1T0KB

Joint x-ray and nmr refinement of yeast l30e-mrna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*CP*GP*GP*AP*GP*UP*GP*UP*CP*C)-3'
publication title Joint X-Ray and NMR Refinement of the Yeast L30e-mRNA Complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1t0kB00
4BY9D 2OTLF 1YJWF 1X7PA 1K8AH 3CCRF 3N4YA 1Q81H 2OTJF 1X7OA 5A2QM 3LWPC 3CG6A 2KTVA 3VMFB 1W2BF 4LCKA 3ON1A 3CCJF 3CC7F 2VGMA 3MCAB 1W3EX 2OHWA 5EWRA 1SDSA 4C4WC 2FC3A 3J81M 1X52A 1W42A 3CCUF 3LWOC 1Q82H 3CMAF 3CCSF 1YITF 3V7EA 3SIVA 3CMEF 1CK2A 3NK6A 3NVKE 2ALEA 5IT9M 2QEXF 1ZWZA 3RA6A 1GO0A 3HJWC 3V7QA 3WXMB 2KTUA 4X3LA 3N4ZA 2HVYD 2QI2A 2OZBA 3NMUC 1VQNF 2BO1A 2KG4A 3CCQF 1T0KB 1N8RH 1K73H 4BW0B 1QVGF 3SIUA 3PLAC 3E20B 1YI2F 2JNBA 3OW2F 3OBWA 1W41A 3I56F 2WALA 3E1YA 1KD1H 1VQKF 3LWRC 3CC2F 5GAPK 5GIOC 2AIFA 3HAXD 1NMUB 1KC8H 4NUTA 2QA4F 3NK7A 1NJIH 2LBWA 1RLGA 1YJ9F 3I55F 1XBIA 1GZ0A 1Q7YH 3G6EF 1YIJF 5G4VC 1QVFF 1Q86H 5G4UC 5DCVA 3G71F 1JJ2F 1VQ6F 2I6DA 1VQ8F 1YHQF 1KQSF 2VGNA 1RA4A 4X3MA 3JCMM 1M90H 3FFMA 3CCEF 5EO3A 3CCLF 1VQOF 1M1KH 5GINC 3CCMF 1K9MH 1VQ4F 1VQ5F 1S72F 3CD6F 3J80M 5FJ4C 3J7AR 3RA5A 5GIPC 1GO1A 3O85A 1PXWA 1VQ7F 3CXCF 1VQMF 3VI6A 2LBXA 1CN7A 3AGKA 3CC4F 1DT9A 3GYQA 1W40A 1YJNF 1VQ9F 1H7MA 3LWQC 1VQLF 4TZZA 1E7KA 3PAFA 3NVIB 3CPQA 3JAMM 3G4SF 3LWVC 3CCVF 1VQPF 3CPWF 2CZWA 3IR9A 5GANK 5FLXM 1IPAA 3OBYA 3LFOA
chains in the Genus database with same CATH superfamily
4X1IA 4BY9D 2ZVZA 2V9YA 4TV9B 2RHLA 3S0HA 4BVSA 2G9IA 5A2QM 1JFFB 2KTVA 3VMFB 5C8YB 2LBTA 4LCKA 4EI7A 3TD3A 2OHWA 4I50B 3IKEA 2FC3A 4U3JA 1PF5A 1W42A 1SZQA 1TVKB 3QHDA 4XCQA 5JVDA 3S0YA 5EB0A 4TV8B 5HY2A 3DDNA 3CCSF 2PMPA 2RHJA 3JALA 1RLUA 1KNJA 1W55A 4O4HB 5IT9M 4O2AA 4X1KA 4ZK7A 3RA6A 4C8GA 1W5FA 5IYZA 3UT5B 3N4ZA 2QI2A 2Z1TA 3NMUC 1VH8A 1W5BA 3JARB 3CCQF 4G4WA 3ZP7A 1UI9A 4B62A 1QVGF 1JY8A 4FFBB 3PLAC 5GONB 5EYPA 5ITZB 3FPIA 4I55A 4YJ3B 3FD5A 3I56F 2UYNB 1IV1A 1KD1H 5HY1A 5HXZA 5GAPK 3IEWA 4IHJA 2YXZA 3RYCB 3P10A 5J2UB 1KC8H 1Q8RA 5EZYA 3JATB 2CW4A 2LBWA 5KMGB 4IIJB 4O4IA 3I55F 3EORA 4ZOLB 1XBIA 1Q7YH 3ESJA 1QAHA 2HP0A 5JQGA 5JH7B 1KNKA 1YIJF 3TD5A 2ZAUA 1ONIA 1QVFF 1XV2A 4I4TA 5G4UC 4RHAA 1T0AA 5IJ0B 1KQSF 2DYYA 1RA4A 4X3MA 3JCMM 5MN4A 3F0FA 4F6RA 2CSLA 5EO3A 1GX1A 5GINC 1K9MH 1VQ5F 3V3TA 2Z01A 2CHSA 1U43A 4C81A 4O4JA 1CLIA 3WGLA 2UZHA 2LBXA 3WGKA 3R0PA 3RYIB 5CB4B 2ZVYA 3K2XA 5HY0A 3CC4F 1DT9A 1FSZA 3HKEB 5HP8A 4ZI7A 2AIZP 3F6MA 3LWQC 1VQLF 4TUYA 2ZOVA 3NVIB 3CPQA 5HP7A 5MN5A 4WBNA 3S06A 1IPAA 1SA0B 2OTLF 4KWEA 3C9SA 4TV9A 5LP6B 3WPWA 1IV3A 3GHZA 3VYTC 4O4LB 1DBFA 2BTUA 2Z1EA 4ZHVA 2L26A 3JAKB 5HWEA 5LYJA 2UYJA 1VQVA 5CA0A 5EIBC 4EB6B 1J7HA 5LXTA 3ERNA 1W3EX 3M1XA 4R40B 4U39A 2FGYA 3JAWA 3L7QA 3MQWA 5LA6A 1IV4A 2N48A 3KJJA 2IAFA 2R751 4RQOA 3RYHB 1TUBA 3CMAF 3HKDB 3MDOA 3CMEF 2CWJA 4M8IA 1CK2A 3NK6A 2ALEA 1GO0A 5AVMA 3HJWC 2CVLA 2VAWA 4X3LA 2OZBA 2OTMA 2BO1A 3HKBB 1YGYA 2KG4A 4LNUA 1R1MA 4DRXB 3K14A 4NQ3A 4BW0B 4O2BB 3SIUA 4X1YA 2JNBA 4BT5A 1W41A 2RB9A 2I6RA 2HS3A 4HNAB 5J2TA 3LWRC 3C9TA 3CC2F 2HRUA 4BT6A 3HAXD 4YJ2A 1NMUB 4BT3A 3N2GB 1NJIH 2EWCA 3F0EA 3F0GA 1YQNA 4IIJA 3DC2A 4BVQA 2HP3A 5KX5B 2KGWA 1Q86H 1H48A 3JASB 3KIZA 3G71F 2I6DA 3F0DA 1JJ2F 1YHQF 1VQ8F 4X20B 4X1IB 2GZLA 3FFMA 1M1KH 1VQ4F 3J80M 3O85A 2AMTA 2BTOA 3HTNA 3LMEA 4B5CA 3VTIC 3CXCF 1VQMF 3JVHA 1CN7A 3P0ZA 5CB4A 3RYFA 3RYIA 3GYQA 1W40A 1W57A 3D54A 2GVIA 4U3JB 2Q1YA 1FFXA 3WPXA 3CCVF 3LWVC 1VQPF 5JVDB 3CPWF 2CZWA 3BYQA 3HKCA 2HS0A 1XHOA 4O2AB 4X1KB 4ZHQA 3K0TA 3E22B 1YJWF 5IYZB 1X7PA 5CA1A 3N4YA 2OTJF 3QUWA 3WGMA 5LOVA 5FNVA 3LWPC 2UYPA 2Q1XA 3ZO8A 2HQSC 3IMPA 3ON1A 3Q8HA 3CC7F 2VGMA 5EYPB 3MBMA 5EWRA 4I55B 5EAZA 4C4WC 3M84A 3J81M 3CCUF 3N2KA 4ZHYB 1ODEA 4IHJB 5BMVA 4BT7A 3V7EA 1W581 3SIVA 5EZYB 2Z1UA 3NVKE 2QEXF 4G4XA 3C8LA 4O4IB 2K1SA 2KTUA 3WXMB 4B46A 5JQGB 2HP0B 5HY4A 2PHNA 1JFFA 1T0KB 3VCZA 4I4TB 1K73H 5C8YA 4B45A 1JN1A 3E20B 1YI2F 2P6YA 3OW2F 4I50A 3VYSC 4F6RB 2DT4A 1COMA 1VHAA 1TVKA 4C8IA 2HX0A 2IG8A 2H8CA 2AIFA 4O4JB 4TV8A 1RQ7A 4NUTA 1FNKA 3CYPB 3MCQA 4O4HA 4DXDA 2IQQA 3UT5A 2MQEA 2Z1FA 4ZI7B 4BT2A 4NWOB 4TUYB 1U3PA 3WGJA 4BT4A 3JARA 3C9RA 4ERHA 4FFBA 3U0OA 3HWUA 3JASA 2VGNA 5GONA 5ITZA 1M90H 4YJ3A 3CCEF 2H8EA 2UYNA 3CCLF 2GLZA 3ZP4A 3VIUA 3VYUC 3D00A 1VQOF 3CCMF 1S72F 3CD6F 3RYCA 3S02A 3J7AR 3CYQA 1W5EA 5EB1B 4BVTA 5LYJB 5J2UA 1NQ3A 3JATA 1XRGA 5CA0B 5KMGA 5LXTB 3K12A 2R6R1 5IJ9B 4G4VA 1YJNF 4ZOLA 3IKFA 1Z5WA 1H7MA 2HS4A 3ELCA 5JH7A 1E7KA 3PAFA 3QTYA 3CB2A 3JAWB 3KJKA 5LA6B 5JCOC 3JAMM 1TUBB 3IR9A 3I3FA 2BTQB 5JCOA 5IJ0A 5GANK 2CHTA 5B8FA 5FLXM 4TZZA 3OBYA 3M4SA 3P4EA 3WGNA 3ZOPA 1K8AH 3E22A 3CCRF 1Q81H 2VXYA 1X7OA 1VK3A 4LNUB 3FBAA 3CG6A 3I7TA 1W2BF 4X1YB 3V4DA 3CCJF 1UFYA 3MCAB 5EIBD 1Z5VA 3HKEA 1SDSA 4C8EA 1X52A 4BVRA 4EI9A 3WJPA 5J2TB 3LWOC 2RHOA 1Q82H 4PWTA 1OAPA 3B6NA 3JALB 4YJ2B 1YITF 5LP6C 1SA0A 1ZWZA 3LDTA 3WJRA 3V7QA 5LP6A 2HVYD 3RE3A 2UYKA 4O4LA 1VQNF 3JAKA 1N8RH 1IV2A 4EB6A 1X25A 1W59A 1H47A 2NMUA 3S0WA 3OBWA 3VO8A 4ZHWA 2H6LA 3VOBA 2WALA 3E1YA 1VQKF 3RYHA 3T80A 4E6EA 1U3LA 5GIOC 3VOAA 2W8BC 2VAPA 3HKDA 2QA4F 3NK7A 1RLGA 1U40A 3RYFB 1YJ9F 1QD9A 2ZF8A 1GZ0A 3HKBA 3G6EF 4C82A 3WJQA 5G4VC 1FFXB 3KHNA 4DRXA 5DCVA 4O2BA 4G4ZA 1VQ6F 3HKCB 3C9UA 3GTZA 3IEQA 2ZODA 5MN6A 4ZHQB 4HNAA 1JD1A 1QU9A 3D01A 5CA1B 2RHHA 5FJ4C 2VAMA 5LOVB 5FNVB 2QTPA 3RA5A 3S03A 5GIPC 2B33A 1GO1A 1PXWA 3KE1A 3N2GA 1VQ7F 3FD6A 2HRYA 1RQ2A 3VI6A 3AGKA 1W5AA 4EI8A 3OONA 5IJ9A 1VQ9F 5HXUA 1FNJA 1OFUA 2LCAA 3N2KB 3G4SF 5KX5A 2YYEA 4G88A 2F9ZC 5BMVB 4G4YA 4WBNB 4X20A 3LYBA 3TD4A 3LFOA
chains in the Genus database with same CATH topology
4BY9D 2OTLF 1YJWF 1X7PA 1K8AH 3CCRF 3N4YA 1Q81H 2OTJF 4BVSA 1X7OA 5A2QM 3LWPC 3CG6A 5HWEA 2KTVA 3VMFB 1W2BF 4LCKA 4EI7A 3ON1A 3CCJF 3CC7F 2VGMA 3MCAB 1W3EX 2OHWA 5EWRA 1SDSA 4C4WC 2FC3A 3J81M 1X52A 2FGYA 4BVRA 4EI9A 1W42A 3CCUF 3LWOC 4XCQA 1Q82H 3CMAF 5HY2A 3CCSF 1YITF 3V7EA 3SIVA 3CMEF 1CK2A 3NK6A 3NVKE 2ALEA 5IT9M 2QEXF 1ZWZA 3RA6A 1GO0A 3HJWC 3V7QA 3WXMB 2KTUA 4X3LA 3N4ZA 2HVYD 2QI2A 2OZBA 3NMUC 1VQNF 2BO1A 5HY4A 2KG4A 3CCQF 1T0KB 1N8RH 1K73H 4NQ3A 4BW0B 1QVGF 3SIUA 3PLAC 3E20B 1YI2F 2JNBA 3OW2F 3OBWA 1W41A 3I56F 2WALA 3E1YA 1KD1H 1VQKF 5HY1A 3LWRC 5HXZA 3CC2F 5GAPK 5GIOC 2AIFA 3HAXD 1NMUB 1KC8H 4NUTA 2QA4F 3NK7A 1NJIH 2LBWA 1RLGA 4BVQA 1YJ9F 3I55F 1XBIA 1GZ0A 1Q7YH 3G6EF 1YIJF 5G4VC 1QVFF 1Q86H 5G4UC 5DCVA 3G71F 1JJ2F 1VQ6F 2I6DA 1VQ8F 1YHQF 1KQSF 2VGNA 1RA4A 4X3MA 3JCMM 1M90H 3FFMA 3CCEF 5EO3A 3CCLF 2GLZA 3D00A 1VQOF 5GINC 3CCMF 1K9MH 1M1KH 1VQ4F 3V3TA 1S72F 3J80M 1VQ5F 3CD6F 3J7AR 5FJ4C 3RA5A 5GIPC 1GO1A 3O85A 1PXWA 4BVTA 1VQ7F 3CXCF 1VQMF 3VI6A 2LBXA 5HY0A 1CN7A 3AGKA 3CC4F 1DT9A 3GYQA 1W40A 1YJNF 4EI8A 1VQ9F 1H7MA 3LWQC 1VQLF 5HXUA 4TZZA 1E7KA 3PAFA 3NVIB 3CPQA 3JAMM 3G4SF 3LWVC 3CCVF 1VQPF 3CPWF 2CZWA 2F9ZC 3IR9A 5GANK 5FLXM 1IPAA 3OBYA 3LFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY9 D;  2OTL F;  1YJW F;  1X7P A;  1K8A H;  3CCR F;  3N4Y A;  1Q81 H;  2OTJ F;  1X7O A;  5A2Q M;  3LWP C;  3CG6 A;  2KTV A;  3VMF B;  1W2B F;  4LCK A;  3ON1 A;  3CCJ F;  3CC7 F;  2VGM A;  3MCA B;  1W3E X;  2OHW A;  5EWR A;  1SDS A;  4C4W C;  2FC3 A;  3J81 M;  1X52 A;  1W42 A;  3CCU F;  3LWO C;  1Q82 H;  3CMA F;  3CCS F;  1YIT F;  3V7E A;  3SIV A;  3CME F;  1CK2 A;  3NK6 A;  3NVK E;  2ALE A;  5IT9 M;  2QEX F;  1ZWZ A;  3RA6 A;  1GO0 A;  3HJW C;  3V7Q A;  3WXM B;  2KTU A;  4X3L A;  3N4Z A;  2HVY D;  2QI2 A;  2OZB A;  3NMU C;  1VQN F;  2BO1 A;  2KG4 A;  3CCQ F;  1T0K B;  1N8R H;  1K73 H;  4BW0 B;  1QVG F;  3SIU A;  3PLA C;  3E20 B;  1YI2 F;  2JNB A;  3OW2 F;  3OBW A;  1W41 A;  3I56 F;  2WAL A;  3E1Y A;  1KD1 H;  1VQK F;  3LWR C;  3CC2 F;  5GAP K;  5GIO C;  2AIF A;  3HAX D;  1NMU B;  1KC8 H;  4NUT A;  2QA4 F;  3NK7 A;  1NJI H;  2LBW A;  1RLG A;  1YJ9 F;  3I55 F;  1XBI A;  1GZ0 A;  1Q7Y H;  3G6E F;  1YIJ F;  5G4V C;  1QVF F;  1Q86 H;  5G4U C;  5DCV A;  3G71 F;  1JJ2 F;  1VQ6 F;  2I6D A;  1VQ8 F;  1YHQ F;  1KQS F;  2VGN A;  1RA4 A;  4X3M A;  3JCM M;  1M90 H;  3FFM A;  3CCE F;  5EO3 A;  3CCL F;  1VQO F;  1M1K H;  5GIN C;  3CCM F;  1K9M H;  1VQ4 F;  1VQ5 F;  1S72 F;  3CD6 F;  3J80 M;  5FJ4 C;  3J7A R;  3RA5 A;  5GIP C;  1GO1 A;  3O85 A;  1PXW A;  1VQ7 F;  3CXC F;  1VQM F;  3VI6 A;  2LBX A;  1CN7 A;  3AGK A;  3CC4 F;  1DT9 A;  3GYQ A;  1W40 A;  1YJN F;  1VQ9 F;  1H7M A;  3LWQ C;  1VQL F;  4TZZ A;  1E7K A;  3PAF A;  3NVI B;  3CPQ A;  3JAM M;  3G4S F;  3LWV C;  3CCV F;  1VQP F;  3CPW F;  2CZW A;  3IR9 A;  5GAN K;  5FLX M;  1IPA A;  3OBY A;  3LFO A; 
#chains in the Genus database with same CATH topology
 4X1I A;  4BY9 D;  2ZVZ A;  2V9Y A;  4TV9 B;  2RHL A;  3S0H A;  4BVS A;  2G9I A;  5A2Q M;  1JFF B;  2KTV A;  3VMF B;  5C8Y B;  2LBT A;  4LCK A;  4EI7 A;  3TD3 A;  2OHW A;  4I50 B;  3IKE A;  2FC3 A;  4U3J A;  1PF5 A;  1W42 A;  1SZQ A;  1TVK B;  3QHD A;  4XCQ A;  5JVD A;  3S0Y A;  5EB0 A;  4TV8 B;  5HY2 A;  3DDN A;  3CCS F;  2PMP A;  2RHJ A;  3JAL A;  1RLU A;  1KNJ A;  1W55 A;  4O4H B;  5IT9 M;  4O2A A;  4X1K A;  4ZK7 A;  3RA6 A;  4C8G A;  1W5F A;  5IYZ A;  3UT5 B;  3N4Z A;  2QI2 A;  2Z1T A;  3NMU C;  1VH8 A;  1W5B A;  3JAR B;  3CCQ F;  4G4W A;  3ZP7 A;  1UI9 A;  4B62 A;  1QVG F;  1JY8 A;  4FFB B;  3PLA C;  5GON B;  5EYP A;  5ITZ B;  3FPI A;  4I55 A;  4YJ3 B;  3FD5 A;  3I56 F;  2UYN B;  1IV1 A;  1KD1 H;  5HY1 A;  5HXZ A;  5GAP K;  3IEW A;  4IHJ A;  2YXZ A;  3RYC B;  3P10 A;  5J2U B;  1KC8 H;  1Q8R A;  5EZY A;  3JAT B;  2CW4 A;  2LBW A;  5KMG B;  4IIJ B;  4O4I A;  3I55 F;  3EOR A;  4ZOL B;  1XBI A;  1Q7Y H;  3ESJ A;  1QAH A;  2HP0 A;  5JQG A;  5JH7 B;  1KNK A;  1YIJ F;  3TD5 A;  2ZAU A;  1ONI A;  1QVF F;  1XV2 A;  4I4T A;  5G4U C;  4RHA A;  1T0A A;  5IJ0 B;  1KQS F;  2DYY A;  1RA4 A;  4X3M A;  3JCM M;  5MN4 A;  3F0F A;  4F6R A;  2CSL A;  5EO3 A;  1GX1 A;  5GIN C;  1K9M H;  1VQ5 F;  3V3T A;  2Z01 A;  2CHS A;  1U43 A;  4C81 A;  4O4J A;  1CLI A;  3WGL A;  2UZH A;  2LBX A;  3WGK A;  3R0P A;  3RYI B;  5CB4 B;  2ZVY A;  3K2X A;  5HY0 A;  3CC4 F;  1DT9 A;  1FSZ A;  3HKE B;  5HP8 A;  4ZI7 A;  2AIZ P;  3F6M A;  3LWQ C;  1VQL F;  4TUY A;  2ZOV A;  3NVI B;  3CPQ A;  5HP7 A;  5MN5 A;  4WBN A;  3S06 A;  1IPA A;  1SA0 B;  2OTL F;  4KWE A;  3C9S A;  4TV9 A;  5LP6 B;  3WPW A;  1IV3 A;  3GHZ A;  3VYT C;  4O4L B;  1DBF A;  2BTU A;  2Z1E A;  4ZHV A;  2L26 A;  3JAK B;  5HWE A;  5LYJ A;  2UYJ A;  1VQV A;  5CA0 A;  5EIB C;  4EB6 B;  1J7H A;  5LXT A;  3ERN A;  1W3E X;  3M1X A;  4R40 B;  4U39 A;  2FGY A;  3JAW A;  3L7Q A;  3MQW A;  5LA6 A;  1IV4 A;  2N48 A;  3KJJ A;  2IAF A;  2R75 1;  4RQO A;  3RYH B;  1TUB A;  3CMA F;  3HKD B;  3MDO A;  3CME F;  2CWJ A;  4M8I A;  1CK2 A;  3NK6 A;  2ALE A;  1GO0 A;  5AVM A;  3HJW C;  2CVL A;  2VAW A;  4X3L A;  2OZB A;  2OTM A;  2BO1 A;  3HKB B;  1YGY A;  2KG4 A;  4LNU A;  1R1M A;  4DRX B;  3K14 A;  4NQ3 A;  4BW0 B;  4O2B B;  3SIU A;  4X1Y A;  2JNB A;  4BT5 A;  1W41 A;  2RB9 A;  2I6R A;  2HS3 A;  4HNA B;  5J2T A;  3LWR C;  3C9T A;  3CC2 F;  2HRU A;  4BT6 A;  3HAX D;  4YJ2 A;  1NMU B;  4BT3 A;  3N2G B;  1NJI H;  2EWC A;  3F0E A;  3F0G A;  1YQN A;  4IIJ A;  3DC2 A;  4BVQ A;  2HP3 A;  5KX5 B;  2KGW A;  1Q86 H;  1H48 A;  3JAS B;  3KIZ A;  3G71 F;  2I6D A;  3F0D A;  1JJ2 F;  1YHQ F;  1VQ8 F;  4X20 B;  4X1I B;  2GZL A;  3FFM A;  1M1K H;  1VQ4 F;  3J80 M;  3O85 A;  2AMT A;  2BTO A;  3HTN A;  3LME A;  4B5C A;  3VTI C;  3CXC F;  1VQM F;  3JVH A;  1CN7 A;  3P0Z A;  5CB4 A;  3RYF A;  3RYI A;  3GYQ A;  1W40 A;  1W57 A;  3D54 A;  2GVI A;  4U3J B;  2Q1Y A;  1FFX A;  3WPX A;  3CCV F;  3LWV C;  1VQP F;  5JVD B;  3CPW F;  2CZW A;  3BYQ A;  3HKC A;  2HS0 A;  1XHO A;  4O2A B;  4X1K B;  4ZHQ A;  3K0T A;  3E22 B;  1YJW F;  5IYZ B;  1X7P A;  5CA1 A;  3N4Y A;  2OTJ F;  3QUW A;  3WGM A;  5LOV A;  5FNV A;  3LWP C;  2UYP A;  2Q1X A;  3ZO8 A;  2HQS C;  3IMP A;  3ON1 A;  3Q8H A;  3CC7 F;  2VGM A;  5EYP B;  3MBM A;  5EWR A;  4I55 B;  5EAZ A;  4C4W C;  3M84 A;  3J81 M;  3CCU F;  3N2K A;  4ZHY B;  1ODE A;  4IHJ B;  5BMV A;  4BT7 A;  3V7E A;  1W58 1;  3SIV A;  5EZY B;  2Z1U A;  3NVK E;  2QEX F;  4G4X A;  3C8L A;  4O4I B;  2K1S A;  2KTU A;  3WXM B;  4B46 A;  5JQG B;  2HP0 B;  5HY4 A;  2PHN A;  1JFF A;  1T0K B;  3VCZ A;  4I4T B;  1K73 H;  5C8Y A;  4B45 A;  1JN1 A;  3E20 B;  1YI2 F;  2P6Y A;  3OW2 F;  4I50 A;  3VYS C;  4F6R B;  2DT4 A;  1COM A;  1VHA A;  1TVK A;  4C8I A;  2HX0 A;  2IG8 A;  2H8C A;  2AIF A;  4O4J B;  4TV8 A;  1RQ7 A;  4NUT A;  1FNK A;  3CYP B;  3MCQ A;  4O4H A;  4DXD A;  2IQQ A;  3UT5 A;  2MQE A;  2Z1F A;  4ZI7 B;  4BT2 A;  4NWO B;  4TUY B;  1U3P A;  3WGJ A;  4BT4 A;  3JAR A;  3C9R A;  4ERH A;  4FFB A;  3U0O A;  3HWU A;  3JAS A;  2VGN A;  5GON A;  5ITZ A;  1M90 H;  4YJ3 A;  3CCE F;  2H8E A;  2UYN A;  3CCL F;  2GLZ A;  3ZP4 A;  3VIU A;  3VYU C;  3D00 A;  1VQO F;  3CCM F;  1S72 F;  3CD6 F;  3RYC A;  3S02 A;  3J7A R;  3CYQ A;  1W5E A;  5EB1 B;  4BVT A;  5LYJ B;  5J2U A;  1NQ3 A;  3JAT A;  1XRG A;  5CA0 B;  5KMG A;  5LXT B;  3K12 A;  2R6R 1;  5IJ9 B;  4G4V A;  1YJN F;  4ZOL A;  3IKF A;  1Z5W A;  1H7M A;  2HS4 A;  3ELC A;  5JH7 A;  1E7K A;  3PAF A;  3QTY A;  3CB2 A;  3JAW B;  3KJK A;  5LA6 B;  5JCO C;  3JAM M;  1TUB B;  3IR9 A;  3I3F A;  2BTQ B;  5JCO A;  5IJ0 A;  5GAN K;  2CHT A;  5B8F A;  5FLX M;  4TZZ A;  3OBY A;  3M4S A;  3P4E A;  3WGN A;  3ZOP A;  1K8A H;  3E22 A;  3CCR F;  1Q81 H;  2VXY A;  1X7O A;  1VK3 A;  4LNU B;  3FBA A;  3CG6 A;  3I7T A;  1W2B F;  4X1Y B;  3V4D A;  3CCJ F;  1UFY A;  3MCA B;  5EIB D;  1Z5V A;  3HKE A;  1SDS A;  4C8E A;  1X52 A;  4BVR A;  4EI9 A;  3WJP A;  5J2T B;  3LWO C;  2RHO A;  1Q82 H;  4PWT A;  1OAP A;  3B6N A;  3JAL B;  4YJ2 B;  1YIT F;  5LP6 C;  1SA0 A;  1ZWZ A;  3LDT A;  3WJR A;  3V7Q A;  5LP6 A;  2HVY D;  3RE3 A;  2UYK A;  4O4L A;  1VQN F;  3JAK A;  1N8R H;  1IV2 A;  4EB6 A;  1X25 A;  1W59 A;  1H47 A;  2NMU A;  3S0W A;  3OBW A;  3VO8 A;  4ZHW A;  2H6L A;  3VOB A;  2WAL A;  3E1Y A;  1VQK F;  3RYH A;  3T80 A;  4E6E A;  1U3L A;  5GIO C;  3VOA A;  2W8B C;  2VAP A;  3HKD A;  2QA4 F;  3NK7 A;  1RLG A;  1U40 A;  3RYF B;  1YJ9 F;  1QD9 A;  2ZF8 A;  1GZ0 A;  3HKB A;  3G6E F;  4C82 A;  3WJQ A;  5G4V C;  1FFX B;  3KHN A;  4DRX A;  5DCV A;  4O2B A;  4G4Z A;  1VQ6 F;  3HKC B;  3C9U A;  3GTZ A;  3IEQ A;  2ZOD A;  5MN6 A;  4ZHQ B;  4HNA A;  1JD1 A;  1QU9 A;  3D01 A;  5CA1 B;  2RHH A;  5FJ4 C;  2VAM A;  5LOV B;  5FNV B;  2QTP A;  3RA5 A;  3S03 A;  5GIP C;  2B33 A;  1GO1 A;  1PXW A;  3KE1 A;  3N2G A;  1VQ7 F;  3FD6 A;  2HRY A;  1RQ2 A;  3VI6 A;  3AGK A;  1W5A A;  4EI8 A;  3OON A;  5IJ9 A;  1VQ9 F;  5HXU A;  1FNJ A;  1OFU A;  2LCA A;  3N2K B;  3G4S F;  5KX5 A;  2YYE A;  4G88 A;  2F9Z C;  5BMV B;  4G4Y A;  4WBN B;  4X20 A;  3LYB A;  3TD4 A;  3LFO A; 
#chains in the Genus database with same CATH homology
 4BY9 D;  2OTL F;  1YJW F;  1X7P A;  1K8A H;  3CCR F;  3N4Y A;  1Q81 H;  2OTJ F;  4BVS A;  1X7O A;  5A2Q M;  3LWP C;  3CG6 A;  5HWE A;  2KTV A;  3VMF B;  1W2B F;  4LCK A;  4EI7 A;  3ON1 A;  3CCJ F;  3CC7 F;  2VGM A;  3MCA B;  1W3E X;  2OHW A;  5EWR A;  1SDS A;  4C4W C;  2FC3 A;  3J81 M;  1X52 A;  2FGY A;  4BVR A;  4EI9 A;  1W42 A;  3CCU F;  3LWO C;  4XCQ A;  1Q82 H;  3CMA F;  5HY2 A;  3CCS F;  1YIT F;  3V7E A;  3SIV A;  3CME F;  1CK2 A;  3NK6 A;  3NVK E;  2ALE A;  5IT9 M;  2QEX F;  1ZWZ A;  3RA6 A;  1GO0 A;  3HJW C;  3V7Q A;  3WXM B;  2KTU A;  4X3L A;  3N4Z A;  2HVY D;  2QI2 A;  2OZB A;  3NMU C;  1VQN F;  2BO1 A;  5HY4 A;  2KG4 A;  3CCQ F;  1T0K B;  1N8R H;  1K73 H;  4NQ3 A;  4BW0 B;  1QVG F;  3SIU A;  3PLA C;  3E20 B;  1YI2 F;  2JNB A;  3OW2 F;  3OBW A;  1W41 A;  3I56 F;  2WAL A;  3E1Y A;  1KD1 H;  1VQK F;  5HY1 A;  3LWR C;  5HXZ A;  3CC2 F;  5GAP K;  5GIO C;  2AIF A;  3HAX D;  1NMU B;  1KC8 H;  4NUT A;  2QA4 F;  3NK7 A;  1NJI H;  2LBW A;  1RLG A;  4BVQ A;  1YJ9 F;  3I55 F;  1XBI A;  1GZ0 A;  1Q7Y H;  3G6E F;  1YIJ F;  5G4V C;  1QVF F;  1Q86 H;  5G4U C;  5DCV A;  3G71 F;  1JJ2 F;  1VQ6 F;  2I6D A;  1VQ8 F;  1YHQ F;  1KQS F;  2VGN A;  1RA4 A;  4X3M A;  3JCM M;  1M90 H;  3FFM A;  3CCE F;  5EO3 A;  3CCL F;  2GLZ A;  3D00 A;  1VQO F;  5GIN C;  3CCM F;  1K9M H;  1M1K H;  1VQ4 F;  3V3T A;  1S72 F;  3J80 M;  1VQ5 F;  3CD6 F;  3J7A R;  5FJ4 C;  3RA5 A;  5GIP C;  1GO1 A;  3O85 A;  1PXW A;  4BVT A;  1VQ7 F;  3CXC F;  1VQM F;  3VI6 A;  2LBX A;  5HY0 A;  1CN7 A;  3AGK A;  3CC4 F;  1DT9 A;  3GYQ A;  1W40 A;  1YJN F;  4EI8 A;  1VQ9 F;  1H7M A;  3LWQ C;  1VQL F;  5HXU A;  4TZZ A;  1E7K A;  3PAF A;  3NVI B;  3CPQ A;  3JAM M;  3G4S F;  3LWV C;  3CCV F;  1VQP F;  3CPW F;  2CZW A;  2F9Z C;  3IR9 A;  5GAN K;  5FLX M;  1IPA A;  3OBY A;  3LFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...