1T0KB

Joint x-ray and nmr refinement of yeast l30e-mrna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 5'-R(*GP*AP*CP*CP*GP*GP*AP*GP*UP*GP*UP*CP*C)-3'
publication title Joint X-Ray and NMR Refinement of the Yeast L30e-mRNA Complex
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1t0kB00
3J7AR 2AIFA 1RA4A 3CG6A 2VGMA 1Q7YH 5G4VC 1KC8H 3CCQF 3IR9A 1Q86H 2HVYD 1VQ9F 3VI6A 3LWQC 1W3EX 1N8RH 1QVGF 1M1KH 3AGKA 1CK2A 4LCKA 3CPWF 1RLGA 1K8AH 3OW2F 1NMUB 2JNBA 3CCEF 1K73H 3ON1A 4BY9D 5IT9M 1SDSA 2CZWA 3CCUF 1VQPF 1E7KA 1KD1H 1X7OA 5FLXM 5GIOC 5FJ4C 3CC4F 4BW0B 1JJ2F 5A2QM 1GO0A 3RA6A 3NK6A 3MCAB 1CN7A 3NMUC 2QA4F 1T0KB 3CPQA 3G6EF 2I6DA 3CCMF 1VQ8F 5G4UC 3CC2F 3E1YA 3N4ZA 3CCLF 1W42A 1PXWA 1S72F 3CCRF 3PLAC 2OZBA 1VQ6F 3G4SF 3GYQA 3NVKE 3CCJF 3LWPC 3CCSF 1K9MH 3CMEF 2OTLF 1GZ0A 1VQ7F 1GO1A 1YIJF 4NUTA 3I56F 1W2BF 2LBXA 3OBWA 1YJNF 3O85A 5GIPC 5GANK 3LWOC 3J80M 1XBIA 3FFMA 5EO3A 3V7QA 1YITF 1VQNF 1YI2F 2KTUA 1ZWZA 2KG4A 2OTJF 2LBWA 3VMFB 1QVFF 3NVIB 5GAPK 1VQOF 2QEXF 1Q81H 3LWRC 1VQ4F 2VGNA 3NK7A 3CMAF 3CD6F 3PAFA 1W41A 1NJIH 1X52A 3G71F 1Q82H 1VQMF 3JAMM 1IPAA 4X3MA 3CCVF 3RA5A 1VQ5F 3N4YA 5DCVA 1W40A 1H7MA 3E20B 3WXMB 4C4WC 3JCMM 5EWRA 3I55F 2KTVA 3J81M 3CXCF 3CC7F 1M90H 2FC3A 3V7EA 2OHWA 1VQKF 3LWVC 3SIVA 3OBYA 1YHQF 5GINC 1YJWF 4TZZA 3LFOA 3HJWC 1YJ9F 3SIUA 2QI2A 3HAXD 2ALEA 4X3LA 2WALA 1KQSF 2BO1A 1DT9A 1VQLF 1X7PA
chains in the Genus database with same CATH superfamily
2AIFA 2CHSA 4TV8A 3M1XA 2CVLA 5CA1A 1VQ9F 1U3PA 4O4IA 4YJ3A 1XV2A 4C8EA 3LWQC 1QVGF 5FNVB 4BVTA 4X1IA 5ITZB 4NWOB 5JCOA 5HXZA 3M84A 2Z01A 4O2BB 1RQ7A 1W5BA 5EYPB 5JCOC 2CHTA 3ON1A 1T0AA 4I50A 1X7OA 5FLXM 5GIOC 1R1MA 1W5EA 1X25A 2Z1TA 3RYIA 5A2QM 5EB1B 2VAMA 4F6RB 3NMUC 2QA4F 1VHAA 1T0KB 5GONA 4O2BA 4DRXB 3CCMF 5HXUA 4U3JA 4TV9A 3E1YA 3RE3A 1W42A 1Q8RA 3IKEA 2W8BC 5MN5A 3CCRF 3K0TA 3K12A 5CB4B 3LWPC 3CCSF 3JVHA 1GZ0A 3K2XA 5LOVB 5MN6A 3C9RA 2P6YA 3OBWA 5CA0B 3O85A 5GIPC 3S0HA 1OAPA 5EIBD 5IJ0B 3E22B 3HKCB 4C82A 4ZOLB 4FFBA 3JATA 2KGWA 2UYKA 5LOVA 3FFMA 3P0ZA 5EO3A 3V7QA 3KE1A 3VTIC 3V3TA 4BVSA 2Z1UA 1NQ3A 5IJ0A 3JALA 5IYZB 1CLIA 2Z1EA 1W581 1QVFF 5B8FA 3FD6A 4EI9A 2HS4A 5LP6A 3NK7A 1RLUA 2BTQB 2IG8A 3CD6F 5JVDB 4TUYB 5IYZA 1XHOA 5LP6C 4B45A 3JAMM 3VCZA 3CCVF 3RYHB 3N4YA 3D01A 3WXMB 4IIJB 4C4WC 4RHAA 1XRGA 4TUYA 5JH7A 3QHDA 3JAWB 2ZVZA 1ODEA 5KX5A 3JAKB 3GHZA 2Z1FA 1Z5VA 2FC3A 3V7EA 2OTMA 3RYHA 3OBYA 2B33A 1SA0B 5GINC 4NQ3A 4ZHYB 3HJWC 1JY8A 2UZHA 3JAWA 4O4LB 4IHJB 5J2UB 5IJ9B 3C9SA 2BO1A 1IV2A 3N2GB 1DT9A 1VQLF 4ZI7B 1U43A 1SA0A 4G88A 2YYEA 2VGMA 4BVRA 2HVYD 1W3EX 3KJKA 4LNUB 3HKDA 4IHJA 5J2UA 5IJ9A 4ZI7A 3CPWF 1RLGA 1K8AH 4C81A 4M8IA 3I7TA 3VOBA 4O4HB 2HP3A 3QTYA 4BY9D 5IT9M 3CCUF 1VQPF 2FGYA 4LNUA 1KD1H 4G4XA 3F0FA 3K14A 2QTPA 1JJ2F 3NK6A 1CN7A 3N2KB 3VO8A 4XCQA 3WJQA 1RQ2A 3JARB 2I6RA 2G9IA 2UYNA 5LYJA 1PXWA 3PLAC 2OZBA 3G4SF 3LMEA 5LXTB 2Q1XA 3JARA 1KNJA 3CMEF 1K9MH 4WBNB 3ERNA 4NUTA 5KMGB 4I55B 3WGJA 3I56F 1W2BF 2LBXA 1FNJA 3QUWA 3C9TA 1W55A 2MQEA 4C8GA 5LXTA 3MQWA 5FNVA 2Q1YA 2PMPA 3J80M 5ITZA 1JFFB 3HKBB 3WGNA 5KMGA 5EYPA 1YI2F 5MN4A 1ZWZA 3B6NA 5HP7A 3ZP7A 3S02A 2LBWA 1PF5A 2DT4A 1U40A 5EZYB 4R40B 4KWEA 4F6RA 3ZO8A 3NVIB 1Q81H 2ZOVA 2RHOA 4DRXA 5JQGB 2IAFA 1VQ4F 4X1YB 1KNKA 4PWTA 3DDNA 3PAFA 2BTUA 5EZYA 3G71F 1VQMF 3BYQA 4ZHWA 5CB4A 2RHLA 5HWEA 1J7HA 1H7MA 4X1YA 4EI7A 5HY1A 1QD9A 1IV3A 1H47A 1UFYA 5CA0A 3JCMM 3I55F 2KTVA 3C8LA 3E22A 3HKCA 4HNAB 3CC7F 4ZOLA 3LWVC 1TVKB 1YJWF 2GVIA 2RB9A 4X1KB 1FSZA 3LDTA 2ZODA 4G4ZA 5HY4A 4X3LA 5C8YB 3Q8HA 3WGMA 5HP8A 4DXDA 1KQSF 3VIUA 4HNAA 1X7PA 3J7AR 1RA4A 3CG6A 1DBFA 2CW4A 1FFXB 4X1KA 5EIBC 1KC8H 3UT5B 2H8EA 3CCQF 2VXYA 1Q86H 1IV1A 3D54A 2HRYA 5JVDA 3AGKA 3VOAA 4LCKA 3S0YA 4ZHVA 3OW2F 1NMUB 2JNBA 2UYPA 1FFXA 1VH8A 3CCEF 1K73H 3KIZA 2H8CA 1SDSA 4IIJA 3CC4F 1UI9A 4BW0B 1GO0A 3WPWA 5BMVB 3JAKA 4BVQA 3MCQA 3TD5A 5J2TB 2CSLA 3FD5A 5LA6B 3G6EF 4YJ2B 3GTZA 3HKEB 3CCLF 3FPIA 1S72F 3TD4A 1VQ6F 3GYQA 3NVKE 4O4LA 5BMVA 3RYFB 5J2TA 3N2GA 2OTLF 4YJ2A 1VQ7F 1YIJF 3HKEA 5EB0A 3S0WA 2R6R1 3T80A 3L7QA 2HP0B 2ZF8A 4G4YA 2RHJA 5GANK 3LWOC 2YXZA 1U3LA 2HX0A 1TUBB 4O4JB 2AMTA 1YITF 1VQNF 4O4HA 2KTUA 2IQQA 1GX1A 2KG4A 3CYPB 3FBAA 4ZHQB 2UYJA 2R751 3KHNA 3N2KA 1VQOF 1TUBA 4O4JA 1QU9A 2H6LA 2VAWA 4TV8B 5CA1B 2PHNA 4O4IB 2VGNA 1VQVA 4BT4A 4ZHQA 1W41A 1NJIH 1Q82H 3D00A 1IPAA 4X3MA 2CWJA 3C9UA 4WBNA 3CB2A 5DCVA 1W40A 3E20B 4I55A 2RHHA 4BT6A 4I50B 3ZP4A 4X20B 3JASB 5AVMA 3RYIB 4BT3A 1W5FA 2L26A 1M90H 5GONB 5HY0A 4O2AB 1JFFA 3HKBA 4U3JB 4TZZA 4TV9B 4ERHA 4B46A 3LFOA 2LCAA 3IKFA 1H48A 4B62A 4X20A 3ESJA 3JASA 3SIUA 2QI2A 3HAXD 1YQNA 2ALEA 3VYSC 2V9YA 2WALA 3I3FA 4O2AA 2BTOA 3IMPA 1Q7YH 5G4VC 5JQGA 2VAPA 3IR9A 3VI6A 4BT7A 1N8RH 1M1KH 2AIZP 1CK2A 2N48A 4I4TB 4G4VA 4FFBB 3JATB 1JD1A 4G4WA 4RQOA 2F9ZC 1OFUA 2K1SA 1W59A 2CZWA 1E7KA 2LBTA 3VYTC 5FJ4C 3JALB 3CYQA 4I4TA 4C8IA 3HTNA 3RA6A 3MCAB 2HS0A 1ONIA 3CPQA 1YGYA 1TVKA 2I6DA 1VQ8F 3P10A 5G4UC 3CC2F 2GZLA 3N4ZA 5HY2A 5LP6B 4EI8A 3CCJF 5C8YA 3WPXA 5EAZA 3F0DA 3TD3A 1VK3A 1SZQA 2NMUA 3LYBA 1GO1A 3S06A 3EORA 1QAHA 3UT5A 3R0PA 4EB6B 3VYUC 1YJNF 1FNKA 5JH7B 5KX5B 3F0GA 2HS3A 4B5CA 3P4EA 1XBIA 1W57A 1COMA 3U0OA 4EB6A 3V4DA 1IV4A 3IEWA 2OTJF 3VMFB 1W5AA 3DC2A 2ZVYA 3MBMA 4BT5A 2GLZA 3F6MA 5GAPK 2QEXF 5LA6A 3WGKA 3LWRC 3S03A 2DYYA 3HWUA 4E6EA 3CMAF 3HKDB 3WJPA 1X52A 3MDOA 3RYFA 3OONA 2HRUA 3F0EA 3RA5A 1VQ5F 1Z5WA 3IEQA 1JN1A 2HP0A 2EWCA 5EWRA 3RYCB 3J81M 3ZOPA 3CXCF 3SIVA 2OHWA 1VQKF 2ZAUA 1YHQF 3M4SA 3ELCA 4BT2A 2HQSC 2UYNB 5LYJB 1YJ9F 4YJ3B 3RYCA 4U39A 3WJRA 3KJJA 4X1IB 4ZK7A 3WGLA
chains in the Genus database with same CATH topology
3J7AR 2AIFA 1RA4A 3CG6A 2VGMA 4BVRA 1Q7YH 5G4VC 1KC8H 3CCQF 3IR9A 1Q86H 2HVYD 1VQ9F 3VI6A 3LWQC 1W3EX 1N8RH 1QVGF 1M1KH 3AGKA 1CK2A 4BVTA 4LCKA 3CPWF 5HXZA 1RLGA 1K8AH 3OW2F 1NMUB 2JNBA 3CCEF 1K73H 2F9ZC 3ON1A 4BY9D 5IT9M 1SDSA 2CZWA 3CCUF 1VQPF 1E7KA 2FGYA 1KD1H 1X7OA 5FLXM 5GIOC 5FJ4C 3CC4F 4BW0B 1JJ2F 5A2QM 1GO0A 3RA6A 3NK6A 3MCAB 1CN7A 4BVQA 4XCQA 3NMUC 2QA4F 1T0KB 3CPQA 3G6EF 2I6DA 3CCMF 1VQ8F 5HXUA 5G4UC 3CC2F 3E1YA 3N4ZA 3CCLF 1W42A 5HY2A 1PXWA 1S72F 3CCRF 3PLAC 2OZBA 1VQ6F 3G4SF 3GYQA 4EI8A 3NVKE 3CCJF 3LWPC 3CCSF 1K9MH 3CMEF 2OTLF 1GZ0A 1VQ7F 1GO1A 1YIJF 4NUTA 3I56F 1W2BF 2LBXA 3OBWA 1YJNF 3O85A 5GIPC 5GANK 3LWOC 3J80M 1XBIA 3FFMA 5EO3A 3V7QA 1YITF 1VQNF 3V3TA 4BVSA 2KTUA 1YI2F 1ZWZA 2KG4A 2OTJF 2LBWA 3VMFB 1QVFF 2GLZA 3NVIB 5GAPK 1VQOF 2QEXF 1Q81H 3LWRC 4EI9A 1VQ4F 2VGNA 3NK7A 3CMAF 3CD6F 3PAFA 1W41A 1NJIH 1X52A 3G71F 1Q82H 1VQMF 3D00A 3JAMM 1IPAA 4X3MA 3CCVF 3RA5A 1VQ5F 5HWEA 3N4YA 5DCVA 1W40A 1H7MA 3E20B 4EI7A 5HY1A 3WXMB 4C4WC 3JCMM 5EWRA 3I55F 2KTVA 3J81M 3CXCF 3CC7F 1M90H 2FC3A 3V7EA 2OHWA 5HY0A 3LWVC 1VQKF 3SIVA 3OBYA 1YHQF 5GINC 1YJWF 4TZZA 4NQ3A 3LFOA 3HJWC 1YJ9F 3SIUA 2QI2A 3HAXD 5HY4A 2ALEA 4X3LA 2WALA 1KQSF 2BO1A 1DT9A 1VQLF 1X7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A R;  2AIF A;  1RA4 A;  3CG6 A;  2VGM A;  1Q7Y H;  5G4V C;  1KC8 H;  3CCQ F;  3IR9 A;  1Q86 H;  2HVY D;  1VQ9 F;  3VI6 A;  3LWQ C;  1W3E X;  1N8R H;  1QVG F;  1M1K H;  3AGK A;  1CK2 A;  4LCK A;  3CPW F;  1RLG A;  1K8A H;  3OW2 F;  1NMU B;  2JNB A;  3CCE F;  1K73 H;  3ON1 A;  4BY9 D;  5IT9 M;  1SDS A;  2CZW A;  3CCU F;  1VQP F;  1E7K A;  1KD1 H;  1X7O A;  5FLX M;  5GIO C;  5FJ4 C;  3CC4 F;  4BW0 B;  1JJ2 F;  5A2Q M;  1GO0 A;  3RA6 A;  3NK6 A;  3MCA B;  1CN7 A;  3NMU C;  2QA4 F;  1T0K B;  3CPQ A;  3G6E F;  2I6D A;  3CCM F;  1VQ8 F;  5G4U C;  3CC2 F;  3E1Y A;  3N4Z A;  3CCL F;  1W42 A;  1PXW A;  1S72 F;  3CCR F;  3PLA C;  2OZB A;  1VQ6 F;  3G4S F;  3GYQ A;  3NVK E;  3CCJ F;  3LWP C;  3CCS F;  1K9M H;  3CME F;  2OTL F;  1GZ0 A;  1VQ7 F;  1GO1 A;  1YIJ F;  4NUT A;  3I56 F;  1W2B F;  2LBX A;  3OBW A;  1YJN F;  3O85 A;  5GIP C;  5GAN K;  3LWO C;  3J80 M;  1XBI A;  3FFM A;  5EO3 A;  3V7Q A;  1YIT F;  1VQN F;  1YI2 F;  2KTU A;  1ZWZ A;  2KG4 A;  2OTJ F;  2LBW A;  3VMF B;  1QVF F;  3NVI B;  5GAP K;  1VQO F;  2QEX F;  1Q81 H;  3LWR C;  1VQ4 F;  2VGN A;  3NK7 A;  3CMA F;  3CD6 F;  3PAF A;  1W41 A;  1NJI H;  1X52 A;  3G71 F;  1Q82 H;  1VQM F;  3JAM M;  1IPA A;  4X3M A;  3CCV F;  3RA5 A;  1VQ5 F;  3N4Y A;  5DCV A;  1W40 A;  1H7M A;  3E20 B;  3WXM B;  4C4W C;  3JCM M;  5EWR A;  3I55 F;  2KTV A;  3J81 M;  3CXC F;  3CC7 F;  1M90 H;  2FC3 A;  3V7E A;  2OHW A;  1VQK F;  3LWV C;  3SIV A;  3OBY A;  1YHQ F;  5GIN C;  1YJW F;  4TZZ A;  3LFO A;  3HJW C;  1YJ9 F;  3SIU A;  2QI2 A;  3HAX D;  2ALE A;  4X3L A;  2WAL A;  1KQS F;  2BO1 A;  1DT9 A;  1VQL F;  1X7P A; 
#chains in the Genus database with same CATH topology
 2AIF A;  2CHS A;  4TV8 A;  3M1X A;  2CVL A;  5CA1 A;  1VQ9 F;  1U3P A;  4O4I A;  4YJ3 A;  1XV2 A;  4C8E A;  3LWQ C;  1QVG F;  5FNV B;  4BVT A;  4X1I A;  5ITZ B;  4NWO B;  5JCO A;  5HXZ A;  3M84 A;  2Z01 A;  4O2B B;  1RQ7 A;  1W5B A;  5EYP B;  5JCO C;  2CHT A;  3ON1 A;  1T0A A;  4I50 A;  1X7O A;  5FLX M;  5GIO C;  1R1M A;  1W5E A;  1X25 A;  2Z1T A;  3RYI A;  5A2Q M;  5EB1 B;  2VAM A;  4F6R B;  3NMU C;  2QA4 F;  1VHA A;  1T0K B;  5GON A;  4O2B A;  4DRX B;  3CCM F;  5HXU A;  4U3J A;  4TV9 A;  3E1Y A;  3RE3 A;  1W42 A;  1Q8R A;  3IKE A;  2W8B C;  5MN5 A;  3CCR F;  3K0T A;  3K12 A;  5CB4 B;  3LWP C;  3CCS F;  3JVH A;  1GZ0 A;  3K2X A;  5LOV B;  5MN6 A;  3C9R A;  2P6Y A;  3OBW A;  5CA0 B;  3O85 A;  5GIP C;  3S0H A;  1OAP A;  5EIB D;  5IJ0 B;  3E22 B;  3HKC B;  4C82 A;  4ZOL B;  4FFB A;  3JAT A;  2KGW A;  2UYK A;  5LOV A;  3FFM A;  3P0Z A;  5EO3 A;  3V7Q A;  3KE1 A;  3VTI C;  3V3T A;  4BVS A;  2Z1U A;  1NQ3 A;  5IJ0 A;  3JAL A;  5IYZ B;  1CLI A;  2Z1E A;  1W58 1;  1QVF F;  5B8F A;  3FD6 A;  4EI9 A;  2HS4 A;  5LP6 A;  3NK7 A;  1RLU A;  2BTQ B;  2IG8 A;  3CD6 F;  5JVD B;  4TUY B;  5IYZ A;  1XHO A;  5LP6 C;  4B45 A;  3JAM M;  3VCZ A;  3CCV F;  3RYH B;  3N4Y A;  3D01 A;  3WXM B;  4IIJ B;  4C4W C;  4RHA A;  1XRG A;  4TUY A;  5JH7 A;  3QHD A;  3JAW B;  2ZVZ A;  1ODE A;  5KX5 A;  3JAK B;  3GHZ A;  2Z1F A;  1Z5V A;  2FC3 A;  3V7E A;  2OTM A;  3RYH A;  3OBY A;  2B33 A;  1SA0 B;  5GIN C;  4NQ3 A;  4ZHY B;  3HJW C;  1JY8 A;  2UZH A;  3JAW A;  4O4L B;  4IHJ B;  5J2U B;  5IJ9 B;  3C9S A;  2BO1 A;  1IV2 A;  3N2G B;  1DT9 A;  1VQL F;  4ZI7 B;  1U43 A;  1SA0 A;  4G88 A;  2YYE A;  2VGM A;  4BVR A;  2HVY D;  1W3E X;  3KJK A;  4LNU B;  3HKD A;  4IHJ A;  5J2U A;  5IJ9 A;  4ZI7 A;  3CPW F;  1RLG A;  1K8A H;  4C81 A;  4M8I A;  3I7T A;  3VOB A;  4O4H B;  2HP3 A;  3QTY A;  4BY9 D;  5IT9 M;  3CCU F;  1VQP F;  2FGY A;  4LNU A;  1KD1 H;  4G4X A;  3F0F A;  3K14 A;  2QTP A;  1JJ2 F;  3NK6 A;  1CN7 A;  3N2K B;  3VO8 A;  4XCQ A;  3WJQ A;  1RQ2 A;  3JAR B;  2I6R A;  2G9I A;  2UYN A;  5LYJ A;  1PXW A;  3PLA C;  2OZB A;  3G4S F;  3LME A;  5LXT B;  2Q1X A;  3JAR A;  1KNJ A;  3CME F;  1K9M H;  4WBN B;  3ERN A;  4NUT A;  5KMG B;  4I55 B;  3WGJ A;  3I56 F;  1W2B F;  2LBX A;  1FNJ A;  3QUW A;  3C9T A;  1W55 A;  2MQE A;  4C8G A;  5LXT A;  3MQW A;  5FNV A;  2Q1Y A;  2PMP A;  3J80 M;  5ITZ A;  1JFF B;  3HKB B;  3WGN A;  5KMG A;  5EYP A;  1YI2 F;  5MN4 A;  1ZWZ A;  3B6N A;  5HP7 A;  3ZP7 A;  3S02 A;  2LBW A;  1PF5 A;  2DT4 A;  1U40 A;  5EZY B;  4R40 B;  4KWE A;  4F6R A;  3ZO8 A;  3NVI B;  1Q81 H;  2ZOV A;  2RHO A;  4DRX A;  5JQG B;  2IAF A;  1VQ4 F;  4X1Y B;  1KNK A;  4PWT A;  3DDN A;  3PAF A;  2BTU A;  5EZY A;  3G71 F;  1VQM F;  3BYQ A;  4ZHW A;  5CB4 A;  2RHL A;  5HWE A;  1J7H A;  1H7M A;  4X1Y A;  4EI7 A;  5HY1 A;  1QD9 A;  1IV3 A;  1H47 A;  1UFY A;  5CA0 A;  3JCM M;  3I55 F;  2KTV A;  3C8L A;  3E22 A;  3HKC A;  4HNA B;  3CC7 F;  4ZOL A;  3LWV C;  1TVK B;  1YJW F;  2GVI A;  2RB9 A;  4X1K B;  1FSZ A;  3LDT A;  2ZOD A;  4G4Z A;  5HY4 A;  4X3L A;  5C8Y B;  3Q8H A;  3WGM A;  5HP8 A;  4DXD A;  1KQS F;  3VIU A;  4HNA A;  1X7P A;  3J7A R;  1RA4 A;  3CG6 A;  1DBF A;  2CW4 A;  1FFX B;  4X1K A;  5EIB C;  1KC8 H;  3UT5 B;  2H8E A;  3CCQ F;  2VXY A;  1Q86 H;  1IV1 A;  3D54 A;  2HRY A;  5JVD A;  3AGK A;  3VOA A;  4LCK A;  3S0Y A;  4ZHV A;  3OW2 F;  1NMU B;  2JNB A;  2UYP A;  1FFX A;  1VH8 A;  3CCE F;  1K73 H;  3KIZ A;  2H8C A;  1SDS A;  4IIJ A;  3CC4 F;  1UI9 A;  4BW0 B;  1GO0 A;  3WPW A;  5BMV B;  3JAK A;  4BVQ A;  3MCQ A;  3TD5 A;  5J2T B;  2CSL A;  3FD5 A;  5LA6 B;  3G6E F;  4YJ2 B;  3GTZ A;  3HKE B;  3CCL F;  3FPI A;  1S72 F;  3TD4 A;  1VQ6 F;  3GYQ A;  3NVK E;  4O4L A;  5BMV A;  3RYF B;  5J2T A;  3N2G A;  2OTL F;  4YJ2 A;  1VQ7 F;  1YIJ F;  3HKE A;  5EB0 A;  3S0W A;  2R6R 1;  3T80 A;  3L7Q A;  2HP0 B;  2ZF8 A;  4G4Y A;  2RHJ A;  5GAN K;  3LWO C;  2YXZ A;  1U3L A;  2HX0 A;  1TUB B;  4O4J B;  2AMT A;  1YIT F;  1VQN F;  4O4H A;  2KTU A;  2IQQ A;  1GX1 A;  2KG4 A;  3CYP B;  3FBA A;  4ZHQ B;  2UYJ A;  2R75 1;  3KHN A;  3N2K A;  1VQO F;  1TUB A;  4O4J A;  1QU9 A;  2H6L A;  2VAW A;  4TV8 B;  5CA1 B;  2PHN A;  4O4I B;  2VGN A;  1VQV A;  4BT4 A;  4ZHQ A;  1W41 A;  1NJI H;  1Q82 H;  3D00 A;  1IPA A;  4X3M A;  2CWJ A;  3C9U A;  4WBN A;  3CB2 A;  5DCV A;  1W40 A;  3E20 B;  4I55 A;  2RHH A;  4BT6 A;  4I50 B;  3ZP4 A;  4X20 B;  3JAS B;  5AVM A;  3RYI B;  4BT3 A;  1W5F A;  2L26 A;  1M90 H;  5GON B;  5HY0 A;  4O2A B;  1JFF A;  3HKB A;  4U3J B;  4TZZ A;  4TV9 B;  4ERH A;  4B46 A;  3LFO A;  2LCA A;  3IKF A;  1H48 A;  4B62 A;  4X20 A;  3ESJ A;  3JAS A;  3SIU A;  2QI2 A;  3HAX D;  1YQN A;  2ALE A;  3VYS C;  2V9Y A;  2WAL A;  3I3F A;  4O2A A;  2BTO A;  3IMP A;  1Q7Y H;  5G4V C;  5JQG A;  2VAP A;  3IR9 A;  3VI6 A;  4BT7 A;  1N8R H;  1M1K H;  2AIZ P;  1CK2 A;  2N48 A;  4I4T B;  4G4V A;  4FFB B;  3JAT B;  1JD1 A;  4G4W A;  4RQO A;  2F9Z C;  1OFU A;  2K1S A;  1W59 A;  2CZW A;  1E7K A;  2LBT A;  3VYT C;  5FJ4 C;  3JAL B;  3CYQ A;  4I4T A;  4C8I A;  3HTN A;  3RA6 A;  3MCA B;  2HS0 A;  1ONI A;  3CPQ A;  1YGY A;  1TVK A;  2I6D A;  1VQ8 F;  3P10 A;  5G4U C;  3CC2 F;  2GZL A;  3N4Z A;  5HY2 A;  5LP6 B;  4EI8 A;  3CCJ F;  5C8Y A;  3WPX A;  5EAZ A;  3F0D A;  3TD3 A;  1VK3 A;  1SZQ A;  2NMU A;  3LYB A;  1GO1 A;  3S06 A;  3EOR A;  1QAH A;  3UT5 A;  3R0P A;  4EB6 B;  3VYU C;  1YJN F;  1FNK A;  5JH7 B;  5KX5 B;  3F0G A;  2HS3 A;  4B5C A;  3P4E A;  1XBI A;  1W57 A;  1COM A;  3U0O A;  4EB6 A;  3V4D A;  1IV4 A;  3IEW A;  2OTJ F;  3VMF B;  1W5A A;  3DC2 A;  2ZVY A;  3MBM A;  4BT5 A;  2GLZ A;  3F6M A;  5GAP K;  2QEX F;  5LA6 A;  3WGK A;  3LWR C;  3S03 A;  2DYY A;  3HWU A;  4E6E A;  3CMA F;  3HKD B;  3WJP A;  1X52 A;  3MDO A;  3RYF A;  3OON A;  2HRU A;  3F0E A;  3RA5 A;  1VQ5 F;  1Z5W A;  3IEQ A;  1JN1 A;  2HP0 A;  2EWC A;  5EWR A;  3RYC B;  3J81 M;  3ZOP A;  3CXC F;  3SIV A;  2OHW A;  1VQK F;  2ZAU A;  1YHQ F;  3M4S A;  3ELC A;  4BT2 A;  2HQS C;  2UYN B;  5LYJ B;  1YJ9 F;  4YJ3 B;  3RYC A;  4U39 A;  3WJR A;  3KJJ A;  4X1I B;  4ZK7 A;  3WGL A; 
#chains in the Genus database with same CATH homology
 3J7A R;  2AIF A;  1RA4 A;  3CG6 A;  2VGM A;  4BVR A;  1Q7Y H;  5G4V C;  1KC8 H;  3CCQ F;  3IR9 A;  1Q86 H;  2HVY D;  1VQ9 F;  3VI6 A;  3LWQ C;  1W3E X;  1N8R H;  1QVG F;  1M1K H;  3AGK A;  1CK2 A;  4BVT A;  4LCK A;  3CPW F;  5HXZ A;  1RLG A;  1K8A H;  3OW2 F;  1NMU B;  2JNB A;  3CCE F;  1K73 H;  2F9Z C;  3ON1 A;  4BY9 D;  5IT9 M;  1SDS A;  2CZW A;  3CCU F;  1VQP F;  1E7K A;  2FGY A;  1KD1 H;  1X7O A;  5FLX M;  5GIO C;  5FJ4 C;  3CC4 F;  4BW0 B;  1JJ2 F;  5A2Q M;  1GO0 A;  3RA6 A;  3NK6 A;  3MCA B;  1CN7 A;  4BVQ A;  4XCQ A;  3NMU C;  2QA4 F;  1T0K B;  3CPQ A;  3G6E F;  2I6D A;  3CCM F;  1VQ8 F;  5HXU A;  5G4U C;  3CC2 F;  3E1Y A;  3N4Z A;  3CCL F;  1W42 A;  5HY2 A;  1PXW A;  1S72 F;  3CCR F;  3PLA C;  2OZB A;  1VQ6 F;  3G4S F;  3GYQ A;  4EI8 A;  3NVK E;  3CCJ F;  3LWP C;  3CCS F;  1K9M H;  3CME F;  2OTL F;  1GZ0 A;  1VQ7 F;  1GO1 A;  1YIJ F;  4NUT A;  3I56 F;  1W2B F;  2LBX A;  3OBW A;  1YJN F;  3O85 A;  5GIP C;  5GAN K;  3LWO C;  3J80 M;  1XBI A;  3FFM A;  5EO3 A;  3V7Q A;  1YIT F;  1VQN F;  3V3T A;  4BVS A;  2KTU A;  1YI2 F;  1ZWZ A;  2KG4 A;  2OTJ F;  2LBW A;  3VMF B;  1QVF F;  2GLZ A;  3NVI B;  5GAP K;  1VQO F;  2QEX F;  1Q81 H;  3LWR C;  4EI9 A;  1VQ4 F;  2VGN A;  3NK7 A;  3CMA F;  3CD6 F;  3PAF A;  1W41 A;  1NJI H;  1X52 A;  3G71 F;  1Q82 H;  1VQM F;  3D00 A;  3JAM M;  1IPA A;  4X3M A;  3CCV F;  3RA5 A;  1VQ5 F;  5HWE A;  3N4Y A;  5DCV A;  1W40 A;  1H7M A;  3E20 B;  4EI7 A;  5HY1 A;  3WXM B;  4C4W C;  3JCM M;  5EWR A;  3I55 F;  2KTV A;  3J81 M;  3CXC F;  3CC7 F;  1M90 H;  2FC3 A;  3V7E A;  2OHW A;  5HY0 A;  3LWV C;  1VQK F;  3SIV A;  3OBY A;  1YHQ F;  5GIN C;  1YJW F;  4TZZ A;  4NQ3 A;  3LFO A;  3HJW C;  1YJ9 F;  3SIU A;  2QI2 A;  3HAX D;  5HY4 A;  2ALE A;  4X3L A;  2WAL A;  1KQS F;  2BO1 A;  1DT9 A;  1VQL F;  1X7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...