2AIFA

Crystal structure of high mobility like protein, nhp2, putative from cryptosporidium parvum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
FPLASPDLNNKIINLVQQACNYKQLRKGANEATKALNRGIAEIVLLAADAEPLEILLHLPLVCEDKNTPYVFVRSKVALGRACGVSRPVIAAAITSKDGSSLSSQITELKDQIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Dna binding protein, cytokine
molecule keywords ribosomal protein L7A
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aifA00
1Q7YH 2CZWA 2KTUA 4C4WC 2BO1A 3N4ZA 1YI2F 2HVYD 3J81M 3LWVC 3I55F 3CPQA 3AGKA 4X3LA 2ALEA 2FC3A 2QI2A 3PAFA 3WXMB 1VQ8F 3G71F 5GAPK 5GIPC 1VQ9F 2LBWA 4BY9D 3O85A 1S72F 3NVKE 5DCVA 2KG4A 1VQLF 3JCMM 5G4UC 1VQOF 1YITF 5FJ4C 1QVGF 3LFOA 1X52A 5GIOC 1CN7A 1W41A 2JNBA 5EO3A 1GO1A 1W3EX 1YJNF 3PLAC 3NK7A 1VQKF 3LWQC 2WALA 3J80M 3E1YA 2OZBA 4NUTA 4TZZA 3CXCF 3VI6A 1YHQF 1DT9A 3LWPC 3VMFB 3CCJF 1K9MH 1Q82H 1H7MA 3RA5A 1VQPF 1GZ0A 3LWRC 3J7AR 3OBWA 2VGMA 4LCKA 2OTJF 3ON1A 1ZWZA 1KD1H 1KC8H 3CD6F 1NJIH 1K8AH 1GO0A 3I56F 3SIVA 3RA6A 1VQ6F 3CC7F 2QA4F 1M1KH 1JJ2F 1T0KB 1VQ7F 1VQ4F 1X7PA 1IPAA 3CCQF 3SIUA 1Q81H 3HJWC 3CMEF 1X7OA 5G4VC 3HAXD 3FFMA 1XBIA 1Q86H 3GYQA 4BW0B 1E7KA 3IR9A 2AIFA 1YIJF 1W2BF 3NMUC 3E20B 1PXWA 3CG6A 2QEXF 1CK2A 3CPWF 3NVIB 5GINC 3CCMF 2VGNA 3N4YA 3OBYA 1KQSF 2OHWA 3CMAF 3NK6A 5A2QM 2LBXA 3JAMM 3CCSF 1N8RH 1K73H 2KTVA 3CC4F 1QVFF 4X3MA 3CCVF 1VQNF 3CC2F 3V7QA 3G6EF 1NMUB 1YJWF 5IT9M 3V7EA 3CCEF 3CCLF 1VQMF 1VQ5F 1SDSA 5FLXM 5GANK 5EWRA 3LWOC 3G4SF 3OW2F 1RA4A 2I6DA 3CCRF 2OTLF 1RLGA 1W42A 3MCAB 3CCUF 1W40A 1M90H 1YJ9F
chains in the Genus database with same CATH superfamily
5LYJA 2UYNB 3N2GA 4BT4A 5IYZA 2Z1FA 3K0TA 1OFUA 4ZHQB 3N4ZA 2HVYD 4X1IB 4TUYA 5HP8A 4EI9A 3I55F 5IJ9B 1J7HA 2EWCA 3WPXA 3R0PA 3RYHB 4HNAA 3WXMB 5JCOA 4C81A 4O4HB 3LMEA 3WJQA 3C9RA 4C8EA 3JARB 3MCQA 5GIPC 3IKEA 2LBWA 4WBNA 5CA1B 5HWEA 1S72F 3P10A 3JCMM 1VQOF 2UYKA 1U3LA 5FJ4C 4E6EA 1CN7A 1W41A 1GO1A 3VO8A 1W3EX 2Z1EA 1U3PA 3HKCA 5LP6A 3MQWA 3RYIB 5JQGB 4EI8A 5EIBC 5J2TB 3J80M 4TZZA 2NMUA 2PHNA 5EZYA 3WGNA 1YHQF 5EAZA 1DT9A 1T0AA 3CCJF 1VHAA 5JQGA 2HS0A 1VQPF 1W5FA 3S0WA 3HKEA 3ZP4A 1H47A 2ZVZA 4ZHWA 4IHJA 3F6MA 3FD6A 2G9IA 3JAWA 5LXTA 5AVMA 3DC2A 4X20A 4LCKA 2OTJF 3WPWA 3M1XA 3VYUC 3JASA 2DT4A 3C8LA 3I56F 3RA6A 1VQ6F 2UYJA 1M1KH 1JJ2F 2LBTA 4X20B 2FGYA 1FFXB 3JALB 4BVSA 4O4LB 3HKDA 3F0EA 1FNKA 3CCQF 2Q1YA 1X7OA 5G4VC 5LP6B 4O4JA 5BMVA 2GLZA 4B45A 4BVTA 5MN6A 3IR9A 2AIFA 2N48A 1W2BF 3E20B 1UFYA 3CG6A 1TVKA 2CHTA 4O4JB 4BT7A 5KMGB 3OBYA 3N4YA 1KQSF 1UI9A 3HKCB 4EB6B 2LBXA 5A2QM 3CYQA 1QVFF 3F0GA 4X3MA 4O2AA 4ERHA 5LXTB 3G6EF 3HKBA 2I6RA 5ITZA 2ZOVA 1COMA 3JARA 1VQMF 1VQ5F 1SDSA 3B6NA 2RHLA 3HWUA 3TD5A 5EYPA 3OW2F 4DXDA 3FD5A 3QTYA 2B33A 1RLGA 5JH7A 1YJ9F 4KWEA 1W5AA 2GZLA 2KTUA 5IYZB 2VAWA 1YI2F 1IV3A 1YGYA 3KJKA 1IV2A 5EZYB 3K2XA 3IEQA 3K12A 3F0FA 4O2BA 4I50B 3AGKA 1U43A 4NQ3A 4FFBA 2IG8A 4M8IA 3G71F 4X1KB 2AIZP 3JATB 4B62A 4BY9D 4X1YB 2KG4A 3I7TA 3N2KB 4O4IB 3T80A 4B5CA 4BT2A 1YITF 3M84A 1X52A 4BVRA 5GIOC 5GONA 1W59A 3D00A 2JNBA 4ZOLB 1ODEA 3WGJA 5KX5A 4BVQA 2R6R1 4O4HA 5EIBD 4TV9A 1YJNF 3LWQC 2OZBA 2HS3A 2VAPA 1XV2A 3GTZA 3VMFB 1K9MH 1Q82H 5JVDA 1H7MA 3RA5A 1RQ7A 3N2KA 4O4IA 3VIUA 2DYYA 3LWRC 3J7AR 1TUBB 4I55A 2VGMA 2CHSA 3JALA 4F6RB 3RYCB 4ZK7A 2IAFA 1KC8H 4I50A 1NJIH 3SIVA 3S06A 3K14A 3TD3A 3ZP7A 3RYIA 3P4EA 1Z5VA 3VYTC 1IPAA 5B8FA 1PF5A 3F0DA 4G4VA 4O4LA 5KX5B 5HXZA 3HAXD 1JN1A 2ZVYA 4I4TA 3GYQA 2RHJA 4X1YA 2CWJA 3VCZA 2BTUA 3I3FA 3CCMF 3HTNA 3WGLA 4C8IA 3CMAF 3JAMM 1N8RH 1K73H 1SZQA 3CC4F 3FBAA 3CC2F 3V7QA 2K1SA 2YYEA 1W55A 4IIJA 2GVIA 1VQVA 1XRGA 2AMTA 5CA0A 5FLXM 3DDNA 3MBMA 4LNUA 2R751 1X25A 3U0OA 1QU9A 3ZO8A 1IV1A 2OTMA 5HXUA 4R40B 5BMVB 2OTLF 1FSZA 1JFFA 5IJ9A 5J2UA 2BTQB 3RYFA 4ZI7B 1Q7YH 2CZWA 3JAKB 5FNVA 4U39A 4C4WC 4G4WA 4IHJB 4EB6A 1JFFB 3QHDA 3J81M 3LWVC 3UT5A 1FNJA 3KIZA 3PAFA 1SA0A 3C9TA 1JD1A 1VQ9F 1Z5WA 3NVKE 5DCVA 3KE1A 3GHZA 1VQLF 5EYPB 5G4UC 4B46A 3N2GB 5EO3A 3HKDB 3TD4A 5MN4A 3WGKA 5MN5A 5IJ0A 3NK7A 1VQKF 2ZF8A 2RB9A 3E1YA 3MDOA 1QD9A 1RQ2A 4BT5A 2W8BC 4NUTA 3WGMA 4DRXB 3LWPC 4YJ3B 3JAKA 3S02A 5CA0B 4ZI7A 5JCOC 2HP0B 4YJ2A 4ZHVA 4O2AB 2QTPA 4I55B 2Z1TA 4XCQA 1ZWZA 3ON1A 5HY0A 1KD1H 3VOAA 1GO0A 3EORA 2HQSC 4PWTA 1VH8A 2HX0A 2IQQA 3CC7F 1TVKB 1SA0B 5HY2A 2MQEA 3CB2A 4TUYB 3VTIC 4WBNB 3OONA 3KHNA 1TUBA 1VQ7F 1VQ4F 1X7PA 3WJPA 3ERNA 4EI7A 3E22A 3RYHA 2HP0A 2HRUA 4YJ2B 5LA6B 5ITZB 3CMEF 1Q81H 3HJWC 3FFMA 3LDTA 1NQ3A 5CA1A 1YIJF 4RQOA 3NMUC 2H8EA 3P0ZA 1PXWA 1CK2A 3C9UA 3CPWF 3D01A 3ELCA 3JATA 4TV9B 3NK6A 4G4XA 5HY4A 2KTVA 3L7QA 3CCVF 1VQNF 3JAWB 1NMUB 5HP7A 1YJWF 3V7EA 2HS4A 1H48A 1QAHA 3CCEF 5JH7B 3CCLF 1KNJA 5GANK 2UZHA 1XHOA 2VAMA 3LWOC 3G4SF 2UYPA 5LOVA 3UT5B 1W42A 5EB1B 2VXYA 3S03A 3MCAB 3CCUF 1W40A 2HP3A 1M90H 3M4SA 2HRYA 5IJ0B 5FNVB 5JVDB 1JY8A 2BO1A 4LNUB 5LA6A 3V3TA 2P6YA 1YQNA 4BT3A 3CPQA 3VYSC 2RHOA 5C8YA 2LCAA 1DBFA 4C82A 3CYPB 4X3LA 2ALEA 2FC3A 2QI2A 1VQ8F 5GAPK 2KGWA 3VOBA 2PMPA 3O85A 3KJJA 5J2TA 4O2BB 1VK3A 3WJRA 1QVGF 3LFOA 2YXZA 5HY1A 3IKFA 3FPIA 3IMPA 3JVHA 1ONIA 5KMGA 2UYNA 3PLAC 4ZHYB 1RLUA 2WALA 4U3JB 4RHAA 3CXCF 2ZAUA 2CW4A 4TV8B 3VI6A 4YJ3A 3JASB 3LYBA 5CB4A 3S0HA 3ZOPA 3QUWA 1GZ0A 2F9ZC 1IV4A 5GONB 4ZOLA 3OBWA 3RYFB 3RE3A 2Z1UA 5CB4B 3CD6F 3E22B 5C8YB 1K8AH 3HKEB 3D54A 3IEWA 4FFBB 4X1KA 2QA4F 4U3JA 1T0KB 5EB0A 3Q8HA 4F6RA 3RYCA 4BT6A 1W57A 2CSLA 1R1MA 5LYJB 2CVLA 4ZHQA 3SIUA 2BTOA 2H8CA 3ESJA 5LOVB 2Z01A 1GX1A 1XBIA 4C8GA 1Q86H 4BW0B 1E7KA 1W5EA 1KNKA 1FFXA 3V4DA 2V9YA 4HNAB 2QEXF 1W581 1OAPA 3NVIB 1U40A 5GINC 2L26A 2VGNA 2Q1XA 2OHWA 2H6LA 4I4TB 1Q8RA 3CCSF 3BYQA 4X1IA 3HKBB 4NWOB 5IT9M 1W5BA 4DRXA 4TV8A 5J2UB 5LP6C 4G4ZA 2ZODA 5EWRA 4G4YA 1RA4A 2I6DA 3CCRF 2RHHA 4G88A 3S0YA 1CLIA 3C9SA 4IIJB
chains in the Genus database with same CATH topology
1Q7YH 2CZWA 2KTUA 4C4WC 2BO1A 3N4ZA 3V3TA 1YI2F 2HVYD 4EI9A 3J81M 3LWVC 3I55F 3CPQA 3AGKA 4X3LA 2ALEA 2FC3A 2QI2A 4NQ3A 3PAFA 3WXMB 1VQ8F 3G71F 5GAPK 5GIPC 1VQ9F 2LBWA 4BY9D 3O85A 5HWEA 1S72F 3NVKE 5DCVA 2KG4A 1VQLF 3JCMM 5G4UC 1VQOF 1YITF 5FJ4C 1QVGF 3LFOA 1X52A 4BVRA 5HY1A 5GIOC 1CN7A 1W41A 2JNBA 5EO3A 3D00A 1GO1A 1W3EX 4BVQA 1YJNF 3PLAC 3NK7A 1VQKF 4EI8A 3LWQC 2WALA 3J80M 3E1YA 2OZBA 4NUTA 4TZZA 3CXCF 3VI6A 1YHQF 1DT9A 3LWPC 3VMFB 3CCJF 1K9MH 1Q82H 1H7MA 3RA5A 1VQPF 1GZ0A 2F9ZC 3LWRC 3J7AR 3OBWA 2VGMA 4LCKA 4XCQA 2OTJF 3ON1A 1ZWZA 5HY0A 1KD1H 1KC8H 3CD6F 1NJIH 1K8AH 1GO0A 3I56F 3SIVA 3RA6A 1VQ6F 3CC7F 2QA4F 5HY2A 1M1KH 1JJ2F 1T0KB 2FGYA 1VQ7F 4BVSA 1VQ4F 1X7PA 4EI7A 1IPAA 3CCQF 3SIUA 1Q81H 3HJWC 5HXZA 3CMEF 1X7OA 5G4VC 3HAXD 3FFMA 2GLZA 1XBIA 4BVTA 3GYQA 1Q86H 4BW0B 1E7KA 3IR9A 2AIFA 1YIJF 1W2BF 3NMUC 3E20B 1PXWA 3CG6A 2QEXF 1CK2A 3CPWF 3NVIB 5GINC 3CCMF 2VGNA 3N4YA 3OBYA 1KQSF 2OHWA 3CMAF 3NK6A 5A2QM 2LBXA 3JAMM 3CCSF 5HY4A 1K73H 2KTVA 1N8RH 3CC4F 4X3MA 3CCVF 1QVFF 1VQNF 3CC2F 3V7QA 3G6EF 1NMUB 1YJWF 5IT9M 3V7EA 3CCEF 3CCLF 1VQMF 1VQ5F 1SDSA 5FLXM 5GANK 5EWRA 5HXUA 3LWOC 3G4SF 3OW2F 1RA4A 2I6DA 3CCRF 2OTLF 1RLGA 1W42A 3MCAB 3CCUF 1W40A 1M90H 1YJ9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y H;  2CZW A;  2KTU A;  4C4W C;  2BO1 A;  3N4Z A;  1YI2 F;  2HVY D;  3J81 M;  3LWV C;  3I55 F;  3CPQ A;  3AGK A;  4X3L A;  2ALE A;  2FC3 A;  2QI2 A;  3PAF A;  3WXM B;  1VQ8 F;  3G71 F;  5GAP K;  5GIP C;  1VQ9 F;  2LBW A;  4BY9 D;  3O85 A;  1S72 F;  3NVK E;  5DCV A;  2KG4 A;  1VQL F;  3JCM M;  5G4U C;  1VQO F;  1YIT F;  5FJ4 C;  1QVG F;  3LFO A;  1X52 A;  5GIO C;  1CN7 A;  1W41 A;  2JNB A;  5EO3 A;  1GO1 A;  1W3E X;  1YJN F;  3PLA C;  3NK7 A;  1VQK F;  3LWQ C;  2WAL A;  3J80 M;  3E1Y A;  2OZB A;  4NUT A;  4TZZ A;  3CXC F;  3VI6 A;  1YHQ F;  1DT9 A;  3LWP C;  3VMF B;  3CCJ F;  1K9M H;  1Q82 H;  1H7M A;  3RA5 A;  1VQP F;  1GZ0 A;  3LWR C;  3J7A R;  3OBW A;  2VGM A;  4LCK A;  2OTJ F;  3ON1 A;  1ZWZ A;  1KD1 H;  1KC8 H;  3CD6 F;  1NJI H;  1K8A H;  1GO0 A;  3I56 F;  3SIV A;  3RA6 A;  1VQ6 F;  3CC7 F;  2QA4 F;  1M1K H;  1JJ2 F;  1T0K B;  1VQ7 F;  1VQ4 F;  1X7P A;  1IPA A;  3CCQ F;  3SIU A;  1Q81 H;  3HJW C;  3CME F;  1X7O A;  5G4V C;  3HAX D;  3FFM A;  1XBI A;  1Q86 H;  3GYQ A;  4BW0 B;  1E7K A;  3IR9 A;  2AIF A;  1YIJ F;  1W2B F;  3NMU C;  3E20 B;  1PXW A;  3CG6 A;  2QEX F;  1CK2 A;  3CPW F;  3NVI B;  5GIN C;  3CCM F;  2VGN A;  3N4Y A;  3OBY A;  1KQS F;  2OHW A;  3CMA F;  3NK6 A;  5A2Q M;  2LBX A;  3JAM M;  3CCS F;  1N8R H;  1K73 H;  2KTV A;  3CC4 F;  1QVF F;  4X3M A;  3CCV F;  1VQN F;  3CC2 F;  3V7Q A;  3G6E F;  1NMU B;  1YJW F;  5IT9 M;  3V7E A;  3CCE F;  3CCL F;  1VQM F;  1VQ5 F;  1SDS A;  5FLX M;  5GAN K;  5EWR A;  3LWO C;  3G4S F;  3OW2 F;  1RA4 A;  2I6D A;  3CCR F;  2OTL F;  1RLG A;  1W42 A;  3MCA B;  3CCU F;  1W40 A;  1M90 H;  1YJ9 F; 
#chains in the Genus database with same CATH topology
 5LYJ A;  2UYN B;  3N2G A;  4BT4 A;  5IYZ A;  2Z1F A;  3K0T A;  1OFU A;  4ZHQ B;  3N4Z A;  2HVY D;  4X1I B;  4TUY A;  5HP8 A;  4EI9 A;  3I55 F;  5IJ9 B;  1J7H A;  2EWC A;  3WPX A;  3R0P A;  3RYH B;  4HNA A;  3WXM B;  5JCO A;  4C81 A;  4O4H B;  3LME A;  3WJQ A;  3C9R A;  4C8E A;  3JAR B;  3MCQ A;  5GIP C;  3IKE A;  2LBW A;  4WBN A;  5CA1 B;  5HWE A;  1S72 F;  3P10 A;  3JCM M;  1VQO F;  2UYK A;  1U3L A;  5FJ4 C;  4E6E A;  1CN7 A;  1W41 A;  1GO1 A;  3VO8 A;  1W3E X;  2Z1E A;  1U3P A;  3HKC A;  5LP6 A;  3MQW A;  3RYI B;  5JQG B;  4EI8 A;  5EIB C;  5J2T B;  3J80 M;  4TZZ A;  2NMU A;  2PHN A;  5EZY A;  3WGN A;  1YHQ F;  5EAZ A;  1DT9 A;  1T0A A;  3CCJ F;  1VHA A;  5JQG A;  2HS0 A;  1VQP F;  1W5F A;  3S0W A;  3HKE A;  3ZP4 A;  1H47 A;  2ZVZ A;  4ZHW A;  4IHJ A;  3F6M A;  3FD6 A;  2G9I A;  3JAW A;  5LXT A;  5AVM A;  3DC2 A;  4X20 A;  4LCK A;  2OTJ F;  3WPW A;  3M1X A;  3VYU C;  3JAS A;  2DT4 A;  3C8L A;  3I56 F;  3RA6 A;  1VQ6 F;  2UYJ A;  1M1K H;  1JJ2 F;  2LBT A;  4X20 B;  2FGY A;  1FFX B;  3JAL B;  4BVS A;  4O4L B;  3HKD A;  3F0E A;  1FNK A;  3CCQ F;  2Q1Y A;  1X7O A;  5G4V C;  5LP6 B;  4O4J A;  5BMV A;  2GLZ A;  4B45 A;  4BVT A;  5MN6 A;  3IR9 A;  2AIF A;  2N48 A;  1W2B F;  3E20 B;  1UFY A;  3CG6 A;  1TVK A;  2CHT A;  4O4J B;  4BT7 A;  5KMG B;  3OBY A;  3N4Y A;  1KQS F;  1UI9 A;  3HKC B;  4EB6 B;  2LBX A;  5A2Q M;  3CYQ A;  1QVF F;  3F0G A;  4X3M A;  4O2A A;  4ERH A;  5LXT B;  3G6E F;  3HKB A;  2I6R A;  5ITZ A;  2ZOV A;  1COM A;  3JAR A;  1VQM F;  1VQ5 F;  1SDS A;  3B6N A;  2RHL A;  3HWU A;  3TD5 A;  5EYP A;  3OW2 F;  4DXD A;  3FD5 A;  3QTY A;  2B33 A;  1RLG A;  5JH7 A;  1YJ9 F;  4KWE A;  1W5A A;  2GZL A;  2KTU A;  5IYZ B;  2VAW A;  1YI2 F;  1IV3 A;  1YGY A;  3KJK A;  1IV2 A;  5EZY B;  3K2X A;  3IEQ A;  3K12 A;  3F0F A;  4O2B A;  4I50 B;  3AGK A;  1U43 A;  4NQ3 A;  4FFB A;  2IG8 A;  4M8I A;  3G71 F;  4X1K B;  2AIZ P;  3JAT B;  4B62 A;  4BY9 D;  4X1Y B;  2KG4 A;  3I7T A;  3N2K B;  4O4I B;  3T80 A;  4B5C A;  4BT2 A;  1YIT F;  3M84 A;  1X52 A;  4BVR A;  5GIO C;  5GON A;  1W59 A;  3D00 A;  2JNB A;  4ZOL B;  1ODE A;  3WGJ A;  5KX5 A;  4BVQ A;  2R6R 1;  4O4H A;  5EIB D;  4TV9 A;  1YJN F;  3LWQ C;  2OZB A;  2HS3 A;  2VAP A;  1XV2 A;  3GTZ A;  3VMF B;  1K9M H;  1Q82 H;  5JVD A;  1H7M A;  3RA5 A;  1RQ7 A;  3N2K A;  4O4I A;  3VIU A;  2DYY A;  3LWR C;  3J7A R;  1TUB B;  4I55 A;  2VGM A;  2CHS A;  3JAL A;  4F6R B;  3RYC B;  4ZK7 A;  2IAF A;  1KC8 H;  4I50 A;  1NJI H;  3SIV A;  3S06 A;  3K14 A;  3TD3 A;  3ZP7 A;  3RYI A;  3P4E A;  1Z5V A;  3VYT C;  1IPA A;  5B8F A;  1PF5 A;  3F0D A;  4G4V A;  4O4L A;  5KX5 B;  5HXZ A;  3HAX D;  1JN1 A;  2ZVY A;  4I4T A;  3GYQ A;  2RHJ A;  4X1Y A;  2CWJ A;  3VCZ A;  2BTU A;  3I3F A;  3CCM F;  3HTN A;  3WGL A;  4C8I A;  3CMA F;  3JAM M;  1N8R H;  1K73 H;  1SZQ A;  3CC4 F;  3FBA A;  3CC2 F;  3V7Q A;  2K1S A;  2YYE A;  1W55 A;  4IIJ A;  2GVI A;  1VQV A;  1XRG A;  2AMT A;  5CA0 A;  5FLX M;  3DDN A;  3MBM A;  4LNU A;  2R75 1;  1X25 A;  3U0O A;  1QU9 A;  3ZO8 A;  1IV1 A;  2OTM A;  5HXU A;  4R40 B;  5BMV B;  2OTL F;  1FSZ A;  1JFF A;  5IJ9 A;  5J2U A;  2BTQ B;  3RYF A;  4ZI7 B;  1Q7Y H;  2CZW A;  3JAK B;  5FNV A;  4U39 A;  4C4W C;  4G4W A;  4IHJ B;  4EB6 A;  1JFF B;  3QHD A;  3J81 M;  3LWV C;  3UT5 A;  1FNJ A;  3KIZ A;  3PAF A;  1SA0 A;  3C9T A;  1JD1 A;  1VQ9 F;  1Z5W A;  3NVK E;  5DCV A;  3KE1 A;  3GHZ A;  1VQL F;  5EYP B;  5G4U C;  4B46 A;  3N2G B;  5EO3 A;  3HKD B;  3TD4 A;  5MN4 A;  3WGK A;  5MN5 A;  5IJ0 A;  3NK7 A;  1VQK F;  2ZF8 A;  2RB9 A;  3E1Y A;  3MDO A;  1QD9 A;  1RQ2 A;  4BT5 A;  2W8B C;  4NUT A;  3WGM A;  4DRX B;  3LWP C;  4YJ3 B;  3JAK A;  3S02 A;  5CA0 B;  4ZI7 A;  5JCO C;  2HP0 B;  4YJ2 A;  4ZHV A;  4O2A B;  2QTP A;  4I55 B;  2Z1T A;  4XCQ A;  1ZWZ A;  3ON1 A;  5HY0 A;  1KD1 H;  3VOA A;  1GO0 A;  3EOR A;  2HQS C;  4PWT A;  1VH8 A;  2HX0 A;  2IQQ A;  3CC7 F;  1TVK B;  1SA0 B;  5HY2 A;  2MQE A;  3CB2 A;  4TUY B;  3VTI C;  4WBN B;  3OON A;  3KHN A;  1TUB A;  1VQ7 F;  1VQ4 F;  1X7P A;  3WJP A;  3ERN A;  4EI7 A;  3E22 A;  3RYH A;  2HP0 A;  2HRU A;  4YJ2 B;  5LA6 B;  5ITZ B;  3CME F;  1Q81 H;  3HJW C;  3FFM A;  3LDT A;  1NQ3 A;  5CA1 A;  1YIJ F;  4RQO A;  3NMU C;  2H8E A;  3P0Z A;  1PXW A;  1CK2 A;  3C9U A;  3CPW F;  3D01 A;  3ELC A;  3JAT A;  4TV9 B;  3NK6 A;  4G4X A;  5HY4 A;  2KTV A;  3L7Q A;  3CCV F;  1VQN F;  3JAW B;  1NMU B;  5HP7 A;  1YJW F;  3V7E A;  2HS4 A;  1H48 A;  1QAH A;  3CCE F;  5JH7 B;  3CCL F;  1KNJ A;  5GAN K;  2UZH A;  1XHO A;  2VAM A;  3LWO C;  3G4S F;  2UYP A;  5LOV A;  3UT5 B;  1W42 A;  5EB1 B;  2VXY A;  3S03 A;  3MCA B;  3CCU F;  1W40 A;  2HP3 A;  1M90 H;  3M4S A;  2HRY A;  5IJ0 B;  5FNV B;  5JVD B;  1JY8 A;  2BO1 A;  4LNU B;  5LA6 A;  3V3T A;  2P6Y A;  1YQN A;  4BT3 A;  3CPQ A;  3VYS C;  2RHO A;  5C8Y A;  2LCA A;  1DBF A;  4C82 A;  3CYP B;  4X3L A;  2ALE A;  2FC3 A;  2QI2 A;  1VQ8 F;  5GAP K;  2KGW A;  3VOB A;  2PMP A;  3O85 A;  3KJJ A;  5J2T A;  4O2B B;  1VK3 A;  3WJR A;  1QVG F;  3LFO A;  2YXZ A;  5HY1 A;  3IKF A;  3FPI A;  3IMP A;  3JVH A;  1ONI A;  5KMG A;  2UYN A;  3PLA C;  4ZHY B;  1RLU A;  2WAL A;  4U3J B;  4RHA A;  3CXC F;  2ZAU A;  2CW4 A;  4TV8 B;  3VI6 A;  4YJ3 A;  3JAS B;  3LYB A;  5CB4 A;  3S0H A;  3ZOP A;  3QUW A;  1GZ0 A;  2F9Z C;  1IV4 A;  5GON B;  4ZOL A;  3OBW A;  3RYF B;  3RE3 A;  2Z1U A;  5CB4 B;  3CD6 F;  3E22 B;  5C8Y B;  1K8A H;  3HKE B;  3D54 A;  3IEW A;  4FFB B;  4X1K A;  2QA4 F;  4U3J A;  1T0K B;  5EB0 A;  3Q8H A;  4F6R A;  3RYC A;  4BT6 A;  1W57 A;  2CSL A;  1R1M A;  5LYJ B;  2CVL A;  4ZHQ A;  3SIU A;  2BTO A;  2H8C A;  3ESJ A;  5LOV B;  2Z01 A;  1GX1 A;  1XBI A;  4C8G A;  1Q86 H;  4BW0 B;  1E7K A;  1W5E A;  1KNK A;  1FFX A;  3V4D A;  2V9Y A;  4HNA B;  2QEX F;  1W58 1;  1OAP A;  3NVI B;  1U40 A;  5GIN C;  2L26 A;  2VGN A;  2Q1X A;  2OHW A;  2H6L A;  4I4T B;  1Q8R A;  3CCS F;  3BYQ A;  4X1I A;  3HKB B;  4NWO B;  5IT9 M;  1W5B A;  4DRX A;  4TV8 A;  5J2U B;  5LP6 C;  4G4Z A;  2ZOD A;  5EWR A;  4G4Y A;  1RA4 A;  2I6D A;  3CCR F;  2RHH A;  4G88 A;  3S0Y A;  1CLI A;  3C9S A;  4IIJ B; 
#chains in the Genus database with same CATH homology
 1Q7Y H;  2CZW A;  2KTU A;  4C4W C;  2BO1 A;  3N4Z A;  3V3T A;  1YI2 F;  2HVY D;  4EI9 A;  3J81 M;  3LWV C;  3I55 F;  3CPQ A;  3AGK A;  4X3L A;  2ALE A;  2FC3 A;  2QI2 A;  4NQ3 A;  3PAF A;  3WXM B;  1VQ8 F;  3G71 F;  5GAP K;  5GIP C;  1VQ9 F;  2LBW A;  4BY9 D;  3O85 A;  5HWE A;  1S72 F;  3NVK E;  5DCV A;  2KG4 A;  1VQL F;  3JCM M;  5G4U C;  1VQO F;  1YIT F;  5FJ4 C;  1QVG F;  3LFO A;  1X52 A;  4BVR A;  5HY1 A;  5GIO C;  1CN7 A;  1W41 A;  2JNB A;  5EO3 A;  3D00 A;  1GO1 A;  1W3E X;  4BVQ A;  1YJN F;  3PLA C;  3NK7 A;  1VQK F;  4EI8 A;  3LWQ C;  2WAL A;  3J80 M;  3E1Y A;  2OZB A;  4NUT A;  4TZZ A;  3CXC F;  3VI6 A;  1YHQ F;  1DT9 A;  3LWP C;  3VMF B;  3CCJ F;  1K9M H;  1Q82 H;  1H7M A;  3RA5 A;  1VQP F;  1GZ0 A;  2F9Z C;  3LWR C;  3J7A R;  3OBW A;  2VGM A;  4LCK A;  4XCQ A;  2OTJ F;  3ON1 A;  1ZWZ A;  5HY0 A;  1KD1 H;  1KC8 H;  3CD6 F;  1NJI H;  1K8A H;  1GO0 A;  3I56 F;  3SIV A;  3RA6 A;  1VQ6 F;  3CC7 F;  2QA4 F;  5HY2 A;  1M1K H;  1JJ2 F;  1T0K B;  2FGY A;  1VQ7 F;  4BVS A;  1VQ4 F;  1X7P A;  4EI7 A;  1IPA A;  3CCQ F;  3SIU A;  1Q81 H;  3HJW C;  5HXZ A;  3CME F;  1X7O A;  5G4V C;  3HAX D;  3FFM A;  2GLZ A;  1XBI A;  4BVT A;  3GYQ A;  1Q86 H;  4BW0 B;  1E7K A;  3IR9 A;  2AIF A;  1YIJ F;  1W2B F;  3NMU C;  3E20 B;  1PXW A;  3CG6 A;  2QEX F;  1CK2 A;  3CPW F;  3NVI B;  5GIN C;  3CCM F;  2VGN A;  3N4Y A;  3OBY A;  1KQS F;  2OHW A;  3CMA F;  3NK6 A;  5A2Q M;  2LBX A;  3JAM M;  3CCS F;  5HY4 A;  1K73 H;  2KTV A;  1N8R H;  3CC4 F;  4X3M A;  3CCV F;  1QVF F;  1VQN F;  3CC2 F;  3V7Q A;  3G6E F;  1NMU B;  1YJW F;  5IT9 M;  3V7E A;  3CCE F;  3CCL F;  1VQM F;  1VQ5 F;  1SDS A;  5FLX M;  5GAN K;  5EWR A;  5HXU A;  3LWO C;  3G4S F;  3OW2 F;  1RA4 A;  2I6D A;  3CCR F;  2OTL F;  1RLG A;  1W42 A;  3MCA B;  3CCU F;  1W40 A;  1M90 H;  1YJ9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...