1T0KB

Joint x-ray and nmr refinement of yeast l30e-mrna complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Joint X-Ray and NMR Refinement of the Yeast L30e-mRNA Complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 5'-R(*GP*AP*CP*CP*GP*GP*AP*GP*UP*GP*UP*CP*C)-3'
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1t0kB00
2FC3A 2KTUA 1VQNF 3PAFA 1JJ2F 4LCKA 1GZ0A 2OTLF 3E20B 3CC2F 2I6DA 5FJ4C 1N8RH 3PLAC 3CC4F 3SIVA 3NMUC 5EWRA 3VMFB 1VQ6F 1W41A 5DCVA 3N4ZA 4C4WC 1M1KH 2VGNA 1YI2F 3CCEF 3O85A 5GIPC 3G6EF 3CCJF 4BY9D 1YJNF 1QVGF 3J7AR 1X52A 3CPWF 2QA4F 3LWPC 3IR9A 3NK6A 3LWVC 3OBYA 1VQ4F 2OTJF 5G4VC 1VQLF 1IPAA 3WXMB 3E1YA 1VQPF 1VQ9F 3JAMM 1VQOF 1KD1H 1XBIA 1KC8H 3V7EA 1ZWZA 3VI6A 1NMUB 2OHWA 1VQKF 5FLXM 2KG4A 3CCRF 2LBWA 3FFMA 1W2BF 2ALEA 5GIOC 3J80M 1Q81H 1KQSF 1DT9A 1W42A 2AIFA 3G71F 3GYQA 1YJ9F 5GAPK 5GINC 1VQ7F 3CXCF 3CD6F 1K9MH 2CZWA 2QI2A 3NVKE 3CCQF 2BO1A 3AGKA 3CCVF 1H7MA 1Q86H 2WALA 2KTVA 1QVFF 1VQ5F 1X7PA 5GANK 3RA5A 1SDSA 3G4SF 2LBXA 3ON1A 1Q7YH 1GO0A 4BW0B 1S72F 2VGMA 5IT9M 3OBWA 3JCMM 3LWRC 2QEXF 3CPQA 1NJIH 1VQ8F 1RA4A 3CCUF 1M90H 1W40A 1T0KB 3J81M 1X7OA 3HJWC 3OW2F 3NK7A 3CMAF 1RLGA 1K8AH 4X3MA 4TZZA 3HAXD 1K73H 3LWQC 3N4YA 3LWOC 1GO1A 5EO3A 3I56F 1YJWF 2HVYD 1CN7A 4X3LA 3MCAB 1W3EX 3RA6A 3V7QA 4NUTA 1E7KA 3CG6A 1YHQF 1Q82H 5A2QM 3CMEF 2OZBA 1YITF 3CCMF 5G4UC 3LFOA 3CCSF 3SIUA 3CCLF 1YIJF 3NVIB 3CC7F 1PXWA 3I55F 1CK2A 1VQMF 2JNBA
chains in the Genus database with same CATH superfamily
2KTUA 2HS0A 2OTLF 2ZODA 3JAWB 3E20B 5LXTA 3PLAC 1RQ2A 4IHJB 5EWRA 2UYNB 1NQ3A 5DCVA 2F9ZC 1ODEA 1YI2F 2HS3A 5GONB 3C9UA 4I4TB 1X52A 4TV9B 2PMPA 2QA4F 4YJ3A 3K0TA 4C8EA 4IIJB 3P4EA 3M4SA 3VI6A 3FD6A 1VQKF 3HKBA 3HKDB 1KNJA 3WGJA 2GVIA 3FFMA 4G4ZA 4G4YA 3V3TA 5HY2A 4X1YB 2CSLA 3KJJA 2FGYA 3C9SA 3P10A 5EYPA 2YYEA 5GIOC 3LDTA 2HP3A 5JH7A 3I3FA 1DT9A 3ZO8A 3UT5B 4BT2A 1JY8A 1X25A 1W57A 5HY0A 2K1SA 5EIBC 5GAPK 4B5CA 2V9YA 3MBMA 4NQ3A 2H8CA 4XCQA 5MN5A 2CZWA 3JVHA 1IV2A 2BTUA 3NVKE 5C8YA 5EB0A 2BO1A 5LA6A 4ZI7A 3CCVF 5JH7B 1CLIA 4U39A 3HKCA 3JARA 2WALA 5LOVB 3DC2A 2H8EA 4EI9A 3WGKA 1SDSA 5BMVB 2Z1EA 1Q7YH 3WGNA 5HP8A 1S72F 5EZYB 5CA0A 4O2BA 3RE3A 3OBWA 1RQ7A 2UYNA 3Q8HA 1W581 2RHJA 2KGWA 2CWJA 4C82A 1X7OA 1U3LA 5MN6A 2Z1FA 4FFBB 1K8AH 5GONA 2IQQA 1VHAA 4TUYB 3C9TA 4O4HB 2HVYD 4ZHVA 5JCOC 2UZHA 3V7QA 1E7KA 1IV3A 1H48A 4X1KA 3JAKA 5A2QM 3CMEF 4ZHQA 2OZBA 5G4UC 3CCMF 4BT6A 5CA1B 3CCSF 3SIUA 2HP0A 1PF5A 1PXWA 3I55F 2PHNA 4NWOB 3MQWA 4ZI7B 5CA0B 1VQMF 4EB6B 5C8YB 3ZOPA 3JAKB 3MDOA 1GZ0A 5LP6A 1JD1A 2ZF8A 1Z5WA 3NMUC 3E22A 2Z1UA 1W41A 4B62A 2ZVZA 3N4ZA 4O4HA 4C4WC 2VGNA 3V4DA 2ZAUA 3JASB 1W5BA 2RB9A 4G88A 2IAFA 3J7AR 3TD5A 4YJ2B 4O4LB 4BVSA 1YQNA 3IR9A 4I4TA 3BYQA 3LWVC 3OBYA 1VQ4F 5JQGA 1IPAA 3WXMB 3D54A 1KD1H 3KJKA 5EYPB 4O2BB 1KC8H 2OTMA 5CB4B 2OHWA 4U3JA 1Z5VA 5HY4A 5LP6B 1UFYA 5ITZB 3UT5A 3ZP7A 3IEWA 4C8GA 3VO8A 2ALEA 3JARB 1Q81H 1FFXA 5JVDA 2AMTA 3N2GB 4ZHQB 2AIFA 4O2AB 4ZOLA 3JATA 2HRUA 3KIZA 4B46A 3M84A 5GINC 5HXZA 1VQ7F 3DDNA 2EWCA 3VTIC 3F6MA 1W5EA 1UI9A 1K9MH 4IHJA 2B33A 2QI2A 4DRXB 3GHZA 3VIUA 5KX5B 4G4VA 1QD9A 1QU9A 2RHLA 5FNVA 1X7PA 1TUBA 3HWUA 4BT5A 5J2UA 3G4SF 4X20B 3ON1A 3WJPA 4ZOLB 2GLZA 5IJ0B 1GO0A 3C8LA 3HTNA 5EIBD 3RYCA 4PWTA 4EI7A 1VQ8F 2R751 3RYHA 2HRYA 4G4WA 1M90H 3FBAA 1T0KB 3HJWC 5HWEA 3EORA 1RLGA 4X3MA 1K73H 1YGYA 3LWQC 2GZLA 4WBNB 1W59A 1GO1A 5EO3A 1YJWF 3MCAB 4DXDA 1SA0B 4F6RB 3CG6A 3D00A 4I50A 1Q82H 3WPXA 5JCOA 4YJ2A 4I50B 4ERHA 1YITF 2P6YA 3KHNA 4HNAB 3R0PA 5J2TB 1VK3A 3VYTC 2AIZP 4O4IA 1W55A 1CK2A 5HP7A 1VQNF 3PAFA 3TD3A 4LCKA 3K12A 3K14A 3CC2F 4I55B 3WPWA 2H6LA 2L26A 3HKBB 1U43A 5J2UB 3N2KB 3TD4A 5IJ9B 1VQVA 3CYPB 3RYFB 3VMFB 1VQ6F 1M1KH 3ESJA 3C9RA 3O85A 1QVGF 4I55A 3CPWF 5ITZA 2VAPA 1FNKA 2OTJF 1VQPF 2Q1YA 3JALB 3V7EA 1ZWZA 1DBFA 5FNVB 1NMUB 2VAMA 4LNUA 4O4JA 5FLXM 3JAWA 1T0AA 5EB1B 4BT4A 5HXUA 3ZP4A 2QTPA 3ERNA 3JALA 3J80M 5EAZA 1KQSF 3E22B 1GX1A 2UYKA 3U0OA 3G71F 1TVKA 3S02A 1FSZA 4X20A 4X1IB 3WJQA 1YJ9F 4M8IA 1W5FA 5LOVA 1R1MA 1XRGA 2UYPA 3IEQA 5IJ9A 1OFUA 5CA1A 5IYZB 5HY1A 4TV8B 4DRXA 5KMGA 2CVLA 3AGKA 3VYSC 1H7MA 1TUBB 4ZHWA 2KTVA 1QVFF 1VQ5F 2ZVYA 5GANK 4HNAA 3RA5A 3S0WA 4B45A 2LBXA 1COMA 1XHOA 1SZQA 3QUWA 3IKEA 4BT7A 5AVMA 2N48A 2MQEA 3S06A 1JN1A 3RYHB 3LWRC 2QEXF 3CPQA 3M1XA 3RYFA 3CCUF 4KWEA 4BVTA 3HKEB 3NK7A 4TZZA 1IV4A 3RYIA 3HAXD 5IYZA 3N4YA 3F0GA 5JVDB 3LWOC 3I56F 3S0HA 1CN7A 2HQSC 2Q1XA 1QAHA 3RA6A 3VOBA 1YHQF 3F0EA 4TV9A 1SA0A 1VH8A 3LFOA 2CW4A 5CB4A 3CCLF 3CYQA 3NVIB 4E6EA 2JNBA 1JFFB 2FC3A 3FPIA 2CHTA 1JJ2F 5LXTB 3S0YA 1W5AA 2W8BC 2I6DA 5FJ4C 4R40B 1N8RH 1KNKA 4LNUB 3CC4F 3SIVA 2BTQB 4RHAA 3GTZA 3CCEF 3B6NA 4RQOA 5LA6B 5EZYA 4X1IA 5GIPC 3G6EF 4ZK7A 5IJ0A 3CCJF 1YJNF 4BY9D 4X1KB 3LWPC 3LYBA 3NK6A 3I7TA 5G4VC 1VQLF 4O4IB 3E1YA 3WGLA 1VQ9F 3JAMM 1VQOF 2I6RA 3F0FA 1XBIA 2RHHA 4IIJA 3MCQA 5MN4A 4O4LA 3QHDA 2KG4A 1ONIA 2R6R1 2Z01A 4YJ3B 2CHSA 4O4JB 2LBWA 3VYUC 2NMUA 3KE1A 3CCRF 1JFFA 4C81A 2VXYA 3JASA 4BVRA 2Z1TA 3P0ZA 3IKFA 4TUYA 2ZOVA 3S03A 3QTYA 1W42A 2IG8A 2BTOA 2VAWA 3CB2A 3GYQA 4O2AA 1XV2A 4F6RA 3LMEA 5BMVA 4ZHYB 5LYJA 4BVQA 3CXCF 2G9IA 3CD6F 1J7HA 3RYCB 2HX0A 3N2KA 1IV1A 3RYIB 4X1YA 1Q8RA 1TVKB 3HKEA 3CCQF 4U3JB 3HKDA 3FD5A 1U3PA 3IMPA 3N2GA 2DT4A 3F0DA 1Q86H 1FFXB 3HKCB 3L7QA 5LP6C 1FNJA 2DYYA 4EI8A 3WGMA 2LBTA 3VOAA 1RLUA 4BW0B 4BT3A 1OAPA 2VGMA 5IT9M 3OONA 3JCMM 1NJIH 3T80A 4G4XA 1RA4A 2LCAA 5B8FA 1W40A 2UYJA 3K2XA 5JQGB 5KMGB 3JATB 3J81M 4FFBA 4TV8A 3VCZA 3OW2F 3WJRA 5KX5A 2YXZA 3CMAF 4EB6A 2HP0B 4WBNA 4X3LA 1W3EX 4C8IA 3D01A 4NUTA 2HS4A 3ELCA 1U40A 5J2TA 1YIJF 3CC7F 2RHOA 5LYJB 1W2BF 1H47A
chains in the Genus database with same CATH topology
2FC3A 2KTUA 1VQNF 3PAFA 1JJ2F 4LCKA 1GZ0A 2OTLF 3E20B 3CC2F 2I6DA 5FJ4C 1N8RH 3PLAC 3CC4F 3SIVA 3NMUC 5EWRA 3VMFB 1VQ6F 1W41A 5DCVA 3N4ZA 2F9ZC 1M1KH 4C4WC 2VGNA 1YI2F 3CCEF 3O85A 5GIPC 3G6EF 3CCJF 4BY9D 1YJNF 1QVGF 3J7AR 1X52A 4BVSA 3CPWF 2QA4F 3LWPC 3IR9A 3NK6A 3LWVC 3OBYA 1VQ4F 2OTJF 5G4VC 1VQLF 1IPAA 3WXMB 3E1YA 1VQPF 1VQ9F 3JAMM 1VQOF 1KD1H 1XBIA 1KC8H 3V7EA 1ZWZA 3VI6A 1NMUB 2OHWA 1VQKF 5FLXM 5HY4A 2KG4A 3CCRF 2LBWA 3FFMA 3V3TA 5HY2A 5HXUA 4BVRA 2FGYA 1W2BF 2ALEA 5GIOC 3J80M 1Q81H 1KQSF 1DT9A 1W42A 2AIFA 3G71F 3GYQA 5HY0A 1YJ9F 5GAPK 5GINC 5HXZA 4NQ3A 1VQ7F 4BVQA 3CXCF 3CD6F 1K9MH 4XCQA 2CZWA 5HY1A 2QI2A 3NVKE 3CCQF 2BO1A 3AGKA 3CCVF 1H7MA 1Q86H 2WALA 2KTVA 1QVFF 1VQ5F 1X7PA 4EI9A 5GANK 3RA5A 1SDSA 3G4SF 2LBXA 3ON1A 4EI8A 1Q7YH 2GLZA 1GO0A 4BW0B 1S72F 2VGMA 5IT9M 3OBWA 3JCMM 4EI7A 3LWRC 3CPQA 2QEXF 1NJIH 1VQ8F 1RA4A 3CCUF 1M90H 1W40A 4BVTA 1T0KB 3J81M 1X7OA 3HJWC 5HWEA 3OW2F 3NK7A 3CMAF 1RLGA 1K8AH 4X3MA 4TZZA 3HAXD 1K73H 3LWQC 3N4YA 3LWOC 1GO1A 5EO3A 3I56F 1YJWF 2HVYD 1CN7A 4X3LA 3MCAB 1W3EX 3RA6A 3V7QA 4NUTA 1E7KA 3CG6A 3D00A 1YHQF 1Q82H 5A2QM 3CMEF 2OZBA 1YITF 3CCMF 5G4UC 3LFOA 3CCSF 3SIUA 3CCLF 1YIJF 3NVIB 3CC7F 1PXWA 3I55F 1CK2A 1VQMF 2JNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FC3 A;  2KTU A;  1VQN F;  3PAF A;  1JJ2 F;  4LCK A;  1GZ0 A;  2OTL F;  3E20 B;  3CC2 F;  2I6D A;  5FJ4 C;  1N8R H;  3PLA C;  3CC4 F;  3SIV A;  3NMU C;  5EWR A;  3VMF B;  1VQ6 F;  1W41 A;  5DCV A;  3N4Z A;  4C4W C;  1M1K H;  2VGN A;  1YI2 F;  3CCE F;  3O85 A;  5GIP C;  3G6E F;  3CCJ F;  4BY9 D;  1YJN F;  1QVG F;  3J7A R;  1X52 A;  3CPW F;  2QA4 F;  3LWP C;  3IR9 A;  3NK6 A;  3LWV C;  3OBY A;  1VQ4 F;  2OTJ F;  5G4V C;  1VQL F;  1IPA A;  3WXM B;  3E1Y A;  1VQP F;  1VQ9 F;  3JAM M;  1VQO F;  1KD1 H;  1XBI A;  1KC8 H;  3V7E A;  1ZWZ A;  3VI6 A;  1NMU B;  2OHW A;  1VQK F;  5FLX M;  2KG4 A;  3CCR F;  2LBW A;  3FFM A;  1W2B F;  2ALE A;  5GIO C;  3J80 M;  1Q81 H;  1KQS F;  1DT9 A;  1W42 A;  2AIF A;  3G71 F;  3GYQ A;  1YJ9 F;  5GAP K;  5GIN C;  1VQ7 F;  3CXC F;  3CD6 F;  1K9M H;  2CZW A;  2QI2 A;  3NVK E;  3CCQ F;  2BO1 A;  3AGK A;  3CCV F;  1H7M A;  1Q86 H;  2WAL A;  2KTV A;  1QVF F;  1VQ5 F;  1X7P A;  5GAN K;  3RA5 A;  1SDS A;  3G4S F;  2LBX A;  3ON1 A;  1Q7Y H;  1GO0 A;  4BW0 B;  1S72 F;  2VGM A;  5IT9 M;  3OBW A;  3JCM M;  3LWR C;  2QEX F;  3CPQ A;  1NJI H;  1VQ8 F;  1RA4 A;  3CCU F;  1M90 H;  1W40 A;  1T0K B;  3J81 M;  1X7O A;  3HJW C;  3OW2 F;  3NK7 A;  3CMA F;  1RLG A;  1K8A H;  4X3M A;  4TZZ A;  3HAX D;  1K73 H;  3LWQ C;  3N4Y A;  3LWO C;  1GO1 A;  5EO3 A;  3I56 F;  1YJW F;  2HVY D;  1CN7 A;  4X3L A;  3MCA B;  1W3E X;  3RA6 A;  3V7Q A;  4NUT A;  1E7K A;  3CG6 A;  1YHQ F;  1Q82 H;  5A2Q M;  3CME F;  2OZB A;  1YIT F;  3CCM F;  5G4U C;  3LFO A;  3CCS F;  3SIU A;  3CCL F;  1YIJ F;  3NVI B;  3CC7 F;  1PXW A;  3I55 F;  1CK2 A;  1VQM F;  2JNB A; 
#chains in the Genus database with same CATH topology
 2KTU A;  2HS0 A;  2OTL F;  2ZOD A;  3JAW B;  3E20 B;  5LXT A;  3PLA C;  1RQ2 A;  4IHJ B;  5EWR A;  2UYN B;  1NQ3 A;  5DCV A;  2F9Z C;  1ODE A;  1YI2 F;  2HS3 A;  5GON B;  3C9U A;  4I4T B;  1X52 A;  4TV9 B;  2PMP A;  2QA4 F;  4YJ3 A;  3K0T A;  4C8E A;  4IIJ B;  3P4E A;  3M4S A;  3VI6 A;  3FD6 A;  1VQK F;  3HKB A;  3HKD B;  1KNJ A;  3WGJ A;  2GVI A;  3FFM A;  4G4Z A;  4G4Y A;  3V3T A;  5HY2 A;  4X1Y B;  2CSL A;  3KJJ A;  2FGY A;  3C9S A;  3P10 A;  5EYP A;  2YYE A;  5GIO C;  3LDT A;  2HP3 A;  5JH7 A;  3I3F A;  1DT9 A;  3ZO8 A;  3UT5 B;  4BT2 A;  1JY8 A;  1X25 A;  1W57 A;  5HY0 A;  2K1S A;  5EIB C;  5GAP K;  4B5C A;  2V9Y A;  3MBM A;  4NQ3 A;  2H8C A;  4XCQ A;  5MN5 A;  2CZW A;  3JVH A;  1IV2 A;  2BTU A;  3NVK E;  5C8Y A;  5EB0 A;  2BO1 A;  5LA6 A;  4ZI7 A;  3CCV F;  5JH7 B;  1CLI A;  4U39 A;  3HKC A;  3JAR A;  2WAL A;  5LOV B;  3DC2 A;  2H8E A;  4EI9 A;  3WGK A;  1SDS A;  5BMV B;  2Z1E A;  1Q7Y H;  3WGN A;  5HP8 A;  1S72 F;  5EZY B;  5CA0 A;  4O2B A;  3RE3 A;  3OBW A;  1RQ7 A;  2UYN A;  3Q8H A;  1W58 1;  2RHJ A;  2KGW A;  2CWJ A;  4C82 A;  1X7O A;  1U3L A;  5MN6 A;  2Z1F A;  4FFB B;  1K8A H;  5GON A;  2IQQ A;  1VHA A;  4TUY B;  3C9T A;  4O4H B;  2HVY D;  4ZHV A;  5JCO C;  2UZH A;  3V7Q A;  1E7K A;  1IV3 A;  1H48 A;  4X1K A;  3JAK A;  5A2Q M;  3CME F;  4ZHQ A;  2OZB A;  5G4U C;  3CCM F;  4BT6 A;  5CA1 B;  3CCS F;  3SIU A;  2HP0 A;  1PF5 A;  1PXW A;  3I55 F;  2PHN A;  4NWO B;  3MQW A;  4ZI7 B;  5CA0 B;  1VQM F;  4EB6 B;  5C8Y B;  3ZOP A;  3JAK B;  3MDO A;  1GZ0 A;  5LP6 A;  1JD1 A;  2ZF8 A;  1Z5W A;  3NMU C;  3E22 A;  2Z1U A;  1W41 A;  4B62 A;  2ZVZ A;  3N4Z A;  4O4H A;  4C4W C;  2VGN A;  3V4D A;  2ZAU A;  3JAS B;  1W5B A;  2RB9 A;  4G88 A;  2IAF A;  3J7A R;  3TD5 A;  4YJ2 B;  4O4L B;  4BVS A;  1YQN A;  3IR9 A;  4I4T A;  3BYQ A;  3LWV C;  3OBY A;  1VQ4 F;  5JQG A;  1IPA A;  3WXM B;  3D54 A;  1KD1 H;  3KJK A;  5EYP B;  4O2B B;  1KC8 H;  2OTM A;  5CB4 B;  2OHW A;  4U3J A;  1Z5V A;  5HY4 A;  5LP6 B;  1UFY A;  5ITZ B;  3UT5 A;  3ZP7 A;  3IEW A;  4C8G A;  3VO8 A;  2ALE A;  3JAR B;  1Q81 H;  1FFX A;  5JVD A;  2AMT A;  3N2G B;  4ZHQ B;  2AIF A;  4O2A B;  4ZOL A;  3JAT A;  2HRU A;  3KIZ A;  4B46 A;  3M84 A;  5GIN C;  5HXZ A;  1VQ7 F;  3DDN A;  2EWC A;  3VTI C;  3F6M A;  1W5E A;  1UI9 A;  1K9M H;  4IHJ A;  2B33 A;  2QI2 A;  4DRX B;  3GHZ A;  3VIU A;  5KX5 B;  4G4V A;  1QD9 A;  1QU9 A;  2RHL A;  5FNV A;  1X7P A;  1TUB A;  3HWU A;  4BT5 A;  5J2U A;  3G4S F;  4X20 B;  3ON1 A;  3WJP A;  4ZOL B;  2GLZ A;  5IJ0 B;  1GO0 A;  3C8L A;  3HTN A;  5EIB D;  3RYC A;  4PWT A;  4EI7 A;  1VQ8 F;  2R75 1;  3RYH A;  2HRY A;  4G4W A;  1M90 H;  3FBA A;  1T0K B;  3HJW C;  5HWE A;  3EOR A;  1RLG A;  4X3M A;  1K73 H;  1YGY A;  3LWQ C;  2GZL A;  4WBN B;  1W59 A;  1GO1 A;  5EO3 A;  1YJW F;  3MCA B;  4DXD A;  1SA0 B;  4F6R B;  3CG6 A;  3D00 A;  4I50 A;  1Q82 H;  3WPX A;  5JCO A;  4YJ2 A;  4I50 B;  4ERH A;  1YIT F;  2P6Y A;  3KHN A;  4HNA B;  3R0P A;  5J2T B;  1VK3 A;  3VYT C;  2AIZ P;  4O4I A;  1W55 A;  1CK2 A;  5HP7 A;  1VQN F;  3PAF A;  3TD3 A;  4LCK A;  3K12 A;  3K14 A;  3CC2 F;  4I55 B;  3WPW A;  2H6L A;  2L26 A;  3HKB B;  1U43 A;  5J2U B;  3N2K B;  3TD4 A;  5IJ9 B;  1VQV A;  3CYP B;  3RYF B;  3VMF B;  1VQ6 F;  1M1K H;  3ESJ A;  3C9R A;  3O85 A;  1QVG F;  4I55 A;  3CPW F;  5ITZ A;  2VAP A;  1FNK A;  2OTJ F;  1VQP F;  2Q1Y A;  3JAL B;  3V7E A;  1ZWZ A;  1DBF A;  5FNV B;  1NMU B;  2VAM A;  4LNU A;  4O4J A;  5FLX M;  3JAW A;  1T0A A;  5EB1 B;  4BT4 A;  5HXU A;  3ZP4 A;  2QTP A;  3ERN A;  3JAL A;  3J80 M;  5EAZ A;  1KQS F;  3E22 B;  1GX1 A;  2UYK A;  3U0O A;  3G71 F;  1TVK A;  3S02 A;  1FSZ A;  4X20 A;  4X1I B;  3WJQ A;  1YJ9 F;  4M8I A;  1W5F A;  5LOV A;  1R1M A;  1XRG A;  2UYP A;  3IEQ A;  5IJ9 A;  1OFU A;  5CA1 A;  5IYZ B;  5HY1 A;  4TV8 B;  4DRX A;  5KMG A;  2CVL A;  3AGK A;  3VYS C;  1H7M A;  1TUB B;  4ZHW A;  2KTV A;  1QVF F;  1VQ5 F;  2ZVY A;  5GAN K;  4HNA A;  3RA5 A;  3S0W A;  4B45 A;  2LBX A;  1COM A;  1XHO A;  1SZQ A;  3QUW A;  3IKE A;  4BT7 A;  5AVM A;  2N48 A;  2MQE A;  3S06 A;  1JN1 A;  3RYH B;  3LWR C;  2QEX F;  3CPQ A;  3M1X A;  3RYF A;  3CCU F;  4KWE A;  4BVT A;  3HKE B;  3NK7 A;  4TZZ A;  1IV4 A;  3RYI A;  3HAX D;  5IYZ A;  3N4Y A;  3F0G A;  5JVD B;  3LWO C;  3I56 F;  3S0H A;  1CN7 A;  2HQS C;  2Q1X A;  1QAH A;  3RA6 A;  3VOB A;  1YHQ F;  3F0E A;  4TV9 A;  1SA0 A;  1VH8 A;  3LFO A;  2CW4 A;  5CB4 A;  3CCL F;  3CYQ A;  3NVI B;  4E6E A;  2JNB A;  1JFF B;  2FC3 A;  3FPI A;  2CHT A;  1JJ2 F;  5LXT B;  3S0Y A;  1W5A A;  2W8B C;  2I6D A;  5FJ4 C;  4R40 B;  1N8R H;  1KNK A;  4LNU B;  3CC4 F;  3SIV A;  2BTQ B;  4RHA A;  3GTZ A;  3CCE F;  3B6N A;  4RQO A;  5LA6 B;  5EZY A;  4X1I A;  5GIP C;  3G6E F;  4ZK7 A;  5IJ0 A;  3CCJ F;  1YJN F;  4BY9 D;  4X1K B;  3LWP C;  3LYB A;  3NK6 A;  3I7T A;  5G4V C;  1VQL F;  4O4I B;  3E1Y A;  3WGL A;  1VQ9 F;  3JAM M;  1VQO F;  2I6R A;  3F0F A;  1XBI A;  2RHH A;  4IIJ A;  3MCQ A;  5MN4 A;  4O4L A;  3QHD A;  2KG4 A;  1ONI A;  2R6R 1;  2Z01 A;  4YJ3 B;  2CHS A;  4O4J B;  2LBW A;  3VYU C;  2NMU A;  3KE1 A;  3CCR F;  1JFF A;  4C81 A;  2VXY A;  3JAS A;  4BVR A;  2Z1T A;  3P0Z A;  3IKF A;  4TUY A;  2ZOV A;  3S03 A;  3QTY A;  1W42 A;  2IG8 A;  2BTO A;  2VAW A;  3CB2 A;  3GYQ A;  4O2A A;  1XV2 A;  4F6R A;  3LME A;  5BMV A;  4ZHY B;  5LYJ A;  4BVQ A;  3CXC F;  2G9I A;  3CD6 F;  1J7H A;  3RYC B;  2HX0 A;  3N2K A;  1IV1 A;  3RYI B;  4X1Y A;  1Q8R A;  1TVK B;  3HKE A;  3CCQ F;  4U3J B;  3HKD A;  3FD5 A;  1U3P A;  3IMP A;  3N2G A;  2DT4 A;  3F0D A;  1Q86 H;  1FFX B;  3HKC B;  3L7Q A;  5LP6 C;  1FNJ A;  2DYY A;  4EI8 A;  3WGM A;  2LBT A;  3VOA A;  1RLU A;  4BW0 B;  4BT3 A;  1OAP A;  2VGM A;  5IT9 M;  3OON A;  3JCM M;  1NJI H;  3T80 A;  4G4X A;  1RA4 A;  2LCA A;  5B8F A;  1W40 A;  2UYJ A;  3K2X A;  5JQG B;  5KMG B;  3JAT B;  3J81 M;  4FFB A;  4TV8 A;  3VCZ A;  3OW2 F;  3WJR A;  5KX5 A;  2YXZ A;  3CMA F;  4EB6 A;  2HP0 B;  4WBN A;  4X3L A;  1W3E X;  4C8I A;  3D01 A;  4NUT A;  2HS4 A;  3ELC A;  1U40 A;  5J2T A;  1YIJ F;  3CC7 F;  2RHO A;  5LYJ B;  1W2B F;  1H47 A; 
#chains in the Genus database with same CATH homology
 2FC3 A;  2KTU A;  1VQN F;  3PAF A;  1JJ2 F;  4LCK A;  1GZ0 A;  2OTL F;  3E20 B;  3CC2 F;  2I6D A;  5FJ4 C;  1N8R H;  3PLA C;  3CC4 F;  3SIV A;  3NMU C;  5EWR A;  3VMF B;  1VQ6 F;  1W41 A;  5DCV A;  3N4Z A;  2F9Z C;  1M1K H;  4C4W C;  2VGN A;  1YI2 F;  3CCE F;  3O85 A;  5GIP C;  3G6E F;  3CCJ F;  4BY9 D;  1YJN F;  1QVG F;  3J7A R;  1X52 A;  4BVS A;  3CPW F;  2QA4 F;  3LWP C;  3IR9 A;  3NK6 A;  3LWV C;  3OBY A;  1VQ4 F;  2OTJ F;  5G4V C;  1VQL F;  1IPA A;  3WXM B;  3E1Y A;  1VQP F;  1VQ9 F;  3JAM M;  1VQO F;  1KD1 H;  1XBI A;  1KC8 H;  3V7E A;  1ZWZ A;  3VI6 A;  1NMU B;  2OHW A;  1VQK F;  5FLX M;  5HY4 A;  2KG4 A;  3CCR F;  2LBW A;  3FFM A;  3V3T A;  5HY2 A;  5HXU A;  4BVR A;  2FGY A;  1W2B F;  2ALE A;  5GIO C;  3J80 M;  1Q81 H;  1KQS F;  1DT9 A;  1W42 A;  2AIF A;  3G71 F;  3GYQ A;  5HY0 A;  1YJ9 F;  5GAP K;  5GIN C;  5HXZ A;  4NQ3 A;  1VQ7 F;  4BVQ A;  3CXC F;  3CD6 F;  1K9M H;  4XCQ A;  2CZW A;  5HY1 A;  2QI2 A;  3NVK E;  3CCQ F;  2BO1 A;  3AGK A;  3CCV F;  1H7M A;  1Q86 H;  2WAL A;  2KTV A;  1QVF F;  1VQ5 F;  1X7P A;  4EI9 A;  5GAN K;  3RA5 A;  1SDS A;  3G4S F;  2LBX A;  3ON1 A;  4EI8 A;  1Q7Y H;  2GLZ A;  1GO0 A;  4BW0 B;  1S72 F;  2VGM A;  5IT9 M;  3OBW A;  3JCM M;  4EI7 A;  3LWR C;  3CPQ A;  2QEX F;  1NJI H;  1VQ8 F;  1RA4 A;  3CCU F;  1M90 H;  1W40 A;  4BVT A;  1T0K B;  3J81 M;  1X7O A;  3HJW C;  5HWE A;  3OW2 F;  3NK7 A;  3CMA F;  1RLG A;  1K8A H;  4X3M A;  4TZZ A;  3HAX D;  1K73 H;  3LWQ C;  3N4Y A;  3LWO C;  1GO1 A;  5EO3 A;  3I56 F;  1YJW F;  2HVY D;  1CN7 A;  4X3L A;  3MCA B;  1W3E X;  3RA6 A;  3V7Q A;  4NUT A;  1E7K A;  3CG6 A;  3D00 A;  1YHQ F;  1Q82 H;  5A2Q M;  3CME F;  2OZB A;  1YIT F;  3CCM F;  5G4U C;  3LFO A;  3CCS F;  3SIU A;  3CCL F;  1YIJ F;  3NVI B;  3CC7 F;  1PXW A;  3I55 F;  1CK2 A;  1VQM F;  2JNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...