2AIFA

Crystal structure of high mobility like protein, nhp2, putative from cryptosporidium parvum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
FPLASPDLNNKIINLVQQACNYKQLRKGANEATKALNRGIAEIVLLAADAEPLEILLHLPLVCEDKNTPYVFVRSKVALGRACGVSRPVIAAAITSKDGSSLSSQITELKDQIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal protein L7A
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Dna binding protein, cytokine
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aifA00
1X7OA 3CCMF 2QA4F 1ZWZA 5FLXM 1QVFF 3NK7A 1KD1H 3G4SF 5GAPK 1VQLF 2WALA 1CK2A 3CXCF 3E1YA 5DCVA 2OTJF 2BO1A 3O85A 2KTVA 1GO1A 2QI2A 1YJNF 1N8RH 3HJWC 3PAFA 1K8AH 1VQ6F 2QEXF 1W3EX 3CCUF 5GIOC 1YJWF 3FFMA 3CMAF 1M90H 1XBIA 1KC8H 2KTUA 3IR9A 1GO0A 4X3MA 5A2QM 2LBWA 5GIPC 3NVIB 3CD6F 2OTLF 3CPQA 3MCAB 3CCVF 1CN7A 1VQ4F 1X7PA 3CCSF 1E7KA 3G6EF 2CZWA 3ON1A 5EWRA 3CCRF 2OZBA 2ALEA 4C4WC 1VQKF 1KQSF 1PXWA 3WXMB 2KG4A 3I56F 1W2BF 1YHQF 1W42A 3CC4F 1GZ0A 3I55F 3LWOC 3V7QA 2I6DA 3CPWF 1Q81H 3J7AR 3OW2F 1Q86H 1M1KH 1JJ2F 1K73H 2FC3A 1YIJF 3VMFB 3JAMM 4BW0B 3GYQA 1S72F 1YJ9F 5FJ4C 3N4YA 4BY9D 4NUTA 1SDSA 3LWVC 5EO3A 1VQPF 3LWPC 3OBYA 5GINC 2HVYD 3LWQC 3J80M 3OBWA 3CC7F 3CG6A 1K9MH 3V7EA 3CC2F 1VQ9F 1IPAA 4X3LA 1VQ8F 3HAXD 3G71F 3LWRC 3NMUC 1Q7YH 3SIVA 3AGKA 3NVKE 3RA5A 1YITF 3CCLF 1RLGA 5G4VC 3RA6A 1T0KB 5GANK 5IT9M 1X52A 3NK6A 2VGNA 1VQMF 1VQNF 2LBXA 4LCKA 2AIFA 2OHWA 1H7MA 1NJIH 5G4UC 3CMEF 2JNBA 1VQOF 1VQ7F 3CCQF 3SIUA 1NMUB 1Q82H 1VQ5F 2VGMA 1DT9A 1W41A 3VI6A 1W40A 4TZZA 3CCJF 3E20B 3LFOA 1RA4A 1YI2F 1QVGF 3PLAC 3N4ZA 3JCMM 3J81M 3CCEF
chains in the Genus database with same CATH superfamily
3CCMF 2QA4F 3F0GA 1KD1H 3JARA 3HKEA 4I55B 5GAPK 1H48A 2G9IA 5J2UB 4BVRA 4KWEA 3CXCF 1OAPA 1T0AA 4F6RA 4U3JB 5DCVA 2OTJF 2BO1A 4TV9A 4NQ3A 5LP6C 4RHAA 4ERHA 3HJWC 2VAWA 3PAFA 1W3EX 3V4DA 3FFMA 1VHAA 5JQGB 1IV2A 3JVHA 5IYZA 5JCOC 1VH8A 3ESJA 2UYJA 3E22B 4C82A 4BT7A 3IR9A 1GO0A 5A2QM 2LBWA 4M8IA 4ZHVA 3CPQA 3QTYA 2NMUA 4YJ3B 2RHHA 3FPIA 3DC2A 3IMPA 4O4LB 3G6EF 5LXTA 4BVQA 4X1YA 3JASB 2ALEA 1VQKF 1KQSF 2KG4A 3ZP7A 3VYUC 5JVDB 5EZYA 4C81A 4O2AA 3CC4F 2HRUA 3I55F 1W59A 2UYKA 3K12A 3T80A 3I7TA 5LP6A 1K73H 5CA1B 3VMFB 3GYQA 2GVIA 4O4JB 1YJ9F 3N4YA 5BMVA 4BY9D 1IV3A 3TD4A 1U40A 1W5BA 3WGKA 1SA0A 2LCAA 4EB6A 4ZHYB 3RYFB 2IAFA 3LWVC 2ZVYA 5EYPB 3LWPC 2YXZA 4IIJA 3P0ZA 2R751 5KMGB 3CG6A 1K9MH 3CC2F 4X3LA 5IJ0B 1JFFA 2P6YA 3RE3A 2AIZP 3ZP4A 1IV4A 1RLUA 3VOBA 3RYHA 2OTMA 3AGKA 4O4IA 2ZAUA 1VQVA 3V3TA 1RLGA 4O2BB 3D01A 5CA0B 5GANK 2H6LA 4DXDA 5IT9M 5GONA 3QHDA 2VGNA 4NWOB 2LBXA 2V9YA 1NJIH 3F0DA 3VYSC 1VQ7F 3CCQF 4B45A 2HP0A 5CB4A 3MQWA 2VGMA 1PF5A 4DRXA 1RQ2A 4ZHQA 4TZZA 3CCJF 3E20B 3IEQA 3PLAC 3S06A 2HS0A 2IG8A 3C9RA 3N4ZA 5B8FA 4EI7A 2CW4A 3CCEF 3FBAA 2PHNA 1X7OA 3RYCB 3JAKA 1ZWZA 5FLXM 4TV8B 4B62A 1QVFF 5ITZB 4O4HA 3JARB 2UYNA 2MQEA 3K2XA 3O85A 5KX5A 3DDNA 3JALB 3KE1A 4C8IA 2QTPA 2QEXF 5GIOC 3C9SA 5IYZB 2CVLA 3B6NA 1XBIA 5LA6B 4B5CA 3TD5A 4ZOLA 5GIPC 3F0FA 5EB0A 4ZI7A 1XHOA 3CD6F 2OTLF 2UZHA 5HXUA 2HRYA 1X7PA 1E7KA 4YJ2A 1NQ3A 4X1YB 3VOAA 4IHJB 4C4WC 3HWUA 3WXMB 4ZK7A 3JATA 5EZYB 3WJQA 1FFXA 2AMTA 2L26A 3BYQA 1GZ0A 4G4ZA 2I6DA 3CPWF 3HKBB 5J2TB 3JAMM 3HKDB 4BT3A 1IV1A 3UT5B 4EI8A 5IJ9B 4FFBA 4TUYA 4EB6B 3LYBA 5HP7A 1TVKA 3S0HA 2I6RA 2RHLA 1GX1A 3JAWB 2B33A 3IEWA 1TUBA 4G4VA 4I50B 3LWRC 4WBNA 1Q7YH 4G88A 5EIBC 1W5EA 5LOVA 3HKCB 3N2GB 3RA5A 3WGJA 3CCLF 1Z5WA 5G4VC 2FGYA 5JCOA 3CYQA 4X1KB 2HP3A 4I55A 3NK6A 4HNAB 3VO8A 3M84A 5FNVB 3MCQA 5HY0A 4U3JA 4LNUB 4BT2A 2VXYA 2JNBA 4BVTA 2YYEA 3D54A 3FD6A 2F9ZC 1H47A 4DRXB 4ZHQB 5JQGA 3VYTC 1YI2F 3K14A 2CWJA 3CYPB 3E22A 2IQQA 3WGNA 3JCMM 5EB1B 2VAMA 1ODEA 5LYJB 3ELCA 4YJ3A 3KJJA 3NK7A 3TD3A 4G4XA 4ZHWA 4O4LA 4BT4A 3G4SF 1JN1A 2KGWA 2HX0A 2Q1YA 3JASA 4X1IB 4I4TB 1CK2A 4X20B 3E1YA 2N48A 5JVDA 3R0PA 3C8LA 3M1XA 2KTVA 1GO1A 2QI2A 1YJNF 1VQ6F 2BTOA 2RHJA 3IKEA 3CCUF 4G4WA 2Z1TA 5C8YB 3KHNA 3CMAF 1M90H 5CA1A 3S0WA 2RHOA 1KC8H 3N2KB 4E6EA 4EI9A 1XRGA 2GZLA 4O4JA 2EWCA 2ZODA 3NVIB 5JH7B 3IKFA 3GHZA 5HXZA 1Q8RA 1CN7A 3D00A 3RYFA 3VCZA 5EYPA 3HKEB 5EWRA 3CCRF 2OZBA 5HY1A 1ONIA 5KMGA 4F6RB 1CLIA 5IJ0A 3I56F 2VAPA 1Z5VA 4TV9B 3M4SA 1YHQF 1YQNA 3F6MA 3RYIA 2PMPA 3J7AR 1Q86H 2H8EA 2Q1XA 1YIJF 3VTIC 1DBFA 5CA0A 5FJ4C 1JD1A 3MBMA 1FNKA 1SDSA 2CHTA 1SZQA 4G4YA 5LXTB 1TVKB 2HVYD 3J80M 1RQ7A 3OBWA 5EIBD 3P4EA 3CC7F 3V7EA 1VQ9F 3HAXD 1COMA 3LMEA 2HS3A 4O2AB 3EORA 4WBNB 2UYPA 1QAHA 3SIVA 2ZF8A 5LP6B 1KNKA 1YITF 3RYCA 5MN5A 3WPXA 1T0KB 4TV8A 2R6R1 3ERNA 3GTZA 5BMVB 5ITZA 1VK3A 1U3PA 1VQMF 1SA0B 1VQNF 1KNJA 2AIFA 2Z1UA 2OHWA 4XCQA 1H7MA 5G4UC 3JALA 1VQOF 3SIUA 4IIJB 2DT4A 1NMUB 1Q82H 2Z1EA 5HP8A 1JFFB 1W41A 3VI6A 1W40A 3C9TA 1RA4A 5LA6A 3RYHB 5HY4A 4O4IB 2CSLA 1U3LA 2BTUA 3VIUA 3ZOPA 5GONB 1VQLF 5J2UA 2WALA 1W5AA 4IHJA 3Q8HA 2W8BC 4B46A 2K1SA 3L7QA 4PWTA 3WPWA 1N8RH 2HP0B 5CB4B 1K8AH 3OONA 2ZOVA 4BVSA 1YJWF 3HKBA 5J2TA 4RQOA 2KTUA 3HKDA 2LBTA 4X3MA 3UT5A 3F0EA 3CB2A 1W5FA 5IJ9A 1XV2A 3JAKB 3MCAB 3CCVF 1VQ4F 3CCSF 2ZVZA 4O4HB 2CZWA 3ON1A 4BT6A 2CHSA 4R40B 2UYNB 1X25A 1PXWA 3JAWA 3KJKA 1W57A 1W2BF 5KX5B 4I50A 1W42A 5MN4A 1OFUA 3RYIB 3LWOC 3V7QA 1Q81H 3OW2F 1M1KH 3WJRA 3S03A 1JJ2F 2DYYA 5MN6A 3HKCA 3N2GA 2FC3A 4BW0B 1U43A 5HWEA 1S72F 3FD5A 5HY2A 1YGYA 3P10A 4X1KA 4ZOLB 4C8EA 3K0TA 4ZI7B 4HNAA 5FNVA 4NUTA 2H8CA 5EO3A 1VQPF 1R1MA 4LNUA 4YJ2B 4C8GA 3OBYA 5GINC 3LWQC 1QU9A 1IPAA 1VQ8F 1W55A 3JATB 1FFXB 3G71F 2RB9A 1FNJA 3NMUC 3WJPA 2Z01A 3NVKE 1UFYA 3WGMA 3KIZA 4O2BA 3RA6A 5LYJA 5EAZA 4BT5A 1X52A 3I3FA 3HTNA 1UI9A 4FFBB 4TUYB 4X1IA 3C9UA 4I4TA 1QD9A 4X20A 3S0YA 4LCKA 2HS4A 3CMEF 3MDOA 3ZO8A 3QUWA 2BTQB 1VQ5F 1W581 1FSZA 2GLZA 1JY8A 1DT9A 5C8YA 2Z1FA 1TUBB 3LFOA 1QVGF 3N2KA 4U39A 3WGLA 3LDTA 1J7HA 5LOVB 3U0OA 5AVMA 2HQSC 3S02A 3J81M 5JH7A
chains in the Genus database with same CATH topology
1X7OA 3CCMF 2QA4F 1ZWZA 5FLXM 1QVFF 3NK7A 1KD1H 3G4SF 5GAPK 1VQLF 2WALA 4BVRA 1CK2A 3CXCF 3E1YA 5DCVA 2OTJF 2BO1A 3O85A 2KTVA 4NQ3A 1GO1A 2QI2A 1YJNF 1N8RH 3HJWC 3PAFA 1K8AH 1VQ6F 2QEXF 1W3EX 3CCUF 4BVSA 5GIOC 1YJWF 3FFMA 3CMAF 1M90H 1XBIA 1KC8H 4EI9A 2KTUA 3IR9A 1GO0A 4X3MA 5A2QM 2LBWA 5GIPC 3NVIB 3CD6F 5HXZA 2OTLF 3CPQA 3MCAB 3CCVF 5HXUA 1CN7A 3D00A 1VQ4F 1X7PA 3CCSF 1E7KA 3G6EF 2CZWA 3ON1A 4BVQA 5EWRA 3CCRF 2OZBA 2ALEA 4C4WC 5HY1A 1VQKF 1KQSF 1PXWA 3WXMB 2KG4A 3I56F 1W2BF 1YHQF 1W42A 3CC4F 1GZ0A 3I55F 3LWOC 3V7QA 2I6DA 3CPWF 1Q81H 3J7AR 3OW2F 1Q86H 1M1KH 1JJ2F 1K73H 2FC3A 1YIJF 3VMFB 3JAMM 4BW0B 3GYQA 5HWEA 5HY2A 1YJ9F 1S72F 5FJ4C 3N4YA 4BY9D 4EI8A 4NUTA 1SDSA 3LWVC 5EO3A 1VQPF 3LWPC 3OBYA 5GINC 2HVYD 3LWQC 3J80M 3OBWA 3CC7F 3CG6A 1K9MH 3V7EA 3CC2F 1VQ9F 1IPAA 4X3LA 1VQ8F 3HAXD 3G71F 3LWRC 3NMUC 1Q7YH 3SIVA 3AGKA 3NVKE 3RA5A 1YITF 3CCLF 3V3TA 1RLGA 5G4VC 3RA6A 1T0KB 2FGYA 5GANK 5IT9M 1X52A 3NK6A 2VGNA 1VQMF 1VQNF 2LBXA 5HY0A 4LCKA 2AIFA 2OHWA 4XCQA 1H7MA 1NJIH 5G4UC 3CMEF 2JNBA 1VQOF 4BVTA 3CCQF 1VQ7F 3SIUA 1NMUB 1Q82H 1VQ5F 2GLZA 2VGMA 1DT9A 2F9ZC 1W41A 3VI6A 1W40A 4TZZA 3CCJF 3E20B 3LFOA 1RA4A 1YI2F 1QVGF 3PLAC 3N4ZA 5HY4A 4EI7A 3JCMM 3J81M 3CCEF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7O A;  3CCM F;  2QA4 F;  1ZWZ A;  5FLX M;  1QVF F;  3NK7 A;  1KD1 H;  3G4S F;  5GAP K;  1VQL F;  2WAL A;  1CK2 A;  3CXC F;  3E1Y A;  5DCV A;  2OTJ F;  2BO1 A;  3O85 A;  2KTV A;  1GO1 A;  2QI2 A;  1YJN F;  1N8R H;  3HJW C;  3PAF A;  1K8A H;  1VQ6 F;  2QEX F;  1W3E X;  3CCU F;  5GIO C;  1YJW F;  3FFM A;  3CMA F;  1M90 H;  1XBI A;  1KC8 H;  2KTU A;  3IR9 A;  1GO0 A;  4X3M A;  5A2Q M;  2LBW A;  5GIP C;  3NVI B;  3CD6 F;  2OTL F;  3CPQ A;  3MCA B;  3CCV F;  1CN7 A;  1VQ4 F;  1X7P A;  3CCS F;  1E7K A;  3G6E F;  2CZW A;  3ON1 A;  5EWR A;  3CCR F;  2OZB A;  2ALE A;  4C4W C;  1VQK F;  1KQS F;  1PXW A;  3WXM B;  2KG4 A;  3I56 F;  1W2B F;  1YHQ F;  1W42 A;  3CC4 F;  1GZ0 A;  3I55 F;  3LWO C;  3V7Q A;  2I6D A;  3CPW F;  1Q81 H;  3J7A R;  3OW2 F;  1Q86 H;  1M1K H;  1JJ2 F;  1K73 H;  2FC3 A;  1YIJ F;  3VMF B;  3JAM M;  4BW0 B;  3GYQ A;  1S72 F;  1YJ9 F;  5FJ4 C;  3N4Y A;  4BY9 D;  4NUT A;  1SDS A;  3LWV C;  5EO3 A;  1VQP F;  3LWP C;  3OBY A;  5GIN C;  2HVY D;  3LWQ C;  3J80 M;  3OBW A;  3CC7 F;  3CG6 A;  1K9M H;  3V7E A;  3CC2 F;  1VQ9 F;  1IPA A;  4X3L A;  1VQ8 F;  3HAX D;  3G71 F;  3LWR C;  3NMU C;  1Q7Y H;  3SIV A;  3AGK A;  3NVK E;  3RA5 A;  1YIT F;  3CCL F;  1RLG A;  5G4V C;  3RA6 A;  1T0K B;  5GAN K;  5IT9 M;  1X52 A;  3NK6 A;  2VGN A;  1VQM F;  1VQN F;  2LBX A;  4LCK A;  2AIF A;  2OHW A;  1H7M A;  1NJI H;  5G4U C;  3CME F;  2JNB A;  1VQO F;  1VQ7 F;  3CCQ F;  3SIU A;  1NMU B;  1Q82 H;  1VQ5 F;  2VGM A;  1DT9 A;  1W41 A;  3VI6 A;  1W40 A;  4TZZ A;  3CCJ F;  3E20 B;  3LFO A;  1RA4 A;  1YI2 F;  1QVG F;  3PLA C;  3N4Z A;  3JCM M;  3J81 M;  3CCE F; 
#chains in the Genus database with same CATH topology
 3CCM F;  2QA4 F;  3F0G A;  1KD1 H;  3JAR A;  3HKE A;  4I55 B;  5GAP K;  1H48 A;  2G9I A;  5J2U B;  4BVR A;  4KWE A;  3CXC F;  1OAP A;  1T0A A;  4F6R A;  4U3J B;  5DCV A;  2OTJ F;  2BO1 A;  4TV9 A;  4NQ3 A;  5LP6 C;  4RHA A;  4ERH A;  3HJW C;  2VAW A;  3PAF A;  1W3E X;  3V4D A;  3FFM A;  1VHA A;  5JQG B;  1IV2 A;  3JVH A;  5IYZ A;  5JCO C;  1VH8 A;  3ESJ A;  2UYJ A;  3E22 B;  4C82 A;  4BT7 A;  3IR9 A;  1GO0 A;  5A2Q M;  2LBW A;  4M8I A;  4ZHV A;  3CPQ A;  3QTY A;  2NMU A;  4YJ3 B;  2RHH A;  3FPI A;  3DC2 A;  3IMP A;  4O4L B;  3G6E F;  5LXT A;  4BVQ A;  4X1Y A;  3JAS B;  2ALE A;  1VQK F;  1KQS F;  2KG4 A;  3ZP7 A;  3VYU C;  5JVD B;  5EZY A;  4C81 A;  4O2A A;  3CC4 F;  2HRU A;  3I55 F;  1W59 A;  2UYK A;  3K12 A;  3T80 A;  3I7T A;  5LP6 A;  1K73 H;  5CA1 B;  3VMF B;  3GYQ A;  2GVI A;  4O4J B;  1YJ9 F;  3N4Y A;  5BMV A;  4BY9 D;  1IV3 A;  3TD4 A;  1U40 A;  1W5B A;  3WGK A;  1SA0 A;  2LCA A;  4EB6 A;  4ZHY B;  3RYF B;  2IAF A;  3LWV C;  2ZVY A;  5EYP B;  3LWP C;  2YXZ A;  4IIJ A;  3P0Z A;  2R75 1;  5KMG B;  3CG6 A;  1K9M H;  3CC2 F;  4X3L A;  5IJ0 B;  1JFF A;  2P6Y A;  3RE3 A;  2AIZ P;  3ZP4 A;  1IV4 A;  1RLU A;  3VOB A;  3RYH A;  2OTM A;  3AGK A;  4O4I A;  2ZAU A;  1VQV A;  3V3T A;  1RLG A;  4O2B B;  3D01 A;  5CA0 B;  5GAN K;  2H6L A;  4DXD A;  5IT9 M;  5GON A;  3QHD A;  2VGN A;  4NWO B;  2LBX A;  2V9Y A;  1NJI H;  3F0D A;  3VYS C;  1VQ7 F;  3CCQ F;  4B45 A;  2HP0 A;  5CB4 A;  3MQW A;  2VGM A;  1PF5 A;  4DRX A;  1RQ2 A;  4ZHQ A;  4TZZ A;  3CCJ F;  3E20 B;  3IEQ A;  3PLA C;  3S06 A;  2HS0 A;  2IG8 A;  3C9R A;  3N4Z A;  5B8F A;  4EI7 A;  2CW4 A;  3CCE F;  3FBA A;  2PHN A;  1X7O A;  3RYC B;  3JAK A;  1ZWZ A;  5FLX M;  4TV8 B;  4B62 A;  1QVF F;  5ITZ B;  4O4H A;  3JAR B;  2UYN A;  2MQE A;  3K2X A;  3O85 A;  5KX5 A;  3DDN A;  3JAL B;  3KE1 A;  4C8I A;  2QTP A;  2QEX F;  5GIO C;  3C9S A;  5IYZ B;  2CVL A;  3B6N A;  1XBI A;  5LA6 B;  4B5C A;  3TD5 A;  4ZOL A;  5GIP C;  3F0F A;  5EB0 A;  4ZI7 A;  1XHO A;  3CD6 F;  2OTL F;  2UZH A;  5HXU A;  2HRY A;  1X7P A;  1E7K A;  4YJ2 A;  1NQ3 A;  4X1Y B;  3VOA A;  4IHJ B;  4C4W C;  3HWU A;  3WXM B;  4ZK7 A;  3JAT A;  5EZY B;  3WJQ A;  1FFX A;  2AMT A;  2L26 A;  3BYQ A;  1GZ0 A;  4G4Z A;  2I6D A;  3CPW F;  3HKB B;  5J2T B;  3JAM M;  3HKD B;  4BT3 A;  1IV1 A;  3UT5 B;  4EI8 A;  5IJ9 B;  4FFB A;  4TUY A;  4EB6 B;  3LYB A;  5HP7 A;  1TVK A;  3S0H A;  2I6R A;  2RHL A;  1GX1 A;  3JAW B;  2B33 A;  3IEW A;  1TUB A;  4G4V A;  4I50 B;  3LWR C;  4WBN A;  1Q7Y H;  4G88 A;  5EIB C;  1W5E A;  5LOV A;  3HKC B;  3N2G B;  3RA5 A;  3WGJ A;  3CCL F;  1Z5W A;  5G4V C;  2FGY A;  5JCO A;  3CYQ A;  4X1K B;  2HP3 A;  4I55 A;  3NK6 A;  4HNA B;  3VO8 A;  3M84 A;  5FNV B;  3MCQ A;  5HY0 A;  4U3J A;  4LNU B;  4BT2 A;  2VXY A;  2JNB A;  4BVT A;  2YYE A;  3D54 A;  3FD6 A;  2F9Z C;  1H47 A;  4DRX B;  4ZHQ B;  5JQG A;  3VYT C;  1YI2 F;  3K14 A;  2CWJ A;  3CYP B;  3E22 A;  2IQQ A;  3WGN A;  3JCM M;  5EB1 B;  2VAM A;  1ODE A;  5LYJ B;  3ELC A;  4YJ3 A;  3KJJ A;  3NK7 A;  3TD3 A;  4G4X A;  4ZHW A;  4O4L A;  4BT4 A;  3G4S F;  1JN1 A;  2KGW A;  2HX0 A;  2Q1Y A;  3JAS A;  4X1I B;  4I4T B;  1CK2 A;  4X20 B;  3E1Y A;  2N48 A;  5JVD A;  3R0P A;  3C8L A;  3M1X A;  2KTV A;  1GO1 A;  2QI2 A;  1YJN F;  1VQ6 F;  2BTO A;  2RHJ A;  3IKE A;  3CCU F;  4G4W A;  2Z1T A;  5C8Y B;  3KHN A;  3CMA F;  1M90 H;  5CA1 A;  3S0W A;  2RHO A;  1KC8 H;  3N2K B;  4E6E A;  4EI9 A;  1XRG A;  2GZL A;  4O4J A;  2EWC A;  2ZOD A;  3NVI B;  5JH7 B;  3IKF A;  3GHZ A;  5HXZ A;  1Q8R A;  1CN7 A;  3D00 A;  3RYF A;  3VCZ A;  5EYP A;  3HKE B;  5EWR A;  3CCR F;  2OZB A;  5HY1 A;  1ONI A;  5KMG A;  4F6R B;  1CLI A;  5IJ0 A;  3I56 F;  2VAP A;  1Z5V A;  4TV9 B;  3M4S A;  1YHQ F;  1YQN A;  3F6M A;  3RYI A;  2PMP A;  3J7A R;  1Q86 H;  2H8E A;  2Q1X A;  1YIJ F;  3VTI C;  1DBF A;  5CA0 A;  5FJ4 C;  1JD1 A;  3MBM A;  1FNK A;  1SDS A;  2CHT A;  1SZQ A;  4G4Y A;  5LXT B;  1TVK B;  2HVY D;  3J80 M;  1RQ7 A;  3OBW A;  5EIB D;  3P4E A;  3CC7 F;  3V7E A;  1VQ9 F;  3HAX D;  1COM A;  3LME A;  2HS3 A;  4O2A B;  3EOR A;  4WBN B;  2UYP A;  1QAH A;  3SIV A;  2ZF8 A;  5LP6 B;  1KNK A;  1YIT F;  3RYC A;  5MN5 A;  3WPX A;  1T0K B;  4TV8 A;  2R6R 1;  3ERN A;  3GTZ A;  5BMV B;  5ITZ A;  1VK3 A;  1U3P A;  1VQM F;  1SA0 B;  1VQN F;  1KNJ A;  2AIF A;  2Z1U A;  2OHW A;  4XCQ A;  1H7M A;  5G4U C;  3JAL A;  1VQO F;  3SIU A;  4IIJ B;  2DT4 A;  1NMU B;  1Q82 H;  2Z1E A;  5HP8 A;  1JFF B;  1W41 A;  3VI6 A;  1W40 A;  3C9T A;  1RA4 A;  5LA6 A;  3RYH B;  5HY4 A;  4O4I B;  2CSL A;  1U3L A;  2BTU A;  3VIU A;  3ZOP A;  5GON B;  1VQL F;  5J2U A;  2WAL A;  1W5A A;  4IHJ A;  3Q8H A;  2W8B C;  4B46 A;  2K1S A;  3L7Q A;  4PWT A;  3WPW A;  1N8R H;  2HP0 B;  5CB4 B;  1K8A H;  3OON A;  2ZOV A;  4BVS A;  1YJW F;  3HKB A;  5J2T A;  4RQO A;  2KTU A;  3HKD A;  2LBT A;  4X3M A;  3UT5 A;  3F0E A;  3CB2 A;  1W5F A;  5IJ9 A;  1XV2 A;  3JAK B;  3MCA B;  3CCV F;  1VQ4 F;  3CCS F;  2ZVZ A;  4O4H B;  2CZW A;  3ON1 A;  4BT6 A;  2CHS A;  4R40 B;  2UYN B;  1X25 A;  1PXW A;  3JAW A;  3KJK A;  1W57 A;  1W2B F;  5KX5 B;  4I50 A;  1W42 A;  5MN4 A;  1OFU A;  3RYI B;  3LWO C;  3V7Q A;  1Q81 H;  3OW2 F;  1M1K H;  3WJR A;  3S03 A;  1JJ2 F;  2DYY A;  5MN6 A;  3HKC A;  3N2G A;  2FC3 A;  4BW0 B;  1U43 A;  5HWE A;  1S72 F;  3FD5 A;  5HY2 A;  1YGY A;  3P10 A;  4X1K A;  4ZOL B;  4C8E A;  3K0T A;  4ZI7 B;  4HNA A;  5FNV A;  4NUT A;  2H8C A;  5EO3 A;  1VQP F;  1R1M A;  4LNU A;  4YJ2 B;  4C8G A;  3OBY A;  5GIN C;  3LWQ C;  1QU9 A;  1IPA A;  1VQ8 F;  1W55 A;  3JAT B;  1FFX B;  3G71 F;  2RB9 A;  1FNJ A;  3NMU C;  3WJP A;  2Z01 A;  3NVK E;  1UFY A;  3WGM A;  3KIZ A;  4O2B A;  3RA6 A;  5LYJ A;  5EAZ A;  4BT5 A;  1X52 A;  3I3F A;  3HTN A;  1UI9 A;  4FFB B;  4TUY B;  4X1I A;  3C9U A;  4I4T A;  1QD9 A;  4X20 A;  3S0Y A;  4LCK A;  2HS4 A;  3CME F;  3MDO A;  3ZO8 A;  3QUW A;  2BTQ B;  1VQ5 F;  1W58 1;  1FSZ A;  2GLZ A;  1JY8 A;  1DT9 A;  5C8Y A;  2Z1F A;  1TUB B;  3LFO A;  1QVG F;  3N2K A;  4U39 A;  3WGL A;  3LDT A;  1J7H A;  5LOV B;  3U0O A;  5AVM A;  2HQS C;  3S02 A;  3J81 M;  5JH7 A; 
#chains in the Genus database with same CATH homology
 1X7O A;  3CCM F;  2QA4 F;  1ZWZ A;  5FLX M;  1QVF F;  3NK7 A;  1KD1 H;  3G4S F;  5GAP K;  1VQL F;  2WAL A;  4BVR A;  1CK2 A;  3CXC F;  3E1Y A;  5DCV A;  2OTJ F;  2BO1 A;  3O85 A;  2KTV A;  4NQ3 A;  1GO1 A;  2QI2 A;  1YJN F;  1N8R H;  3HJW C;  3PAF A;  1K8A H;  1VQ6 F;  2QEX F;  1W3E X;  3CCU F;  4BVS A;  5GIO C;  1YJW F;  3FFM A;  3CMA F;  1M90 H;  1XBI A;  1KC8 H;  4EI9 A;  2KTU A;  3IR9 A;  1GO0 A;  4X3M A;  5A2Q M;  2LBW A;  5GIP C;  3NVI B;  3CD6 F;  5HXZ A;  2OTL F;  3CPQ A;  3MCA B;  3CCV F;  5HXU A;  1CN7 A;  3D00 A;  1VQ4 F;  1X7P A;  3CCS F;  1E7K A;  3G6E F;  2CZW A;  3ON1 A;  4BVQ A;  5EWR A;  3CCR F;  2OZB A;  2ALE A;  4C4W C;  5HY1 A;  1VQK F;  1KQS F;  1PXW A;  3WXM B;  2KG4 A;  3I56 F;  1W2B F;  1YHQ F;  1W42 A;  3CC4 F;  1GZ0 A;  3I55 F;  3LWO C;  3V7Q A;  2I6D A;  3CPW F;  1Q81 H;  3J7A R;  3OW2 F;  1Q86 H;  1M1K H;  1JJ2 F;  1K73 H;  2FC3 A;  1YIJ F;  3VMF B;  3JAM M;  4BW0 B;  3GYQ A;  5HWE A;  5HY2 A;  1YJ9 F;  1S72 F;  5FJ4 C;  3N4Y A;  4BY9 D;  4EI8 A;  4NUT A;  1SDS A;  3LWV C;  5EO3 A;  1VQP F;  3LWP C;  3OBY A;  5GIN C;  2HVY D;  3LWQ C;  3J80 M;  3OBW A;  3CC7 F;  3CG6 A;  1K9M H;  3V7E A;  3CC2 F;  1VQ9 F;  1IPA A;  4X3L A;  1VQ8 F;  3HAX D;  3G71 F;  3LWR C;  3NMU C;  1Q7Y H;  3SIV A;  3AGK A;  3NVK E;  3RA5 A;  1YIT F;  3CCL F;  3V3T A;  1RLG A;  5G4V C;  3RA6 A;  1T0K B;  2FGY A;  5GAN K;  5IT9 M;  1X52 A;  3NK6 A;  2VGN A;  1VQM F;  1VQN F;  2LBX A;  5HY0 A;  4LCK A;  2AIF A;  2OHW A;  4XCQ A;  1H7M A;  1NJI H;  5G4U C;  3CME F;  2JNB A;  1VQO F;  4BVT A;  3CCQ F;  1VQ7 F;  3SIU A;  1NMU B;  1Q82 H;  1VQ5 F;  2GLZ A;  2VGM A;  1DT9 A;  2F9Z C;  1W41 A;  3VI6 A;  1W40 A;  4TZZ A;  3CCJ F;  3E20 B;  3LFO A;  1RA4 A;  1YI2 F;  1QVG F;  3PLA C;  3N4Z A;  5HY4 A;  4EI7 A;  3JCM M;  3J81 M;  3CCE F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...