1Q82H

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q82H00
3FFMA 2KTVA 3OW2F 1K73H 2OTLF 5FLXM 3NVKE 1CN7A 3G71F 3JAMM 1XBIA 3CPWF 3LFOA 1M90H 2WALA 2KG4A 1X52A 1VQLF 5DCVA 5IT9M 1NMUB 1GO1A 3CCEF 1YJ9F 1YIJF 1W41A 3CG6A 3OBYA 1QVFF 3CCVF 2QA4F 2ALEA 4X3MA 3RA5A 3CMAF 1JJ2F 1K8AH 1YI2F 3J81M 3N4ZA 1VQ7F 3OBWA 1VQ6F 1E7KA 2KTUA 1VQ8F 5GIOC 1SDSA 3NK6A 1W2BF 1YJNF 2LBXA 2BO1A 3NVIB 1H7MA 3NK7A 1Q82H 3CCLF 3MCAB 3LWOC 1Q86H 1PXWA 3O85A 3V7EA 5GINC 5GAPK 1ZWZA 1T0KB 1YJWF 3V7QA 2VGMA 4C4WC 3SIUA 3VMFB 4X3LA 2OZBA 3GYQA 4TZZA 3LWQC 5A2QM 1VQKF 1RA4A 3G4SF 1X7PA 4LCKA 1Q7YH 2I6DA 3RA6A 4NUTA 5EO3A 3CC2F 3N4YA 3CCRF 3LWRC 1GO0A 3J7AR 2LBWA 2FC3A 3CXCF 3WXMB 1W3EX 3VI6A 1YHQF 4BY9D 5G4VC 5GANK 3LWVC 1VQPF 2QI2A 3CCQF 3CC4F 1VQMF 1W42A 1YITF 5FJ4C 2JNBA 2OHWA 1VQ9F 3J80M 3PLAC 3CMEF 1K9MH 3AGKA 2QEXF 1VQNF 3ON1A 5GIPC 1IPAA 3JCMM 1NJIH 3I55F 3G6EF 3CCJF 1CK2A 1GZ0A 3HJWC 3CCUF 3CC7F 1M1KH 3I56F 1KD1H 1KQSF 5EWRA 2AIFA 2OTJF 3NMUC 1W40A 1S72F 1KC8H 3IR9A 3CD6F 2VGNA 3SIVA 1DT9A 1X7OA 2CZWA 4BW0B 5G4UC 3E1YA 3CPQA 3CCMF 1QVGF 1RLGA 2HVYD 1VQ4F 1N8RH 3CCSF 1Q81H 1VQ5F 3HAXD 3LWPC 3PAFA 3E20B 1VQOF
chains in the Genus database with same CATH superfamily
1COMA 3WPXA 1PF5A 5HY0A 2HRYA 2GVIA 3V4DA 1UFYA 2ZVYA 3NVKE 2FGYA 4YJ3B 2WALA 3WGKA 1XHOA 1NMUB 1XRGA 2CW4A 1OFUA 4YJ2B 3VCZA 4WBNB 2LCAA 4O4LB 3HKDA 2Z1UA 3JATA 5KMGA 3OBYA 4E6EA 1QVFF 2CWJA 1QAHA 3RA5A 3VO8A 1IV4A 3HKEA 3S06A 3OBWA 1E7KA 1W59A 1U3LA 3RYFB 1VQVA 2DYYA 2BO1A 3NVIB 3JAWB 4EB6B 1GX1A 1XV2A 1SZQA 3E22B 3VYUC 4G4ZA 5IYZB 3MCAB 4X1IB 3V7EA 3V7QA 1ONIA 3E22A 3VMFB 1RA4A 4ZOLB 2YYEA 4TV8A 2H8EA 3S0HA 3HKDB 5HY4A 3S0WA 3IMPA 3N4YA 4BT5A 2HRUA 3C9RA 5CA1B 3CXCF 3WXMB 2HS4A 1FSZA 2IG8A 5IJ9A 4I4TA 5GANK 3LWVC 4O4JA 2IQQA 5ITZA 1U43A 2UYKA 1JD1A 4RQOA 4O2BB 1VQMF 5JVDA 3ZO8A 5ITZB 1JFFA 2UYNB 2Z1TA 2HS0A 4X20B 5C8YA 3HJWC 3ZP4A 3CCUF 1M1KH 5JH7B 1TUBA 3C9SA 3LDTA 3OONA 3F0EA 2V9YA 3GHZA 1S72F 4IIJB 4B46A 5EB1B 2G9IA 1Z5WA 5AVMA 5G4UC 4C8GA 5LYJB 3FD5A 2HVYD 1N8RH 3N2KB 5CB4B 1VQ5F 3TD5A 3DC2A 3N2GA 2PHNA 2ZOVA 5EYPB 2GLZA 2AIZP 3P4EA 5CA0B 5LOVB 1CN7A 3F6MA 3JAMM 1M90H 3LFOA 3P10A 1GO1A 1J7HA 5FNVA 1YGYA 4ZI7A 1NQ3A 3LYBA 4ZHWA 2H8CA 1FNKA 3RYFA 4B62A 4G4YA 4EI8A 1YIJF 4HNAB 5HP7A 4F6RB 1W41A 1T0AA 2CVLA 1W5AA 4WBNA 5J2UB 2ALEA 4B45A 4I50A 3CMAF 1JJ2F 2OTMA 3J81M 2AMTA 4LNUB 3KHNA 1VQ6F 4BVQA 2KTUA 5LP6C 3WPWA 1VQ8F 4C81A 3NK6A 1QU9A 1W581 4M8IA 1YJNF 2Z1EA 5EYPA 3S0YA 4RHAA 2IAFA 3ZP7A 1JY8A 3CCLF 1Q86H 2W8BC 5GINC 1ZWZA 4C4WC 2RHHA 2VGMA 4BT7A 4C8EA 5IYZA 3HKEB 4TZZA 3L7QA 3D54A 4LCKA 1Q7YH 2GZLA 5LA6B 4X1KA 2N48A 3C9TA 1H47A 4ZK7A 3ZOPA 3CC2F 3CCRF 1GO0A 3CB2A 3J7AR 2LBWA 4TV9A 2FC3A 4YJ2A 1VK3A 2VXYA 3VOAA 4BY9D 4NWOB 3DDNA 5KX5A 2DT4A 3M84A 4ZHVA 1W42A 3WJQA 2JNBA 2OHWA 1VQ9F 5JQGB 3HKBA 4U39A 1K9MH 3S02A 3AGKA 5C8YB 3WGNA 3T80A 3ON1A 2ZF8A 4X1YB 1IPAA 5EB0A 3JAKB 3JCMM 4YJ3A 3G6EF 1R1MA 3CC7F 5J2UA 4I55A 1U40A 1UI9A 4X1YA 3I56F 1CLIA 3JASA 2AIFA 4O4LA 3C8LA 3NMUC 4LNUA 2OTJF 3CD6F 3SIVA 3JARA 4FFBB 3JALA 1DT9A 4IIJA 3CYQA 2CZWA 2EWCA 4EB6A 3VYTC 3CCMF 1FFXA 4BT3A 3CCSF 1Q81H 3HAXD 3FBAA 1VQOF 1QD9A 3VOBA 2KTVA 1H48A 1YQNA 2RHJA 3ELCA 3RYIA 2L26A 3G71F 1XBIA 4B5CA 3CPWF 5DCVA 5IT9M 5HXZA 4I55B 3JVHA 3CCEF 1YJ9F 2NMUA 3P0ZA 5CB4A 4XCQA 2F9ZC 4EI9A 3CG6A 4O2AA 3RYHB 3MDOA 4G4WA 2CHSA 5CA0A 3CCVF 5EIBD 4X1IA 3HWUA 4O2AB 3UT5A 4DRXA 4TUYA 3N4ZA 1X25A 3JAWA 3V3TA 3JARB 5GIOC 1SDSA 4X1KB 1W2BF 2HX0A 2LBXA 2Q1XA 3Q8HA 3K0TA 5GONB 3F0FA 5HY1A 3LWOC 1TVKB 1PXWA 5MN4A 4BT6A 3N2KA 2MQEA 2ZAUA 1YJWF 1T0KB 1RLUA 4DRXB 3GYQA 3LWQC 3G4SF 1X7PA 3RA6A 4C8IA 4HNAA 1FFXB 3IEWA 3QUWA 5HY2A 3WGLA 5LA6A 3MBMA 3LWRC 1W5FA 3KIZA 3JALB 1RQ7A 3CYPB 5J2TB 1VH8A 5HWEA 5LYJA 4BT4A 2BTOA 2UYPA 3C9UA 1VQPF 2QI2A 4C82A 3TD3A 5MN5A 3N2GB 4U3JB 1JFFB 2UYNA 4I4TB 3CC4F 4PWTA 5FNVB 3TD4A 4ZI7B 3J80M 3CMEF 3I3FA 3K14A 3RYCA 4O4HB 5MN6A 1ODEA 2RHLA 4TV9B 1IV3A 2CHTA 5JH7A 3RYIB 3HKBB 3I55F 3HTNA 5J2TA 1CK2A 2VAWA 2P6YA 1KD1H 5GONA 1KQSF 4FFBA 1SA0B 2ZODA 3I7TA 5JCOA 3IR9A 4NQ3A 3WJPA 2KGWA 1KC8H 3F0GA 4BT2A 2R751 2VGNA 2UZHA 3ERNA 1SA0A 3KJKA 1X7OA 3K2XA 1OAPA 3JAKA 3R0PA 5IJ9B 1VHAA 3F0DA 1RLGA 1TVKA 3LWPC 3PAFA 3VIUA 2Z01A 3E20B 1DBFA 5JQGA 3K12A 3FFMA 3OW2F 2OTLF 4G4XA 5FLXM 1FNJA 3FPIA 3WGMA 3KE1A 1IV2A 3UT5B 2HP0B 4G4VA 5EAZA 2KG4A 1X52A 5CA1A 1VQLF 5EZYA 4F6RA 3ESJA 3MCQA 3WJRA 4BVTA 3RE3A 4G88A 1W5BA 2YXZA 3BYQA 5KX5B 2HQSC 2QA4F 4R40B 5IJ0A 4X3MA 3S03A 2HS3A 1K8AH 1YI2F 3JASB 4O4HA 2K1SA 1VQ7F 2PMPA 3HKCB 5HXUA 4U3JA 2HP3A 3GTZA 4O4IB 2R6R1 4EI7A 1H7MA 3EORA 3RYCB 3NK7A 3QHDA 1Q82H 2VAPA 3O85A 5BMVA 5HP8A 5GAPK 3SIUA 4X3LA 2OZBA 1IV1A 3D00A 5A2QM 1VQKF 1JN1A 2VAMA 1U3PA 5LP6A 2I6DA 3U0OA 4NUTA 2BTUA 5JVDB 5EIBC 3LMEA 5EO3A 2LBTA 2HP0A 4TV8B 2Q1YA 2H6LA 5LXTA 3MQWA 4IHJA 3D01A 4I50B 1W3EX 3VI6A 1YHQF 5G4VC 4ZHQA 3VYSC 2Z1FA 4KWEA 3RYHA 2UYJA 4ERHA 3WGJA 2I6RA 1Z5VA 3CCQF 2RHOA 5FJ4C 1YITF 4O4JB 1W55A 4ZHYB 3PLAC 5B8FA 2B33A 4TUYB 1W57A 4IHJB 2QEXF 1VQNF 2CSLA 3JATB 5KMGB 5GIPC 5LOVA 1NJIH 3CCJF 1GZ0A 1Q8RA 3VTIC 4ZHQB 2BTQB 5EZYB 5IJ0B 3M1XA 3B6NA 1KNJA 1KNKA 3QTYA 4X20A 4ZOLA 5JCOC 4BVRA 3KJJA 5EWRA 1W40A 2ZVZA 1TUBB 3IEQA 4BVSA 1W5EA 3IKFA 4BW0B 2QTPA 4O4IA 3E1YA 5LP6B 3CPQA 1RQ2A 1QVGF 3M4SA 1VQ4F 5BMVB 3HKCA 3FD6A 2RB9A 3IKEA 1K73H 5LXTB 4DXDA 4O2BA
chains in the Genus database with same CATH topology
5HY0A 3FFMA 2GLZA 2KTVA 3OW2F 1K73H 2OTLF 5FLXM 3NVKE 2FGYA 1CN7A 3G71F 3JAMM 1XBIA 3CPWF 3LFOA 1M90H 2WALA 2KG4A 1X52A 1VQLF 5DCVA 5IT9M 1NMUB 5HXZA 1GO1A 3CCEF 1YJ9F 4BVTA 4EI8A 4XCQA 1YIJF 2F9ZC 4EI9A 1W41A 3CG6A 3OBYA 1QVFF 3CCVF 2QA4F 2ALEA 4X3MA 3RA5A 3CMAF 1JJ2F 1K8AH 1YI2F 3J81M 3N4ZA 1VQ7F 3V3TA 3OBWA 1VQ6F 1E7KA 4BVQA 2KTUA 5HXUA 5GIOC 1VQ8F 3NK6A 1W2BF 1SDSA 1YJNF 2LBXA 2BO1A 3NVIB 4EI7A 1H7MA 3NK7A 1Q82H 5HY1A 3MCAB 3LWOC 3CCLF 1Q86H 1PXWA 3O85A 3V7EA 5GINC 5GAPK 1ZWZA 1T0KB 1YJWF 3V7QA 2VGMA 4C4WC 3SIUA 3VMFB 4X3LA 2OZBA 3GYQA 3D00A 4TZZA 3LWQC 5A2QM 1VQKF 1RA4A 3G4SF 1X7PA 4LCKA 1Q7YH 2I6DA 3RA6A 4NUTA 5HY4A 5HY2A 5EO3A 3CC2F 3N4YA 3CCRF 3LWRC 1GO0A 3J7AR 2LBWA 2FC3A 3CXCF 3WXMB 1W3EX 3VI6A 1YHQF 4BY9D 5HWEA 5G4VC 5GANK 3LWVC 1VQPF 2QI2A 3CCQF 3CC4F 1VQMF 1W42A 1YITF 5FJ4C 2JNBA 2OHWA 1VQ9F 3J80M 3PLAC 3CMEF 1K9MH 3AGKA 2QEXF 1VQNF 3ON1A 5GIPC 1IPAA 3JCMM 1NJIH 3I55F 3G6EF 3CCJF 1CK2A 1GZ0A 3HJWC 3CCUF 3CC7F 1M1KH 3I56F 4BVRA 1KD1H 1KQSF 5EWRA 2AIFA 2OTJF 3NMUC 1W40A 1S72F 1KC8H 3IR9A 4NQ3A 3CD6F 2VGNA 3SIVA 1DT9A 1X7OA 4BVSA 2CZWA 4BW0B 5G4UC 3E1YA 3CPQA 3CCMF 1QVGF 1RLGA 2HVYD 1VQ4F 1N8RH 3CCSF 1Q81H 1VQ5F 3HAXD 3LWPC 3PAFA 3E20B 1VQOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFM A;  2KTV A;  3OW2 F;  1K73 H;  2OTL F;  5FLX M;  3NVK E;  1CN7 A;  3G71 F;  3JAM M;  1XBI A;  3CPW F;  3LFO A;  1M90 H;  2WAL A;  2KG4 A;  1X52 A;  1VQL F;  5DCV A;  5IT9 M;  1NMU B;  1GO1 A;  3CCE F;  1YJ9 F;  1YIJ F;  1W41 A;  3CG6 A;  3OBY A;  1QVF F;  3CCV F;  2QA4 F;  2ALE A;  4X3M A;  3RA5 A;  3CMA F;  1JJ2 F;  1K8A H;  1YI2 F;  3J81 M;  3N4Z A;  1VQ7 F;  3OBW A;  1VQ6 F;  1E7K A;  2KTU A;  1VQ8 F;  5GIO C;  1SDS A;  3NK6 A;  1W2B F;  1YJN F;  2LBX A;  2BO1 A;  3NVI B;  1H7M A;  3NK7 A;  1Q82 H;  3CCL F;  3MCA B;  3LWO C;  1Q86 H;  1PXW A;  3O85 A;  3V7E A;  5GIN C;  5GAP K;  1ZWZ A;  1T0K B;  1YJW F;  3V7Q A;  2VGM A;  4C4W C;  3SIU A;  3VMF B;  4X3L A;  2OZB A;  3GYQ A;  4TZZ A;  3LWQ C;  5A2Q M;  1VQK F;  1RA4 A;  3G4S F;  1X7P A;  4LCK A;  1Q7Y H;  2I6D A;  3RA6 A;  4NUT A;  5EO3 A;  3CC2 F;  3N4Y A;  3CCR F;  3LWR C;  1GO0 A;  3J7A R;  2LBW A;  2FC3 A;  3CXC F;  3WXM B;  1W3E X;  3VI6 A;  1YHQ F;  4BY9 D;  5G4V C;  5GAN K;  3LWV C;  1VQP F;  2QI2 A;  3CCQ F;  3CC4 F;  1VQM F;  1W42 A;  1YIT F;  5FJ4 C;  2JNB A;  2OHW A;  1VQ9 F;  3J80 M;  3PLA C;  3CME F;  1K9M H;  3AGK A;  2QEX F;  1VQN F;  3ON1 A;  5GIP C;  1IPA A;  3JCM M;  1NJI H;  3I55 F;  3G6E F;  3CCJ F;  1CK2 A;  1GZ0 A;  3HJW C;  3CCU F;  3CC7 F;  1M1K H;  3I56 F;  1KD1 H;  1KQS F;  5EWR A;  2AIF A;  2OTJ F;  3NMU C;  1W40 A;  1S72 F;  1KC8 H;  3IR9 A;  3CD6 F;  2VGN A;  3SIV A;  1DT9 A;  1X7O A;  2CZW A;  4BW0 B;  5G4U C;  3E1Y A;  3CPQ A;  3CCM F;  1QVG F;  1RLG A;  2HVY D;  1VQ4 F;  1N8R H;  3CCS F;  1Q81 H;  1VQ5 F;  3HAX D;  3LWP C;  3PAF A;  3E20 B;  1VQO F; 
#chains in the Genus database with same CATH topology
 1COM A;  3WPX A;  1PF5 A;  5HY0 A;  2HRY A;  2GVI A;  3V4D A;  1UFY A;  2ZVY A;  3NVK E;  2FGY A;  4YJ3 B;  2WAL A;  3WGK A;  1XHO A;  1NMU B;  1XRG A;  2CW4 A;  1OFU A;  4YJ2 B;  3VCZ A;  4WBN B;  2LCA A;  4O4L B;  3HKD A;  2Z1U A;  3JAT A;  5KMG A;  3OBY A;  4E6E A;  1QVF F;  2CWJ A;  1QAH A;  3RA5 A;  3VO8 A;  1IV4 A;  3HKE A;  3S06 A;  3OBW A;  1E7K A;  1W59 A;  1U3L A;  3RYF B;  1VQV A;  2DYY A;  2BO1 A;  3NVI B;  3JAW B;  4EB6 B;  1GX1 A;  1XV2 A;  1SZQ A;  3E22 B;  3VYU C;  4G4Z A;  5IYZ B;  3MCA B;  4X1I B;  3V7E A;  3V7Q A;  1ONI A;  3E22 A;  3VMF B;  1RA4 A;  4ZOL B;  2YYE A;  4TV8 A;  2H8E A;  3S0H A;  3HKD B;  5HY4 A;  3S0W A;  3IMP A;  3N4Y A;  4BT5 A;  2HRU A;  3C9R A;  5CA1 B;  3CXC F;  3WXM B;  2HS4 A;  1FSZ A;  2IG8 A;  5IJ9 A;  4I4T A;  5GAN K;  3LWV C;  4O4J A;  2IQQ A;  5ITZ A;  1U43 A;  2UYK A;  1JD1 A;  4RQO A;  4O2B B;  1VQM F;  5JVD A;  3ZO8 A;  5ITZ B;  1JFF A;  2UYN B;  2Z1T A;  2HS0 A;  4X20 B;  5C8Y A;  3HJW C;  3ZP4 A;  3CCU F;  1M1K H;  5JH7 B;  1TUB A;  3C9S A;  3LDT A;  3OON A;  3F0E A;  2V9Y A;  3GHZ A;  1S72 F;  4IIJ B;  4B46 A;  5EB1 B;  2G9I A;  1Z5W A;  5AVM A;  5G4U C;  4C8G A;  5LYJ B;  3FD5 A;  2HVY D;  1N8R H;  3N2K B;  5CB4 B;  1VQ5 F;  3TD5 A;  3DC2 A;  3N2G A;  2PHN A;  2ZOV A;  5EYP B;  2GLZ A;  2AIZ P;  3P4E A;  5CA0 B;  5LOV B;  1CN7 A;  3F6M A;  3JAM M;  1M90 H;  3LFO A;  3P10 A;  1GO1 A;  1J7H A;  5FNV A;  1YGY A;  4ZI7 A;  1NQ3 A;  3LYB A;  4ZHW A;  2H8C A;  1FNK A;  3RYF A;  4B62 A;  4G4Y A;  4EI8 A;  1YIJ F;  4HNA B;  5HP7 A;  4F6R B;  1W41 A;  1T0A A;  2CVL A;  1W5A A;  4WBN A;  5J2U B;  2ALE A;  4B45 A;  4I50 A;  3CMA F;  1JJ2 F;  2OTM A;  3J81 M;  2AMT A;  4LNU B;  3KHN A;  1VQ6 F;  4BVQ A;  2KTU A;  5LP6 C;  3WPW A;  1VQ8 F;  4C81 A;  3NK6 A;  1QU9 A;  1W58 1;  4M8I A;  1YJN F;  2Z1E A;  5EYP A;  3S0Y A;  4RHA A;  2IAF A;  3ZP7 A;  1JY8 A;  3CCL F;  1Q86 H;  2W8B C;  5GIN C;  1ZWZ A;  4C4W C;  2RHH A;  2VGM A;  4BT7 A;  4C8E A;  5IYZ A;  3HKE B;  4TZZ A;  3L7Q A;  3D54 A;  4LCK A;  1Q7Y H;  2GZL A;  5LA6 B;  4X1K A;  2N48 A;  3C9T A;  1H47 A;  4ZK7 A;  3ZOP A;  3CC2 F;  3CCR F;  1GO0 A;  3CB2 A;  3J7A R;  2LBW A;  4TV9 A;  2FC3 A;  4YJ2 A;  1VK3 A;  2VXY A;  3VOA A;  4BY9 D;  4NWO B;  3DDN A;  5KX5 A;  2DT4 A;  3M84 A;  4ZHV A;  1W42 A;  3WJQ A;  2JNB A;  2OHW A;  1VQ9 F;  5JQG B;  3HKB A;  4U39 A;  1K9M H;  3S02 A;  3AGK A;  5C8Y B;  3WGN A;  3T80 A;  3ON1 A;  2ZF8 A;  4X1Y B;  1IPA A;  5EB0 A;  3JAK B;  3JCM M;  4YJ3 A;  3G6E F;  1R1M A;  3CC7 F;  5J2U A;  4I55 A;  1U40 A;  1UI9 A;  4X1Y A;  3I56 F;  1CLI A;  3JAS A;  2AIF A;  4O4L A;  3C8L A;  3NMU C;  4LNU A;  2OTJ F;  3CD6 F;  3SIV A;  3JAR A;  4FFB B;  3JAL A;  1DT9 A;  4IIJ A;  3CYQ A;  2CZW A;  2EWC A;  4EB6 A;  3VYT C;  3CCM F;  1FFX A;  4BT3 A;  3CCS F;  1Q81 H;  3HAX D;  3FBA A;  1VQO F;  1QD9 A;  3VOB A;  2KTV A;  1H48 A;  1YQN A;  2RHJ A;  3ELC A;  3RYI A;  2L26 A;  3G71 F;  1XBI A;  4B5C A;  3CPW F;  5DCV A;  5IT9 M;  5HXZ A;  4I55 B;  3JVH A;  3CCE F;  1YJ9 F;  2NMU A;  3P0Z A;  5CB4 A;  4XCQ A;  2F9Z C;  4EI9 A;  3CG6 A;  4O2A A;  3RYH B;  3MDO A;  4G4W A;  2CHS A;  5CA0 A;  3CCV F;  5EIB D;  4X1I A;  3HWU A;  4O2A B;  3UT5 A;  4DRX A;  4TUY A;  3N4Z A;  1X25 A;  3JAW A;  3V3T A;  3JAR B;  5GIO C;  1SDS A;  4X1K B;  1W2B F;  2HX0 A;  2LBX A;  2Q1X A;  3Q8H A;  3K0T A;  5GON B;  3F0F A;  5HY1 A;  3LWO C;  1TVK B;  1PXW A;  5MN4 A;  4BT6 A;  3N2K A;  2MQE A;  2ZAU A;  1YJW F;  1T0K B;  1RLU A;  4DRX B;  3GYQ A;  3LWQ C;  3G4S F;  1X7P A;  3RA6 A;  4C8I A;  4HNA A;  1FFX B;  3IEW A;  3QUW A;  5HY2 A;  3WGL A;  5LA6 A;  3MBM A;  3LWR C;  1W5F A;  3KIZ A;  3JAL B;  1RQ7 A;  3CYP B;  5J2T B;  1VH8 A;  5HWE A;  5LYJ A;  4BT4 A;  2BTO A;  2UYP A;  3C9U A;  1VQP F;  2QI2 A;  4C82 A;  3TD3 A;  5MN5 A;  3N2G B;  4U3J B;  1JFF B;  2UYN A;  4I4T B;  3CC4 F;  4PWT A;  5FNV B;  3TD4 A;  4ZI7 B;  3J80 M;  3CME F;  3I3F A;  3K14 A;  3RYC A;  4O4H B;  5MN6 A;  1ODE A;  2RHL A;  4TV9 B;  1IV3 A;  2CHT A;  5JH7 A;  3RYI B;  3HKB B;  3I55 F;  3HTN A;  5J2T A;  1CK2 A;  2VAW A;  2P6Y A;  1KD1 H;  5GON A;  1KQS F;  4FFB A;  1SA0 B;  2ZOD A;  3I7T A;  5JCO A;  3IR9 A;  4NQ3 A;  3WJP A;  2KGW A;  1KC8 H;  3F0G A;  4BT2 A;  2R75 1;  2VGN A;  2UZH A;  3ERN A;  1SA0 A;  3KJK A;  1X7O A;  3K2X A;  1OAP A;  3JAK A;  3R0P A;  5IJ9 B;  1VHA A;  3F0D A;  1RLG A;  1TVK A;  3LWP C;  3PAF A;  3VIU A;  2Z01 A;  3E20 B;  1DBF A;  5JQG A;  3K12 A;  3FFM A;  3OW2 F;  2OTL F;  4G4X A;  5FLX M;  1FNJ A;  3FPI A;  3WGM A;  3KE1 A;  1IV2 A;  3UT5 B;  2HP0 B;  4G4V A;  5EAZ A;  2KG4 A;  1X52 A;  5CA1 A;  1VQL F;  5EZY A;  4F6R A;  3ESJ A;  3MCQ A;  3WJR A;  4BVT A;  3RE3 A;  4G88 A;  1W5B A;  2YXZ A;  3BYQ A;  5KX5 B;  2HQS C;  2QA4 F;  4R40 B;  5IJ0 A;  4X3M A;  3S03 A;  2HS3 A;  1K8A H;  1YI2 F;  3JAS B;  4O4H A;  2K1S A;  1VQ7 F;  2PMP A;  3HKC B;  5HXU A;  4U3J A;  2HP3 A;  3GTZ A;  4O4I B;  2R6R 1;  4EI7 A;  1H7M A;  3EOR A;  3RYC B;  3NK7 A;  3QHD A;  1Q82 H;  2VAP A;  3O85 A;  5BMV A;  5HP8 A;  5GAP K;  3SIU A;  4X3L A;  2OZB A;  1IV1 A;  3D00 A;  5A2Q M;  1VQK F;  1JN1 A;  2VAM A;  1U3P A;  5LP6 A;  2I6D A;  3U0O A;  4NUT A;  2BTU A;  5JVD B;  5EIB C;  3LME A;  5EO3 A;  2LBT A;  2HP0 A;  4TV8 B;  2Q1Y A;  2H6L A;  5LXT A;  3MQW A;  4IHJ A;  3D01 A;  4I50 B;  1W3E X;  3VI6 A;  1YHQ F;  5G4V C;  4ZHQ A;  3VYS C;  2Z1F A;  4KWE A;  3RYH A;  2UYJ A;  4ERH A;  3WGJ A;  2I6R A;  1Z5V A;  3CCQ F;  2RHO A;  5FJ4 C;  1YIT F;  4O4J B;  1W55 A;  4ZHY B;  3PLA C;  5B8F A;  2B33 A;  4TUY B;  1W57 A;  4IHJ B;  2QEX F;  1VQN F;  2CSL A;  3JAT B;  5KMG B;  5GIP C;  5LOV A;  1NJI H;  3CCJ F;  1GZ0 A;  1Q8R A;  3VTI C;  4ZHQ B;  2BTQ B;  5EZY B;  5IJ0 B;  3M1X A;  3B6N A;  1KNJ A;  1KNK A;  3QTY A;  4X20 A;  4ZOL A;  5JCO C;  4BVR A;  3KJJ A;  5EWR A;  1W40 A;  2ZVZ A;  1TUB B;  3IEQ A;  4BVS A;  1W5E A;  3IKF A;  4BW0 B;  2QTP A;  4O4I A;  3E1Y A;  5LP6 B;  3CPQ A;  1RQ2 A;  1QVG F;  3M4S A;  1VQ4 F;  5BMV B;  3HKC A;  3FD6 A;  2RB9 A;  3IKE A;  1K73 H;  5LXT B;  4DXD A;  4O2B A; 
#chains in the Genus database with same CATH homology
 5HY0 A;  3FFM A;  2GLZ A;  2KTV A;  3OW2 F;  1K73 H;  2OTL F;  5FLX M;  3NVK E;  2FGY A;  1CN7 A;  3G71 F;  3JAM M;  1XBI A;  3CPW F;  3LFO A;  1M90 H;  2WAL A;  2KG4 A;  1X52 A;  1VQL F;  5DCV A;  5IT9 M;  1NMU B;  5HXZ A;  1GO1 A;  3CCE F;  1YJ9 F;  4BVT A;  4EI8 A;  4XCQ A;  1YIJ F;  2F9Z C;  4EI9 A;  1W41 A;  3CG6 A;  3OBY A;  1QVF F;  3CCV F;  2QA4 F;  2ALE A;  4X3M A;  3RA5 A;  3CMA F;  1JJ2 F;  1K8A H;  1YI2 F;  3J81 M;  3N4Z A;  1VQ7 F;  3V3T A;  3OBW A;  1VQ6 F;  1E7K A;  4BVQ A;  2KTU A;  5HXU A;  5GIO C;  1VQ8 F;  3NK6 A;  1W2B F;  1SDS A;  1YJN F;  2LBX A;  2BO1 A;  3NVI B;  4EI7 A;  1H7M A;  3NK7 A;  1Q82 H;  5HY1 A;  3MCA B;  3LWO C;  3CCL F;  1Q86 H;  1PXW A;  3O85 A;  3V7E A;  5GIN C;  5GAP K;  1ZWZ A;  1T0K B;  1YJW F;  3V7Q A;  2VGM A;  4C4W C;  3SIU A;  3VMF B;  4X3L A;  2OZB A;  3GYQ A;  3D00 A;  4TZZ A;  3LWQ C;  5A2Q M;  1VQK F;  1RA4 A;  3G4S F;  1X7P A;  4LCK A;  1Q7Y H;  2I6D A;  3RA6 A;  4NUT A;  5HY4 A;  5HY2 A;  5EO3 A;  3CC2 F;  3N4Y A;  3CCR F;  3LWR C;  1GO0 A;  3J7A R;  2LBW A;  2FC3 A;  3CXC F;  3WXM B;  1W3E X;  3VI6 A;  1YHQ F;  4BY9 D;  5HWE A;  5G4V C;  5GAN K;  3LWV C;  1VQP F;  2QI2 A;  3CCQ F;  3CC4 F;  1VQM F;  1W42 A;  1YIT F;  5FJ4 C;  2JNB A;  2OHW A;  1VQ9 F;  3J80 M;  3PLA C;  3CME F;  1K9M H;  3AGK A;  2QEX F;  1VQN F;  3ON1 A;  5GIP C;  1IPA A;  3JCM M;  1NJI H;  3I55 F;  3G6E F;  3CCJ F;  1CK2 A;  1GZ0 A;  3HJW C;  3CCU F;  3CC7 F;  1M1K H;  3I56 F;  4BVR A;  1KD1 H;  1KQS F;  5EWR A;  2AIF A;  2OTJ F;  3NMU C;  1W40 A;  1S72 F;  1KC8 H;  3IR9 A;  4NQ3 A;  3CD6 F;  2VGN A;  3SIV A;  1DT9 A;  1X7O A;  4BVS A;  2CZW A;  4BW0 B;  5G4U C;  3E1Y A;  3CPQ A;  3CCM F;  1QVG F;  1RLG A;  2HVY D;  1VQ4 F;  1N8R H;  3CCS F;  1Q81 H;  1VQ5 F;  3HAX D;  3LWP C;  3PAF A;  3E20 B;  1VQO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...