1Q82H

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1q82H00
3CD6F 1K9MH 5A2QM 1VQPF 5FLXM 1YJ9F 3CPQA 3CMEF 4BY9D 3JAMM 1W3EX 5GAPK 1KD1H 1VQ7F 1GO1A 2OZBA 3HJWC 1X7PA 3NVKE 1GZ0A 1VQ9F 1VQMF 3I55F 1VQ6F 3LWQC 3CCEF 1M1KH 1VQOF 3AGKA 3NK7A 2HVYD 3O85A 1H7MA 1K8AH 1KQSF 3NMUC 3N4YA 3CC2F 3FFMA 1YHQF 3MCAB 1Q81H 1CN7A 2QI2A 3J80M 1QVFF 2OHWA 3LWOC 3G71F 3WXMB 2VGNA 2LBXA 2KTUA 1DT9A 3CCSF 3SIVA 1W40A 3CPWF 2LBWA 1SDSA 1YJNF 1Q7YH 3OW2F 3J7AR 1XBIA 2AIFA 2ALEA 3CCVF 3G4SF 3ON1A 3CG6A 3NVIB 1W41A 1CK2A 1NJIH 1QVGF 3CC7F 1E7KA 1X52A 1VQ4F 2VGMA 1VQLF 5GIPC 3V7QA 2KG4A 3N4ZA 3HAXD 1YI2F 1S72F 5GINC 2KTVA 1M90H 4X3MA 3OBWA 1VQ5F 3VMFB 3RA5A 2WALA 1KC8H 2CZWA 4C4WC 1YIJF 1JJ2F 5EO3A 1RLGA 2I6DA 3NK6A 1Q86H 3CMAF 3LWVC 3CCQF 3E20B 1ZWZA 3G6EF 2QA4F 1VQNF 5GIOC 3PAFA 5G4UC 1IPAA 5G4VC 3PLAC 3V7EA 1Q82H 2BO1A 3JCMM 1W2BF 3IR9A 1PXWA 3OBYA 2JNBA 3I56F 2QEXF 3CCLF 3RA6A 5GANK 1YITF 3J81M 3CC4F 4BW0B 2OTJF 3CCUF 1GO0A 3CCRF 3VI6A 5IT9M 1YJWF 1N8RH 3CXCF 4X3LA 1VQKF 3E1YA 2FC3A 2OTLF 3SIUA 1W42A 3LWPC 3CCMF 1X7OA 1T0KB 1K73H 1RA4A 4TZZA 3LWRC 5DCVA 4NUTA 3CCJF 1VQ8F 4LCKA 3GYQA 5FJ4C 5EWRA 3LFOA 1NMUB
chains in the Genus database with same CATH superfamily
4O4HB 1KNKA 3JASA 5A2QM 5B8FA 3D54A 3UT5B 5GONB 4BY9D 5LP6B 1VQ7F 1COMA 1GO1A 4XCQA 2H6LA 2LCAA 3N2GB 3UT5A 4WBNA 1W55A 3I55F 1ODEA 5ITZA 5LP6A 4I50B 1VQOF 4G4VA 2HVYD 4HNAB 4ZHYB 1K8AH 3N4YA 1YHQF 5BMVB 2QI2A 5C8YB 2ZVYA 3HKBB 4HNAA 2HRYA 2KTUA 2P6YA 3RE3A 1DT9A 5BMVA 3S03A 2BTUA 5JVDA 1QU9A 3HKBA 3VTIC 5MN5A 3B6NA 1FFXB 1XV2A 3JATB 4G4XA 4TUYB 4BT3A 5J2TB 2YXZA 5CB4B 1JFFB 1FFXA 2YYEA 2N48A 5MN6A 3JATA 1ONIA 4YJ2B 3NVIB 1U43A 1W41A 2VAWA 5CB4A 1FNKA 3I7TA 3M1XA 3TD4A 1VQLF 4YJ2A 5GIPC 4ZOLA 3GHZA 1M90H 2UYJA 5KMGB 2CW4A 1UFYA 3C9TA 5EIBC 3K2XA 2UYNB 4C4WC 1W57A 1J7HA 5EO3A 3T80A 3NK6A 4DRXB 4F6RA 2UYNA 4X1KB 1Q86H 3CB2A 2IAFA 1ZWZA 2HX0A 4DRXA 2CSLA 5G4UC 1NQ3A 2VAMA 3PLAC 1Q82H 3JCMM 4TV9B 4B5CA 3V3TA 3WPWA 1IV3A 3ELCA 4R40B 3QTYA 4TV9A 4EB6B 1W5BA 5FNVB 4BW0B 3VOBA 3CC4F 4PWTA 4IHJA 4EB6A 1TVKA 3IKEA 1YJWF 3FD6A 3F0GA 2ZODA 4O4JB 4G4WA 2OTLF 3VYTC 4C81A 3LWPC 2Z1TA 3CCMF 4EI7A 3HKDB 4TV8A 3GTZA 1T0KB 4O4JA 3OONA 3ZP4A 3HKEB 3M4SA 2PMPA 3HKDA 4LCKA 2W8BC 3HKEA 3LYBA 2GLZA 3MDOA 3FPIA 1CLIA 2RB9A 1W5FA 4X1IB 5LXTA 4ZHWA 5HP7A 2AIZP 3DDNA 3F0FA 2UZHA 3KHNA 2L26A 1W3EX 1W5EA 5GAPK 1KD1H 3NVKE 3LDTA 2ZVZA 2VXYA 1GZ0A 3WGKA 4O2AB 2VAPA 3JALA 3ZP7A 5HXUA 3VO8A 1XHOA 1XRGA 1Z5WA 2QTPA 3O85A 3U0OA 1KQSF 1VHAA 3MCAB 1Q81H 1CN7A 3J80M 3RYIB 4YJ3A 3G71F 3K0TA 5LP6C 2LBXA 4NWOB 3D01A 2IG8A 3CCSF 3V4DA 1W40A 3KJJA 3CPWF 5IJ9B 1FNJA 5EB1B 5HY4A 2LBTA 5JCOC 3OW2F 3J7AR 2AMTA 3ERNA 5IJ9A 1RQ7A 3WJQA 4WBNB 3CCVF 3FD5A 5ITZB 1UI9A 4EI8A 3F0DA 3L7QA 4RHAA 3S0YA 1S72F 3P10A 5HY0A 3P4EA 5GINC 5JCOA 3HKCB 3QUWA 5JVDB 1U3LA 4BT5A 1VQ5F 3VMFB 2I6RA 5HY2A 1VK3A 3HKCA 3ESJA 3LMEA 2I6DA 1JY8A 1W581 3CMAF 3C9SA 3CCQF 5JH7B 5MN4A 2DT4A 2Q1YA 1YQNA 1U3PA 3E20B 3WGJA 3MQWA 1Q8RA 4X20B 5JH7A 4I4TB 3TD3A 3V7EA 4ZOLB 5HWEA 4X20A 1X25A 3WGMA 1W2BF 4I4TA 2G9IA 2JNBA 3CCLF 5KX5A 5AVMA 5GANK 1W59A 2HS0A 4NQ3A 3RYFB 4F6RB 2GVIA 3DC2A 1N8RH 3WGLA 3RYFA 4C82A 3CXCF 5IJ0A 3E1YA 2FC3A 2Z01A 4DXDA 1H47A 3VYSC 1W42A 3VYUC 1YGYA 1X7OA 4KWEA 4O4LB 3JAWB 2BTOA 3JARA 3C9UA 4O4LA 3JAWA 5EWRA 2IQQA 2EWCA 3LFOA 3IKFA 3KIZA 4IHJB 5JQGB 1TVKB 3BYQA 2BTQB 3ZO8A 2R751 1YJ9F 3WGNA 1SZQA 4C8IA 5JQGA 5IYZA 1PF5A 3CMEF 3HJWC 1R1MA 1X7PA 1VQMF 4TV8B 1OAPA 3CCEF 1M1KH 4FFBB 2K1SA 2OTMA 3FFMA 4IIJB 4FFBA 2H8EA 1QVFF 2OHWA 3Q8HA 1FSZA 3WXMB 3VOAA 4IIJA 2ZF8A 5LXTB 3SIVA 4LNUB 2R6R1 4ZHQA 2Z1FA 1TUBB 2ZAUA 4LNUA 2NMUA 3MCQA 1XBIA 4BT4A 1JD1A 3JALB 2ALEA 3G4SF 3MBMA 3KJKA 1TUBA 1NJIH 1QVGF 1SA0A 1VQ4F 1GX1A 3C9RA 3I3FA 4YJ3B 2UYPA 4X3MA 2B33A 3IEQA 3RA5A 5HY1A 1KC8H 2CZWA 4B45A 1JJ2F 3QHDA 2GZLA 3JAKA 3G6EF 1VQNF 3RYHA 2HRUA 1IPAA 3CYQA 4ZI7A 4U3JB 4G88A 3RYCA 3F6MA 4U3JA 3OBYA 4BVRA 3R0PA 2QEXF 4O4IB 3I56F 3VCZA 2CHTA 3ZOPA 2RHLA 1YITF 1KNJA 3J81M 4O4IA 3WPXA 3CCUF 4B62A 1GO0A 2HQSC 3TD5A 5IT9M 4O4HA 5LOVB 3WJPA 2RHJA 4X3LA 1VQKF 5LOVA 5GONA 4ERHA 3S0HA 4BVTA 1IV1A 3N2GA 1OFUA 1QAHA 1W5AA 5EZYB 1K73H 1RA4A 2Z1EA 3VIUA 4I50A 5KX5B 3LWRC 5DCVA 3S06A 5EZYA 2HS4A 1JN1A 3CCJF 1U40A 4G4YA 2ZOVA 5C8YA 3CD6F 1K9MH 1VQPF 5EYPB 5FLXM 3F0EA 5IJ0B 3HTNA 3CPQA 5HP8A 2CHSA 2RHOA 5EYPA 3JAMM 2OZBA 4TUYA 4B46A 1VQ9F 5J2TA 3S0WA 1JFFA 1VQ6F 1IV2A 3LWQC 3IMPA 3N2KB 3AGKA 3NK7A 3JARB 1H7MA 3NMUC 3FBAA 4I55B 3CC2F 4EI9A 3N2KA 3LWOC 2VGNA 4I55A 2HP0B 5KMGA 5LA6B 4X1YB 2LBWA 1Z5VA 4BT7A 4ZK7A 5IYZB 2HP0A 1YJNF 1SDSA 1Q7YH 5LA6A 4X1YA 3HWUA 3P0ZA 4BT2A 2RHHA 1DBFA 2UYKA 2AIFA 5EAZA 3ON1A 3CYPB 4X1KA 3CG6A 1CK2A 2HS3A 2PHNA 3CC7F 1E7KA 1X52A 2VGMA 3E22B 4M8IA 3V7QA 2FGYA 2KG4A 3N4ZA 4RQOA 1YI2F 3HAXD 2KTVA 4O2BB 3E22A 3OBWA 3IEWA 4ZHQB 5EIBD 2H8CA 2HP3A 2WALA 4O2BA 1YIJF 5FNVA 1RLGA 1VQVA 2F9ZC 5EB0A 3LWVC 2CWJA 4ZHVA 3KE1A 2MQEA 1SA0B 3JVHA 3WJRA 2QA4F 3S02A 5GIOC 3PAFA 2DYYA 5G4VC 4C8GA 1RQ2A 2BO1A 1H48A 3IR9A 5LYJB 1PXWA 4BVSA 1VH8A 4BT6A 5CA1B 3RA6A 3M84A 5LYJA 2OTJF 4U39A 5CA1A 3CCRF 4G4ZA 3K14A 3VI6A 2Z1UA 5CA0B 1T0AA 3JAKB 2CVLA 3D00A 1RLUA 4X1IA 5CA0A 3RYHB 1IV4A 2Q1XA 4E6EA 3K12A 4ZI7B 3SIUA 4BVQA 3RYCB 3C8LA 4C8EA 4O2AA 2KGWA 2V9YA 3EORA 4TZZA 5J2UB 5HXZA 4NUTA 1VQ8F 3GYQA 3JASB 5FJ4C 1QD9A 5J2UA 3RYIA 1NMUB
chains in the Genus database with same CATH topology
3CD6F 1K9MH 5A2QM 1VQPF 5FLXM 1YJ9F 3CPQA 3CMEF 4BY9D 3JAMM 1W3EX 5GAPK 1KD1H 1VQ7F 1GO1A 2OZBA 3HJWC 1X7PA 4XCQA 3NVKE 1GZ0A 1VQ9F 1VQMF 3I55F 1VQ6F 3LWQC 3CCEF 5HXUA 1M1KH 1VQOF 3AGKA 3NK7A 2HVYD 3O85A 1H7MA 1K8AH 1KQSF 3NMUC 3N4YA 3CC2F 3FFMA 1YHQF 3MCAB 4EI9A 1Q81H 1CN7A 2QI2A 3J80M 1QVFF 2OHWA 3LWOC 3G71F 3WXMB 2VGNA 2LBXA 2KTUA 1DT9A 3CCSF 3SIVA 1W40A 3CPWF 2LBWA 1SDSA 1YJNF 5HY4A 1Q7YH 3OW2F 3J7AR 1XBIA 2AIFA 2ALEA 3CCVF 3G4SF 3ON1A 3CG6A 3NVIB 1W41A 1CK2A 1NJIH 1QVGF 3CC7F 1E7KA 1X52A 4EI8A 1VQ4F 2VGMA 1VQLF 5GIPC 3V7QA 2FGYA 2KG4A 3N4ZA 3HAXD 1YI2F 1S72F 5HY0A 5GINC 2KTVA 1M90H 4X3MA 3OBWA 1VQ5F 3VMFB 3RA5A 5HY1A 2WALA 1KC8H 2CZWA 5HY2A 4C4WC 1YIJF 1JJ2F 5EO3A 1RLGA 2F9ZC 2I6DA 3NK6A 1Q86H 3CMAF 3LWVC 3CCQF 3E20B 1ZWZA 3G6EF 2QA4F 1VQNF 5GIOC 3PAFA 5G4UC 1IPAA 5G4VC 3PLAC 3V7EA 5HWEA 2BO1A 1Q82H 3JCMM 1W2BF 3IR9A 1PXWA 4BVSA 4BVRA 3OBYA 3V3TA 2JNBA 3I56F 2QEXF 3CCLF 3RA6A 5GANK 1YITF 3J81M 3CC4F 4BW0B 2OTJF 4NQ3A 3CCUF 1GO0A 3CCRF 3VI6A 5IT9M 1YJWF 1N8RH 3D00A 3CXCF 4X3LA 1VQKF 3E1YA 2FC3A 2OTLF 3SIUA 1W42A 4BVQA 3LWPC 4BVTA 3CCMF 4EI7A 1X7OA 1T0KB 1K73H 1RA4A 4TZZA 3LWRC 5DCVA 5HXZA 4NUTA 3CCJF 1VQ8F 4LCKA 3GYQA 2GLZA 5FJ4C 5EWRA 3LFOA 1NMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 F;  1K9M H;  5A2Q M;  1VQP F;  5FLX M;  1YJ9 F;  3CPQ A;  3CME F;  4BY9 D;  3JAM M;  1W3E X;  5GAP K;  1KD1 H;  1VQ7 F;  1GO1 A;  2OZB A;  3HJW C;  1X7P A;  3NVK E;  1GZ0 A;  1VQ9 F;  1VQM F;  3I55 F;  1VQ6 F;  3LWQ C;  3CCE F;  1M1K H;  1VQO F;  3AGK A;  3NK7 A;  2HVY D;  3O85 A;  1H7M A;  1K8A H;  1KQS F;  3NMU C;  3N4Y A;  3CC2 F;  3FFM A;  1YHQ F;  3MCA B;  1Q81 H;  1CN7 A;  2QI2 A;  3J80 M;  1QVF F;  2OHW A;  3LWO C;  3G71 F;  3WXM B;  2VGN A;  2LBX A;  2KTU A;  1DT9 A;  3CCS F;  3SIV A;  1W40 A;  3CPW F;  2LBW A;  1SDS A;  1YJN F;  1Q7Y H;  3OW2 F;  3J7A R;  1XBI A;  2AIF A;  2ALE A;  3CCV F;  3G4S F;  3ON1 A;  3CG6 A;  3NVI B;  1W41 A;  1CK2 A;  1NJI H;  1QVG F;  3CC7 F;  1E7K A;  1X52 A;  1VQ4 F;  2VGM A;  1VQL F;  5GIP C;  3V7Q A;  2KG4 A;  3N4Z A;  3HAX D;  1YI2 F;  1S72 F;  5GIN C;  2KTV A;  1M90 H;  4X3M A;  3OBW A;  1VQ5 F;  3VMF B;  3RA5 A;  2WAL A;  1KC8 H;  2CZW A;  4C4W C;  1YIJ F;  1JJ2 F;  5EO3 A;  1RLG A;  2I6D A;  3NK6 A;  1Q86 H;  3CMA F;  3LWV C;  3CCQ F;  3E20 B;  1ZWZ A;  3G6E F;  2QA4 F;  1VQN F;  5GIO C;  3PAF A;  5G4U C;  1IPA A;  5G4V C;  3PLA C;  3V7E A;  1Q82 H;  2BO1 A;  3JCM M;  1W2B F;  3IR9 A;  1PXW A;  3OBY A;  2JNB A;  3I56 F;  2QEX F;  3CCL F;  3RA6 A;  5GAN K;  1YIT F;  3J81 M;  3CC4 F;  4BW0 B;  2OTJ F;  3CCU F;  1GO0 A;  3CCR F;  3VI6 A;  5IT9 M;  1YJW F;  1N8R H;  3CXC F;  4X3L A;  1VQK F;  3E1Y A;  2FC3 A;  2OTL F;  3SIU A;  1W42 A;  3LWP C;  3CCM F;  1X7O A;  1T0K B;  1K73 H;  1RA4 A;  4TZZ A;  3LWR C;  5DCV A;  4NUT A;  3CCJ F;  1VQ8 F;  4LCK A;  3GYQ A;  5FJ4 C;  5EWR A;  3LFO A;  1NMU B; 
#chains in the Genus database with same CATH topology
 4O4H B;  1KNK A;  3JAS A;  5A2Q M;  5B8F A;  3D54 A;  3UT5 B;  5GON B;  4BY9 D;  5LP6 B;  1VQ7 F;  1COM A;  1GO1 A;  4XCQ A;  2H6L A;  2LCA A;  3N2G B;  3UT5 A;  4WBN A;  1W55 A;  3I55 F;  1ODE A;  5ITZ A;  5LP6 A;  4I50 B;  1VQO F;  4G4V A;  2HVY D;  4HNA B;  4ZHY B;  1K8A H;  3N4Y A;  1YHQ F;  5BMV B;  2QI2 A;  5C8Y B;  2ZVY A;  3HKB B;  4HNA A;  2HRY A;  2KTU A;  2P6Y A;  3RE3 A;  1DT9 A;  5BMV A;  3S03 A;  2BTU A;  5JVD A;  1QU9 A;  3HKB A;  3VTI C;  5MN5 A;  3B6N A;  1FFX B;  1XV2 A;  3JAT B;  4G4X A;  4TUY B;  4BT3 A;  5J2T B;  2YXZ A;  5CB4 B;  1JFF B;  1FFX A;  2YYE A;  2N48 A;  5MN6 A;  3JAT A;  1ONI A;  4YJ2 B;  3NVI B;  1U43 A;  1W41 A;  2VAW A;  5CB4 A;  1FNK A;  3I7T A;  3M1X A;  3TD4 A;  1VQL F;  4YJ2 A;  5GIP C;  4ZOL A;  3GHZ A;  1M90 H;  2UYJ A;  5KMG B;  2CW4 A;  1UFY A;  3C9T A;  5EIB C;  3K2X A;  2UYN B;  4C4W C;  1W57 A;  1J7H A;  5EO3 A;  3T80 A;  3NK6 A;  4DRX B;  4F6R A;  2UYN A;  4X1K B;  1Q86 H;  3CB2 A;  2IAF A;  1ZWZ A;  2HX0 A;  4DRX A;  2CSL A;  5G4U C;  1NQ3 A;  2VAM A;  3PLA C;  1Q82 H;  3JCM M;  4TV9 B;  4B5C A;  3V3T A;  3WPW A;  1IV3 A;  3ELC A;  4R40 B;  3QTY A;  4TV9 A;  4EB6 B;  1W5B A;  5FNV B;  4BW0 B;  3VOB A;  3CC4 F;  4PWT A;  4IHJ A;  4EB6 A;  1TVK A;  3IKE A;  1YJW F;  3FD6 A;  3F0G A;  2ZOD A;  4O4J B;  4G4W A;  2OTL F;  3VYT C;  4C81 A;  3LWP C;  2Z1T A;  3CCM F;  4EI7 A;  3HKD B;  4TV8 A;  3GTZ A;  1T0K B;  4O4J A;  3OON A;  3ZP4 A;  3HKE B;  3M4S A;  2PMP A;  3HKD A;  4LCK A;  2W8B C;  3HKE A;  3LYB A;  2GLZ A;  3MDO A;  3FPI A;  1CLI A;  2RB9 A;  1W5F A;  4X1I B;  5LXT A;  4ZHW A;  5HP7 A;  2AIZ P;  3DDN A;  3F0F A;  2UZH A;  3KHN A;  2L26 A;  1W3E X;  1W5E A;  5GAP K;  1KD1 H;  3NVK E;  3LDT A;  2ZVZ A;  2VXY A;  1GZ0 A;  3WGK A;  4O2A B;  2VAP A;  3JAL A;  3ZP7 A;  5HXU A;  3VO8 A;  1XHO A;  1XRG A;  1Z5W A;  2QTP A;  3O85 A;  3U0O A;  1KQS F;  1VHA A;  3MCA B;  1Q81 H;  1CN7 A;  3J80 M;  3RYI B;  4YJ3 A;  3G71 F;  3K0T A;  5LP6 C;  2LBX A;  4NWO B;  3D01 A;  2IG8 A;  3CCS F;  3V4D A;  1W40 A;  3KJJ A;  3CPW F;  5IJ9 B;  1FNJ A;  5EB1 B;  5HY4 A;  2LBT A;  5JCO C;  3OW2 F;  3J7A R;  2AMT A;  3ERN A;  5IJ9 A;  1RQ7 A;  3WJQ A;  4WBN B;  3CCV F;  3FD5 A;  5ITZ B;  1UI9 A;  4EI8 A;  3F0D A;  3L7Q A;  4RHA A;  3S0Y A;  1S72 F;  3P10 A;  5HY0 A;  3P4E A;  5GIN C;  5JCO A;  3HKC B;  3QUW A;  5JVD B;  1U3L A;  4BT5 A;  1VQ5 F;  3VMF B;  2I6R A;  5HY2 A;  1VK3 A;  3HKC A;  3ESJ A;  3LME A;  2I6D A;  1JY8 A;  1W58 1;  3CMA F;  3C9S A;  3CCQ F;  5JH7 B;  5MN4 A;  2DT4 A;  2Q1Y A;  1YQN A;  1U3P A;  3E20 B;  3WGJ A;  3MQW A;  1Q8R A;  4X20 B;  5JH7 A;  4I4T B;  3TD3 A;  3V7E A;  4ZOL B;  5HWE A;  4X20 A;  1X25 A;  3WGM A;  1W2B F;  4I4T A;  2G9I A;  2JNB A;  3CCL F;  5KX5 A;  5AVM A;  5GAN K;  1W59 A;  2HS0 A;  4NQ3 A;  3RYF B;  4F6R B;  2GVI A;  3DC2 A;  1N8R H;  3WGL A;  3RYF A;  4C82 A;  3CXC F;  5IJ0 A;  3E1Y A;  2FC3 A;  2Z01 A;  4DXD A;  1H47 A;  3VYS C;  1W42 A;  3VYU C;  1YGY A;  1X7O A;  4KWE A;  4O4L B;  3JAW B;  2BTO A;  3JAR A;  3C9U A;  4O4L A;  3JAW A;  5EWR A;  2IQQ A;  2EWC A;  3LFO A;  3IKF A;  3KIZ A;  4IHJ B;  5JQG B;  1TVK B;  3BYQ A;  2BTQ B;  3ZO8 A;  2R75 1;  1YJ9 F;  3WGN A;  1SZQ A;  4C8I A;  5JQG A;  5IYZ A;  1PF5 A;  3CME F;  3HJW C;  1R1M A;  1X7P A;  1VQM F;  4TV8 B;  1OAP A;  3CCE F;  1M1K H;  4FFB B;  2K1S A;  2OTM A;  3FFM A;  4IIJ B;  4FFB A;  2H8E A;  1QVF F;  2OHW A;  3Q8H A;  1FSZ A;  3WXM B;  3VOA A;  4IIJ A;  2ZF8 A;  5LXT B;  3SIV A;  4LNU B;  2R6R 1;  4ZHQ A;  2Z1F A;  1TUB B;  2ZAU A;  4LNU A;  2NMU A;  3MCQ A;  1XBI A;  4BT4 A;  1JD1 A;  3JAL B;  2ALE A;  3G4S F;  3MBM A;  3KJK A;  1TUB A;  1NJI H;  1QVG F;  1SA0 A;  1VQ4 F;  1GX1 A;  3C9R A;  3I3F A;  4YJ3 B;  2UYP A;  4X3M A;  2B33 A;  3IEQ A;  3RA5 A;  5HY1 A;  1KC8 H;  2CZW A;  4B45 A;  1JJ2 F;  3QHD A;  2GZL A;  3JAK A;  3G6E F;  1VQN F;  3RYH A;  2HRU A;  1IPA A;  3CYQ A;  4ZI7 A;  4U3J B;  4G88 A;  3RYC A;  3F6M A;  4U3J A;  3OBY A;  4BVR A;  3R0P A;  2QEX F;  4O4I B;  3I56 F;  3VCZ A;  2CHT A;  3ZOP A;  2RHL A;  1YIT F;  1KNJ A;  3J81 M;  4O4I A;  3WPX A;  3CCU F;  4B62 A;  1GO0 A;  2HQS C;  3TD5 A;  5IT9 M;  4O4H A;  5LOV B;  3WJP A;  2RHJ A;  4X3L A;  1VQK F;  5LOV A;  5GON A;  4ERH A;  3S0H A;  4BVT A;  1IV1 A;  3N2G A;  1OFU A;  1QAH A;  1W5A A;  5EZY B;  1K73 H;  1RA4 A;  2Z1E A;  3VIU A;  4I50 A;  5KX5 B;  3LWR C;  5DCV A;  3S06 A;  5EZY A;  2HS4 A;  1JN1 A;  3CCJ F;  1U40 A;  4G4Y A;  2ZOV A;  5C8Y A;  3CD6 F;  1K9M H;  1VQP F;  5EYP B;  5FLX M;  3F0E A;  5IJ0 B;  3HTN A;  3CPQ A;  5HP8 A;  2CHS A;  2RHO A;  5EYP A;  3JAM M;  2OZB A;  4TUY A;  4B46 A;  1VQ9 F;  5J2T A;  3S0W A;  1JFF A;  1VQ6 F;  1IV2 A;  3LWQ C;  3IMP A;  3N2K B;  3AGK A;  3NK7 A;  3JAR B;  1H7M A;  3NMU C;  3FBA A;  4I55 B;  3CC2 F;  4EI9 A;  3N2K A;  3LWO C;  2VGN A;  4I55 A;  2HP0 B;  5KMG A;  5LA6 B;  4X1Y B;  2LBW A;  1Z5V A;  4BT7 A;  4ZK7 A;  5IYZ B;  2HP0 A;  1YJN F;  1SDS A;  1Q7Y H;  5LA6 A;  4X1Y A;  3HWU A;  3P0Z A;  4BT2 A;  2RHH A;  1DBF A;  2UYK A;  2AIF A;  5EAZ A;  3ON1 A;  3CYP B;  4X1K A;  3CG6 A;  1CK2 A;  2HS3 A;  2PHN A;  3CC7 F;  1E7K A;  1X52 A;  2VGM A;  3E22 B;  4M8I A;  3V7Q A;  2FGY A;  2KG4 A;  3N4Z A;  4RQO A;  1YI2 F;  3HAX D;  2KTV A;  4O2B B;  3E22 A;  3OBW A;  3IEW A;  4ZHQ B;  5EIB D;  2H8C A;  2HP3 A;  2WAL A;  4O2B A;  1YIJ F;  5FNV A;  1RLG A;  1VQV A;  2F9Z C;  5EB0 A;  3LWV C;  2CWJ A;  4ZHV A;  3KE1 A;  2MQE A;  1SA0 B;  3JVH A;  3WJR A;  2QA4 F;  3S02 A;  5GIO C;  3PAF A;  2DYY A;  5G4V C;  4C8G A;  1RQ2 A;  2BO1 A;  1H48 A;  3IR9 A;  5LYJ B;  1PXW A;  4BVS A;  1VH8 A;  4BT6 A;  5CA1 B;  3RA6 A;  3M84 A;  5LYJ A;  2OTJ F;  4U39 A;  5CA1 A;  3CCR F;  4G4Z A;  3K14 A;  3VI6 A;  2Z1U A;  5CA0 B;  1T0A A;  3JAK B;  2CVL A;  3D00 A;  1RLU A;  4X1I A;  5CA0 A;  3RYH B;  1IV4 A;  2Q1X A;  4E6E A;  3K12 A;  4ZI7 B;  3SIU A;  4BVQ A;  3RYC B;  3C8L A;  4C8E A;  4O2A A;  2KGW A;  2V9Y A;  3EOR A;  4TZZ A;  5J2U B;  5HXZ A;  4NUT A;  1VQ8 F;  3GYQ A;  3JAS B;  5FJ4 C;  1QD9 A;  5J2U A;  3RYI A;  1NMU B; 
#chains in the Genus database with same CATH homology
 3CD6 F;  1K9M H;  5A2Q M;  1VQP F;  5FLX M;  1YJ9 F;  3CPQ A;  3CME F;  4BY9 D;  3JAM M;  1W3E X;  5GAP K;  1KD1 H;  1VQ7 F;  1GO1 A;  2OZB A;  3HJW C;  1X7P A;  4XCQ A;  3NVK E;  1GZ0 A;  1VQ9 F;  1VQM F;  3I55 F;  1VQ6 F;  3LWQ C;  3CCE F;  5HXU A;  1M1K H;  1VQO F;  3AGK A;  3NK7 A;  2HVY D;  3O85 A;  1H7M A;  1K8A H;  1KQS F;  3NMU C;  3N4Y A;  3CC2 F;  3FFM A;  1YHQ F;  3MCA B;  4EI9 A;  1Q81 H;  1CN7 A;  2QI2 A;  3J80 M;  1QVF F;  2OHW A;  3LWO C;  3G71 F;  3WXM B;  2VGN A;  2LBX A;  2KTU A;  1DT9 A;  3CCS F;  3SIV A;  1W40 A;  3CPW F;  2LBW A;  1SDS A;  1YJN F;  5HY4 A;  1Q7Y H;  3OW2 F;  3J7A R;  1XBI A;  2AIF A;  2ALE A;  3CCV F;  3G4S F;  3ON1 A;  3CG6 A;  3NVI B;  1W41 A;  1CK2 A;  1NJI H;  1QVG F;  3CC7 F;  1E7K A;  1X52 A;  4EI8 A;  1VQ4 F;  2VGM A;  1VQL F;  5GIP C;  3V7Q A;  2FGY A;  2KG4 A;  3N4Z A;  3HAX D;  1YI2 F;  1S72 F;  5HY0 A;  5GIN C;  2KTV A;  1M90 H;  4X3M A;  3OBW A;  1VQ5 F;  3VMF B;  3RA5 A;  5HY1 A;  2WAL A;  1KC8 H;  2CZW A;  5HY2 A;  4C4W C;  1YIJ F;  1JJ2 F;  5EO3 A;  1RLG A;  2F9Z C;  2I6D A;  3NK6 A;  1Q86 H;  3CMA F;  3LWV C;  3CCQ F;  3E20 B;  1ZWZ A;  3G6E F;  2QA4 F;  1VQN F;  5GIO C;  3PAF A;  5G4U C;  1IPA A;  5G4V C;  3PLA C;  3V7E A;  5HWE A;  2BO1 A;  1Q82 H;  3JCM M;  1W2B F;  3IR9 A;  1PXW A;  4BVS A;  4BVR A;  3OBY A;  3V3T A;  2JNB A;  3I56 F;  2QEX F;  3CCL F;  3RA6 A;  5GAN K;  1YIT F;  3J81 M;  3CC4 F;  4BW0 B;  2OTJ F;  4NQ3 A;  3CCU F;  1GO0 A;  3CCR F;  3VI6 A;  5IT9 M;  1YJW F;  1N8R H;  3D00 A;  3CXC F;  4X3L A;  1VQK F;  3E1Y A;  2FC3 A;  2OTL F;  3SIU A;  1W42 A;  4BVQ A;  3LWP C;  4BVT A;  3CCM F;  4EI7 A;  1X7O A;  1T0K B;  1K73 H;  1RA4 A;  4TZZ A;  3LWR C;  5DCV A;  5HXZ A;  4NUT A;  3CCJ F;  1VQ8 F;  4LCK A;  3GYQ A;  2GLZ A;  5FJ4 C;  5EWR A;  3LFO A;  1NMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...