2AIFA

Crystal structure of high mobility like protein, nhp2, putative from cryptosporidium parvum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
FPLASPDLNNKIINLVQQACNYKQLRKGANEATKALNRGIAEIVLLAADAEPLEILLHLPLVCEDKNTPYVFVRSKVALGRACGVSRPVIAAAITSKDGSSLSSQITELKDQIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein, cytokine
molecule keywords ribosomal protein L7A
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aifA00
1Q86H 2OTLF 2QI2A 3NK7A 3OBWA 3CC7F 3LFOA 2ALEA 3GYQA 5FLXM 1XBIA 3V7EA 3E1YA 5EO3A 1X7OA 1K8AH 2VGNA 1M90H 3MCAB 5GANK 3I55F 1ZWZA 1QVFF 4NUTA 4X3LA 1VQ9F 1GZ0A 1T0KB 2KTVA 1YJWF 1VQOF 2QA4F 2VGMA 3NVKE 2OZBA 3SIVA 1S72F 3N4YA 3CD6F 3HAXD 1CN7A 4BW0B 3LWOC 3CCEF 1W41A 1KC8H 1YI2F 5GAPK 5GINC 3LWQC 3CCQF 4LCKA 1QVGF 1VQ4F 3FFMA 3N4ZA 2CZWA 3JCMM 4X3MA 1DT9A 1GO1A 1E7KA 2KTUA 3J80M 2LBXA 5G4VC 3CCUF 1KD1H 1VQ8F 1VQNF 3O85A 1PXWA 1Q82H 1VQKF 3CPQA 3RA6A 3CC4F 3I56F 1GO0A 3CCMF 1RA4A 1VQPF 1K9MH 5FJ4C 2JNBA 1X52A 1Q7YH 2BO1A 3CMEF 3ON1A 1YITF 3G71F 1VQ7F 3LWPC 4C4WC 2FC3A 3CCJF 2OHWA 1VQ6F 3LWVC 5EWRA 3G6EF 1YIJF 3J81M 3JAMM 3CMAF 2WALA 1VQMF 1K73H 1YHQF 1RLGA 5GIOC 3G4SF 1NJIH 5GIPC 1YJNF 2KG4A 1CK2A 1X7PA 3LWRC 3CCVF 2OTJF 3AGKA 3HJWC 3J7AR 3CXCF 2AIFA 2LBWA 1NMUB 5A2QM 3SIUA 1VQLF 4BY9D 3CG6A 1SDSA 1N8RH 3E20B 3IR9A 1W2BF 3RA5A 5G4UC 1VQ5F 3NVIB 3PAFA 1KQSF 3OW2F 3CC2F 5IT9M 1YJ9F 1Q81H 1M1KH 3OBYA 2HVYD 3V7QA 1H7MA 3PLAC 3CCRF 1IPAA 3WXMB 4TZZA 3VMFB 1JJ2F 5DCVA 2I6DA 2QEXF 3CCLF 1W3EX 3VI6A 3CPWF 1W42A 3CCSF 3NMUC 1W40A 3NK6A
chains in the Genus database with same CATH superfamily
1TUBB 3OONA 3F6MA 2EWCA 2ALEA 4TV9B 1NQ3A 3E1YA 2HQSC 3RYCA 5HXZA 1SZQA 2Q1YA 2VGNA 3C9SA 5JCOC 3Q8HA 3MCAB 5GANK 2OTMA 1JFFA 1ZWZA 4NUTA 3WPWA 4O4IA 3ZOPA 3WGJA 1W55A 1GX1A 3N2GB 4IHJB 3ZP4A 4B5CA 1VQ9F 2KTVA 3KJJA 1YJWF 3RYFA 2UYPA 3HAXD 2VAWA 1PF5A 5LYJB 3JASA 3F0DA 1W41A 3JATA 4X1IA 3TD3A 3WPXA 1RQ7A 3DC2A 5GINC 3LWQC 1JY8A 4LCKA 2NMUA 2HRUA 3TD4A 5KMGA 2CHTA 3KE1A 5LA6B 3FFMA 3IMPA 4TV8A 4ERHA 1FFXA 5J2UA 1GO1A 3CYQA 1W5EA 5KX5A 1E7KA 4BVQA 2YXZA 3J80M 2Z1EA 3FBAA 3CCUF 1VQ8F 3O85A 2K1SA 2ZVYA 4X1YA 3RYIA 1GO0A 3JAKA 3CCMF 4YJ3A 2G9IA 5IYZA 3M84A 4ZHYB 2JNBA 2B33A 5LP6C 3CMEF 2DT4A 4X1KB 4B62A 4U39A 5CA1B 1TUBA 1VQ7F 4TV9A 5EWRA 4O4LB 5IJ9B 3G6EF 4DRXB 2IAFA 2WALA 2CW4A 5EZYB 2QTPA 3QTYA 1RLGA 3N2GA 1XRGA 4IHJA 3LWRC 3FPIA 1W5FA 2OTJF 4O4JB 4BT2A 2LBWA 1NMUB 3GTZA 3QHDA 5A2QM 3HTNA 5LYJA 4G4XA 1R1MA 3IR9A 5HY1A 2V9YA 2BTUA 1IV4A 2Z1TA 5LA6A 2BTOA 5HY2A 3OW2F 1M1KH 4R40B 1W5AA 4I55B 2CVLA 1H7MA 4NWOB 2IQQA 5DCVA 2HS4A 2I6DA 4M8IA 3EORA 1J7HA 3VI6A 2RHOA 3CPWF 3GHZA 4G4VA 1U43A 4X1KA 5CA1A 3CCSF 1RQ2A 1Q86H 1CLIA 3OBWA 2VXYA 4O4LA 2W8BC 3MCQA 5IJ9A 3LYBA 4DRXA 3GYQA 4C8EA 5AVMA 1SA0B 3VTIC 2H6LA 5EO3A 5EZYA 3LDTA 3JALA 2L26A 3S03A 5MN6A 1VH8A 4EB6B 1KNJA 1QVFF 1KNKA 5J2TB 4X3LA 3KIZA 4X20B 4O4JA 1U3PA 1UFYA 1VQOF 2VGMA 3NVKE 2Z1UA 3U0OA 4I4TB 5LP6B 1QD9A 3N4YA 4PWTA 3WGLA 3CD6F 4BW0B 3LWOC 1U40A 1UI9A 1X25A 4LNUB 1KC8H 3FD5A 5GAPK 4YJ2B 1QVGF 3FD6A 4B45A 3N4ZA 4I55A 4BT7A 2CZWA 3MDOA 3JCMM 3RYHB 1H47A 1JN1A 2LBXA 1Q82H 1VQKF 5EB1B 3VCZA 2KGWA 1RA4A 5C8YB 3WGNA 4BVTA 3UT5B 1IV2A 1K9MH 5BMVB 3F0GA 3T80A 2R6R1 3LWPC 2PHNA 2ZVZA 1SA0A 3JVHA 2MQEA 4IIJB 3J81M 5JQGB 3VYSC 3HKCB 4EB6A 3IKEA 3VO8A 4BT4A 1VQVA 5J2TA 2KG4A 4X20A 5LXTB 1X7PA 2ZF8A 1COMA 5HP7A 3CXCF 1XHOA 2AIFA 3D00A 4I4TA 5LP6A 4BY9D 5CA0B 3WGMA 4LNUA 4B46A 4E6EA 3E20B 2HRYA 1W2BF 1RLUA 4YJ2A 3PAFA 3CC2F 1YJ9F 1Q81H 4ZOLB 3MQWA 3RYHA 4ZHWA 3WJPA 2HVYD 4RQOA 3VOAA 1QU9A 1Z5WA 3WJRA 2RHJA 4O4HB 3PLAC 1T0AA 1XV2A 1OFUA 2GLZA 3JALB 4KWEA 3WXMB 5HXUA 5JVDB 2QEXF 3VYUC 5HWEA 5C8YA 3UT5A 1W3EX 5BMVA 5EB0A 4ZI7B 3NMUC 1W40A 3NK6A 3S0HA 5IJ0B 1QAHA 5JH7B 3NK7A 4BVSA 3C8LA 4G4YA 3LFOA 2ZOVA 4IIJA 5FLXM 1XBIA 3HKEB 4C81A 3V7EA 5B8FA 5JQGA 1X7OA 3HKCA 1VK3A 1M90H 1VHAA 1ODEA 3B6NA 3TD5A 2H8EA 1YGYA 5LXTA 3I55F 4EI9A 3I7TA 1DBFA 5HP8A 1T0KB 2IG8A 3D54A 3V3TA 3SIVA 2DYYA 5CA0A 2UZHA 3ZO8A 3HKBB 4ZK7A 3V4DA 1Q8RA 1CN7A 4BT5A 3CCEF 5HY0A 2RB9A 2Z1FA 4EI7A 3VOBA 2P6YA 2CHSA 3CCQF 4ZOLA 4DXDA 3KHNA 2RHLA 1VQ4F 3QUWA 1TVKB 2F9ZC 2I6RA 3ELCA 3K2XA 4X3MA 1ONIA 2AIZP 4O4HA 2HX0A 4EI8A 2KTUA 3S0YA 2R751 5G4VC 1VQNF 3C9TA 4NQ3A 5JVDA 3CPQA 3RA6A 5EIBC 2HP0B 2AMTA 1FSZA 3N2KB 3IKFA 3WJQA 4ZI7A 3ERNA 5IJ0A 5FJ4C 3P10A 4U3JB 3C9RA 5JH7A 2ZODA 3ON1A 1YITF 3I3FA 3S02A 2Q1XA 2UYNB 3CCJF 5LOVB 1VQ6F 3E22B 3LWVC 2LBTA 3HKEA 1FNKA 4BVRA 3R0PA 4O2BB 3CMAF 1IV1A 5JCOA 2CWJA 1YHQF 5EIBD 1W581 3S06A 1NJIH 3RE3A 1YJNF 3CYPB 3WGKA 3CCVF 3ZP7A 5CB4B 3J7AR 2CSLA 2ZAUA 3LMEA 3SIUA 3HKBA 2FGYA 2HS0A 1VQLF 3CG6A 1IV3A 2PMPA 1VQ5F 1KQSF 1TVKA 3KJKA 5ITZB 4FFBB 3VIUA 3OBYA 2VAMA 1FNJA 5GONB 3V7QA 1W5BA 3CCRF 1IPAA 2HS3A 4WBNB 4TZZA 4G4WA 2HP0A 1JJ2F 3N2KA 2UYJA 4U3JA 4BT3A 1CK2A 2OTLF 2GZLA 2QI2A 2UYNA 5LOVA 3CC7F 3E22A 2BTQB 4O2BA 2UYKA 1K8AH 3K0TA 4ZHQB 1U3LA 5CB4A 3IEQA 1GZ0A 3ESJA 4I50B 2QA4F 2OZBA 4HNAB 1S72F 3MBMA 5FNVB 3HKDB 4XCQA 1OAPA 5HY4A 4F6RB 1YI2F 3M1XA 2RHHA 5EYPB 5ITZA 4FFBA 3VYTC 2LCAA 4TUYB 3IEWA 5GONA 1DT9A 4WBNA 3JAWB 1KD1H 4C82A 3BYQA 5MN5A 4C8GA 1PXWA 1W57A 3K14A 3K12A 3CC4F 5MN4A 3I56F 5EAZA 3F0FA 1VQPF 3L7QA 3JARB 1H48A 1X52A 4O2AB 1Q7YH 2BO1A 3G71F 4C8IA 4C4WC 2Z01A 2FC3A 2N48A 2H8CA 2OHWA 4G88A 2YYEA 4G4ZA 1YQNA 1YIJF 3HWUA 3JAMM 4ZHQA 1VQMF 3DDNA 3RYCB 1K73H 5GIOC 3G4SF 5GIPC 4BT6A 1JFFB 4I50A 4O4IB 3AGKA 3HJWC 4HNAA 5FNVA 3HKDA 3RYFB 4RHAA 1SDSA 1N8RH 4F6RA 3CB2A 3JASB 3JATB 5EYPA 3RA5A 5G4UC 3NVIB 3D01A 4X1IB 5IT9M 1JD1A 4TUYA 2GVIA 3C9UA 4ZHVA 5KMGB 3P0ZA 4TV8B 1FFXB 3JAWA 5J2UB 5KX5B 1W59A 3VMFB 2HP3A 2VAPA 3S0WA 1Z5VA 4X1YB 3RYIB 3CCLF 3JAKB 3M4SA 3JARA 4YJ3B 4O2AA 3F0EA 3P4EA 1W42A 5IYZB
chains in the Genus database with same CATH topology
1Q86H 2OTLF 2QI2A 3NK7A 4BVSA 3OBWA 3CC7F 3LFOA 2ALEA 3GYQA 5FLXM 1XBIA 3V7EA 3E1YA 5EO3A 1X7OA 5HXZA 1K8AH 2VGNA 1M90H 3MCAB 5GANK 3I55F 1ZWZA 4EI9A 4NUTA 1QVFF 4X3LA 1VQ9F 1GZ0A 1T0KB 2KTVA 1YJWF 1VQOF 2QA4F 2VGMA 3NVKE 2OZBA 3V3TA 3SIVA 1S72F 3N4YA 3CD6F 3HAXD 1CN7A 4BW0B 3LWOC 3CCEF 4XCQA 1W41A 5HY0A 1KC8H 5HY4A 4EI7A 1YI2F 5GAPK 5GINC 3LWQC 3CCQF 4LCKA 1QVGF 1VQ4F 2F9ZC 3FFMA 3N4ZA 2CZWA 3JCMM 4X3MA 1DT9A 1GO1A 1E7KA 4EI8A 2KTUA 4BVQA 3J80M 2LBXA 5G4VC 3CCUF 1KD1H 1VQ8F 1VQNF 3O85A 4NQ3A 1PXWA 1Q82H 1VQKF 3CPQA 3RA6A 3CC4F 3I56F 1GO0A 3CCMF 1RA4A 4BVTA 1VQPF 1K9MH 5FJ4C 2JNBA 1X52A 1Q7YH 2BO1A 3CMEF 3ON1A 1YITF 3G71F 1VQ7F 3LWPC 4C4WC 2FC3A 3CCJF 2OHWA 1VQ6F 3LWVC 5EWRA 4BVRA 3G6EF 1YIJF 3J81M 3JAMM 3CMAF 2WALA 1VQMF 1K73H 1YHQF 1RLGA 5GIOC 3G4SF 1NJIH 5GIPC 1YJNF 2KG4A 1CK2A 1X7PA 3LWRC 3CCVF 2OTJF 3AGKA 3HJWC 3J7AR 3CXCF 2AIFA 3D00A 2LBWA 1NMUB 5A2QM 3SIUA 2FGYA 1VQLF 4BY9D 3CG6A 1SDSA 1N8RH 3E20B 3IR9A 5HY1A 1W2BF 3RA5A 5G4UC 1VQ5F 3NVIB 3PAFA 1KQSF 3OW2F 5HY2A 3CC2F 5IT9M 1YJ9F 1Q81H 1M1KH 3OBYA 2HVYD 3V7QA 1H7MA 3PLAC 3CCRF 1IPAA 2GLZA 3WXMB 5HXUA 3VMFB 4TZZA 1JJ2F 5DCVA 2I6DA 2QEXF 5HWEA 3CCLF 1W3EX 3VI6A 3CPWF 1W42A 3CCSF 3NMUC 1W40A 3NK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 H;  2OTL F;  2QI2 A;  3NK7 A;  3OBW A;  3CC7 F;  3LFO A;  2ALE A;  3GYQ A;  5FLX M;  1XBI A;  3V7E A;  3E1Y A;  5EO3 A;  1X7O A;  1K8A H;  2VGN A;  1M90 H;  3MCA B;  5GAN K;  3I55 F;  1ZWZ A;  1QVF F;  4NUT A;  4X3L A;  1VQ9 F;  1GZ0 A;  1T0K B;  2KTV A;  1YJW F;  1VQO F;  2QA4 F;  2VGM A;  3NVK E;  2OZB A;  3SIV A;  1S72 F;  3N4Y A;  3CD6 F;  3HAX D;  1CN7 A;  4BW0 B;  3LWO C;  3CCE F;  1W41 A;  1KC8 H;  1YI2 F;  5GAP K;  5GIN C;  3LWQ C;  3CCQ F;  4LCK A;  1QVG F;  1VQ4 F;  3FFM A;  3N4Z A;  2CZW A;  3JCM M;  4X3M A;  1DT9 A;  1GO1 A;  1E7K A;  2KTU A;  3J80 M;  2LBX A;  5G4V C;  3CCU F;  1KD1 H;  1VQ8 F;  1VQN F;  3O85 A;  1PXW A;  1Q82 H;  1VQK F;  3CPQ A;  3RA6 A;  3CC4 F;  3I56 F;  1GO0 A;  3CCM F;  1RA4 A;  1VQP F;  1K9M H;  5FJ4 C;  2JNB A;  1X52 A;  1Q7Y H;  2BO1 A;  3CME F;  3ON1 A;  1YIT F;  3G71 F;  1VQ7 F;  3LWP C;  4C4W C;  2FC3 A;  3CCJ F;  2OHW A;  1VQ6 F;  3LWV C;  5EWR A;  3G6E F;  1YIJ F;  3J81 M;  3JAM M;  3CMA F;  2WAL A;  1VQM F;  1K73 H;  1YHQ F;  1RLG A;  5GIO C;  3G4S F;  1NJI H;  5GIP C;  1YJN F;  2KG4 A;  1CK2 A;  1X7P A;  3LWR C;  3CCV F;  2OTJ F;  3AGK A;  3HJW C;  3J7A R;  3CXC F;  2AIF A;  2LBW A;  1NMU B;  5A2Q M;  3SIU A;  1VQL F;  4BY9 D;  3CG6 A;  1SDS A;  1N8R H;  3E20 B;  3IR9 A;  1W2B F;  3RA5 A;  5G4U C;  1VQ5 F;  3NVI B;  3PAF A;  1KQS F;  3OW2 F;  3CC2 F;  5IT9 M;  1YJ9 F;  1Q81 H;  1M1K H;  3OBY A;  2HVY D;  3V7Q A;  1H7M A;  3PLA C;  3CCR F;  1IPA A;  3WXM B;  4TZZ A;  3VMF B;  1JJ2 F;  5DCV A;  2I6D A;  2QEX F;  3CCL F;  1W3E X;  3VI6 A;  3CPW F;  1W42 A;  3CCS F;  3NMU C;  1W40 A;  3NK6 A; 
#chains in the Genus database with same CATH topology
 1TUB B;  3OON A;  3F6M A;  2EWC A;  2ALE A;  4TV9 B;  1NQ3 A;  3E1Y A;  2HQS C;  3RYC A;  5HXZ A;  1SZQ A;  2Q1Y A;  2VGN A;  3C9S A;  5JCO C;  3Q8H A;  3MCA B;  5GAN K;  2OTM A;  1JFF A;  1ZWZ A;  4NUT A;  3WPW A;  4O4I A;  3ZOP A;  3WGJ A;  1W55 A;  1GX1 A;  3N2G B;  4IHJ B;  3ZP4 A;  4B5C A;  1VQ9 F;  2KTV A;  3KJJ A;  1YJW F;  3RYF A;  2UYP A;  3HAX D;  2VAW A;  1PF5 A;  5LYJ B;  3JAS A;  3F0D A;  1W41 A;  3JAT A;  4X1I A;  3TD3 A;  3WPX A;  1RQ7 A;  3DC2 A;  5GIN C;  3LWQ C;  1JY8 A;  4LCK A;  2NMU A;  2HRU A;  3TD4 A;  5KMG A;  2CHT A;  3KE1 A;  5LA6 B;  3FFM A;  3IMP A;  4TV8 A;  4ERH A;  1FFX A;  5J2U A;  1GO1 A;  3CYQ A;  1W5E A;  5KX5 A;  1E7K A;  4BVQ A;  2YXZ A;  3J80 M;  2Z1E A;  3FBA A;  3CCU F;  1VQ8 F;  3O85 A;  2K1S A;  2ZVY A;  4X1Y A;  3RYI A;  1GO0 A;  3JAK A;  3CCM F;  4YJ3 A;  2G9I A;  5IYZ A;  3M84 A;  4ZHY B;  2JNB A;  2B33 A;  5LP6 C;  3CME F;  2DT4 A;  4X1K B;  4B62 A;  4U39 A;  5CA1 B;  1TUB A;  1VQ7 F;  4TV9 A;  5EWR A;  4O4L B;  5IJ9 B;  3G6E F;  4DRX B;  2IAF A;  2WAL A;  2CW4 A;  5EZY B;  2QTP A;  3QTY A;  1RLG A;  3N2G A;  1XRG A;  4IHJ A;  3LWR C;  3FPI A;  1W5F A;  2OTJ F;  4O4J B;  4BT2 A;  2LBW A;  1NMU B;  3GTZ A;  3QHD A;  5A2Q M;  3HTN A;  5LYJ A;  4G4X A;  1R1M A;  3IR9 A;  5HY1 A;  2V9Y A;  2BTU A;  1IV4 A;  2Z1T A;  5LA6 A;  2BTO A;  5HY2 A;  3OW2 F;  1M1K H;  4R40 B;  1W5A A;  4I55 B;  2CVL A;  1H7M A;  4NWO B;  2IQQ A;  5DCV A;  2HS4 A;  2I6D A;  4M8I A;  3EOR A;  1J7H A;  3VI6 A;  2RHO A;  3CPW F;  3GHZ A;  4G4V A;  1U43 A;  4X1K A;  5CA1 A;  3CCS F;  1RQ2 A;  1Q86 H;  1CLI A;  3OBW A;  2VXY A;  4O4L A;  2W8B C;  3MCQ A;  5IJ9 A;  3LYB A;  4DRX A;  3GYQ A;  4C8E A;  5AVM A;  1SA0 B;  3VTI C;  2H6L A;  5EO3 A;  5EZY A;  3LDT A;  3JAL A;  2L26 A;  3S03 A;  5MN6 A;  1VH8 A;  4EB6 B;  1KNJ A;  1QVF F;  1KNK A;  5J2T B;  4X3L A;  3KIZ A;  4X20 B;  4O4J A;  1U3P A;  1UFY A;  1VQO F;  2VGM A;  3NVK E;  2Z1U A;  3U0O A;  4I4T B;  5LP6 B;  1QD9 A;  3N4Y A;  4PWT A;  3WGL A;  3CD6 F;  4BW0 B;  3LWO C;  1U40 A;  1UI9 A;  1X25 A;  4LNU B;  1KC8 H;  3FD5 A;  5GAP K;  4YJ2 B;  1QVG F;  3FD6 A;  4B45 A;  3N4Z A;  4I55 A;  4BT7 A;  2CZW A;  3MDO A;  3JCM M;  3RYH B;  1H47 A;  1JN1 A;  2LBX A;  1Q82 H;  1VQK F;  5EB1 B;  3VCZ A;  2KGW A;  1RA4 A;  5C8Y B;  3WGN A;  4BVT A;  3UT5 B;  1IV2 A;  1K9M H;  5BMV B;  3F0G A;  3T80 A;  2R6R 1;  3LWP C;  2PHN A;  2ZVZ A;  1SA0 A;  3JVH A;  2MQE A;  4IIJ B;  3J81 M;  5JQG B;  3VYS C;  3HKC B;  4EB6 A;  3IKE A;  3VO8 A;  4BT4 A;  1VQV A;  5J2T A;  2KG4 A;  4X20 A;  5LXT B;  1X7P A;  2ZF8 A;  1COM A;  5HP7 A;  3CXC F;  1XHO A;  2AIF A;  3D00 A;  4I4T A;  5LP6 A;  4BY9 D;  5CA0 B;  3WGM A;  4LNU A;  4B46 A;  4E6E A;  3E20 B;  2HRY A;  1W2B F;  1RLU A;  4YJ2 A;  3PAF A;  3CC2 F;  1YJ9 F;  1Q81 H;  4ZOL B;  3MQW A;  3RYH A;  4ZHW A;  3WJP A;  2HVY D;  4RQO A;  3VOA A;  1QU9 A;  1Z5W A;  3WJR A;  2RHJ A;  4O4H B;  3PLA C;  1T0A A;  1XV2 A;  1OFU A;  2GLZ A;  3JAL B;  4KWE A;  3WXM B;  5HXU A;  5JVD B;  2QEX F;  3VYU C;  5HWE A;  5C8Y A;  3UT5 A;  1W3E X;  5BMV A;  5EB0 A;  4ZI7 B;  3NMU C;  1W40 A;  3NK6 A;  3S0H A;  5IJ0 B;  1QAH A;  5JH7 B;  3NK7 A;  4BVS A;  3C8L A;  4G4Y A;  3LFO A;  2ZOV A;  4IIJ A;  5FLX M;  1XBI A;  3HKE B;  4C81 A;  3V7E A;  5B8F A;  5JQG A;  1X7O A;  3HKC A;  1VK3 A;  1M90 H;  1VHA A;  1ODE A;  3B6N A;  3TD5 A;  2H8E A;  1YGY A;  5LXT A;  3I55 F;  4EI9 A;  3I7T A;  1DBF A;  5HP8 A;  1T0K B;  2IG8 A;  3D54 A;  3V3T A;  3SIV A;  2DYY A;  5CA0 A;  2UZH A;  3ZO8 A;  3HKB B;  4ZK7 A;  3V4D A;  1Q8R A;  1CN7 A;  4BT5 A;  3CCE F;  5HY0 A;  2RB9 A;  2Z1F A;  4EI7 A;  3VOB A;  2P6Y A;  2CHS A;  3CCQ F;  4ZOL A;  4DXD A;  3KHN A;  2RHL A;  1VQ4 F;  3QUW A;  1TVK B;  2F9Z C;  2I6R A;  3ELC A;  3K2X A;  4X3M A;  1ONI A;  2AIZ P;  4O4H A;  2HX0 A;  4EI8 A;  2KTU A;  3S0Y A;  2R75 1;  5G4V C;  1VQN F;  3C9T A;  4NQ3 A;  5JVD A;  3CPQ A;  3RA6 A;  5EIB C;  2HP0 B;  2AMT A;  1FSZ A;  3N2K B;  3IKF A;  3WJQ A;  4ZI7 A;  3ERN A;  5IJ0 A;  5FJ4 C;  3P10 A;  4U3J B;  3C9R A;  5JH7 A;  2ZOD A;  3ON1 A;  1YIT F;  3I3F A;  3S02 A;  2Q1X A;  2UYN B;  3CCJ F;  5LOV B;  1VQ6 F;  3E22 B;  3LWV C;  2LBT A;  3HKE A;  1FNK A;  4BVR A;  3R0P A;  4O2B B;  3CMA F;  1IV1 A;  5JCO A;  2CWJ A;  1YHQ F;  5EIB D;  1W58 1;  3S06 A;  1NJI H;  3RE3 A;  1YJN F;  3CYP B;  3WGK A;  3CCV F;  3ZP7 A;  5CB4 B;  3J7A R;  2CSL A;  2ZAU A;  3LME A;  3SIU A;  3HKB A;  2FGY A;  2HS0 A;  1VQL F;  3CG6 A;  1IV3 A;  2PMP A;  1VQ5 F;  1KQS F;  1TVK A;  3KJK A;  5ITZ B;  4FFB B;  3VIU A;  3OBY A;  2VAM A;  1FNJ A;  5GON B;  3V7Q A;  1W5B A;  3CCR F;  1IPA A;  2HS3 A;  4WBN B;  4TZZ A;  4G4W A;  2HP0 A;  1JJ2 F;  3N2K A;  2UYJ A;  4U3J A;  4BT3 A;  1CK2 A;  2OTL F;  2GZL A;  2QI2 A;  2UYN A;  5LOV A;  3CC7 F;  3E22 A;  2BTQ B;  4O2B A;  2UYK A;  1K8A H;  3K0T A;  4ZHQ B;  1U3L A;  5CB4 A;  3IEQ A;  1GZ0 A;  3ESJ A;  4I50 B;  2QA4 F;  2OZB A;  4HNA B;  1S72 F;  3MBM A;  5FNV B;  3HKD B;  4XCQ A;  1OAP A;  5HY4 A;  4F6R B;  1YI2 F;  3M1X A;  2RHH A;  5EYP B;  5ITZ A;  4FFB A;  3VYT C;  2LCA A;  4TUY B;  3IEW A;  5GON A;  1DT9 A;  4WBN A;  3JAW B;  1KD1 H;  4C82 A;  3BYQ A;  5MN5 A;  4C8G A;  1PXW A;  1W57 A;  3K14 A;  3K12 A;  3CC4 F;  5MN4 A;  3I56 F;  5EAZ A;  3F0F A;  1VQP F;  3L7Q A;  3JAR B;  1H48 A;  1X52 A;  4O2A B;  1Q7Y H;  2BO1 A;  3G71 F;  4C8I A;  4C4W C;  2Z01 A;  2FC3 A;  2N48 A;  2H8C A;  2OHW A;  4G88 A;  2YYE A;  4G4Z A;  1YQN A;  1YIJ F;  3HWU A;  3JAM M;  4ZHQ A;  1VQM F;  3DDN A;  3RYC B;  1K73 H;  5GIO C;  3G4S F;  5GIP C;  4BT6 A;  1JFF B;  4I50 A;  4O4I B;  3AGK A;  3HJW C;  4HNA A;  5FNV A;  3HKD A;  3RYF B;  4RHA A;  1SDS A;  1N8R H;  4F6R A;  3CB2 A;  3JAS B;  3JAT B;  5EYP A;  3RA5 A;  5G4U C;  3NVI B;  3D01 A;  4X1I B;  5IT9 M;  1JD1 A;  4TUY A;  2GVI A;  3C9U A;  4ZHV A;  5KMG B;  3P0Z A;  4TV8 B;  1FFX B;  3JAW A;  5J2U B;  5KX5 B;  1W59 A;  3VMF B;  2HP3 A;  2VAP A;  3S0W A;  1Z5V A;  4X1Y B;  3RYI B;  3CCL F;  3JAK B;  3M4S A;  3JAR A;  4YJ3 B;  4O2A A;  3F0E A;  3P4E A;  1W42 A;  5IYZ B; 
#chains in the Genus database with same CATH homology
 1Q86 H;  2OTL F;  2QI2 A;  3NK7 A;  4BVS A;  3OBW A;  3CC7 F;  3LFO A;  2ALE A;  3GYQ A;  5FLX M;  1XBI A;  3V7E A;  3E1Y A;  5EO3 A;  1X7O A;  5HXZ A;  1K8A H;  2VGN A;  1M90 H;  3MCA B;  5GAN K;  3I55 F;  1ZWZ A;  4EI9 A;  4NUT A;  1QVF F;  4X3L A;  1VQ9 F;  1GZ0 A;  1T0K B;  2KTV A;  1YJW F;  1VQO F;  2QA4 F;  2VGM A;  3NVK E;  2OZB A;  3V3T A;  3SIV A;  1S72 F;  3N4Y A;  3CD6 F;  3HAX D;  1CN7 A;  4BW0 B;  3LWO C;  3CCE F;  4XCQ A;  1W41 A;  5HY0 A;  1KC8 H;  5HY4 A;  4EI7 A;  1YI2 F;  5GAP K;  5GIN C;  3LWQ C;  3CCQ F;  4LCK A;  1QVG F;  1VQ4 F;  2F9Z C;  3FFM A;  3N4Z A;  2CZW A;  3JCM M;  4X3M A;  1DT9 A;  1GO1 A;  1E7K A;  4EI8 A;  2KTU A;  4BVQ A;  3J80 M;  2LBX A;  5G4V C;  3CCU F;  1KD1 H;  1VQ8 F;  1VQN F;  3O85 A;  4NQ3 A;  1PXW A;  1Q82 H;  1VQK F;  3CPQ A;  3RA6 A;  3CC4 F;  3I56 F;  1GO0 A;  3CCM F;  1RA4 A;  4BVT A;  1VQP F;  1K9M H;  5FJ4 C;  2JNB A;  1X52 A;  1Q7Y H;  2BO1 A;  3CME F;  3ON1 A;  1YIT F;  3G71 F;  1VQ7 F;  3LWP C;  4C4W C;  2FC3 A;  3CCJ F;  2OHW A;  1VQ6 F;  3LWV C;  5EWR A;  4BVR A;  3G6E F;  1YIJ F;  3J81 M;  3JAM M;  3CMA F;  2WAL A;  1VQM F;  1K73 H;  1YHQ F;  1RLG A;  5GIO C;  3G4S F;  1NJI H;  5GIP C;  1YJN F;  2KG4 A;  1CK2 A;  1X7P A;  3LWR C;  3CCV F;  2OTJ F;  3AGK A;  3HJW C;  3J7A R;  3CXC F;  2AIF A;  3D00 A;  2LBW A;  1NMU B;  5A2Q M;  3SIU A;  2FGY A;  1VQL F;  4BY9 D;  3CG6 A;  1SDS A;  1N8R H;  3E20 B;  3IR9 A;  5HY1 A;  1W2B F;  3RA5 A;  5G4U C;  1VQ5 F;  3NVI B;  3PAF A;  1KQS F;  3OW2 F;  5HY2 A;  3CC2 F;  5IT9 M;  1YJ9 F;  1Q81 H;  1M1K H;  3OBY A;  2HVY D;  3V7Q A;  1H7M A;  3PLA C;  3CCR F;  1IPA A;  2GLZ A;  3WXM B;  5HXU A;  3VMF B;  4TZZ A;  1JJ2 F;  5DCV A;  2I6D A;  2QEX F;  5HWE A;  3CCL F;  1W3E X;  3VI6 A;  3CPW F;  1W42 A;  3CCS F;  3NMU C;  1W40 A;  3NK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...