1Q8RA

Structure of e.coli rusa holliday junction resolvase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endodeoxyribonuclease rusA
publication title The structure of Escherichia coli RusA endonuclease reveals a new Holliday junction DNA binding fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination,hydrolase
total genus 29
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05866 RusA Endodeoxyribonuclease RusA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.70 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Holliday junction resolvase RusA 1q8rA00
1Q8RA 2H8EA 2H8CA
chains in the Genus database with same CATH superfamily
5EAZA 4G4YA 4B5CA 3MQWA 5FNVA 4B62A 3CCLF 2Z01A 2QA4F 3GHZA 3HKBA 1M90H 3MBMA 1W5BA 3FFMA 4G88A 2VAPA 2KTVA 2AIFA 3VTIC 1FNKA 2VAWA 4LCKA 5GAPK 1GO1A 2B33A 3O85A 4X1YA 3IEQA 5IYZA 4TV8A 3HKDB 1Z5VA 3CCJF 4IIJB 2F9ZC 3WGNA 2ZF8A 1SZQA 4F6RB 1XBIA 1IV4A 1S72F 3LFOA 4O4HA 4DRXA 4BVQA 2VGMA 3VOAA 3WJRA 4EI7A 3M84A 4WBNA 4RHAA 5JQGA 3ZP4A 4PWTA 5GIOC 3CCEF 1X52A 3L7QA 5DCVA 5HY0A 4O4JB 4TZZA 1OFUA 5EZYA 2H8CA 3M4SA 3K0TA 3I7TA 2R6R1 4M8IA 2L26A 4TV9A 3EORA 4HNAA 3F0DA 3CC2F 1JFFA 1QD9A 3JAKB 3T80A 5MN5A 4O4IA 3TD3A 1W5FA 2AIZP 5HXUA 4X1IB 1TVKB 2IAFA 1VQ9F 5EYPB 3E22A 3CMEF 1KNKA 2ZODA 1VQNF 5GINC 3JAWA 1OAPA 4G4WA 5KMGA 5CA0B 5LA6B 3HJWC 3S06A 1GO0A 4O2BB 3I56F 2RB9A 2UYJA 3KHNA 4FFBA 1U43A 3RYCA 3PAFA 5G4UC 1VQ4F 4BT2A 4ZHYB 2BO1A 4R40B 1VQ8F 5JH7A 1KC8H 2ZOVA 5HY1A 4LNUB 3C9SA 3I3FA 2PHNA 1YJNF 1GX1A 4YJ3A 2CW4A 2OTJF 3JAMM 3HKCB 4BW0B 2CHTA 1JN1A 5JVDA 2CZWA 4ZHWA 1X25A 2I6DA 4XCQA 1YHQF 2R751 5EB1B 4EI8A 3JVHA 3HTNA 3CYQA 3LWVC 4ZOLB 2CVLA 3IMPA 5GONA 1K9MH 3IR9A 1SA0A 3VYSC 5HWEA 3CCMF 3JATA 3RYIA 5J2TB 5LYJB 3SIUA 1H7MA 4B46A 3RA6A 4U3JB 3VIUA 1Z5WA 5LXTB 3QUWA 4I50B 3RYFB 3ELCA 2CHSA 3QTYA 4O2AA 3WGKA 5J2UB 4I55B 2K1SA 2BTQB 3D01A 1RQ7A 1YGYA 3D00A 1IV1A 1W57A 3CD6F 1W40A 1KNJA 2UYKA 2PMPA 3ESJA 3OONA 5EB0A 3CCSF 4I4TB 3VYUC 3B6NA 4NUTA 3UT5B 1U40A 3CC7F 3C8LA 4TUYB 4C8IA 2OTMA 2ZAUA 1R1MA 3K14A 2ZVZA 3LYBA 3J7AR 4O4LB 3JASB 1Q7YH 2MQEA 5EO3A 2LBWA 4B45A 4C8EA 3DC2A 2OHWA 3HKDA 5C8YB 1VQLF 2QEXF 4IIJA 3V7QA 2GLZA 3VMFB 4F6RA 3CYPB 1X7OA 4E6EA 5ITZB 3CPWF 1TUBB 3CXCF 5HP7A 3G4SF 1U3LA 3VOBA 3E1YA 5IJ0B 3P0ZA 4G4XA 3CCRF 2JNBA 2HX0A 2IG8A 4O4JA 2KTUA 3JARB 2FGYA 1JY8A 1XV2A 3NK6A 3WPWA 2VGNA 3OBWA 1W41A 2Q1YA 2UYNB 3JAKA 2LBTA 2HQSC 1QU9A 2Z1EA 1ODEA 3F0FA 4X1IA 1TVKA 3S0HA 1DT9A 3C9UA 5EYPA 4EB6B 1COMA 3K2XA 4KWEA 1VH8A 3VYTC 3GYQA 3WGMA 1W2BF 5MN6A 3OBYA 2BTUA 3PLAC 3LWOC 3JCMM 1YIJF 3CC4F 4IHJB 5LOVB 3S03A 3CG6A 3JALB 3P4EA 3U0OA 1CN7A 3RYHB 5CA0A 5LA6A 3IKEA 2CWJA 1U3PA 3ZP7A 4O2BA 2YYEA 5IJ9B 2DT4A 3VO8A 3N2KB 2Z1FA 3RE3A 5LP6B 3FBAA 1W59A 4LNUA 2LCAA 3V4DA 3BYQA 2G9IA 2ZVYA 3M1XA 1NMUB 2GVIA 2QI2A 2RHJA 3J81M 3HKCA 2QTPA 4C81A 5AVMA 1FFXB 3LDTA 3NMUC 5KX5B 1RLUA 1W5EA 1UI9A 2RHOA 1Q82H 1CLIA 3S02A 3WGLA 5CA1B 2I6RA 2Z1TA 4ZOLA 1RLGA 3HKEB 4C8GA 5BMVB 3ZO8A 4DXDA 3SIVA 2NMUA 3VCZA 2HS3A 5J2TA 5LYJA 2BTOA 2KG4A 1RQ2A 2HP0B 4X20B 2Z1UA 4YJ2B 3P10A 5HXZA 1H48A 4U3JA 4ERHA 5LXTA 4I50A 3RYFA 1IPAA 4G4ZA 5J2UA 4I55A 1X7PA 3NK7A 1FSZA 3N2GB 2HS4A 2RHHA 1Q8RA 1K8AH 2AMTA 4I4TA 3CMAF 3UT5A 2YXZA 2H8EA 5CB4B 4BT5A 4X1KB 2V9YA 4ZI7B 3S0YA 5MN4A 4TUYA 3CPQA 3I55F 1VQPF 4ZHQB 4BT3A 1XHOA 3ON1A 5FNVB 2HVYD 2EWCA 1K73H 3HKBB 1H47A 1N8RH 4O4LA 3NVKE 3JASA 3D54A 2DYYA 5C8YA 2KGWA 3DDNA 5HY4A 4X1YB 5IYZB 4TV8B 1NJIH 1W55A 5ITZA 1TUBA 4BVRA 3V7EA 1CK2A 1T0AA 1UFYA 4G4VA 1T0KB 4O4HB 4DRXB 3WGJA 3KJJA 3Q8HA 5IJ0A 3E20B 3AGKA 2Q1XA 1M1KH 5GANK 4EI9A 4WBNB 5GIPC 3TD4A 5FJ4C 5JQGB 3WXMB 3JARA 2N48A 5EWRA 1W581 1NQ3A 2P6YA 3CCUF 2UYPA 1QAHA 5FLXM 2CSLA 5EIBC 2OTLF 2UYNA 5EZYB 4C4WC 2H6LA 4X3LA 3CB2A 3MDOA 5HY2A 4TV9B 1FNJA 5HP8A 3HWUA 2FC3A 4HNAB 4EB6A 4BVSA 1JFFB 4O4IB 2LBXA 1J7HA 1VQOF 1Q81H 1ZWZA 4X3MA 1VQ7F 3E22B 3QHDA 3HAXD 4IHJA 5LOVA 1VQKF 3JALA 4U39A 3G6EF 2OZBA 1Q86H 3RYHA 3RA5A 3FD5A 3V3TA 1YJ9F 3GTZA 3MCAB 5JCOA 3JAWB 2RHLA 3N4YA 5IJ9A 5KMGB 1VK3A 3N2KA 1ONIA 2VAMA 3VI6A 1VQ5F 1YQNA 1YI2F 3ZOPA 4FFBB 2HS0A 3C9RA 3MCQA 4ZK7A 5LP6A 3RYCB 3F0EA 3IEWA 3CCQF 4RQOA 5B8FA 1W5AA 5JH7B 1IV3A 5EIBD 2HRUA 3R0PA 2HP3A 3FD6A 1FFXA 3K12A 3WJQA 4YJ3B 5KX5A 3F6MA 4ZHVA 5G4VC 1SDSA 1YITF 1VQMF 3FPIA 1W42A 1KQSF 5CA1A 5JVDB 3WJPA 1JJ2F 4BT6A 3LWRC 3CCVF 3HKEA 5BMVA 1PXWA 2HRYA 3TD5A 5JCOC 2UZHA 5GONB 3J80M 1RA4A 1SA0B 2WALA 3S0WA 4BY9D 3LMEA 1VQVA 2HP0A 1GZ0A 4NWOB 4X20A 4YJ2A 3OW2F 3JATB 3RYIB 2ALEA 3ERNA 2W8BC 1YJWF 5LP6C 1E7KA 3NVIB 3C9TA 1PF5A 2VXYA 1VHAA 3KE1A 3N4ZA 2IQQA 4NQ3A 1QVGF 4O2AB 3KJKA 3N2GA 4BVTA 3KIZA 4BT4A 1KD1H 3IKFA 3LWPC 5A2QM 1JD1A 1VQ6F 1IV2A 5IT9M 3G71F 3WPXA 5CB4A 4X1KA 3LWQC 4ZI7A 1W3EX 4BT7A 4ZHQA 1DBFA 1XRGA 2GZLA 4C82A 3F0GA 1QVFF
chains in the Genus database with same CATH topology
1Q8RA 2H8EA 2H8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q8R A;  2H8E A;  2H8C A; 
#chains in the Genus database with same CATH topology
 5EAZ A;  4G4Y A;  4B5C A;  3MQW A;  5FNV A;  4B62 A;  3CCL F;  2Z01 A;  2QA4 F;  3GHZ A;  3HKB A;  1M90 H;  3MBM A;  1W5B A;  3FFM A;  4G88 A;  2VAP A;  2KTV A;  2AIF A;  3VTI C;  1FNK A;  2VAW A;  4LCK A;  5GAP K;  1GO1 A;  2B33 A;  3O85 A;  4X1Y A;  3IEQ A;  5IYZ A;  4TV8 A;  3HKD B;  1Z5V A;  3CCJ F;  4IIJ B;  2F9Z C;  3WGN A;  2ZF8 A;  1SZQ A;  4F6R B;  1XBI A;  1IV4 A;  1S72 F;  3LFO A;  4O4H A;  4DRX A;  4BVQ A;  2VGM A;  3VOA A;  3WJR A;  4EI7 A;  3M84 A;  4WBN A;  4RHA A;  5JQG A;  3ZP4 A;  4PWT A;  5GIO C;  3CCE F;  1X52 A;  3L7Q A;  5DCV A;  5HY0 A;  4O4J B;  4TZZ A;  1OFU A;  5EZY A;  2H8C A;  3M4S A;  3K0T A;  3I7T A;  2R6R 1;  4M8I A;  2L26 A;  4TV9 A;  3EOR A;  4HNA A;  3F0D A;  3CC2 F;  1JFF A;  1QD9 A;  3JAK B;  3T80 A;  5MN5 A;  4O4I A;  3TD3 A;  1W5F A;  2AIZ P;  5HXU A;  4X1I B;  1TVK B;  2IAF A;  1VQ9 F;  5EYP B;  3E22 A;  3CME F;  1KNK A;  2ZOD A;  1VQN F;  5GIN C;  3JAW A;  1OAP A;  4G4W A;  5KMG A;  5CA0 B;  5LA6 B;  3HJW C;  3S06 A;  1GO0 A;  4O2B B;  3I56 F;  2RB9 A;  2UYJ A;  3KHN A;  4FFB A;  1U43 A;  3RYC A;  3PAF A;  5G4U C;  1VQ4 F;  4BT2 A;  4ZHY B;  2BO1 A;  4R40 B;  1VQ8 F;  5JH7 A;  1KC8 H;  2ZOV A;  5HY1 A;  4LNU B;  3C9S A;  3I3F A;  2PHN A;  1YJN F;  1GX1 A;  4YJ3 A;  2CW4 A;  2OTJ F;  3JAM M;  3HKC B;  4BW0 B;  2CHT A;  1JN1 A;  5JVD A;  2CZW A;  4ZHW A;  1X25 A;  2I6D A;  4XCQ A;  1YHQ F;  2R75 1;  5EB1 B;  4EI8 A;  3JVH A;  3HTN A;  3CYQ A;  3LWV C;  4ZOL B;  2CVL A;  3IMP A;  5GON A;  1K9M H;  3IR9 A;  1SA0 A;  3VYS C;  5HWE A;  3CCM F;  3JAT A;  3RYI A;  5J2T B;  5LYJ B;  3SIU A;  1H7M A;  4B46 A;  3RA6 A;  4U3J B;  3VIU A;  1Z5W A;  5LXT B;  3QUW A;  4I50 B;  3RYF B;  3ELC A;  2CHS A;  3QTY A;  4O2A A;  3WGK A;  5J2U B;  4I55 B;  2K1S A;  2BTQ B;  3D01 A;  1RQ7 A;  1YGY A;  3D00 A;  1IV1 A;  1W57 A;  3CD6 F;  1W40 A;  1KNJ A;  2UYK A;  2PMP A;  3ESJ A;  3OON A;  5EB0 A;  3CCS F;  4I4T B;  3VYU C;  3B6N A;  4NUT A;  3UT5 B;  1U40 A;  3CC7 F;  3C8L A;  4TUY B;  4C8I A;  2OTM A;  2ZAU A;  1R1M A;  3K14 A;  2ZVZ A;  3LYB A;  3J7A R;  4O4L B;  3JAS B;  1Q7Y H;  2MQE A;  5EO3 A;  2LBW A;  4B45 A;  4C8E A;  3DC2 A;  2OHW A;  3HKD A;  5C8Y B;  1VQL F;  2QEX F;  4IIJ A;  3V7Q A;  2GLZ A;  3VMF B;  4F6R A;  3CYP B;  1X7O A;  4E6E A;  5ITZ B;  3CPW F;  1TUB B;  3CXC F;  5HP7 A;  3G4S F;  1U3L A;  3VOB A;  3E1Y A;  5IJ0 B;  3P0Z A;  4G4X A;  3CCR F;  2JNB A;  2HX0 A;  2IG8 A;  4O4J A;  2KTU A;  3JAR B;  2FGY A;  1JY8 A;  1XV2 A;  3NK6 A;  3WPW A;  2VGN A;  3OBW A;  1W41 A;  2Q1Y A;  2UYN B;  3JAK A;  2LBT A;  2HQS C;  1QU9 A;  2Z1E A;  1ODE A;  3F0F A;  4X1I A;  1TVK A;  3S0H A;  1DT9 A;  3C9U A;  5EYP A;  4EB6 B;  1COM A;  3K2X A;  4KWE A;  1VH8 A;  3VYT C;  3GYQ A;  3WGM A;  1W2B F;  5MN6 A;  3OBY A;  2BTU A;  3PLA C;  3LWO C;  3JCM M;  1YIJ F;  3CC4 F;  4IHJ B;  5LOV B;  3S03 A;  3CG6 A;  3JAL B;  3P4E A;  3U0O A;  1CN7 A;  3RYH B;  5CA0 A;  5LA6 A;  3IKE A;  2CWJ A;  1U3P A;  3ZP7 A;  4O2B A;  2YYE A;  5IJ9 B;  2DT4 A;  3VO8 A;  3N2K B;  2Z1F A;  3RE3 A;  5LP6 B;  3FBA A;  1W59 A;  4LNU A;  2LCA A;  3V4D A;  3BYQ A;  2G9I A;  2ZVY A;  3M1X A;  1NMU B;  2GVI A;  2QI2 A;  2RHJ A;  3J81 M;  3HKC A;  2QTP A;  4C81 A;  5AVM A;  1FFX B;  3LDT A;  3NMU C;  5KX5 B;  1RLU A;  1W5E A;  1UI9 A;  2RHO A;  1Q82 H;  1CLI A;  3S02 A;  3WGL A;  5CA1 B;  2I6R A;  2Z1T A;  4ZOL A;  1RLG A;  3HKE B;  4C8G A;  5BMV B;  3ZO8 A;  4DXD A;  3SIV A;  2NMU A;  3VCZ A;  2HS3 A;  5J2T A;  5LYJ A;  2BTO A;  2KG4 A;  1RQ2 A;  2HP0 B;  4X20 B;  2Z1U A;  4YJ2 B;  3P10 A;  5HXZ A;  1H48 A;  4U3J A;  4ERH A;  5LXT A;  4I50 A;  3RYF A;  1IPA A;  4G4Z A;  5J2U A;  4I55 A;  1X7P A;  3NK7 A;  1FSZ A;  3N2G B;  2HS4 A;  2RHH A;  1Q8R A;  1K8A H;  2AMT A;  4I4T A;  3CMA F;  3UT5 A;  2YXZ A;  2H8E A;  5CB4 B;  4BT5 A;  4X1K B;  2V9Y A;  4ZI7 B;  3S0Y A;  5MN4 A;  4TUY A;  3CPQ A;  3I55 F;  1VQP F;  4ZHQ B;  4BT3 A;  1XHO A;  3ON1 A;  5FNV B;  2HVY D;  2EWC A;  1K73 H;  3HKB B;  1H47 A;  1N8R H;  4O4L A;  3NVK E;  3JAS A;  3D54 A;  2DYY A;  5C8Y A;  2KGW A;  3DDN A;  5HY4 A;  4X1Y B;  5IYZ B;  4TV8 B;  1NJI H;  1W55 A;  5ITZ A;  1TUB A;  4BVR A;  3V7E A;  1CK2 A;  1T0A A;  1UFY A;  4G4V A;  1T0K B;  4O4H B;  4DRX B;  3WGJ A;  3KJJ A;  3Q8H A;  5IJ0 A;  3E20 B;  3AGK A;  2Q1X A;  1M1K H;  5GAN K;  4EI9 A;  4WBN B;  5GIP C;  3TD4 A;  5FJ4 C;  5JQG B;  3WXM B;  3JAR A;  2N48 A;  5EWR A;  1W58 1;  1NQ3 A;  2P6Y A;  3CCU F;  2UYP A;  1QAH A;  5FLX M;  2CSL A;  5EIB C;  2OTL F;  2UYN A;  5EZY B;  4C4W C;  2H6L A;  4X3L A;  3CB2 A;  3MDO A;  5HY2 A;  4TV9 B;  1FNJ A;  5HP8 A;  3HWU A;  2FC3 A;  4HNA B;  4EB6 A;  4BVS A;  1JFF B;  4O4I B;  2LBX A;  1J7H A;  1VQO F;  1Q81 H;  1ZWZ A;  4X3M A;  1VQ7 F;  3E22 B;  3QHD A;  3HAX D;  4IHJ A;  5LOV A;  1VQK F;  3JAL A;  4U39 A;  3G6E F;  2OZB A;  1Q86 H;  3RYH A;  3RA5 A;  3FD5 A;  3V3T A;  1YJ9 F;  3GTZ A;  3MCA B;  5JCO A;  3JAW B;  2RHL A;  3N4Y A;  5IJ9 A;  5KMG B;  1VK3 A;  3N2K A;  1ONI A;  2VAM A;  3VI6 A;  1VQ5 F;  1YQN A;  1YI2 F;  3ZOP A;  4FFB B;  2HS0 A;  3C9R A;  3MCQ A;  4ZK7 A;  5LP6 A;  3RYC B;  3F0E A;  3IEW A;  3CCQ F;  4RQO A;  5B8F A;  1W5A A;  5JH7 B;  1IV3 A;  5EIB D;  2HRU A;  3R0P A;  2HP3 A;  3FD6 A;  1FFX A;  3K12 A;  3WJQ A;  4YJ3 B;  5KX5 A;  3F6M A;  4ZHV A;  5G4V C;  1SDS A;  1YIT F;  1VQM F;  3FPI A;  1W42 A;  1KQS F;  5CA1 A;  5JVD B;  3WJP A;  1JJ2 F;  4BT6 A;  3LWR C;  3CCV F;  3HKE A;  5BMV A;  1PXW A;  2HRY A;  3TD5 A;  5JCO C;  2UZH A;  5GON B;  3J80 M;  1RA4 A;  1SA0 B;  2WAL A;  3S0W A;  4BY9 D;  3LME A;  1VQV A;  2HP0 A;  1GZ0 A;  4NWO B;  4X20 A;  4YJ2 A;  3OW2 F;  3JAT B;  3RYI B;  2ALE A;  3ERN A;  2W8B C;  1YJW F;  5LP6 C;  1E7K A;  3NVI B;  3C9T A;  1PF5 A;  2VXY A;  1VHA A;  3KE1 A;  3N4Z A;  2IQQ A;  4NQ3 A;  1QVG F;  4O2A B;  3KJK A;  3N2G A;  4BVT A;  3KIZ A;  4BT4 A;  1KD1 H;  3IKF A;  3LWP C;  5A2Q M;  1JD1 A;  1VQ6 F;  1IV2 A;  5IT9 M;  3G71 F;  3WPX A;  5CB4 A;  4X1K A;  3LWQ C;  4ZI7 A;  1W3E X;  4BT7 A;  4ZHQ A;  1DBF A;  1XRG A;  2GZL A;  4C82 A;  3F0G A;  1QVF F; 
#chains in the Genus database with same CATH homology
 1Q8R A;  2H8E A;  2H8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...