1T0KB

Joint x-ray and nmr refinement of yeast l30e-mrna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
b'SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*CP*GP*GP*AP*GP*UP*GP*UP*CP*C)-3'
publication title Joint X-Ray and NMR Refinement of the Yeast L30e-mRNA Complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1t0kB00
3LWQC 2QI2A 3NK6A 3CMEF 3CCUF 2KTVA 3FFMA 5GIPC 3CC4F 3PAFA 2CZWA 3LWPC 2OTJF 3CCEF 1PXWA 4C4WC 3AGKA 3G6EF 3CCSF 1YJ9F 3CPQA 3PLAC 1T0KB 3IR9A 3ON1A 1QVFF 2QA4F 3CD6F 2JNBA 2OZBA 2ALEA 1M1KH 1JJ2F 1E7KA 4BW0B 1VQ4F 5EWRA 3MCAB 1M90H 3RA6A 1CN7A 3CCJF 1QVGF 3GYQA 1RA4A 1ZWZA 2OHWA 2LBWA 3LFOA 2BO1A 3OW2F 3J80M 1H7MA 5A2QM 3LWRC 1VQLF 5DCVA 3CC2F 3SIUA 5FLXM 1YHQF 1VQ9F 5IT9M 5G4UC 1W3EX 3NMUC 1VQ5F 1KD1H 2VGMA 3I55F 2OTLF 1YJNF 5G4VC 3CCRF 1VQNF 2HVYD 3G4SF 1VQPF 3G71F 1XBIA 3N4YA 4NUTA 3CC7F 3HJWC 5GAPK 1S72F 4LCKA 3CCVF 3VI6A 3CMAF 1Q81H 4BY9D 1VQMF 3WXMB 3V7EA 3JCMM 3OBYA 1VQ8F 1K8AH 3J81M 1DT9A 3E20B 5GANK 3CPWF 3CCLF 1K9MH 1W40A 2WALA 3CG6A 1W2BF 3CCMF 3CCQF 1X7PA 1GO0A 3NVIB 1K73H 1YJWF 3VMFB 4X3LA 3JAMM 1GZ0A 2VGNA 2QEXF 1W41A 4X3MA 4TZZA 2LBXA 1KC8H 5FJ4C 1NMUB 1X7OA 1YIJF 2I6DA 3V7QA 1NJIH 3E1YA 5EO3A 1GO1A 1RLGA 1CK2A 1SDSA 3LWVC 2KG4A 2KTUA 1W42A 3RA5A 2FC3A 3CXCF 1N8RH 3J7AR 1Q86H 3N4ZA 1YI2F 1VQKF 3OBWA 1YITF 2AIFA 3I56F 5GIOC 5GINC 3LWOC 3O85A 1Q7YH 1VQ6F 1X52A 1KQSF 1Q82H 3HAXD 3NVKE 1VQOF 3NK7A 1VQ7F 1IPAA 3SIVA
chains in the Genus database with same CATH superfamily
4RQOA 3K12A 3CMEF 2KGWA 2KTVA 5GONA 3PAFA 3JARA 2GZLA 4BT5A 5C8YB 5LA6A 5JCOC 4YJ2A 2L26A 3HKDA 2EWCA 3VYTC 4O2BA 1IV2A 2AMTA 2CHTA 4I50A 4X1YA 2Z1FA 5J2UB 3PLAC 3HKCA 3JAKB 3ZP7A 4O4JA 4R40B 2I6RA 4O4LB 3MBMA 1W5BA 4ZK7A 4U39A 3I7TA 1E7KA 3WJQA 2CWJA 1VQ4F 3WGJA 5EWRA 3MCAB 3QUWA 3S0WA 3RYFA 1H48A 3K0TA 2HP3A 5EZYB 3F0DA 4DRXB 1U3PA 2UYNA 3GHZA 1JFFA 3WGLA 3QHDA 5A2QM 3WGMA 1W5EA 1JY8A 5G4UC 5J2TB 3CCRF 2ZOVA 1VQPF 2H8EA 3JVHA 3LMEA 3HJWC 4WBNB 1Q81H 3TD4A 4IHJB 5LYJA 3CB2A 3OBYA 3JCMM 4TV8A 1UFYA 4B46A 4B62A 4BT4A 1K8AH 1FSZA 3CPWF 4U3JB 2CVLA 2Q1YA 2CW4A 3L7QA 3HKEA 1X25A 3RYHA 1K73H 4X3LA 3RE3A 3JASB 1UI9A 2VGNA 4TZZA 3N2KB 3C9UA 1KC8H 4M8IA 3WJRA 4ZI7A 1NMUB 3S06A 5FJ4C 1YIJF 5KX5B 5HP8A 1W57A 1NJIH 5EYPB 5EO3A 3JATB 4C8GA 1GO1A 4BT6A 3TD5A 4RHAA 1SDSA 2KTUA 3RA5A 5JVDA 2UYJA 4HNAA 5MN4A 2ZF8A 1TUBA 3LYBA 1Q86H 1R1MA 5IJ9A 5HY1A 4BT7A 2ZVZA 2HS0A 1COMA 3OBWA 3P0ZA 4C82A 2RB9A 3ZP4A 2GLZA 2B33A 2Z1UA 1RQ7A 2VAPA 1VQ6F 2RHLA 1X52A 4X20B 1VQOF 3NK7A 3D01A 3NMUC 1SZQA 5JQGA 1YQNA 4EI7A 3LWQC 2QI2A 1IV4A 4F6RB 2OTMA 3FFMA 4O4IA 3IKEA 5HY2A 2CZWA 2OTJF 5GONB 2HS4A 4PWTA 1H47A 5LA6B 1PXWA 4YJ2B 3CCSF 1VQVA 1YJ9F 3CYQA 3HKDB 2GVIA 1W581 3VCZA 4O2BB 2RHOA 4X1YB 2VAMA 2DT4A 3FD6A 5IJ0B 1FNKA 1IV1A 1M90H 1QU9A 1CN7A 4O2AA 2OHWA 4KWEA 2BO1A 3RYFB 5CB4B 1RLUA 5HXUA 1H7MA 1FFXA 4DXDA 5IYZA 3N2GA 2UYNB 1JFFB 2K1SA 3CC2F 1ODEA 4C81A 2LCAA 4BVRA 2VGMA 3UT5B 3EORA 2DYYA 1VK3A 3RYCA 5JCOA 4ZOLA 1W5FA 3CC7F 4LCKA 1S72F 3E22A 5CA0A 3RYIA 2FGYA 4BY9D 1XRGA 5FNVA 4EB6A 1VQ8F 5CA1A 5HY0A 3F0FA 5LYJB 5HWEA 4TV8B 4BVQA 3JALA 3J81M 3E20B 4BVTA 3ERNA 5KMGA 1U43A 5GANK 1K9MH 2WALA 3CCMF 1VHAA 4I4TA 3CCQF 1YJWF 3D54A 2QEXF 3RYHB 3VYUC 1SA0A 1JN1A 1U3LA 2N48A 2VAWA 4ERHA 5BMVA 4LNUB 2IAFA 3V7QA 4ZI7B 5EB1B 2R751 3IMPA 5HY4A 4E6EA 3LWVC 3VYSC 2BTOA 4I55A 2UZHA 1OFUA 1FNJA 3M1XA 5EB0A 2CSLA 4HNAB 3ESJA 3HTNA 5IJ9B 3I56F 5GIOC 2NMUA 3R0PA 5GINC 5MN5A 3O85A 1Q7YH 5LOVA 4X1IA 3S03A 3NVKE 3OONA 2VXYA 4FFBA 1GZ0A 1VQ7F 4B5CA 1PF5A 3KJKA 5JQGB 2CHSA 2F9ZC 3IEQA 3LWPC 2IQQA 3IEWA 3KIZA 4O4IB 3CCEF 4X1KA 1KNJA 3B6NA 3V3TA 2PMPA 3ZOPA 2RHHA 2HP0A 3AGKA 5MN6A 5J2TA 2QTPA 1T0KB 3IR9A 3ON1A 2HRYA 3ELCA 1T0AA 3WPXA 5HP7A 3CD6F 2JNBA 2ALEA 2ZVYA 1M1KH 2P6YA 4BW0B 4TUYA 4ZHVA 3QTYA 5JH7A 3WJPA 3CCJF 4YJ3A 1ZWZA 3T80A 3LFOA 4O2AB 3V4DA 5EIBC 5HXZA 2R6R1 1TVKA 2UYKA 2PHNA 3JARB 3LWRC 1FFXB 3I3FA 1VQLF 3DC2A 5IYZB 3N2GB 1YHQF 1VQ9F 5IT9M 2MQEA 1W3EX 3C9RA 3LDTA 5LXTA 3I55F 4I50B 1YJNF 3HKCB 2W8BC 4O4JB 3N4YA 4NUTA 1YGYA 3CMAF 3WGKA 3SIVA 2LBTA 3V7EA 3JAWA 3RYIB 5CA0B 3P4EA 3IKFA 5FNVB 4O4HA 5CA1B 5LP6A 1Z5VA 3C9TA 2G9IA 1GX1A 3Q8HA 4ZHQA 1W2BF 1GO0A 1OAPA 1X7PA 1QAHA 2HRUA 4I4TB 3JAMM 2H6LA 1W41A 4X3MA 2LBXA 2HS3A 2IG8A 3C8LA 1SA0B 5B8FA 5EIBD 4G88A 4BVSA 4F6RA 3HKBA 1RLGA 1CK2A 4C8EA 3FPIA 3HWUA 2FC3A 3K2XA 3VTIC 1N8RH 3J7AR 4I55B 4XCQA 4G4VA 4EI9A 1YI2F 3VIUA 4IIJA 1VQKF 1YITF 1XV2A 5ITZA 3S0YA 3HKEB 3LWOC 5IJ0A 4BT2A 3MDOA 2RHJA 4TV9A 3HAXD 1ONIA 2YYEA 5CB4A 5LOVB 1IPAA 1W5AA 2HX0A 4X1IB 3VOAA 3U0OA 3NK6A 3K14A 4FFBB 4BT3A 3CCUF 5GIPC 5C8YA 3CC4F 2ZODA 3CYPB 4G4ZA 1XHOA 4C8IA 3S0HA 5JVDB 3BYQA 5J2UA 4C4WC 1TUBB 3UT5A 3G6EF 4X1KB 3CPQA 3JAKA 5AVMA 2HP0B 4O4LA 3DDNA 3GTZA 1QVFF 3VOBA 1RQ2A 2QA4F 2OZBA 1W59A 1JJ2F 3MCQA 4B45A 2Q1XA 3RA6A 3VO8A 4TUYB 1QVGF 5EZYA 3GYQA 5JH7B 1RA4A 4DRXA 2LBWA 1JD1A 3OW2F 4YJ3B 3F6MA 3J80M 1CLIA 5DCVA 1TVKB 3SIUA 5FLXM 2BTQB 4ZHWA 3P10A 2Z1EA 1VQ5F 1KD1H 4LNUA 2OTLF 3KE1A 5LXTB 5G4VC 1VQNF 4G4YA 4WBNA 1KNKA 3G4SF 2HVYD 3G71F 4IHJA 1XBIA 2ZAUA 3F0EA 5GAPK 3WPWA 3VI6A 4ZHYB 3CCVF 1VQMF 3WXMB 3TD3A 2V9YA 3KJJA 3FD5A 1QD9A 3JAWB 4U3JA 1Z5WA 1DT9A 3CCLF 5EAZA 4O4HB 1W40A 4G4WA 5LP6B 3CG6A 2HQSC 3JASA 3NVIB 4ZHQB 3N2KA 3VMFB 1Q8RA 3S02A 2Z01A 5KX5A 3ZO8A 4G4XA 1X7OA 3F0GA 3JATA 5EYPA 2I6DA 3FBAA 2UYPA 3E1YA 3RYCB 2BTUA 4ZOLB 2KG4A 1W42A 3E22B 3D00A 3HKBB 1DBFA 3M84A 4NQ3A 1W55A 1VH8A 3M4SA 4EI8A 3CXCF 4EB6B 3N4ZA 3JALB 5KMGB 2AIZP 2YXZA 2Z1TA 1J7HA 2AIFA 4IIJB 4NWOB 5ITZB 1U40A 1IV3A 3WGNA 4X20A 5LP6C 3KHNA 3MQWA 1KQSF 1Q82H 1NQ3A 3C9SA 4TV9B 5BMVB 2H8CA
chains in the Genus database with same CATH topology
4EI7A 3LWQC 2QI2A 3NK6A 3CMEF 3CCUF 2KTVA 3FFMA 5GIPC 3CC4F 3PAFA 2F9ZC 2CZWA 5HY2A 3LWPC 2OTJF 3CCEF 3V3TA 1PXWA 4C4WC 3AGKA 3G6EF 3CCSF 1YJ9F 3CPQA 3PLAC 1T0KB 3IR9A 3ON1A 1QVFF 2QA4F 3CD6F 2JNBA 2OZBA 2ALEA 1M1KH 1JJ2F 1E7KA 4BW0B 1VQ4F 5EWRA 3MCAB 1M90H 3RA6A 1CN7A 3CCJF 1QVGF 3GYQA 1RA4A 1ZWZA 2OHWA 2LBWA 3LFOA 2BO1A 3OW2F 5HXZA 3J80M 5HXUA 1H7MA 5A2QM 3LWRC 1VQLF 5DCVA 3CC2F 3SIUA 5FLXM 1YHQF 1VQ9F 5IT9M 5G4UC 1W3EX 3NMUC 1VQ5F 4BVRA 2VGMA 3I55F 1KD1H 2OTLF 1YJNF 5G4VC 3CCRF 1VQNF 2HVYD 3G4SF 1VQPF 3G71F 1XBIA 3N4YA 4NUTA 3CC7F 3HJWC 5GAPK 1S72F 4LCKA 3CCVF 3VI6A 2FGYA 3CMAF 1Q81H 1VQMF 4BY9D 3WXMB 3V7EA 3JCMM 3OBYA 1VQ8F 5HY0A 5HWEA 4BVQA 1K8AH 3J81M 1DT9A 3E20B 4BVTA 5GANK 3CPWF 3CCLF 1K9MH 1W40A 2WALA 3CG6A 1W2BF 3CCMF 3CCQF 1X7PA 1GO0A 3NVIB 1K73H 1YJWF 3VMFB 4X3LA 1GZ0A 3JAMM 2VGNA 2QEXF 1W41A 4X3MA 4TZZA 2LBXA 1KC8H 5FJ4C 1NMUB 1X7OA 1YIJF 2I6DA 3V7QA 1NJIH 3E1YA 5EO3A 4BVSA 1GO1A 1RLGA 1CK2A 1SDSA 5HY4A 3LWVC 2KG4A 2KTUA 1W42A 3RA5A 3D00A 4NQ3A 2FC3A 4EI8A 3CXCF 1N8RH 3J7AR 4XCQA 1Q86H 3N4ZA 4EI9A 5HY1A 1YI2F 1VQKF 3OBWA 1YITF 2AIFA 3I56F 5GIOC 5GINC 3LWOC 2GLZA 3O85A 1Q7YH 1VQ6F 1X52A 1KQSF 1Q82H 3HAXD 3NVKE 1VQOF 3NK7A 1VQ7F 1IPAA 3SIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWQ C;  2QI2 A;  3NK6 A;  3CME F;  3CCU F;  2KTV A;  3FFM A;  5GIP C;  3CC4 F;  3PAF A;  2CZW A;  3LWP C;  2OTJ F;  3CCE F;  1PXW A;  4C4W C;  3AGK A;  3G6E F;  3CCS F;  1YJ9 F;  3CPQ A;  3PLA C;  1T0K B;  3IR9 A;  3ON1 A;  1QVF F;  2QA4 F;  3CD6 F;  2JNB A;  2OZB A;  2ALE A;  1M1K H;  1JJ2 F;  1E7K A;  4BW0 B;  1VQ4 F;  5EWR A;  3MCA B;  1M90 H;  3RA6 A;  1CN7 A;  3CCJ F;  1QVG F;  3GYQ A;  1RA4 A;  1ZWZ A;  2OHW A;  2LBW A;  3LFO A;  2BO1 A;  3OW2 F;  3J80 M;  1H7M A;  5A2Q M;  3LWR C;  1VQL F;  5DCV A;  3CC2 F;  3SIU A;  5FLX M;  1YHQ F;  1VQ9 F;  5IT9 M;  5G4U C;  1W3E X;  3NMU C;  1VQ5 F;  1KD1 H;  2VGM A;  3I55 F;  2OTL F;  1YJN F;  5G4V C;  3CCR F;  1VQN F;  2HVY D;  3G4S F;  1VQP F;  3G71 F;  1XBI A;  3N4Y A;  4NUT A;  3CC7 F;  3HJW C;  5GAP K;  1S72 F;  4LCK A;  3CCV F;  3VI6 A;  3CMA F;  1Q81 H;  4BY9 D;  1VQM F;  3WXM B;  3V7E A;  3JCM M;  3OBY A;  1VQ8 F;  1K8A H;  3J81 M;  1DT9 A;  3E20 B;  5GAN K;  3CPW F;  3CCL F;  1K9M H;  1W40 A;  2WAL A;  3CG6 A;  1W2B F;  3CCM F;  3CCQ F;  1X7P A;  1GO0 A;  3NVI B;  1K73 H;  1YJW F;  3VMF B;  4X3L A;  3JAM M;  1GZ0 A;  2VGN A;  2QEX F;  1W41 A;  4X3M A;  4TZZ A;  2LBX A;  1KC8 H;  5FJ4 C;  1NMU B;  1X7O A;  1YIJ F;  2I6D A;  3V7Q A;  1NJI H;  3E1Y A;  5EO3 A;  1GO1 A;  1RLG A;  1CK2 A;  1SDS A;  3LWV C;  2KG4 A;  2KTU A;  1W42 A;  3RA5 A;  2FC3 A;  3CXC F;  1N8R H;  3J7A R;  1Q86 H;  3N4Z A;  1YI2 F;  1VQK F;  3OBW A;  1YIT F;  2AIF A;  3I56 F;  5GIO C;  5GIN C;  3LWO C;  3O85 A;  1Q7Y H;  1VQ6 F;  1X52 A;  1KQS F;  1Q82 H;  3HAX D;  3NVK E;  1VQO F;  3NK7 A;  1VQ7 F;  1IPA A;  3SIV A; 
#chains in the Genus database with same CATH topology
 4RQO A;  3K12 A;  3CME F;  2KGW A;  2KTV A;  5GON A;  3PAF A;  3JAR A;  2GZL A;  4BT5 A;  5C8Y B;  5LA6 A;  5JCO C;  4YJ2 A;  2L26 A;  3HKD A;  2EWC A;  3VYT C;  4O2B A;  1IV2 A;  2AMT A;  2CHT A;  4I50 A;  4X1Y A;  2Z1F A;  5J2U B;  3PLA C;  3HKC A;  3JAK B;  3ZP7 A;  4O4J A;  4R40 B;  2I6R A;  4O4L B;  3MBM A;  1W5B A;  4ZK7 A;  4U39 A;  3I7T A;  1E7K A;  3WJQ A;  2CWJ A;  1VQ4 F;  3WGJ A;  5EWR A;  3MCA B;  3QUW A;  3S0W A;  3RYF A;  1H48 A;  3K0T A;  2HP3 A;  5EZY B;  3F0D A;  4DRX B;  1U3P A;  2UYN A;  3GHZ A;  1JFF A;  3WGL A;  3QHD A;  5A2Q M;  3WGM A;  1W5E A;  1JY8 A;  5G4U C;  5J2T B;  3CCR F;  2ZOV A;  1VQP F;  2H8E A;  3JVH A;  3LME A;  3HJW C;  4WBN B;  1Q81 H;  3TD4 A;  4IHJ B;  5LYJ A;  3CB2 A;  3OBY A;  3JCM M;  4TV8 A;  1UFY A;  4B46 A;  4B62 A;  4BT4 A;  1K8A H;  1FSZ A;  3CPW F;  4U3J B;  2CVL A;  2Q1Y A;  2CW4 A;  3L7Q A;  3HKE A;  1X25 A;  3RYH A;  1K73 H;  4X3L A;  3RE3 A;  3JAS B;  1UI9 A;  2VGN A;  4TZZ A;  3N2K B;  3C9U A;  1KC8 H;  4M8I A;  3WJR A;  4ZI7 A;  1NMU B;  3S06 A;  5FJ4 C;  1YIJ F;  5KX5 B;  5HP8 A;  1W57 A;  1NJI H;  5EYP B;  5EO3 A;  3JAT B;  4C8G A;  1GO1 A;  4BT6 A;  3TD5 A;  4RHA A;  1SDS A;  2KTU A;  3RA5 A;  5JVD A;  2UYJ A;  4HNA A;  5MN4 A;  2ZF8 A;  1TUB A;  3LYB A;  1Q86 H;  1R1M A;  5IJ9 A;  5HY1 A;  4BT7 A;  2ZVZ A;  2HS0 A;  1COM A;  3OBW A;  3P0Z A;  4C82 A;  2RB9 A;  3ZP4 A;  2GLZ A;  2B33 A;  2Z1U A;  1RQ7 A;  2VAP A;  1VQ6 F;  2RHL A;  1X52 A;  4X20 B;  1VQO F;  3NK7 A;  3D01 A;  3NMU C;  1SZQ A;  5JQG A;  1YQN A;  4EI7 A;  3LWQ C;  2QI2 A;  1IV4 A;  4F6R B;  2OTM A;  3FFM A;  4O4I A;  3IKE A;  5HY2 A;  2CZW A;  2OTJ F;  5GON B;  2HS4 A;  4PWT A;  1H47 A;  5LA6 B;  1PXW A;  4YJ2 B;  3CCS F;  1VQV A;  1YJ9 F;  3CYQ A;  3HKD B;  2GVI A;  1W58 1;  3VCZ A;  4O2B B;  2RHO A;  4X1Y B;  2VAM A;  2DT4 A;  3FD6 A;  5IJ0 B;  1FNK A;  1IV1 A;  1M90 H;  1QU9 A;  1CN7 A;  4O2A A;  2OHW A;  4KWE A;  2BO1 A;  3RYF B;  5CB4 B;  1RLU A;  5HXU A;  1H7M A;  1FFX A;  4DXD A;  5IYZ A;  3N2G A;  2UYN B;  1JFF B;  2K1S A;  3CC2 F;  1ODE A;  4C81 A;  2LCA A;  4BVR A;  2VGM A;  3UT5 B;  3EOR A;  2DYY A;  1VK3 A;  3RYC A;  5JCO A;  4ZOL A;  1W5F A;  3CC7 F;  4LCK A;  1S72 F;  3E22 A;  5CA0 A;  3RYI A;  2FGY A;  4BY9 D;  1XRG A;  5FNV A;  4EB6 A;  1VQ8 F;  5CA1 A;  5HY0 A;  3F0F A;  5LYJ B;  5HWE A;  4TV8 B;  4BVQ A;  3JAL A;  3J81 M;  3E20 B;  4BVT A;  3ERN A;  5KMG A;  1U43 A;  5GAN K;  1K9M H;  2WAL A;  3CCM F;  1VHA A;  4I4T A;  3CCQ F;  1YJW F;  3D54 A;  2QEX F;  3RYH B;  3VYU C;  1SA0 A;  1JN1 A;  1U3L A;  2N48 A;  2VAW A;  4ERH A;  5BMV A;  4LNU B;  2IAF A;  3V7Q A;  4ZI7 B;  5EB1 B;  2R75 1;  3IMP A;  5HY4 A;  4E6E A;  3LWV C;  3VYS C;  2BTO A;  4I55 A;  2UZH A;  1OFU A;  1FNJ A;  3M1X A;  5EB0 A;  2CSL A;  4HNA B;  3ESJ A;  3HTN A;  5IJ9 B;  3I56 F;  5GIO C;  2NMU A;  3R0P A;  5GIN C;  5MN5 A;  3O85 A;  1Q7Y H;  5LOV A;  4X1I A;  3S03 A;  3NVK E;  3OON A;  2VXY A;  4FFB A;  1GZ0 A;  1VQ7 F;  4B5C A;  1PF5 A;  3KJK A;  5JQG B;  2CHS A;  2F9Z C;  3IEQ A;  3LWP C;  2IQQ A;  3IEW A;  3KIZ A;  4O4I B;  3CCE F;  4X1K A;  1KNJ A;  3B6N A;  3V3T A;  2PMP A;  3ZOP A;  2RHH A;  2HP0 A;  3AGK A;  5MN6 A;  5J2T A;  2QTP A;  1T0K B;  3IR9 A;  3ON1 A;  2HRY A;  3ELC A;  1T0A A;  3WPX A;  5HP7 A;  3CD6 F;  2JNB A;  2ALE A;  2ZVY A;  1M1K H;  2P6Y A;  4BW0 B;  4TUY A;  4ZHV A;  3QTY A;  5JH7 A;  3WJP A;  3CCJ F;  4YJ3 A;  1ZWZ A;  3T80 A;  3LFO A;  4O2A B;  3V4D A;  5EIB C;  5HXZ A;  2R6R 1;  1TVK A;  2UYK A;  2PHN A;  3JAR B;  3LWR C;  1FFX B;  3I3F A;  1VQL F;  3DC2 A;  5IYZ B;  3N2G B;  1YHQ F;  1VQ9 F;  5IT9 M;  2MQE A;  1W3E X;  3C9R A;  3LDT A;  5LXT A;  3I55 F;  4I50 B;  1YJN F;  3HKC B;  2W8B C;  4O4J B;  3N4Y A;  4NUT A;  1YGY A;  3CMA F;  3WGK A;  3SIV A;  2LBT A;  3V7E A;  3JAW A;  3RYI B;  5CA0 B;  3P4E A;  3IKF A;  5FNV B;  4O4H A;  5CA1 B;  5LP6 A;  1Z5V A;  3C9T A;  2G9I A;  1GX1 A;  3Q8H A;  4ZHQ A;  1W2B F;  1GO0 A;  1OAP A;  1X7P A;  1QAH A;  2HRU A;  4I4T B;  3JAM M;  2H6L A;  1W41 A;  4X3M A;  2LBX A;  2HS3 A;  2IG8 A;  3C8L A;  1SA0 B;  5B8F A;  5EIB D;  4G88 A;  4BVS A;  4F6R A;  3HKB A;  1RLG A;  1CK2 A;  4C8E A;  3FPI A;  3HWU A;  2FC3 A;  3K2X A;  3VTI C;  1N8R H;  3J7A R;  4I55 B;  4XCQ A;  4G4V A;  4EI9 A;  1YI2 F;  3VIU A;  4IIJ A;  1VQK F;  1YIT F;  1XV2 A;  5ITZ A;  3S0Y A;  3HKE B;  3LWO C;  5IJ0 A;  4BT2 A;  3MDO A;  2RHJ A;  4TV9 A;  3HAX D;  1ONI A;  2YYE A;  5CB4 A;  5LOV B;  1IPA A;  1W5A A;  2HX0 A;  4X1I B;  3VOA A;  3U0O A;  3NK6 A;  3K14 A;  4FFB B;  4BT3 A;  3CCU F;  5GIP C;  5C8Y A;  3CC4 F;  2ZOD A;  3CYP B;  4G4Z A;  1XHO A;  4C8I A;  3S0H A;  5JVD B;  3BYQ A;  5J2U A;  4C4W C;  1TUB B;  3UT5 A;  3G6E F;  4X1K B;  3CPQ A;  3JAK A;  5AVM A;  2HP0 B;  4O4L A;  3DDN A;  3GTZ A;  1QVF F;  3VOB A;  1RQ2 A;  2QA4 F;  2OZB A;  1W59 A;  1JJ2 F;  3MCQ A;  4B45 A;  2Q1X A;  3RA6 A;  3VO8 A;  4TUY B;  1QVG F;  5EZY A;  3GYQ A;  5JH7 B;  1RA4 A;  4DRX A;  2LBW A;  1JD1 A;  3OW2 F;  4YJ3 B;  3F6M A;  3J80 M;  1CLI A;  5DCV A;  1TVK B;  3SIU A;  5FLX M;  2BTQ B;  4ZHW A;  3P10 A;  2Z1E A;  1VQ5 F;  1KD1 H;  4LNU A;  2OTL F;  3KE1 A;  5LXT B;  5G4V C;  1VQN F;  4G4Y A;  4WBN A;  1KNK A;  3G4S F;  2HVY D;  3G71 F;  4IHJ A;  1XBI A;  2ZAU A;  3F0E A;  5GAP K;  3WPW A;  3VI6 A;  4ZHY B;  3CCV F;  1VQM F;  3WXM B;  3TD3 A;  2V9Y A;  3KJJ A;  3FD5 A;  1QD9 A;  3JAW B;  4U3J A;  1Z5W A;  1DT9 A;  3CCL F;  5EAZ A;  4O4H B;  1W40 A;  4G4W A;  5LP6 B;  3CG6 A;  2HQS C;  3JAS A;  3NVI B;  4ZHQ B;  3N2K A;  3VMF B;  1Q8R A;  3S02 A;  2Z01 A;  5KX5 A;  3ZO8 A;  4G4X A;  1X7O A;  3F0G A;  3JAT A;  5EYP A;  2I6D A;  3FBA A;  2UYP A;  3E1Y A;  3RYC B;  2BTU A;  4ZOL B;  2KG4 A;  1W42 A;  3E22 B;  3D00 A;  3HKB B;  1DBF A;  3M84 A;  4NQ3 A;  1W55 A;  1VH8 A;  3M4S A;  4EI8 A;  3CXC F;  4EB6 B;  3N4Z A;  3JAL B;  5KMG B;  2AIZ P;  2YXZ A;  2Z1T A;  1J7H A;  2AIF A;  4IIJ B;  4NWO B;  5ITZ B;  1U40 A;  1IV3 A;  3WGN A;  4X20 A;  5LP6 C;  3KHN A;  3MQW A;  1KQS F;  1Q82 H;  1NQ3 A;  3C9S A;  4TV9 B;  5BMV B;  2H8C A; 
#chains in the Genus database with same CATH homology
 4EI7 A;  3LWQ C;  2QI2 A;  3NK6 A;  3CME F;  3CCU F;  2KTV A;  3FFM A;  5GIP C;  3CC4 F;  3PAF A;  2F9Z C;  2CZW A;  5HY2 A;  3LWP C;  2OTJ F;  3CCE F;  3V3T A;  1PXW A;  4C4W C;  3AGK A;  3G6E F;  3CCS F;  1YJ9 F;  3CPQ A;  3PLA C;  1T0K B;  3IR9 A;  3ON1 A;  1QVF F;  2QA4 F;  3CD6 F;  2JNB A;  2OZB A;  2ALE A;  1M1K H;  1JJ2 F;  1E7K A;  4BW0 B;  1VQ4 F;  5EWR A;  3MCA B;  1M90 H;  3RA6 A;  1CN7 A;  3CCJ F;  1QVG F;  3GYQ A;  1RA4 A;  1ZWZ A;  2OHW A;  2LBW A;  3LFO A;  2BO1 A;  3OW2 F;  5HXZ A;  3J80 M;  5HXU A;  1H7M A;  5A2Q M;  3LWR C;  1VQL F;  5DCV A;  3CC2 F;  3SIU A;  5FLX M;  1YHQ F;  1VQ9 F;  5IT9 M;  5G4U C;  1W3E X;  3NMU C;  1VQ5 F;  4BVR A;  2VGM A;  3I55 F;  1KD1 H;  2OTL F;  1YJN F;  5G4V C;  3CCR F;  1VQN F;  2HVY D;  3G4S F;  1VQP F;  3G71 F;  1XBI A;  3N4Y A;  4NUT A;  3CC7 F;  3HJW C;  5GAP K;  1S72 F;  4LCK A;  3CCV F;  3VI6 A;  2FGY A;  3CMA F;  1Q81 H;  1VQM F;  4BY9 D;  3WXM B;  3V7E A;  3JCM M;  3OBY A;  1VQ8 F;  5HY0 A;  5HWE A;  4BVQ A;  1K8A H;  3J81 M;  1DT9 A;  3E20 B;  4BVT A;  5GAN K;  3CPW F;  3CCL F;  1K9M H;  1W40 A;  2WAL A;  3CG6 A;  1W2B F;  3CCM F;  3CCQ F;  1X7P A;  1GO0 A;  3NVI B;  1K73 H;  1YJW F;  3VMF B;  4X3L A;  1GZ0 A;  3JAM M;  2VGN A;  2QEX F;  1W41 A;  4X3M A;  4TZZ A;  2LBX A;  1KC8 H;  5FJ4 C;  1NMU B;  1X7O A;  1YIJ F;  2I6D A;  3V7Q A;  1NJI H;  3E1Y A;  5EO3 A;  4BVS A;  1GO1 A;  1RLG A;  1CK2 A;  1SDS A;  5HY4 A;  3LWV C;  2KG4 A;  2KTU A;  1W42 A;  3RA5 A;  3D00 A;  4NQ3 A;  2FC3 A;  4EI8 A;  3CXC F;  1N8R H;  3J7A R;  4XCQ A;  1Q86 H;  3N4Z A;  4EI9 A;  5HY1 A;  1YI2 F;  1VQK F;  3OBW A;  1YIT F;  2AIF A;  3I56 F;  5GIO C;  5GIN C;  3LWO C;  2GLZ A;  3O85 A;  1Q7Y H;  1VQ6 F;  1X52 A;  1KQS F;  1Q82 H;  3HAX D;  3NVK E;  1VQO F;  3NK7 A;  1VQ7 F;  1IPA A;  3SIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...