1Q8RA

Structure of e.coli rusa holliday junction resolvase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endodeoxyribonuclease rusA
publication title The structure of Escherichia coli RusA endonuclease reveals a new Holliday junction DNA binding fold
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination,hydrolase
total genus 29
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.1.22.4: Crossover junction endodeoxyribonuclease.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05866 RusA Endodeoxyribonuclease RusA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.70 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Holliday junction resolvase RusA 1q8rA00
2H8EA 2H8CA 1Q8RA
chains in the Genus database with same CATH superfamily
3CD6F 1GO1A 2IAFA 3Q8HA 2PMPA 4LCKA 4X3LA 1W55A 1X7OA 4O4HB 1VQLF 4C8IA 3F0EA 5HXUA 3P0ZA 3JALA 3M4SA 1R1MA 4C81A 3RYCB 2HS0A 3MCAB 4IIJA 1CK2A 3VO8A 5CB4A 4LNUA 4O2BA 4ZK7A 4HNAB 5LP6B 3ZO8A 1VQVA 3VCZA 5GIOC 4X20A 3D00A 2OZBA 1GZ0A 3KHNA 1NJIH 3JAMM 1Q81H 3U0OA 4C82A 4B5CA 4TV8B 1Z5WA 2BTQB 3JVHA 4E6EA 1KNJA 4NUTA 5MN6A 3IR9A 3TD3A 2I6RA 3CCVF 2GLZA 5JVDA 3JATA 3ESJA 4O2AB 2L26A 2Z1UA 2GZLA 4RQOA 1YJNF 5CA1B 3G71F 4I4TB 2Z1FA 5IYZB 5KX5B 3WXMB 3CYQA 4F6RA 4G4XA 4O4LA 3HJWC 4I55B 1W42A 4FFBB 1S72F 2CSLA 1IPAA 1COMA 2UYPA 3J81M 1UFYA 3LMEA 2ZAUA 3K14A 3VMFB 3WJPA 3UT5B 1UI9A 2HS3A 5EZYB 3WJQA 1YI2F 3GYQA 3CB2A 3JASA 3GTZA 3MCQA 3OBWA 4ZHVA 1U40A 2DT4A 2HP3A 4PWTA 4X1KA 2VAPA 2B33A 4EI7A 2CVLA 1Q86H 1W41A 4O4IA 1Z5VA 3RE3A 5JQGB 1JJ2F 1VK3A 3CG6A 1IV4A 1TVKB 1M90H 3RYHB 4HNAA 5LP6A 4C8GA 3KJKA 2ZOVA 3JAWA 5HY2A 4KWEA 1DT9A 4TV8A 5IJ0B 1OAPA 1GX1A 5JCOA 3S02A 1H7MA 1DBFA 4O2AA 3L7QA 1ONIA 1YGYA 3LWRC 1W5EA 3KIZA 4G4VA 4RHAA 5IJ9A 1KNKA 4I4TA 4G88A 5FNVA 5IYZA 1KD1H 5EB0A 3CCQF 5HY0A 5LYJA 1X25A 4ZHQA 3EORA 1ZWZA 3F0GA 5JCOC 3E1YA 1RLUA 2HP0B 3F0DA 4X1IA 1GO0A 2OHWA 3DDNA 3HKDA 3S0HA 2YXZA 1JN1A 2HRYA 3IMPA 3UT5A 2VAWA 5EZYA 1CLIA 1RQ7A 3CXCF 1W5AA 4U3JB 5EYPB 1N8RH 3VOAA 1Q82H 1FSZA 1NMUB 5EIBD 3N2KB 1XRGA 5JH7B 4R40B 1W581 4YJ3B 5B8FA 3PAFA 5J2TA 3TD4A 3CPWF 2LBXA 1QD9A 2CWJA 3VIUA 3VTIC 2R751 5CA0B 2VGNA 4DRXA 2YYEA 2HQSC 5EWRA 4ZI7A 5HY4A 3CPQA 1OFUA 1IV3A 2N48A 3NVKE 5HY1A 1QVFF 1SDSA 5J2UB 1E7KA 4TV9B 2FC3A 2AIFA 1FNJA 5GONA 4O4JB 2KG4A 3S0WA 2BTOA 2CHSA 3D54A 3HKBB 4X1YA 4IHJB 3HKEA 2DYYA 1X52A 3CCMF 3V3TA 2K1SA 1FFXB 3P4EA 5C8YB 3C9RA 2Q1YA 5LOVB 3CCLF 2H8EA 1W3EX 5EO3A 1PXWA 1K9MH 4C8EA 3CC7F 5IT9M 1XV2A 4I50B 2ALEA 5MN5A 3J7AR 3M1XA 2LCAA 1K73H 3LWVC 1YJWF 4EI8A 1W59A 1VQNF 3N2KA 1YJ9F 3ERNA 1QU9A 5HXZA 1TUBB 3CCEF 4BT7A 3NMUC 2QEXF 1CN7A 2HX0A 4O4HA 1W5BA 4TUYB 5ITZB 4WBNB 2IG8A 3QTYA 3RYCA 3M84A 3I7TA 3G4SF 1W40A 1Q7YH 3VOBA 2LBTA 5EAZA 1JFFB 3LWPC 2R6R1 1VQ5F 4ZHWA 5KMGB 3J80M 1SA0B 3AGKA 3SIVA 2UYKA 3JAKB 4G4ZA 4ZOLB 3RYFB 3MBMA 3O85A 3LYBA 2HS4A 3LWQC 1VQ7F 3HWUA 1JY8A 5LP6C 2G9IA 4IHJA 2QI2A 5GINC 1YITF 3ZOPA 5CA1A 3ON1A 1NQ3A 3F0FA 4IIJB 5KX5A 5CB4B 2RHJA 2RHHA 2CHTA 4LNUB 4I55A 5GAPK 3VI6A 4FFBA 2V9YA 1RLGA 2MQEA 4B62A 1IV1A 3K2XA 3V4DA 3WGJA 2H8CA 2HVYD 5BMVB 2Z01A 3IEWA 2ZF8A 2AIZP 4XCQA 2Z1EA 3ELCA 1PF5A 5LXTB 5JVDB 3JATB 3P10A 3OONA 5HP7A 3F6MA 3N4YA 4U39A 1Q8RA 1QAHA 2AMTA 3LDTA 3QHDA 3S06A 2Q1XA 3HKCB 4TUYA 5JQGA 3RA6A 1VQ4F 1XBIA 3D01A 3C9TA 2KGWA 4BVTA 3CCJF 1W2BF 1TVKA 3ZP7A 1VQ6F 4F6RB 3RYHA 2QTPA 1VQOF 1JFFA 2BO1A 3IEQA 2FGYA 3I55F 1IV2A 1W57A 3FD5A 3VYSC 3QUWA 4BT5A 1VQMF 2RHOA 1SA0A 2ZVZA 5IJ0A 5GANK 1H47A 2QA4F 3MDOA 3CCSF 3RYFA 3JASB 3VYUC 3CCUF 3PLAC 5LA6B 3HAXD 4X1KB 1FNKA 4O4IB 4M8IA 3C9SA 4ERHA 3SIUA 5FJ4C 4BY9D 2ZVYA 1VQPF 3CMEF 2F9ZC 3IKEA 4B46A 1YHQF 2UYNB 1K8AH 3OW2F 3WGLA 2VXYA 3CMAF 2OTJF 3WJRA 4BT6A 3WGMA 3JAWB 3RYIB 1SZQA 1J7HA 2HP0A 3WPWA 3S03A 1U3PA 5FLXM 4EB6B 1U3LA 5BMVA 3N4ZA 3E22B 4G4YA 3LFOA 1RA4A 3FPIA 3NK6A 5G4UC 3K12A 2VAMA 4U3JA 5EYPA 5LXTA 4DXDA 4NWOB 1QVGF 2VGMA 4BT2A 3I56F 3WPXA 2BTUA 5JH7A 3JARB 3HKCA 5IJ9B 2HRUA 3G6EF 4YJ3A 3MQWA 3R0PA 5FNVB 4BW0B 1VQKF 5LYJB 3HTNA 4EI9A 2OTMA 4ZHQB 3N2GB 1ODEA 5CA0A 5A2QM 3V7EA 3T80A 4X1IB 1VH8A 3RA5A 3CC2F 1M1KH 2CW4A 2Z1TA 3HKDB 4BT3A 3KE1A 2UZHA 1W5FA 4YJ2B 1X7PA 3OBYA 5LA6A 4X3MA 1YIJF 3FFMA 5J2UA 1VQ8F 1RQ2A 3CYPB 4TV9A 3IKFA 3NVIB 3TD5A 3I3FA 5HWEA 2KTVA 2W8BC 1U43A 1JD1A 3KJJA 4O4JA 5J2TB 4C4WC 5HP8A 2RB9A 3C9UA 3HKBA 2UYNA 4NQ3A 3WGKA 3JALB 4B45A 1VQ9F 1FFXA 1H48A 2GVIA 3RYIA 3FD6A 4O2BB 5C8YA 3V7QA 2EWCA 4DRXB 3CC4F 4EB6A 5LOVA 3LWOC 4X20B 2CZWA 5EIBC 4BVRA 3E22A 4ZI7B 4ZHYB 3K0TA 3WGNA 1VHAA 2H6LA 2KTUA 4I50A 5EB1B 2JNBA 2PHNA 2P6YA 2WALA 4BVQA 5GIPC 4BVSA 3JARA 3C8LA 3E20B 3GHZA 5GONB 5DCVA 1TUBA 5AVMA 2I6DA 4X1YB 3HKEB 3BYQA 1XHOA 2IQQA 1T0AA 2OTLF 5ITZA 5G4VC 3N2GA 4WBNA 2LBWA 1KQSF 2ZODA 3JCMM 3B6NA 4O4LB 2RHLA 5MN4A 4BT4A 1T0KB 4YJ2A 5KMGA 4TZZA 3FBAA 3VYTC 2UYJA 3DC2A 3CCRF 1YQNA 3JAKA 1KC8H 2NMUA 3NK7A 4G4WA 4ZOLA 3S0YA 3ZP4A
chains in the Genus database with same CATH topology
2H8EA 2H8CA 1Q8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8E A;  2H8C A;  1Q8R A; 
#chains in the Genus database with same CATH topology
 3CD6 F;  1GO1 A;  2IAF A;  3Q8H A;  2PMP A;  4LCK A;  4X3L A;  1W55 A;  1X7O A;  4O4H B;  1VQL F;  4C8I A;  3F0E A;  5HXU A;  3P0Z A;  3JAL A;  3M4S A;  1R1M A;  4C81 A;  3RYC B;  2HS0 A;  3MCA B;  4IIJ A;  1CK2 A;  3VO8 A;  5CB4 A;  4LNU A;  4O2B A;  4ZK7 A;  4HNA B;  5LP6 B;  3ZO8 A;  1VQV A;  3VCZ A;  5GIO C;  4X20 A;  3D00 A;  2OZB A;  1GZ0 A;  3KHN A;  1NJI H;  3JAM M;  1Q81 H;  3U0O A;  4C82 A;  4B5C A;  4TV8 B;  1Z5W A;  2BTQ B;  3JVH A;  4E6E A;  1KNJ A;  4NUT A;  5MN6 A;  3IR9 A;  3TD3 A;  2I6R A;  3CCV F;  2GLZ A;  5JVD A;  3JAT A;  3ESJ A;  4O2A B;  2L26 A;  2Z1U A;  2GZL A;  4RQO A;  1YJN F;  5CA1 B;  3G71 F;  4I4T B;  2Z1F A;  5IYZ B;  5KX5 B;  3WXM B;  3CYQ A;  4F6R A;  4G4X A;  4O4L A;  3HJW C;  4I55 B;  1W42 A;  4FFB B;  1S72 F;  2CSL A;  1IPA A;  1COM A;  2UYP A;  3J81 M;  1UFY A;  3LME A;  2ZAU A;  3K14 A;  3VMF B;  3WJP A;  3UT5 B;  1UI9 A;  2HS3 A;  5EZY B;  3WJQ A;  1YI2 F;  3GYQ A;  3CB2 A;  3JAS A;  3GTZ A;  3MCQ A;  3OBW A;  4ZHV A;  1U40 A;  2DT4 A;  2HP3 A;  4PWT A;  4X1K A;  2VAP A;  2B33 A;  4EI7 A;  2CVL A;  1Q86 H;  1W41 A;  4O4I A;  1Z5V A;  3RE3 A;  5JQG B;  1JJ2 F;  1VK3 A;  3CG6 A;  1IV4 A;  1TVK B;  1M90 H;  3RYH B;  4HNA A;  5LP6 A;  4C8G A;  3KJK A;  2ZOV A;  3JAW A;  5HY2 A;  4KWE A;  1DT9 A;  4TV8 A;  5IJ0 B;  1OAP A;  1GX1 A;  5JCO A;  3S02 A;  1H7M A;  1DBF A;  4O2A A;  3L7Q A;  1ONI A;  1YGY A;  3LWR C;  1W5E A;  3KIZ A;  4G4V A;  4RHA A;  5IJ9 A;  1KNK A;  4I4T A;  4G88 A;  5FNV A;  5IYZ A;  1KD1 H;  5EB0 A;  3CCQ F;  5HY0 A;  5LYJ A;  1X25 A;  4ZHQ A;  3EOR A;  1ZWZ A;  3F0G A;  5JCO C;  3E1Y A;  1RLU A;  2HP0 B;  3F0D A;  4X1I A;  1GO0 A;  2OHW A;  3DDN A;  3HKD A;  3S0H A;  2YXZ A;  1JN1 A;  2HRY A;  3IMP A;  3UT5 A;  2VAW A;  5EZY A;  1CLI A;  1RQ7 A;  3CXC F;  1W5A A;  4U3J B;  5EYP B;  1N8R H;  3VOA A;  1Q82 H;  1FSZ A;  1NMU B;  5EIB D;  3N2K B;  1XRG A;  5JH7 B;  4R40 B;  1W58 1;  4YJ3 B;  5B8F A;  3PAF A;  5J2T A;  3TD4 A;  3CPW F;  2LBX A;  1QD9 A;  2CWJ A;  3VIU A;  3VTI C;  2R75 1;  5CA0 B;  2VGN A;  4DRX A;  2YYE A;  2HQS C;  5EWR A;  4ZI7 A;  5HY4 A;  3CPQ A;  1OFU A;  1IV3 A;  2N48 A;  3NVK E;  5HY1 A;  1QVF F;  1SDS A;  5J2U B;  1E7K A;  4TV9 B;  2FC3 A;  2AIF A;  1FNJ A;  5GON A;  4O4J B;  2KG4 A;  3S0W A;  2BTO A;  2CHS A;  3D54 A;  3HKB B;  4X1Y A;  4IHJ B;  3HKE A;  2DYY A;  1X52 A;  3CCM F;  3V3T A;  2K1S A;  1FFX B;  3P4E A;  5C8Y B;  3C9R A;  2Q1Y A;  5LOV B;  3CCL F;  2H8E A;  1W3E X;  5EO3 A;  1PXW A;  1K9M H;  4C8E A;  3CC7 F;  5IT9 M;  1XV2 A;  4I50 B;  2ALE A;  5MN5 A;  3J7A R;  3M1X A;  2LCA A;  1K73 H;  3LWV C;  1YJW F;  4EI8 A;  1W59 A;  1VQN F;  3N2K A;  1YJ9 F;  3ERN A;  1QU9 A;  5HXZ A;  1TUB B;  3CCE F;  4BT7 A;  3NMU C;  2QEX F;  1CN7 A;  2HX0 A;  4O4H A;  1W5B A;  4TUY B;  5ITZ B;  4WBN B;  2IG8 A;  3QTY A;  3RYC A;  3M84 A;  3I7T A;  3G4S F;  1W40 A;  1Q7Y H;  3VOB A;  2LBT A;  5EAZ A;  1JFF B;  3LWP C;  2R6R 1;  1VQ5 F;  4ZHW A;  5KMG B;  3J80 M;  1SA0 B;  3AGK A;  3SIV A;  2UYK A;  3JAK B;  4G4Z A;  4ZOL B;  3RYF B;  3MBM A;  3O85 A;  3LYB A;  2HS4 A;  3LWQ C;  1VQ7 F;  3HWU A;  1JY8 A;  5LP6 C;  2G9I A;  4IHJ A;  2QI2 A;  5GIN C;  1YIT F;  3ZOP A;  5CA1 A;  3ON1 A;  1NQ3 A;  3F0F A;  4IIJ B;  5KX5 A;  5CB4 B;  2RHJ A;  2RHH A;  2CHT A;  4LNU B;  4I55 A;  5GAP K;  3VI6 A;  4FFB A;  2V9Y A;  1RLG A;  2MQE A;  4B62 A;  1IV1 A;  3K2X A;  3V4D A;  3WGJ A;  2H8C A;  2HVY D;  5BMV B;  2Z01 A;  3IEW A;  2ZF8 A;  2AIZ P;  4XCQ A;  2Z1E A;  3ELC A;  1PF5 A;  5LXT B;  5JVD B;  3JAT B;  3P10 A;  3OON A;  5HP7 A;  3F6M A;  3N4Y A;  4U39 A;  1Q8R A;  1QAH A;  2AMT A;  3LDT A;  3QHD A;  3S06 A;  2Q1X A;  3HKC B;  4TUY A;  5JQG A;  3RA6 A;  1VQ4 F;  1XBI A;  3D01 A;  3C9T A;  2KGW A;  4BVT A;  3CCJ F;  1W2B F;  1TVK A;  3ZP7 A;  1VQ6 F;  4F6R B;  3RYH A;  2QTP A;  1VQO F;  1JFF A;  2BO1 A;  3IEQ A;  2FGY A;  3I55 F;  1IV2 A;  1W57 A;  3FD5 A;  3VYS C;  3QUW A;  4BT5 A;  1VQM F;  2RHO A;  1SA0 A;  2ZVZ A;  5IJ0 A;  5GAN K;  1H47 A;  2QA4 F;  3MDO A;  3CCS F;  3RYF A;  3JAS B;  3VYU C;  3CCU F;  3PLA C;  5LA6 B;  3HAX D;  4X1K B;  1FNK A;  4O4I B;  4M8I A;  3C9S A;  4ERH A;  3SIU A;  5FJ4 C;  4BY9 D;  2ZVY A;  1VQP F;  3CME F;  2F9Z C;  3IKE A;  4B46 A;  1YHQ F;  2UYN B;  1K8A H;  3OW2 F;  3WGL A;  2VXY A;  3CMA F;  2OTJ F;  3WJR A;  4BT6 A;  3WGM A;  3JAW B;  3RYI B;  1SZQ A;  1J7H A;  2HP0 A;  3WPW A;  3S03 A;  1U3P A;  5FLX M;  4EB6 B;  1U3L A;  5BMV A;  3N4Z A;  3E22 B;  4G4Y A;  3LFO A;  1RA4 A;  3FPI A;  3NK6 A;  5G4U C;  3K12 A;  2VAM A;  4U3J A;  5EYP A;  5LXT A;  4DXD A;  4NWO B;  1QVG F;  2VGM A;  4BT2 A;  3I56 F;  3WPX A;  2BTU A;  5JH7 A;  3JAR B;  3HKC A;  5IJ9 B;  2HRU A;  3G6E F;  4YJ3 A;  3MQW A;  3R0P A;  5FNV B;  4BW0 B;  1VQK F;  5LYJ B;  3HTN A;  4EI9 A;  2OTM A;  4ZHQ B;  3N2G B;  1ODE A;  5CA0 A;  5A2Q M;  3V7E A;  3T80 A;  4X1I B;  1VH8 A;  3RA5 A;  3CC2 F;  1M1K H;  2CW4 A;  2Z1T A;  3HKD B;  4BT3 A;  3KE1 A;  2UZH A;  1W5F A;  4YJ2 B;  1X7P A;  3OBY A;  5LA6 A;  4X3M A;  1YIJ F;  3FFM A;  5J2U A;  1VQ8 F;  1RQ2 A;  3CYP B;  4TV9 A;  3IKF A;  3NVI B;  3TD5 A;  3I3F A;  5HWE A;  2KTV A;  2W8B C;  1U43 A;  1JD1 A;  3KJJ A;  4O4J A;  5J2T B;  4C4W C;  5HP8 A;  2RB9 A;  3C9U A;  3HKB A;  2UYN A;  4NQ3 A;  3WGK A;  3JAL B;  4B45 A;  1VQ9 F;  1FFX A;  1H48 A;  2GVI A;  3RYI A;  3FD6 A;  4O2B B;  5C8Y A;  3V7Q A;  2EWC A;  4DRX B;  3CC4 F;  4EB6 A;  5LOV A;  3LWO C;  4X20 B;  2CZW A;  5EIB C;  4BVR A;  3E22 A;  4ZI7 B;  4ZHY B;  3K0T A;  3WGN A;  1VHA A;  2H6L A;  2KTU A;  4I50 A;  5EB1 B;  2JNB A;  2PHN A;  2P6Y A;  2WAL A;  4BVQ A;  5GIP C;  4BVS A;  3JAR A;  3C8L A;  3E20 B;  3GHZ A;  5GON B;  5DCV A;  1TUB A;  5AVM A;  2I6D A;  4X1Y B;  3HKE B;  3BYQ A;  1XHO A;  2IQQ A;  1T0A A;  2OTL F;  5ITZ A;  5G4V C;  3N2G A;  4WBN A;  2LBW A;  1KQS F;  2ZOD A;  3JCM M;  3B6N A;  4O4L B;  2RHL A;  5MN4 A;  4BT4 A;  1T0K B;  4YJ2 A;  5KMG A;  4TZZ A;  3FBA A;  3VYT C;  2UYJ A;  3DC2 A;  3CCR F;  1YQN A;  3JAK A;  1KC8 H;  2NMU A;  3NK7 A;  4G4W A;  4ZOL A;  3S0Y A;  3ZP4 A; 
#chains in the Genus database with same CATH homology
 2H8E A;  2H8C A;  1Q8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...