2AIFA

Crystal structure of high mobility like protein, nhp2, putative from cryptosporidium parvum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
FPLASPDLNNKIINLVQQACNYKQLRKGANEATKALNRGIAEIVLLAADAEPLEILLHLPLVCEDKNTPYVFVRSKVALGRACGVSRPVIAAAITSKDGSSLSSQITELKDQIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal protein L7A
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Dna binding protein, cytokine
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2aifA00
5GIPC 5G4UC 1CK2A 3MCAB 5EWRA 2HVYD 1GO1A 1S72F 3HAXD 5GAPK 4BY9D 3CCJF 2JNBA 3OBYA 3CMAF 3CC2F 1QVGF 3CCSF 1W41A 3CCVF 2WALA 3CPQA 1X7OA 1GO0A 1W42A 1VQLF 1VQ6F 1VQ4F 5FJ4C 2ALEA 1Q81H 1PXWA 3VI6A 3JAMM 1VQ5F 3CCLF 2KG4A 2OZBA 5GIOC 3LWPC 1VQOF 1YHQF 3NVKE 2OHWA 2VGNA 3LWVC 1VQ9F 4TZZA 3NMUC 3O85A 3I55F 2QI2A 1RLGA 1DT9A 3G71F 2I6DA 4BW0B 1NMUB 5GANK 2QA4F 3WXMB 1X7PA 1YITF 1ZWZA 3CCQF 1E7KA 3CCMF 3GYQA 1KQSF 3LWQC 1CN7A 1K8AH 1K9MH 3CPWF 1GZ0A 5FLXM 1X52A 2AIFA 1H7MA 3N4ZA 3OBWA 1VQNF 2KTUA 3FFMA 5A2QM 3LWRC 3NVIB 1VQMF 2FC3A 3G4SF 3VMFB 3AGKA 1KD1H 5G4VC 5EO3A 3NK7A 3J80M 1M1KH 3I56F 3LWOC 3HJWC 1IPAA 1YJ9F 3CD6F 3RA6A 1Q7YH 1VQ7F 1QVFF 3CC7F 2LBXA 3LFOA 1YIJF 3CC4F 1KC8H 3PLAC 1RA4A 3JCMM 1W3EX 1VQKF 3CCUF 3N4YA 5IT9M 3OW2F 1Q86H 1VQ8F 3V7EA 4LCKA 1YJWF 2VGMA 3SIUA 1NJIH 1YI2F 2OTJF 2QEXF 3J7AR 2OTLF 3E20B 3NK6A 1W40A 3J81M 1VQPF 3IR9A 1JJ2F 4NUTA 2LBWA 1M90H 5DCVA 1YJNF 1Q82H 4X3MA 3CXCF 1W2BF 4C4WC 1XBIA 2KTVA 3PAFA 3RA5A 1K73H 1T0KB 3SIVA 3V7QA 1SDSA 2CZWA 3CMEF 3CG6A 3CCRF 3CCEF 5GINC 4X3LA 1N8RH 3E1YA 3G6EF 3ON1A 2BO1A
chains in the Genus database with same CATH superfamily
1RQ2A 4YJ3A 3CB2A 2CWJA 2OTMA 5EWRA 2HVYD 3VCZA 5J2TA 3CC2F 1YGYA 3V4DA 3RYIB 5EIBC 3CCVF 4WBNB 3S0YA 1VH8A 3I3FA 3CPQA 1X7OA 1TVKB 5LP6C 4FFBA 1CLIA 4U3JA 5EYPA 4I4TB 2IQQA 3KJJA 3N2KB 3VI6A 2K1SA 2ZVYA 2KGWA 3CCLF 1VQOF 3LWPC 3B6NA 4TV8B 1VQ9F 4TZZA 4X1YB 3O85A 5BMVA 3I55F 1JD1A 4F6RB 5LA6B 5EZYB 2QI2A 3JAWB 4ZHVA 1DT9A 5HY1A 3C9UA 5JH7A 3GTZA 4BW0B 1NMUB 3JAKA 3FPIA 3N2GA 4DRXA 4TV9B 4ZI7B 3K12A 3F0DA 5J2UA 2BTUA 5HY2A 1K9MH 1IV3A 3S0WA 3M84A 1H7MA 3F0FA 3K0TA 2Z1TA 1Z5VA 4O4JB 3LWRC 3JASA 4YJ2B 1VQMF 5AVMA 3VMFB 2VAMA 5EB1B 1KD1H 2YYEA 3J80M 2Z1EA 1M1KH 3VTIC 4TUYB 3HJWC 1IPAA 1H48A 2QTPA 5IYZB 2HX0A 4ZHQB 2HP0B 3QTYA 2LBXA 3LFOA 2LCAA 5ITZB 1FNJA 1SA0A 2GLZA 1VQKF 5IT9M 3N4YA 3VOAA 2R6R1 1VQ8F 2ZOVA 4ZK7A 3HTNA 1YJWF 1W59A 5LOVB 2CW4A 4ERHA 4YJ3B 4X1IA 2QEXF 1JFFA 3D54A 2NMUA 3J7AR 3NK6A 1QU9A 1VQPF 2Z01A 5J2TB 3M4SA 4G4YA 1Q82H 3F6MA 5HWEA 4EB6A 3HKCA 4FFBB 1T0KB 3SIVA 3JARA 2HRUA 4U3JB 4C8GA 5EYPB 3HKBA 3WJPA 3VIUA 1QD9A 1KNJA 5HP7A 2AIZP 1XHOA 1R1MA 4M8IA 2RHLA 4C81A 5G4UC 2RHHA 5GONA 3T80A 4BT3A 3MCAB 2RHOA 1S72F 4BY9D 3ESJA 5BMVB 3OBYA 1GX1A 4I50A 3CMAF 2FGYA 3L7QA 4ZHWA 3KJKA 1IV4A 4HNAA 4O4HA 1FFXA 3JAKB 5FJ4C 3N2GB 4DRXB 5LXTA 1W57A 5HY0A 5J2UB 1W55A 5EB0A 1VQ5F 2KG4A 1U40A 1YHQF 3NVKE 1UFYA 5EIBD 2OHWA 3WGMA 3JASB 2VGNA 4O4IA 3WJRA 2P6YA 5C8YA 3S0HA 5JCOA 4O2AA 4BT4A 3G71F 4EI8A 4B46A 1VQVA 2UYNA 2QA4F 2F9ZC 3WXMB 1H47A 1SA0B 3VYSC 4E6EA 5HY4A 5HXZA 1CN7A 2AIFA 1QAHA 3R0PA 3N4ZA 4X1IB 2I6RA 2KTUA 3IEQA 1JFFB 3C9TA 2FC3A 3BYQA 4I55A 3G4SF 3AGKA 4IHJA 4O2BA 5G4VC 3DDNA 1FSZA 3KHNA 4BVTA 1SZQA 5LP6A 3LWOC 3RA6A 3HWUA 4EB6B 4LNUA 2UZHA 1ODEA 2H8CA 3HKCB 3JARB 1U43A 3CC7F 3HKBB 4XCQA 4NQ3A 3ZP7A 1FNKA 3V7EA 3VOBA 4LCKA 5KMGA 4ZOLA 1W5EA 5GONB 3D00A 3E22A 2BTQB 3P0ZA 2R751 3J81M 2DYYA 4BT5A 4I50B 1YQNA 4HNAB 3HKDA 3S03A 4O4HB 1FFXB 1Z5WA 1W2BF 1W581 1XBIA 2KTVA 3RA5A 1K73H 5IJ0A 5FNVA 3HKEA 5MN6A 2CZWA 1T0AA 5LXTB 3CG6A 2ZVZA 1COMA 5GINC 1TUBA 2CVLA 3E1YA 3ERNA 2BO1A 3MDOA 5GIPC 3P4EA 3VYUC 4O4IB 5HP8A 2AMTA 2DT4A 3FBAA 4DXDA 5C8YB 3CCJF 1QVGF 5JQGA 2CHTA 3CCSF 4O2AB 3JVHA 2Z1UA 1GO0A 2UYNB 2HP3A 2LBTA 1VQ6F 2L26A 3C9RA 2ALEA 3KIZA 1OFUA 3KE1A 1Q81H 3JATA 3JAMM 2HS3A 3IMPA 3CYQA 3IKFA 2PMPA 2CHSA 5GIOC 5JVDA 2VAPA 3LWVC 4I55B 3C8LA 3I7TA 3QHDA 4IHJB 4O2BB 4ZHYB 3NMUC 2VXYA 5MN4A 5LP6B 3VYTC 3WGJA 3WGKA 4LNUB 4B5CA 2I6DA 2Q1YA 5JH7B 5GANK 1X7PA 2V9YA 2BTOA 1E7KA 3CCMF 3GYQA 2GZLA 2RHJA 1KQSF 5KMGB 2PHNA 3WJQA 1VHAA 4ZOLB 5FLXM 4X1KA 3OBWA 3ZOPA 3E22B 5CA1A 3FFMA 2UYKA 3EORA 3K14A 3NVIB 3IKEA 3CYPB 4RQOA 3NK7A 3WPXA 4G4ZA 3ZP4A 5CB4A 3HKDB 5B8FA 1VQ7F 1Q7YH 3CD6F 3K2XA 4IIJA 5IJ0B 5FNVB 5MN5A 3HKEB 3S02A 4BVRA 3CC4F 3RE3A 1KC8H 3PLAC 1RA4A 3LDTA 2H6LA 3CCUF 1JY8A 3OW2F 1Q86H 1TUBB 2HS4A 2UYJA 2UYPA 4RHAA 3SIUA 2OTJF 1YI2F 3IEWA 1XV2A 1ONIA 4NWOB 1JN1A 2N48A 3E20B 3V3TA 1KNKA 3FD6A 3IR9A 5JQGB 2G9IA 2GVIA 5CA0A 3RYFA 4B62A 5DCVA 4X3MA 1Q8RA 1U3PA 3CXCF 4C8IA 5LYJA 1SDSA 2ZAUA 5KX5A 2ZODA 3UT5A 2RB9A 3JATB 3CCRF 3CCEF 1VK3A 3C9SA 4X3LA 3MCQA 3ON1A 4O4LA 1X25A 1CK2A 5JVDB 3RYCA 4EI7A 4G4XA 1GO1A 4X20A 3HAXD 1DBFA 5IJ9A 5GAPK 2IAFA 3JALA 2JNBA 4BT6A 1U3LA 1W41A 1W5BA 2WALA 3RYHA 3MQWA 4EI9A 1W42A 3D01A 2CSLA 4KWEA 1VQLF 1RQ7A 1VQ4F 3U0OA 3VO8A 4BVSA 1XRGA 1PXWA 2MQEA 3S06A 4B45A 3M1XA 4X1KB 2OZBA 5CA1B 4U39A 4PWTA 1PF5A 3Q8HA 3OONA 3F0EA 5HXUA 5CB4B 2B33A 1RLGA 3QUWA 3RYIA 4IIJB 4WBNA 1IV2A 4C8EA 1OAPA 1TVKA 2W8BC 3FD5A 4R40B 4BT7A 1YITF 4I4TA 3P10A 1ZWZA 3CCQF 1UI9A 3ELCA 3LWQC 3N2KA 1K8AH 1RLUA 3CPWF 1GZ0A 1X52A 4G4VA 3ZO8A 1VQNF 1J7HA 2YXZA 1W5AA 5A2QM 2VAWA 3LYBA 4TV8A 1IV1A 3F0GA 2ZF8A 3WGNA 2H8EA 5EO3A 4X1YA 5CA0B 4F6RA 2IG8A 3RYFB 3I56F 5LA6A 5EZYA 3TD5A 3JAWA 3GHZA 5EAZA 1YJ9F 1QVFF 3WGLA 5LYJB 1YIJF 5KX5B 3UT5B 4BVQA 3JCMM 1W3EX 4TV9A 4ZI7A 2Q1XA 2Z1FA 3TD3A 4G88A 2VGMA 4O4LB 1NJIH 3RYCB 2HRYA 4O4JA 3LMEA 4X20B 5IJ9B 4YJ2A 4G4WA 2HQSC 4BT2A 2OTLF 1W40A 3JALB 1JJ2F 1NQ3A 2EWCA 4NUTA 3MBMA 2LBWA 1M90H 4TUYA 1YJNF 3RYHB 5IYZA 5JCOC 4ZHQA 4C4WC 3PAFA 2HP0A 3V7QA 2HS0A 3TD4A 5ITZA 3CMEF 4C82A 3DC2A 1W5FA 1N8RH 3G6EF 5LOVA 3WPWA
chains in the Genus database with same CATH topology
5GIPC 5G4UC 1CK2A 3MCAB 4EI7A 5EWRA 2HVYD 1GO1A 1S72F 3HAXD 5GAPK 4BY9D 3CCJF 2JNBA 3OBYA 3CMAF 3CC2F 2FGYA 1QVGF 3CCSF 1W41A 3CCVF 2WALA 4EI9A 3CPQA 1X7OA 1GO0A 1W42A 1VQLF 1VQ6F 1VQ4F 5FJ4C 4BVSA 2ALEA 5HY0A 1Q81H 1PXWA 3VI6A 3JAMM 1VQ5F 3CCLF 2KG4A 2OZBA 5GIOC 3LWPC 1VQOF 1YHQF 3NVKE 2OHWA 2VGNA 3LWVC 1VQ9F 4TZZA 3NMUC 3O85A 3I55F 5HXUA 2QI2A 1RLGA 1DT9A 5HY1A 4EI8A 3G71F 2I6DA 4BW0B 1NMUB 5GANK 2QA4F 2F9ZC 3WXMB 1X7PA 1YITF 1ZWZA 3CCQF 1E7KA 3CCMF 3GYQA 5HY4A 5HXZA 3LWQC 1KQSF 1CN7A 1K8AH 5HY2A 1K9MH 3CPWF 1GZ0A 5FLXM 1X52A 2AIFA 1H7MA 3N4ZA 3OBWA 1VQNF 2KTUA 3FFMA 5A2QM 3LWRC 3NVIB 1VQMF 2FC3A 3G4SF 3VMFB 3AGKA 1KD1H 5G4VC 5EO3A 3NK7A 3J80M 1M1KH 4BVTA 3I56F 3LWOC 3HJWC 1IPAA 1YJ9F 3CD6F 3RA6A 1Q7YH 1VQ7F 1QVFF 3CC7F 2LBXA 3LFOA 4BVRA 1YIJF 3CC4F 4XCQA 1KC8H 4NQ3A 2GLZA 4BVQA 1RA4A 3JCMM 1W3EX 3PLAC 1VQKF 3CCUF 3N4YA 5IT9M 3OW2F 1Q86H 1VQ8F 3V7EA 4LCKA 1YJWF 2VGMA 3SIUA 1NJIH 1YI2F 2OTJF 3D00A 2QEXF 3J7AR 2OTLF 3E20B 3NK6A 1W40A 3J81M 3V3TA 1VQPF 3IR9A 1JJ2F 4NUTA 2LBWA 1M90H 5DCVA 1YJNF 1Q82H 4X3MA 5HWEA 3CXCF 1W2BF 4C4WC 1XBIA 2KTVA 3PAFA 3RA5A 1K73H 1T0KB 3SIVA 3V7QA 1SDSA 2CZWA 3CMEF 3CG6A 3CCRF 3CCEF 5GINC 4X3LA 1N8RH 3E1YA 3G6EF 3ON1A 2BO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GIP C;  5G4U C;  1CK2 A;  3MCA B;  5EWR A;  2HVY D;  1GO1 A;  1S72 F;  3HAX D;  5GAP K;  4BY9 D;  3CCJ F;  2JNB A;  3OBY A;  3CMA F;  3CC2 F;  1QVG F;  3CCS F;  1W41 A;  3CCV F;  2WAL A;  3CPQ A;  1X7O A;  1GO0 A;  1W42 A;  1VQL F;  1VQ6 F;  1VQ4 F;  5FJ4 C;  2ALE A;  1Q81 H;  1PXW A;  3VI6 A;  3JAM M;  1VQ5 F;  3CCL F;  2KG4 A;  2OZB A;  5GIO C;  3LWP C;  1VQO F;  1YHQ F;  3NVK E;  2OHW A;  2VGN A;  3LWV C;  1VQ9 F;  4TZZ A;  3NMU C;  3O85 A;  3I55 F;  2QI2 A;  1RLG A;  1DT9 A;  3G71 F;  2I6D A;  4BW0 B;  1NMU B;  5GAN K;  2QA4 F;  3WXM B;  1X7P A;  1YIT F;  1ZWZ A;  3CCQ F;  1E7K A;  3CCM F;  3GYQ A;  1KQS F;  3LWQ C;  1CN7 A;  1K8A H;  1K9M H;  3CPW F;  1GZ0 A;  5FLX M;  1X52 A;  2AIF A;  1H7M A;  3N4Z A;  3OBW A;  1VQN F;  2KTU A;  3FFM A;  5A2Q M;  3LWR C;  3NVI B;  1VQM F;  2FC3 A;  3G4S F;  3VMF B;  3AGK A;  1KD1 H;  5G4V C;  5EO3 A;  3NK7 A;  3J80 M;  1M1K H;  3I56 F;  3LWO C;  3HJW C;  1IPA A;  1YJ9 F;  3CD6 F;  3RA6 A;  1Q7Y H;  1VQ7 F;  1QVF F;  3CC7 F;  2LBX A;  3LFO A;  1YIJ F;  3CC4 F;  1KC8 H;  3PLA C;  1RA4 A;  3JCM M;  1W3E X;  1VQK F;  3CCU F;  3N4Y A;  5IT9 M;  3OW2 F;  1Q86 H;  1VQ8 F;  3V7E A;  4LCK A;  1YJW F;  2VGM A;  3SIU A;  1NJI H;  1YI2 F;  2OTJ F;  2QEX F;  3J7A R;  2OTL F;  3E20 B;  3NK6 A;  1W40 A;  3J81 M;  1VQP F;  3IR9 A;  1JJ2 F;  4NUT A;  2LBW A;  1M90 H;  5DCV A;  1YJN F;  1Q82 H;  4X3M A;  3CXC F;  1W2B F;  4C4W C;  1XBI A;  2KTV A;  3PAF A;  3RA5 A;  1K73 H;  1T0K B;  3SIV A;  3V7Q A;  1SDS A;  2CZW A;  3CME F;  3CG6 A;  3CCR F;  3CCE F;  5GIN C;  4X3L A;  1N8R H;  3E1Y A;  3G6E F;  3ON1 A;  2BO1 A; 
#chains in the Genus database with same CATH topology
 1RQ2 A;  4YJ3 A;  3CB2 A;  2CWJ A;  2OTM A;  5EWR A;  2HVY D;  3VCZ A;  5J2T A;  3CC2 F;  1YGY A;  3V4D A;  3RYI B;  5EIB C;  3CCV F;  4WBN B;  3S0Y A;  1VH8 A;  3I3F A;  3CPQ A;  1X7O A;  1TVK B;  5LP6 C;  4FFB A;  1CLI A;  4U3J A;  5EYP A;  4I4T B;  2IQQ A;  3KJJ A;  3N2K B;  3VI6 A;  2K1S A;  2ZVY A;  2KGW A;  3CCL F;  1VQO F;  3LWP C;  3B6N A;  4TV8 B;  1VQ9 F;  4TZZ A;  4X1Y B;  3O85 A;  5BMV A;  3I55 F;  1JD1 A;  4F6R B;  5LA6 B;  5EZY B;  2QI2 A;  3JAW B;  4ZHV A;  1DT9 A;  5HY1 A;  3C9U A;  5JH7 A;  3GTZ A;  4BW0 B;  1NMU B;  3JAK A;  3FPI A;  3N2G A;  4DRX A;  4TV9 B;  4ZI7 B;  3K12 A;  3F0D A;  5J2U A;  2BTU A;  5HY2 A;  1K9M H;  1IV3 A;  3S0W A;  3M84 A;  1H7M A;  3F0F A;  3K0T A;  2Z1T A;  1Z5V A;  4O4J B;  3LWR C;  3JAS A;  4YJ2 B;  1VQM F;  5AVM A;  3VMF B;  2VAM A;  5EB1 B;  1KD1 H;  2YYE A;  3J80 M;  2Z1E A;  1M1K H;  3VTI C;  4TUY B;  3HJW C;  1IPA A;  1H48 A;  2QTP A;  5IYZ B;  2HX0 A;  4ZHQ B;  2HP0 B;  3QTY A;  2LBX A;  3LFO A;  2LCA A;  5ITZ B;  1FNJ A;  1SA0 A;  2GLZ A;  1VQK F;  5IT9 M;  3N4Y A;  3VOA A;  2R6R 1;  1VQ8 F;  2ZOV A;  4ZK7 A;  3HTN A;  1YJW F;  1W59 A;  5LOV B;  2CW4 A;  4ERH A;  4YJ3 B;  4X1I A;  2QEX F;  1JFF A;  3D54 A;  2NMU A;  3J7A R;  3NK6 A;  1QU9 A;  1VQP F;  2Z01 A;  5J2T B;  3M4S A;  4G4Y A;  1Q82 H;  3F6M A;  5HWE A;  4EB6 A;  3HKC A;  4FFB B;  1T0K B;  3SIV A;  3JAR A;  2HRU A;  4U3J B;  4C8G A;  5EYP B;  3HKB A;  3WJP A;  3VIU A;  1QD9 A;  1KNJ A;  5HP7 A;  2AIZ P;  1XHO A;  1R1M A;  4M8I A;  2RHL A;  4C81 A;  5G4U C;  2RHH A;  5GON A;  3T80 A;  4BT3 A;  3MCA B;  2RHO A;  1S72 F;  4BY9 D;  3ESJ A;  5BMV B;  3OBY A;  1GX1 A;  4I50 A;  3CMA F;  2FGY A;  3L7Q A;  4ZHW A;  3KJK A;  1IV4 A;  4HNA A;  4O4H A;  1FFX A;  3JAK B;  5FJ4 C;  3N2G B;  4DRX B;  5LXT A;  1W57 A;  5HY0 A;  5J2U B;  1W55 A;  5EB0 A;  1VQ5 F;  2KG4 A;  1U40 A;  1YHQ F;  3NVK E;  1UFY A;  5EIB D;  2OHW A;  3WGM A;  3JAS B;  2VGN A;  4O4I A;  3WJR A;  2P6Y A;  5C8Y A;  3S0H A;  5JCO A;  4O2A A;  4BT4 A;  3G71 F;  4EI8 A;  4B46 A;  1VQV A;  2UYN A;  2QA4 F;  2F9Z C;  3WXM B;  1H47 A;  1SA0 B;  3VYS C;  4E6E A;  5HY4 A;  5HXZ A;  1CN7 A;  2AIF A;  1QAH A;  3R0P A;  3N4Z A;  4X1I B;  2I6R A;  2KTU A;  3IEQ A;  1JFF B;  3C9T A;  2FC3 A;  3BYQ A;  4I55 A;  3G4S F;  3AGK A;  4IHJ A;  4O2B A;  5G4V C;  3DDN A;  1FSZ A;  3KHN A;  4BVT A;  1SZQ A;  5LP6 A;  3LWO C;  3RA6 A;  3HWU A;  4EB6 B;  4LNU A;  2UZH A;  1ODE A;  2H8C A;  3HKC B;  3JAR B;  1U43 A;  3CC7 F;  3HKB B;  4XCQ A;  4NQ3 A;  3ZP7 A;  1FNK A;  3V7E A;  3VOB A;  4LCK A;  5KMG A;  4ZOL A;  1W5E A;  5GON B;  3D00 A;  3E22 A;  2BTQ B;  3P0Z A;  2R75 1;  3J81 M;  2DYY A;  4BT5 A;  4I50 B;  1YQN A;  4HNA B;  3HKD A;  3S03 A;  4O4H B;  1FFX B;  1Z5W A;  1W2B F;  1W58 1;  1XBI A;  2KTV A;  3RA5 A;  1K73 H;  5IJ0 A;  5FNV A;  3HKE A;  5MN6 A;  2CZW A;  1T0A A;  5LXT B;  3CG6 A;  2ZVZ A;  1COM A;  5GIN C;  1TUB A;  2CVL A;  3E1Y A;  3ERN A;  2BO1 A;  3MDO A;  5GIP C;  3P4E A;  3VYU C;  4O4I B;  5HP8 A;  2AMT A;  2DT4 A;  3FBA A;  4DXD A;  5C8Y B;  3CCJ F;  1QVG F;  5JQG A;  2CHT A;  3CCS F;  4O2A B;  3JVH A;  2Z1U A;  1GO0 A;  2UYN B;  2HP3 A;  2LBT A;  1VQ6 F;  2L26 A;  3C9R A;  2ALE A;  3KIZ A;  1OFU A;  3KE1 A;  1Q81 H;  3JAT A;  3JAM M;  2HS3 A;  3IMP A;  3CYQ A;  3IKF A;  2PMP A;  2CHS A;  5GIO C;  5JVD A;  2VAP A;  3LWV C;  4I55 B;  3C8L A;  3I7T A;  3QHD A;  4IHJ B;  4O2B B;  4ZHY B;  3NMU C;  2VXY A;  5MN4 A;  5LP6 B;  3VYT C;  3WGJ A;  3WGK A;  4LNU B;  4B5C A;  2I6D A;  2Q1Y A;  5JH7 B;  5GAN K;  1X7P A;  2V9Y A;  2BTO A;  1E7K A;  3CCM F;  3GYQ A;  2GZL A;  2RHJ A;  1KQS F;  5KMG B;  2PHN A;  3WJQ A;  1VHA A;  4ZOL B;  5FLX M;  4X1K A;  3OBW A;  3ZOP A;  3E22 B;  5CA1 A;  3FFM A;  2UYK A;  3EOR A;  3K14 A;  3NVI B;  3IKE A;  3CYP B;  4RQO A;  3NK7 A;  3WPX A;  4G4Z A;  3ZP4 A;  5CB4 A;  3HKD B;  5B8F A;  1VQ7 F;  1Q7Y H;  3CD6 F;  3K2X A;  4IIJ A;  5IJ0 B;  5FNV B;  5MN5 A;  3HKE B;  3S02 A;  4BVR A;  3CC4 F;  3RE3 A;  1KC8 H;  3PLA C;  1RA4 A;  3LDT A;  2H6L A;  3CCU F;  1JY8 A;  3OW2 F;  1Q86 H;  1TUB B;  2HS4 A;  2UYJ A;  2UYP A;  4RHA A;  3SIU A;  2OTJ F;  1YI2 F;  3IEW A;  1XV2 A;  1ONI A;  4NWO B;  1JN1 A;  2N48 A;  3E20 B;  3V3T A;  1KNK A;  3FD6 A;  3IR9 A;  5JQG B;  2G9I A;  2GVI A;  5CA0 A;  3RYF A;  4B62 A;  5DCV A;  4X3M A;  1Q8R A;  1U3P A;  3CXC F;  4C8I A;  5LYJ A;  1SDS A;  2ZAU A;  5KX5 A;  2ZOD A;  3UT5 A;  2RB9 A;  3JAT B;  3CCR F;  3CCE F;  1VK3 A;  3C9S A;  4X3L A;  3MCQ A;  3ON1 A;  4O4L A;  1X25 A;  1CK2 A;  5JVD B;  3RYC A;  4EI7 A;  4G4X A;  1GO1 A;  4X20 A;  3HAX D;  1DBF A;  5IJ9 A;  5GAP K;  2IAF A;  3JAL A;  2JNB A;  4BT6 A;  1U3L A;  1W41 A;  1W5B A;  2WAL A;  3RYH A;  3MQW A;  4EI9 A;  1W42 A;  3D01 A;  2CSL A;  4KWE A;  1VQL F;  1RQ7 A;  1VQ4 F;  3U0O A;  3VO8 A;  4BVS A;  1XRG A;  1PXW A;  2MQE A;  3S06 A;  4B45 A;  3M1X A;  4X1K B;  2OZB A;  5CA1 B;  4U39 A;  4PWT A;  1PF5 A;  3Q8H A;  3OON A;  3F0E A;  5HXU A;  5CB4 B;  2B33 A;  1RLG A;  3QUW A;  3RYI A;  4IIJ B;  4WBN A;  1IV2 A;  4C8E A;  1OAP A;  1TVK A;  2W8B C;  3FD5 A;  4R40 B;  4BT7 A;  1YIT F;  4I4T A;  3P10 A;  1ZWZ A;  3CCQ F;  1UI9 A;  3ELC A;  3LWQ C;  3N2K A;  1K8A H;  1RLU A;  3CPW F;  1GZ0 A;  1X52 A;  4G4V A;  3ZO8 A;  1VQN F;  1J7H A;  2YXZ A;  1W5A A;  5A2Q M;  2VAW A;  3LYB A;  4TV8 A;  1IV1 A;  3F0G A;  2ZF8 A;  3WGN A;  2H8E A;  5EO3 A;  4X1Y A;  5CA0 B;  4F6R A;  2IG8 A;  3RYF B;  3I56 F;  5LA6 A;  5EZY A;  3TD5 A;  3JAW A;  3GHZ A;  5EAZ A;  1YJ9 F;  1QVF F;  3WGL A;  5LYJ B;  1YIJ F;  5KX5 B;  3UT5 B;  4BVQ A;  3JCM M;  1W3E X;  4TV9 A;  4ZI7 A;  2Q1X A;  2Z1F A;  3TD3 A;  4G88 A;  2VGM A;  4O4L B;  1NJI H;  3RYC B;  2HRY A;  4O4J A;  3LME A;  4X20 B;  5IJ9 B;  4YJ2 A;  4G4W A;  2HQS C;  4BT2 A;  2OTL F;  1W40 A;  3JAL B;  1JJ2 F;  1NQ3 A;  2EWC A;  4NUT A;  3MBM A;  2LBW A;  1M90 H;  4TUY A;  1YJN F;  3RYH B;  5IYZ A;  5JCO C;  4ZHQ A;  4C4W C;  3PAF A;  2HP0 A;  3V7Q A;  2HS0 A;  3TD4 A;  5ITZ A;  3CME F;  4C82 A;  3DC2 A;  1W5F A;  1N8R H;  3G6E F;  5LOV A;  3WPW A; 
#chains in the Genus database with same CATH homology
 5GIP C;  5G4U C;  1CK2 A;  3MCA B;  4EI7 A;  5EWR A;  2HVY D;  1GO1 A;  1S72 F;  3HAX D;  5GAP K;  4BY9 D;  3CCJ F;  2JNB A;  3OBY A;  3CMA F;  3CC2 F;  2FGY A;  1QVG F;  3CCS F;  1W41 A;  3CCV F;  2WAL A;  4EI9 A;  3CPQ A;  1X7O A;  1GO0 A;  1W42 A;  1VQL F;  1VQ6 F;  1VQ4 F;  5FJ4 C;  4BVS A;  2ALE A;  5HY0 A;  1Q81 H;  1PXW A;  3VI6 A;  3JAM M;  1VQ5 F;  3CCL F;  2KG4 A;  2OZB A;  5GIO C;  3LWP C;  1VQO F;  1YHQ F;  3NVK E;  2OHW A;  2VGN A;  3LWV C;  1VQ9 F;  4TZZ A;  3NMU C;  3O85 A;  3I55 F;  5HXU A;  2QI2 A;  1RLG A;  1DT9 A;  5HY1 A;  4EI8 A;  3G71 F;  2I6D A;  4BW0 B;  1NMU B;  5GAN K;  2QA4 F;  2F9Z C;  3WXM B;  1X7P A;  1YIT F;  1ZWZ A;  3CCQ F;  1E7K A;  3CCM F;  3GYQ A;  5HY4 A;  5HXZ A;  3LWQ C;  1KQS F;  1CN7 A;  1K8A H;  5HY2 A;  1K9M H;  3CPW F;  1GZ0 A;  5FLX M;  1X52 A;  2AIF A;  1H7M A;  3N4Z A;  3OBW A;  1VQN F;  2KTU A;  3FFM A;  5A2Q M;  3LWR C;  3NVI B;  1VQM F;  2FC3 A;  3G4S F;  3VMF B;  3AGK A;  1KD1 H;  5G4V C;  5EO3 A;  3NK7 A;  3J80 M;  1M1K H;  4BVT A;  3I56 F;  3LWO C;  3HJW C;  1IPA A;  1YJ9 F;  3CD6 F;  3RA6 A;  1Q7Y H;  1VQ7 F;  1QVF F;  3CC7 F;  2LBX A;  3LFO A;  4BVR A;  1YIJ F;  3CC4 F;  4XCQ A;  1KC8 H;  4NQ3 A;  2GLZ A;  4BVQ A;  1RA4 A;  3JCM M;  1W3E X;  3PLA C;  1VQK F;  3CCU F;  3N4Y A;  5IT9 M;  3OW2 F;  1Q86 H;  1VQ8 F;  3V7E A;  4LCK A;  1YJW F;  2VGM A;  3SIU A;  1NJI H;  1YI2 F;  2OTJ F;  3D00 A;  2QEX F;  3J7A R;  2OTL F;  3E20 B;  3NK6 A;  1W40 A;  3J81 M;  3V3T A;  1VQP F;  3IR9 A;  1JJ2 F;  4NUT A;  2LBW A;  1M90 H;  5DCV A;  1YJN F;  1Q82 H;  4X3M A;  5HWE A;  3CXC F;  1W2B F;  4C4W C;  1XBI A;  2KTV A;  3PAF A;  3RA5 A;  1K73 H;  1T0K B;  3SIV A;  3V7Q A;  1SDS A;  2CZW A;  3CME F;  3CG6 A;  3CCR F;  3CCE F;  5GIN C;  4X3L A;  1N8R H;  3E1Y A;  3G6E F;  3ON1 A;  2BO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...