV9B 2Z1FA 2RB9A 2VAWA 1T0AA 1W42A 1KD1H 1KC8H 3V7EA 1VQ8F 5EB1B 3S0HA 3LYBA 4LCKA 4IIJB 3J80M 4ZHVA 3CC4F 3CD6F 3CCMF 2I6DA 3F0FA 2UYPA 3ZOPA 3FPIA 4U3JB 2ZOVA 1QD9A 5IT9M 4O4JA 5CB4B 3VO8A 3RYFB 3JATA 2N48A 2JNBA 5J2TA 5CA1B 3RYCB 5GIOC 2Q1XA 2VGNA 1QU9A 1W59A 3R0PA 3S02A 3VMFB 3P0ZA 4YJ2B 5IYZB 2H6LA 4I50B 2HQSC 4EI8A 4G4VA 4ZI7B 4DRXA 5C8YB 1VQLF 5EIBD 3M4SA 2ZODA 3D00A 3CMEF 3RA5A 2Z1UA 1X7PA 1VHAA 2R6R1 5HY4A 4YJ3B 2DYYA 3WXMB 4I55A 5EYPB 3O85A 3N2GA 1GZ0A 1VQNF 4BT6A 3HAXD 4BW0B 2HS3A 4O2AB 3JAWA 2H8EA 4TUYB 3F0EA 2QA4F 4G4YA 1ONIA 5J2UB 5BMVB 2IAFA 3C9UA 3NK7A 5EWRA 4O4LB 1XRGA 3JALA 1X52A 2ZVYA 3IEQA 2RHLA 3ESJA 1IPAA 4IHJA 3TD4A 4NWOB 1QAHA 4ZHWA 5LA6B 5JQGB 2VAMA 3WPWA 5CA0B 2GVIA 1GO1A 3WPXA 3K14A 4X1KA 1JD1A 1IV1A 3N4YA 2R751 5IJ9A 3LWQC 1RLGA 2RHOA 3CCVF 2UYJA 3MBMA 3CG6A 5KX5B 3I3FA 1W5EA 3LWPC 3CCEF 1YIJF 3ON1A 1Z5VA 3SIVA 3DDNA 3LFOA 2CW4A 4ZHQA 4BT2A 3RYHB 5HP7A 3NVIB 2V9YA 2HVYD 1K9MH 3OBWA 2AIFA 4X1YB 2K1SA 3CCRF 4FFBB 4TV8A 2QI2A 3UT5B 4WBNA 2PHNA 3CXCF 5GONB 4I4TB 2W8BC 3LMEA 5LOVA 2KGWA 3HKBA 2B33A 4LNUA 1VQ5F 1U3PA 2UYNB 4B5CA 5DCVA 2AIZP 1X7OA 3D54A 3QTYA 2OTJF 5GANK 2CVLA 3B6NA 4C4WC 1TVKA 4X1IB 3HTNA 4U39A 1JY8A 3AGKA 3LWOC 2BTQB 1GO0A 1FSZA 5FLXM 1XBIA 2UYKA 2LCAA 3WGMA 2KTUA 4G88A 1W40A 3S0WA 5FNVB 3WGNA 3JAKA 2BO1A 3HKCB 1TUBB 3HKDA 2BTOA 3WGLA 1GX1A 1VQ9F 3I55F 4NUTA 2CHTA 5KMGA 4O4IA 5HXUA 3CYQA 4O2BA 3U0OA 3E22B 1W41A 3CPQA 1W3EX 1W5AA 4BVTA 5LXTB 1OAPA 1FNKA 3P10A 4O4HB 3ELCA 2CWJA 4R40B 1COMA 3G4SF 2HS0A 2NMUA 2VAPA 2P6YA 3K2XA 2HP0A 1W55A 2KG4A 1E7KA 1YITF 3OONA 1YJNF 4BT3A 3I7TA 4EB6A 3KIZA 1IV4A 2LBWA 3RYIA 3GTZA 3NK6A 3CMAF 2LBXA 4G4XA 3ZP7A 1W5FA 2ZVZA 1JFFA 5FJ4C 4O4JB 3MDOA 3JAMM 1SDSA 2LBTA 1JJ2F 1YGYA 3VI6A 4X20A 4BT4A 3VYSC 3JATB 4HNAA 5HY2A 1Q8RA 5J2TB 1ZWZA 5GAPK 3FD6A 1YJWF 2MQEA 4ZOLA 3D01A 3QHDA 3VOBA 3S0YA 5G4VC 2Z1TA 1YQNA 4B45A 3V4DA 2OTMA 4DRXB 3HKEA 3KJKA 1Q82H 3JARA 5LP6A 4M8IA 4C81A 4DXDA 5LP6C 4NQ3A 4C8IA 1SA0A 1YHQF 4BVSA 3J7AR 4F6RA 3IKFA 4I55B 3N2GB 3WJRA 3JASA 3PLAC 3JAWB 3E1YA 5JCOA 2ZAUA 5JH7A 5JCOC 3F0GA 2CZWA 2PMPA 1VQOF 1FFXA 2WALA 3JALB 3SIUA 4G4ZA 3CCJF 1VK3A 4C8EA 1VQ7F 4IHJB 1QVFF 3P4EA 2RHHA 3M1XA 3FBAA 1RQ7A 4X1KB 1VQMF 2OZBA 3KE1A 5LYJA 1H48A 4BVQA 3FD5A 3BYQA 5IJ9B 5IJ0A 3CC7F 1IV2A 4EI9A 3PAFA 1RLUA 5EZYA 5ITZA 2QEXF 5JVDA 1CLIA 2OHWA 3OW2F 4ZK7A 3LDTA 2HRUA 5HXZA 3S06A 3EORA 1DBFA 1NJIH 3N2KA 4ZHQB 3E20B 1KNJA 3Q8HA 3MCAB 2IG8A 3VYTC 2EWCA 2VXYA 1JN1A 4BVRA 3QUWA 4G4WA 2CSLA 3CCLF 3M84A 4TV8B 2I6RA 5AVMA 3K0TA 1VQ6F 4WBNB 1NMUB 3T80A 5MN5A 5LOVB 3C9TA 4C8GA 3IKEA 4TV9A 2OTLF 3HKBB 4LNUB 1U43A 1XV2A 2F9ZC 2YXZA 2AMTA 3VIUA 1W57A 1K73H 1TVKB 1DT9A 2CHSA 5MN4A 2RHJA 1YI2F 3N4ZA 4IIJA 4B46A 2L26A 2HX0A 2ALEA 3ZO8A 1UFYA 1K8AH 1H47A 5MN6A 1N8RH 4U3JA 4BT5A 5CB4A 2BTUA 3JAKB 1RQ2A 1SZQA 3MQWA 3HJWC 2DT4A 3I56F 3RYFA 3KJJA 3HKDB 3S03A 1W581 5HY1A 5CA1A 3RYCA 3CPWF 5KMGB 4O4IB 4O2BB 5GINC 2H8CA 1CN7A 5A2QM 1M90H 2GZLA 4YJ2A 5IYZA 3CCQF 4I50A 3RA6A 4RQOA 3LWRC 3ZP4A 4ZI7A 3C9SA 5C8YA 5GIPC 2HP0B 3VOAA 3ERNA 4X3MA 2VGMA 1W5BA 4TZZA 4YJ3A 3WGKA 4EB6B 1KNKA 5EYPA 1VQKF 3RYIB 3JCMM 1M1KH 3WJPA 2UZHA 2IQQA 4XCQA 4O2AA 1JFFB 4TUYA 3K12A 1OFUA 3GYQA 1VQPF 1U40A 2HRYA 1IV3A 3J81M 5BMVA 5J2UA 4X20B 2HS4A 4X3LA 2Z1EA 4HNAB 4O4LA 3CC2F 3CCUF 4ZHYB 4ZOLB 3KHNA 3F0DA 2KTVA 3DC2A 3G6EF 1J7HA 3IEWA 5LA6A 5JQGA 2G9IA 1VQ4F 1PXWA 5CA0A 3GHZA 2GLZA 1UI9A 1Q86H 3WJQA 1CK2A 3HKEB 3JARB 5LP6B 1VH8A 3IR9A 5G4UC 3VYUC 1ODEA 3CYPB 1SA0B 2FGYA 3IMPA 4B62A 4F6RB 5KX5A 3CCSF 3CB2A 5EIBC 4RHAA 3L7QA 3MCQA
chains in the Genus database with same CATH topology
3CMEF 3RA5A 1X7PA 4BVRA 1RA4A 5HY4A 3G4SF 3CCLF 3WXMB 3O85A 1VQ6F 1GZ0A 1VQNF 3HAXD 1NMUB 4BW0B 2KG4A 1E7KA 1YITF 3NMUC 1YJ9F 4BY9D 1YJNF 2QA4F 2OTLF 1S72F 2F9ZC 2LBWA 4EI7A 3FFMA 3NK6A 3NK7A 5EWRA 3CMAF 2LBXA 1X52A 1Q81H 1K73H 5FJ4C 1DT9A 3JAMM 1SDSA 1YI2F 3N4ZA 1JJ2F 1IPAA 5HY0A 3VI6A 2ALEA 5HY2A 1K8AH 1T0KB 5GAPK 1N8RH 1ZWZA 5EO3A 1YJWF 1GO1A 3NVKE 3LWVC 1Q7YH 3HJWC 3I56F 5G4VC 2FC3A 3N4YA 3LWQC 5HY1A 1RLGA 3CPWF 5GINC 1CN7A 3CCVF 5A2QM 1QVGF 3CG6A 3V3TA 1M90H 3CCEF 3V7QA 3LWPC 1Q82H 1YIJF 3ON1A 3CCQF 3SIVA 3RA6A 3LFOA 4NQ3A 3LWRC 3G71F 1YHQF 1H7MA 4BVSA 3J7AR 3NVIB 5HWEA 1W2BF 3OBYA 5GIPC 2HVYD 1K9MH 3OBWA 1KQSF 2AIFA 3PLAC 4X3MA 2VGMA 3E1YA 4TZZA 3CCRF 2QI2A 1VQKF 1W42A 1KD1H 3JCMM 1KC8H 1M1KH 3V7EA 2CZWA 4XCQA 3CXCF 1VQOF 2WALA 1VQ8F 3SIUA 3GYQA 3CCJF 1VQPF 4LCKA 1VQ7F 3J81M 1VQ5F 3J80M 5DCVA 1QVFF 3CC4F 4X3LA 3CCMF 3CD6F 1X7OA 3CC2F 2I6DA 3CCUF 2OTJF 5GANK 4C4WC 5IT9M 2KTVA 3G6EF 1VQMF 2OZBA 4BVQA 3AGKA 3LWOC 1GO0A 2JNBA 5FLXM 1XBIA 3CC7F 5GIOC 1VQ4F 1PXWA 2KTUA 4EI9A 3PAFA 1W40A 2QEXF 2VGNA 2BO1A 2GLZA 1Q86H 3VMFB 1CK2A 2OHWA 1VQ9F 3OW2F 3I55F 4NUTA 4EI8A 5HXZA 5HXUA 3IR9A 5G4UC 1NJIH 1W41A 2FGYA 3E20B 3CPQA 3CCSF 1VQLF 1W3EX 3MCAB 4BVTA 3D00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME F;  3RA5 A;  1X7P A;  1RA4 A;  3G4S F;  3CCL F;  3WXM B;  3O85 A;  1VQ6 F;  1GZ0 A;  1VQN F;  3HAX D;  1NMU B;  4BW0 B;  2KG4 A;  1E7K A;  1YIT F;  1YJ9 F;  4BY9 D;  1YJN F;  2QA4 F;  2OTL F;  1S72 F;  2LBW A;  3FFM A;  3NK6 A;  3NK7 A;  5EWR A;  3CMA F;  2LBX A;  1X52 A;  1Q81 H;  1K73 H;  5FJ4 C;  1DT9 A;  3JAM M;  1SDS A;  1YI2 F;  3N4Z A;  1JJ2 F;  1IPA A;  3VI6 A;  2ALE A;  1K8A H;  1T0K B;  5GAP K;  1N8R H;  1ZWZ A;  5EO3 A;  1YJW F;  1GO1 A;  3NVK E;  3LWV C;  1Q7Y H;  3HJW C;  3I56 F;  5G4V C;  2FC3 A;  3N4Y A;  3LWQ C;  1RLG A;  3CPW F;  5GIN C;  1CN7 A;  3CCV F;  5A2Q M;  1QVG F;  3CG6 A;  1M90 H;  3CCE F;  3V7Q A;  3LWP C;  1Q82 H;  1YIJ F;  3ON1 A;  3CCQ F;  3SIV A;  3RA6 A;  3LFO A;  3LWR C;  3G71 F;  1YHQ F;  1H7M A;  3J7A R;  3NVI B;  1W2B F;  3OBY A;  5GIP C;  2HVY D;  1K9M H;  3OBW A;  1KQS F;  2AIF A;  3PLA C;  4X3M A;  2VGM A;  3E1Y A;  4TZZ A;  3CCR F;  2QI2 A;  1VQK F;  1W42 A;  1KD1 H;  3JCM M;  1KC8 H;  1M1K H;  3V7E A;  2CZW A;  3CXC F;  1VQO F;  1VQ8 F;  2WAL A;  3SIU A;  3GYQ A;  3CCJ F;  1VQP F;  4LCK A;  1VQ7 F;  3J81 M;  1VQ5 F;  3J80 M;  5DCV A;  1QVF F;  3CC4 F;  4X3L A;  3CCM F;  3CD6 F;  1X7O A;  3CC2 F;  2I6D A;  3CCU F;  2OTJ F;  5GAN K;  4C4W C;  5IT9 M;  2KTV A;  3G6E F;  1VQM F;  2OZB A;  3AGK A;  3LWO C;  1GO0 A;  2JNB A;  5FLX M;  1XBI A;  3CC7 F;  5GIO C;  1VQ4 F;  1PXW A;  2KTU A;  3PAF A;  1W40 A;  2QEX F;  2VGN A;  2BO1 A;  1Q86 H;  3VMF B;  1CK2 A;  2OHW A;  1VQ9 F;  3OW2 F;  3I55 F;  4NUT A;  3IR9 A;  5G4U C;  1NJI H;  1W41 A;  3E20 B;  3CPQ A;  3CCS F;  1VQL F;  1W3E X;  3MCA B;  3NMU C; 
#chains in the Genus database with same CATH topology
 4C82 A;  3JAS B;  1RA4 A;  1VQV A;  1FNJ A;  3RYH A;  5JH7 B;  3VCZ A;  1FFX B;  5EAZ A;  4X1Y A;  3WGJ A;  3NMU C;  1YJ9 F;  4BY9 D;  5EB0 A;  5HP8 A;  4FFB A;  1S72 F;  4PWT A;  3UT5 A;  4EI7 A;  3FFM A;  3HWU A;  5GON A;  4I4T A;  1X25 A;  1Q81 H;  2QTP A;  5HY0 A;  5LYJ B;  2UYN A;  3TD3 A;  5IJ0 B;  4E6E A;  1T0K B;  5EO3 A;  3VTI C;  2YYE A;  3NVK E;  4X1I A;  5EZY B;  5ITZ B;  3LWV C;  1Q7Y H;  1Z5W A;  5JVD B;  3RE3 A;  2FC3 A;  1PF5 A;  1U3L A;  1R1M A;  5FNV A;  2ZF8 A;  3N2K B;  1QVG F;  3HKC A;  1TUB A;  3V3T A;  3F6M A;  3V7Q A;  1NQ3 A;  3C9R A;  1XHO A;  4KWE A;  3C8L A;  4ERH A;  2HP3 A;  3E22 A;  3G71 F;  1H7M A;  2Q1Y A;  4BT7 A;  5HWE A;  1W2B F;  3OBY A;  5LXT A;  3TD5 A;  1KQS F;  4O4H A;  5B8F A;  2Z01 A;  3JVH A;  4TV9 B;  2Z1F A;  2RB9 A;  2VAW A;  1T0A A;  1W42 A;  1KD1 H;  1KC8 H;  3V7E A;  1VQ8 F;  5EB1 B;  3S0H A;  3LYB A;  4LCK A;  4IIJ B;  3J80 M;  4ZHV A;  3CC4 F;  3CD6 F;  3CCM F;  2I6D A;  3F0F A;  2UYP A;  3ZOP A;  3FPI A;  4U3J B;  2ZOV A;  1QD9 A;  5IT9 M;  4O4J A;  5CB4 B;  3VO8 A;  3RYF B;  3JAT A;  2N48 A;  2JNB A;  5J2T A;  5CA1 B;  3RYC B;  5GIO C;  2Q1X A;  2VGN A;  1QU9 A;  1W59 A;  3R0P A;  3S02 A;  3VMF B;  3P0Z A;  4YJ2 B;  5IYZ B;  2H6L A;  4I50 B;  2HQS C;  4EI8 A;  4G4V A;  4ZI7 B;  4DRX A;  5C8Y B;  1VQL F;  5EIB D;  3M4S A;  2ZOD A;  3D00 A;  3CME F;  3RA5 A;  2Z1U A;  1X7P A;  1VHA A;  2R6R 1;  5HY4 A;  4YJ3 B;  2DYY A;  3WXM B;  4I55 A;  5EYP B;  3O85 A;  3N2G A;  1GZ0 A;  1VQN F;  4BT6 A;  3HAX D;  4BW0 B;  2HS3 A;  4O2A B;  3JAW A;  2H8E A;  4TUY B;  3F0E A;  2QA4 F;  4G4Y A;  1ONI A;  5J2U B;  5BMV B;  2IAF A;  3C9U A;  3NK7 A;  5EWR A;  4O4L B;  1XRG A;  3JAL A;  1X52 A;  2ZVY A;  3IEQ A;  2RHL A;  3ESJ A;  1IPA A;  4IHJ A;  3TD4 A;  4NWO B;  1QAH A;  4ZHW A;  5LA6 B;  5JQG B;  2VAM A;  3WPW A;  5CA0 B;  2GVI A;  1GO1 A;  3WPX A;  3K14 A;  4X1K A;  1JD1 A;  1IV1 A;  3N4Y A;  2R75 1;  5IJ9 A;  3LWQ C;  1RLG A;  2RHO A;  3CCV F;  2UYJ A;  3MBM A;  3CG6 A;  5KX5 B;  3I3F A;  1W5E A;  3LWP C;  3CCE F;  1YIJ F;  3ON1 A;  1Z5V A;  3SIV A;  3DDN A;  3LFO A;  2CW4 A;  4ZHQ A;  4BT2 A;  3RYH B;  5HP7 A;  3NVI B;  2V9Y A;  2HVY D;  1K9M H;  3OBW A;  2AIF A;  4X1Y B;  2K1S A;  3CCR F;  4FFB B;  4TV8 A;  2QI2 A;  3UT5 B;  4WBN A;  2PHN A;  3CXC F;  5GON B;  4I4T B;  2W8B C;  3LME A;  5LOV A;  2KGW A;  3HKB A;  2B33 A;  4LNU A;  1VQ5 F;  1U3P A;  2UYN B;  4B5C A;  5DCV A;  2AIZ P;  1X7O A;  3D54 A;  3QTY A;  2OTJ F;  5GAN K;  2CVL A;  3B6N A;  4C4W C;  1TVK A;  4X1I B;  3HTN A;  4U39 A;  1JY8 A;  3AGK A;  3LWO C;  2BTQ B;  1GO0 A;  1FSZ A;  5FLX M;  1XBI A;  2UYK A;  2LCA A;  3WGM A;  2KTU A;  4G88 A;  1W40 A;  3S0W A;  5FNV B;  3WGN A;  3JAK A;  2BO1 A;  3HKC B;  1TUB B;  3HKD A;  2BTO A;  3WGL A;  1GX1 A;  1VQ9 F;  3I55 F;  4NUT A;  2CHT A;  5KMG A;  4O4I A;  5HXU A;  3CYQ A;  4O2B A;  3U0O A;  3E22 B;  1W41 A;  3CPQ A;  1W3E X;  1W5A A;  4BVT A;  5LXT B;  1OAP A;  1FNK A;  3P10 A;  4O4H B;  3ELC A;  2CWJ A;  4R40 B;  1COM A;  3G4S F;  2HS0 A;  2NMU A;  2VAP A;  2P6Y A;  3K2X A;  2HP0 A;  1W55 A;  2KG4 A;  1E7K A;  1YIT F;  3OON A;  1YJN F;  4BT3 A;  3I7T A;  4EB6 A;  3KIZ A;  1IV4 A;  2LBW A;  3RYI A;  3GTZ A;  3NK6 A;  3CMA F;  2LBX A;  4G4X A;  3ZP7 A;  1W5F A;  2ZVZ A;  1JFF A;  5FJ4 C;  4O4J B;  3MDO A;  3JAM M;  1SDS A;  2LBT A;  1JJ2 F;  1YGY A;  3VI6 A;  4X20 A;  4BT4 A;  3VYS C;  3JAT B;  4HNA A;  5HY2 A;  1Q8R A;  5J2T B;  1ZWZ A;  5GAP K;  3FD6 A;  1YJW F;  2MQE A;  4ZOL A;  3D01 A;  3QHD A;  3VOB A;  3S0Y A;  5G4V C;  2Z1T A;  1YQN A;  4B45 A;  3V4D A;  2OTM A;  4DRX B;  3HKE A;  3KJK A;  1Q82 H;  3JAR A;  5LP6 A;  4M8I A;  4C81 A;  4DXD A;  5LP6 C;  4NQ3 A;  4C8I A;  1SA0 A;  1YHQ F;  4BVS A;  3J7A R;  4F6R A;  3IKF A;  4I55 B;  3N2G B;  3WJR A;  3JAS A;  3PLA C;  3JAW B;  3E1Y A;  5JCO A;  2ZAU A;  5JH7 A;  5JCO C;  3F0G A;  2CZW A;  2PMP A;  1VQO F;  1FFX A;  2WAL A;  3JAL B;  3SIU A;  4G4Z A;  3CCJ F;  1VK3 A;  4C8E A;  1VQ7 F;  4IHJ B;  1QVF F;  3P4E A;  2RHH A;  3M1X A;  3FBA A;  1RQ7 A;  4X1K B;  1VQM F;  2OZB A;  3KE1 A;  5LYJ A;  1H48 A;  4BVQ A;  3FD5 A;  3BYQ A;  5IJ9 B;  5IJ0 A;  3CC7 F;  1IV2 A;  4EI9 A;  3PAF A;  1RLU A;  5EZY A;  5ITZ A;  2QEX F;  5JVD A;  1CLI A;  2OHW A;  3OW2 F;  4ZK7 A;  3LDT A;  2HRU A;  5HXZ A;  3S06 A;  3EOR A;  1DBF A;  1NJI H;  3N2K A;  4ZHQ B;  3E20 B;  1KNJ A;  3Q8H A;  3MCA B;  2IG8 A;  3VYT C;  2EWC A;  2VXY A;  1JN1 A;  4BVR A;  3QUW A;  4G4W A;  2CSL A;  3CCL F;  3M84 A;  4TV8 B;  2I6R A;  5AVM A;  3K0T A;  1VQ6 F;  4WBN B;  1NMU B;  3T80 A;  5MN5 A;  5LOV B;  3C9T A;  4C8G A;  3IKE A;  4TV9 A;  2OTL F;  3HKB B;  4LNU B;  1U43 A;  1XV2 A;  2F9Z C;  2YXZ A;  2AMT A;  3VIU A;  1W57 A;  1K73 H;  1TVK B;  1DT9 A;  2CHS A;  5MN4 A;  2RHJ A;  1YI2 F;  3N4Z A;  4IIJ A;  4B46 A;  2L26 A;  2HX0 A;  2ALE A;  3ZO8 A;  1UFY A;  1K8A H;  1H47 A;  5MN6 A;  1N8R H;  4U3J A;  4BT5 A;  5CB4 A;  2BTU A;  3JAK B;  1RQ2 A;  1SZQ A;  3MQW A;  3HJW C;  2DT4 A;  3I56 F;  3RYF A;  3KJJ A;  3HKD B;  3S03 A;  1W58 1;  5HY1 A;  5CA1 A;  3RYC A;  3CPW F;  5KMG B;  4O4I B;  4O2B B;  5GIN C;  2H8C A;  1CN7 A;  5A2Q M;  1M90 H;  2GZL A;  4YJ2 A;  5IYZ A;  3CCQ F;  4I50 A;  3RA6 A;  4RQO A;  3LWR C;  3ZP4 A;  4ZI7 A;  3C9S A;  5C8Y A;  5GIP C;  2HP0 B;  3VOA A;  3ERN A;  4X3M A;  2VGM A;  1W5B A;  4TZZ A;  4YJ3 A;  3WGK A;  4EB6 B;  1KNK A;  5EYP A;  1VQK F;  3RYI B;  3JCM M;  1M1K H;  3WJP A;  2UZH A;  2IQQ A;  4XCQ A;  4O2A A;  1JFF B;  4TUY A;  3K12 A;  1OFU A;  3GYQ A;  1VQP F;  1U40 A;  2HRY A;  1IV3 A;  3J81 M;  5BMV A;  5J2U A;  4X20 B;  2HS4 A;  4X3L A;  2Z1E A;  4HNA B;  4O4L A;  3CC2 F;  3CCU F;  4ZHY B;  4ZOL B;  3KHN A;  3F0D A;  2KTV A;  3DC2 A;  3G6E F;  1J7H A;  3IEW A;  5LA6 A;  5JQG A;  2G9I A;  1VQ4 F;  1PXW A;  5CA0 A;  3GHZ A;  2GLZ A;  1UI9 A;  1Q86 H;  3WJQ A;  1CK2 A;  3HKE B;  3JAR B;  5LP6 B;  1VH8 A;  3IR9 A;  5G4U C;  3VYU C;  1ODE A;  3CYP B;  1SA0 B;  2FGY A;  3IMP A;  4B62 A;  4F6R B;  5KX5 A;  3CCS F;  3CB2 A;  5EIB C;  4RHA A;  3L7Q A;  3MCQ A; 
#chains in the Genus database with same CATH homology
 3CME F;  3RA5 A;  1X7P A;  4BVR A;  1RA4 A;  5HY4 A;  3G4S F;  3CCL F;  3WXM B;  3O85 A;  1VQ6 F;  1GZ0 A;  1VQN F;  3HAX D;  1NMU B;  4BW0 B;  2KG4 A;  1E7K A;  1YIT F;  3NMU C;  1YJ9 F;  4BY9 D;  1YJN F;  2QA4 F;  2OTL F;  1S72 F;  2F9Z C;  2LBW A;  4EI7 A;  3FFM A;  3NK6 A;  3NK7 A;  5EWR A;  3CMA F;  2LBX A;  1X52 A;  1Q81 H;  1K73 H;  5FJ4 C;  1DT9 A;  3JAM M;  1SDS A;  1YI2 F;  3N4Z A;  1JJ2 F;  1IPA A;  5HY0 A;  3VI6 A;  2ALE A;  5HY2 A;  1K8A H;  1T0K B;  5GAP K;  1N8R H;  1ZWZ A;  5EO3 A;  1YJW F;  1GO1 A;  3NVK E;  3LWV C;  1Q7Y H;  3HJW C;  3I56 F;  5G4V C;  2FC3 A;  3N4Y A;  3LWQ C;  5HY1 A;  1RLG A;  3CPW F;  5GIN C;  1CN7 A;  3CCV F;  5A2Q M;  1QVG F;  3CG6 A;  3V3T A;  1M90 H;  3CCE F;  3V7Q A;  3LWP C;  1Q82 H;  1YIJ F;  3ON1 A;  3CCQ F;  3SIV A;  3RA6 A;  3LFO A;  4NQ3 A;  3LWR C;  3G71 F;  1YHQ F;  1H7M A;  4BVS A;  3J7A R;  3NVI B;  5HWE A;  1W2B F;  3OBY A;  5GIP C;  2HVY D;  1K9M H;  3OBW A;  1KQS F;  2AIF A;  3PLA C;  4X3M A;  2VGM A;  3E1Y A;  4TZZ A;  3CCR F;  2QI2 A;  1VQK F;  1W42 A;  1KD1 H;  3JCM M;  1KC8 H;  1M1K H;  3V7E A;  2CZW A;  4XCQ A;  3CXC F;  1VQO F;  2WAL A;  1VQ8 F;  3SIU A;  3GYQ A;  3CCJ F;  1VQP F;  4LCK A;  1VQ7 F;  3J81 M;  1VQ5 F;  3J80 M;  5DCV A;  1QVF F;  3CC4 F;  4X3L A;  3CCM F;  3CD6 F;  1X7O A;  3CC2 F;  2I6D A;  3CCU F;  2OTJ F;  5GAN K;  4C4W C;  5IT9 M;  2KTV A;  3G6E F;  1VQM F;  2OZB A;  4BVQ A;  3AGK A;  3LWO C;  1GO0 A;  2JNB A;  5FLX M;  1XBI A;  3CC7 F;  5GIO C;  1VQ4 F;  1PXW A;  2KTU A;  4EI9 A;  3PAF A;  1W40 A;  2QEX F;  2VGN A;  2BO1 A;  2GLZ A;  1Q86 H;  3VMF B;  1CK2 A;  2OHW A;  1VQ9 F;  3OW2 F;  3I55 F;  4NUT A;  4EI8 A;  5HXZ A;  5HXU A;  3IR9 A;  5G4U C;  1NJI H;  1W41 A;  2FGY A;  3E20 B;  3CPQ A;  3CCS F;  1VQL F;  1W3E X;  3MCA B;  4BVT A;  3D00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...