1E7KA

Crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Spliceosomal 15.5Kd Protein Bound to a U4 Snrna Fragment
pubmed doi rcsb
molecule keywords 15.5 KD RNA BINDING PROTEIN
molecule tags Rna binding protein
source organism Homo sapiens
total genus 38
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1e7kA00
1YI2F 3CCVF 5GINC 1VQ4F 5GIOC 3G71F 1XBIA 2KTVA 1X7OA 3NK7A 2QEXF 1M1KH 1W40A 2KTUA 4BY9D 2OZBA 3GYQA 1NJIH 3O85A 1VQPF 4C4WC 3LWRC 1K73H 1GO1A 5DCVA 3V7EA 2OHWA 1VQ6F 4NUTA 2LBWA 1M90H 1PXWA 2KG4A 3CCRF 5G4UC 3CG6A 2I6DA 1YJWF 3NVIB 3LWVC 4X3LA 2AIFA 2CZWA 1VQKF 3LWOC 1VQOF 1Q7YH 5FJ4C 1Q86H 3CMEF 1S72F 3N4ZA 2HVYD 5FLXM 3N4YA 1VQLF 2QI2A 2QA4F 3LWPC 3E20B 3CXCF 1CN7A 3CCEF 3NVKE 3JAMM 2WALA 3CC2F 1GO0A 2BO1A 2VGNA 1W2BF 4LCKA 3CCQF 1YJNF 1QVFF 1VQ5F 1VQ8F 3NMUC 3V7QA 1YIJF 3MCAB 1Q82H 2OTLF 3OBYA 1RA4A 1Q81H 4X3MA 3JCMM 1QVGF 3VI6A 3LFOA 3RA6A 3IR9A 3OW2F 4TZZA 1VQNF 3RA5A 1VQ9F 3I56F 3G4SF 5IT9M 3I55F 3J7AR 3NK6A 1NMUB 1W3EX 5GANK 5GIPC 1H7MA 3CC7F 3WXMB 3FFMA 3CD6F 1JJ2F 3CCMF 1RLGA 1X7PA 3HJWC 1IPAA 2VGMA 3CC4F 2LBXA 1X52A 3SIUA 1VQMF 3AGKA 1ZWZA 3OBWA 3CCUF 3E1YA 5EWRA 2JNBA 1N8RH 1KC8H 3CCSF 1E7KA 1YJ9F 1K9MH 3CPQA 1KQSF 2FC3A 1YITF 3SIVA 5EO3A 1CK2A 3CMAF 3HAXD 3LWQC 3J80M 3G6EF 5A2QM 2OTJF 3J81M 1W41A 1VQ7F 1W42A 3PAFA 5G4VC 1KD1H 1K8AH 1DT9A 3CPWF 3PLAC 3VMFB 2ALEA 1T0KB 3CCLF 1GZ0A 3CCJF 5GAPK 1YHQF 3ON1A 1SDSA 4BW0B
chains in the Genus database with same CATH superfamily
1YI2F 2CWJA 1TVKA 4X20B 3OONA 4HNAB 2KTUA 3KJKA 5MN5A 4C4WC 5IJ0A 3U0OA 3V7EA 1W5FA 2QTPA 2KG4A 3CCRF 5LOVB 3HKCA 2GVIA 3HKDB 5JVDB 5G4UC 3CG6A 3JASB 5C8YA 4G4VA 2CZWA 5FJ4C 4F6RA 3V4DA 2HRUA 1S72F 3E22B 3C9UA 3N4ZA 3GHZA 3KHNA 2HQSC 3N4YA 4X1IA 2QI2A 4DRXB 4YJ3A 3E20B 1Z5WA 4WBNA 1CN7A 4M8IA 3JATA 4TV8B 3JAMM 1RQ7A 1SA0A 5HY4A 3UT5A 5HXUA 4ZOLA 5MN4A 4LCKA 3GTZA 2FGYA 3IEWA 3S0YA 1VQ5F 3D54A 2G9IA 2H8EA 3V7QA 4BT4A 1JFFA 1Q82H 1RA4A 3F0GA 4X1YA 1Q81H 3JCMM 3VI6A 3RA6A 3IR9A 2HS4A 2YYEA 4ZHYB 3I56F 2N48A 5IT9M 3NK6A 4BT3A 2UYKA 2RHHA 4O2BB 5J2UB 3CC7F 1JY8A 1KNKA 4IIJB 5LXTB 3WGNA 2NMUA 2UZHA 5J2TB 5HP7A 3CD6F 5IJ9A 2ZVYA 1IV4A 2LCAA 2UYPA 1Z5VA 2H6LA 2W8BC 3ERNA 1X52A 3S03A 3JARA 5CA0B 3ELCA 3JAKB 3AGKA 4TUYB 2JNBA 1KC8H 2Q1XA 1CLIA 3CCSF 5JQGB 3C9SA 5KX5A 1R1MA 3BYQA 3KIZA 3K2XA 2UYNB 3WJPA 1JD1A 2RHOA 2P6YA 2K1SA 3TD3A 4BVRA 1QD9A 3CMAF 1VK3A 4I50B 4X1KA 4O2AA 3J80M 5A2QM 3LMEA 3VOAA 5CA1A 1W42A 4BVTA 4FFBA 5LP6B 1DT9A 3KJJA 3P10A 3RYIB 5HY1A 3VMFB 1W5AA 1IV3A 2HP0B 2DYYA 2ZOVA 4BVSA 4KWEA 4BT2A 3JVHA 5HY0A 3CCVF 2AIZP 5GIOC 3G71F 2HP3A 1M1KH 1W40A 2Q1YA 1TUBA 1OAPA 2CHTA 5MN6A 4U3JB 3QTYA 3GYQA 3M4SA 3LWRC 1XV2A 4O4LA 2OHWA 1DBFA 1VQ6F 4RQOA 2LBWA 5JCOA 3MDOA 5LA6B 5IYZB 3V3TA 1PXWA 3Q8HA 3R0PA 4BT7A 3I3FA 4E6EA 1SZQA 1RLUA 4EB6A 5FNVB 3LWVC 2HS3A 1JN1A 4X3LA 3WPXA 2LBTA 2AIFA 4YJ2B 4C81A 5EYPA 1UI9A 2HX0A 3LWOC 1Q7YH 5FLXM 4O4IB 5ITZA 3FD6A 4I55B 3D00A 3NVKE 1PF5A 3CC2F 1GO0A 2VGNA 1W2BF 3RYHB 4LNUB 3EORA 1YJNF 1VQ8F 3P4EA 4B45A 3OBYA 3RE3A 4O4JB 3I7TA 3KE1A 4TV9A 3RA5A 1VQ9F 3TD5A 4ZI7A 2IAFA 1Q8RA 4EI8A 3L7QA 1TVKB 2CW4A 3VYUC 3WXMB 3FFMA 3N2GA 1JJ2F 3CCMF 1ODEA 1IPAA 5IJ0B 3C9TA 3FBAA 3WGLA 1U40A 2PMPA 5LP6C 1ZWZA 3C9RA 4ZHWA 3WGKA 3HKCB 1N8RH 5LYJA 5GONA 3WPWA 4NQ3A 4O4HA 1YJ9F 3IKFA 5BMVA 3VYSC 1UFYA 5EAZA 5C8YB 2UYJA 1OFUA 1KQSF 2FC3A 3C8LA 2PHNA 3SIVA 4F6RB 3N2KA 4IHJA 1KNJA 5CB4A 3HAXD 2Z1UA 3ESJA 4X1IB 4YJ3B 4WBNB 3K0TA 3JATB 3M1XA 1KD1H 1SA0B 3UT5B 3RYCA 1K8AH 4ZOLB 3CPWF 2ALEA 2CSLA 5KMGA 1T0KB 3HKBB 2CHSA 3IKEA 3HWUA 5GAPK 1JFFB 1YHQF 3ON1A 3JALA 2H8CA 2RHLA 1SDSA 2ZAUA 3HKEA 1XRGA 5GINC 4X1YB 1VQ4F 3VYTC 1XBIA 4I50A 1X7OA 3NK7A 5EIBC 2OZBA 2RB9A 1GX1A 3MBMA 3O85A 2ZVZA 3RYFA 1K73H 1NJIH 5DCVA 4ERHA 1X25A 1FFXA 1M90H 4EI9A 1FSZA 2HP0A 3DDNA 3QHDA 1T0AA 3WGMA 2R6R1 2I6DA 1YJWF 3NVIB 5IJ9B 5JH7A 1COMA 1U3LA 4I4TA 1ONIA 2V9YA 3B6NA 2EWCA 3JARB 2DT4A 3D01A 4C8EA 1YQNA 1IV2A 4G4XA 4ZHQA 3VOBA 3JAWA 5LA6A 3T80A 1VQLF 5EZYA 5KX5B 1H48A 2BO1A 2VAPA 2R751 2HS0A 1QVFF 1QAHA 3NMUC 1YIJF 3CYQA 4X1KB 4R40B 2OTLF 4O2AB 4BVQA 5CA1B 3VTIC 3S06A 1QVGF 4X20A 4FFBB 3LFOA 2ZODA 4HNAA 3WJQA 4TZZA 1VQNF 3F0EA 2Z1FA 4BT6A 2VAMA 3K12A 1W59A 3S02A 3I55F 1U43A 1W3EX 4ZK7A 1H7MA 5LOVA 1FNKA 3HKDA 5JVDA 1TUBB 1RLGA 1X7PA 3JASA 3HJWC 4G88A 2VGMA 3CC4F 2LBXA 4O4LB 3SIUA 5B8FA 2HRYA 3OBWA 3E22A 3E1YA 4PWTA 4G4ZA 4NWOB 1E7KA 4EB6B 4DRXA 5AVMA 3ZOPA 4TV8A 2Z1TA 3MCQA 4U39A 5EYPB 5EO3A 1YGYA 1CK2A 3IEQA 5HP8A 2OTJF 5ITZB 1VHAA 2BTOA 5HY2A 5G4VC 4G4WA 1VH8A 3PLAC 2Z1EA 3WGJA 4DXDA 1J7HA 3TD4A 3CCJF 2OTMA 3ZO8A 1GZ0A 4O2BA 3ZP4A 5J2UA 2ZF8A 4C8GA 3K14A 4XCQA 2KTVA 2L26A 3FPIA 4IIJA 3WJRA 5LXTA 2QEXF 5J2TA 1QU9A 2YXZA 4TV9B 4B46A 4BY9D 2I6RA 3LDTA 3P0ZA 1VQPF 1GO1A 4ZI7B 3F6MA 4NUTA 5CA0A 3HKBA 3JAKA 5HWEA 2VAWA 4TUYA 3FD5A 3VIUA 1W55A 3N2GB 4C8IA 5JQGA 3CB2A 5EB0A 3ZP7A 1W5BA 2UYNA 1VQKF 5HXZA 4B62A 1VQOF 2GZLA 1Q86H 3CMEF 1RQ2A 2HVYD 5LYJB 5GONB 1FNJA 4O4HB 4B5CA 2QA4F 5BMVB 2BTQB 3LWPC 3CXCF 3CCEF 2BTUA 2WALA 5LP6A 3MQWA 3RYIA 2MQEA 3N2KB 3CCQF 4IHJB 4ZHVA 1H47A 5CB4B 3MCAB 5JCOC 3QUWA 1U3PA 2IQQA 4X3MA 1NQ3A 3RYCB 3OW2F 2VXYA 4U3JA 5KMGB 2KGWA 2F9ZC 5EB1B 3G4SF 3F0FA 3J7AR 1NMUB 5GANK 3JALB 5GIPC 3HKEB 5IYZA 3S0HA 1XHOA 2AMTA 5FNVA 2CVLA 3RYFB 4YJ2A 1FFXB 3IMPA 1VQMF 4G4YA 4RHAA 2IG8A 5EIBD 3VCZA 3CCUF 5EWRA 2GLZA 4O4IA 1K9MH 3CPQA 5JH7B 3CYPB 4I55A 4I4TB 1YITF 3DC2A 3S0WA 3HTNA 2RHJA 3LYBA 2B33A 3RYHA 4LNUA 4BT5A 1VQVA 4ZHQB 3JAWB 3M84A 3LWQC 3G6EF 5EZYB 3F0DA 3J81M 4O4JA 1W41A 1W5EA 1VQ7F 3PAFA 4EI7A 1IV1A 3CCLF 4C82A 1W581 2Z01A 3VO8A 1W57A 4BW0B
chains in the Genus database with same CATH topology
1YI2F 5HY0A 3CCVF 5GINC 4XCQA 5GIOC 3G71F 1XBIA 2KTVA 1VQ4F 1X7OA 3NK7A 2QEXF 1M1KH 1W40A 2KTUA 4BY9D 2OZBA 3GYQA 1NJIH 3O85A 1VQPF 4C4WC 3LWRC 1K73H 1GO1A 5DCVA 3V7EA 2OHWA 1VQ6F 4NUTA 2LBWA 1M90H 5HWEA 4EI9A 3V3TA 1PXWA 2KG4A 3CCRF 5G4UC 3CG6A 2I6DA 1YJWF 3NVIB 3LWVC 4X3LA 2AIFA 2CZWA 1VQKF 5HXZA 3LWOC 1VQOF 1Q7YH 5FJ4C 1Q86H 3CMEF 1S72F 3N4ZA 2HVYD 5FLXM 3N4YA 1VQLF 2QI2A 2QA4F 3LWPC 3E20B 3CXCF 1CN7A 3CCEF 3D00A 3NVKE 3JAMM 2WALA 5HY4A 5HXUA 3CC2F 1GO0A 2BO1A 2VGNA 1W2BF 4LCKA 3CCQF 2FGYA 1YJNF 1QVFF 1VQ5F 1VQ8F 3NMUC 3V7QA 1YIJF 3MCAB 1Q82H 2OTLF 4BVQA 3OBYA 1RA4A 1Q81H 4X3MA 3JCMM 1QVGF 3VI6A 3LFOA 3RA6A 3IR9A 3OW2F 4TZZA 1VQNF 3RA5A 1VQ9F 2F9ZC 3I56F 3G4SF 5IT9M 3I55F 3J7AR 3NK6A 4EI8A 1NMUB 1W3EX 5GANK 5GIPC 1H7MA 3CC7F 3WXMB 3FFMA 3CD6F 1JJ2F 3CCMF 1RLGA 1X7PA 3HJWC 1IPAA 2VGMA 3CC4F 2LBXA 1X52A 3SIUA 1VQMF 3AGKA 1ZWZA 3OBWA 3CCUF 3E1YA 5EWRA 2JNBA 1N8RH 1KC8H 2GLZA 3CCSF 4NQ3A 1YJ9F 1E7KA 1K9MH 3CPQA 1KQSF 2FC3A 1YITF 3SIVA 5EO3A 4BVRA 1CK2A 3CMAF 3HAXD 3LWQC 3J80M 3G6EF 5A2QM 2OTJF 3J81M 1W41A 1VQ7F 1W42A 3PAFA 4BVTA 4EI7A 5HY2A 5G4VC 1KD1H 1K8AH 1DT9A 3CPWF 3PLAC 5HY1A 3VMFB 2ALEA 1T0KB 3CCLF 1GZ0A 3CCJF 4BVSA 5GAPK 1YHQF 3ON1A 1SDSA 4BW0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 F;  3CCV F;  5GIN C;  1VQ4 F;  5GIO C;  3G71 F;  1XBI A;  2KTV A;  1X7O A;  3NK7 A;  2QEX F;  1M1K H;  1W40 A;  2KTU A;  4BY9 D;  2OZB A;  3GYQ A;  1NJI H;  3O85 A;  1VQP F;  4C4W C;  3LWR C;  1K73 H;  1GO1 A;  5DCV A;  3V7E A;  2OHW A;  1VQ6 F;  4NUT A;  2LBW A;  1M90 H;  1PXW A;  2KG4 A;  3CCR F;  5G4U C;  3CG6 A;  2I6D A;  1YJW F;  3NVI B;  3LWV C;  4X3L A;  2AIF A;  2CZW A;  1VQK F;  3LWO C;  1VQO F;  1Q7Y H;  5FJ4 C;  1Q86 H;  3CME F;  1S72 F;  3N4Z A;  2HVY D;  5FLX M;  3N4Y A;  1VQL F;  2QI2 A;  2QA4 F;  3LWP C;  3E20 B;  3CXC F;  1CN7 A;  3CCE F;  3NVK E;  3JAM M;  2WAL A;  3CC2 F;  1GO0 A;  2BO1 A;  2VGN A;  1W2B F;  4LCK A;  3CCQ F;  1YJN F;  1QVF F;  1VQ5 F;  1VQ8 F;  3NMU C;  3V7Q A;  1YIJ F;  3MCA B;  1Q82 H;  2OTL F;  3OBY A;  1RA4 A;  1Q81 H;  4X3M A;  3JCM M;  1QVG F;  3VI6 A;  3LFO A;  3RA6 A;  3IR9 A;  3OW2 F;  4TZZ A;  1VQN F;  3RA5 A;  1VQ9 F;  3I56 F;  3G4S F;  5IT9 M;  3I55 F;  3J7A R;  3NK6 A;  1NMU B;  1W3E X;  5GAN K;  5GIP C;  1H7M A;  3CC7 F;  3WXM B;  3FFM A;  3CD6 F;  1JJ2 F;  3CCM F;  1RLG A;  1X7P A;  3HJW C;  1IPA A;  2VGM A;  3CC4 F;  2LBX A;  1X52 A;  3SIU A;  1VQM F;  3AGK A;  1ZWZ A;  3OBW A;  3CCU F;  3E1Y A;  5EWR A;  2JNB A;  1N8R H;  1KC8 H;  3CCS F;  1E7K A;  1YJ9 F;  1K9M H;  3CPQ A;  1KQS F;  2FC3 A;  1YIT F;  3SIV A;  5EO3 A;  1CK2 A;  3CMA F;  3HAX D;  3LWQ C;  3J80 M;  3G6E F;  5A2Q M;  2OTJ F;  3J81 M;  1W41 A;  1VQ7 F;  1W42 A;  3PAF A;  5G4V C;  1KD1 H;  1K8A H;  1DT9 A;  3CPW F;  3PLA C;  3VMF B;  2ALE A;  1T0K B;  3CCL F;  1GZ0 A;  3CCJ F;  5GAP K;  1YHQ F;  3ON1 A;  1SDS A;  4BW0 B; 
#chains in the Genus database with same CATH topology
 1YI2 F;  2CWJ A;  1TVK A;  4X20 B;  3OON A;  4HNA B;  2KTU A;  3KJK A;  5MN5 A;  4C4W C;  5IJ0 A;  3U0O A;  3V7E A;  1W5F A;  2QTP A;  2KG4 A;  3CCR F;  5LOV B;  3HKC A;  2GVI A;  3HKD B;  5JVD B;  5G4U C;  3CG6 A;  3JAS B;  5C8Y A;  4G4V A;  2CZW A;  5FJ4 C;  4F6R A;  3V4D A;  2HRU A;  1S72 F;  3E22 B;  3C9U A;  3N4Z A;  3GHZ A;  3KHN A;  2HQS C;  3N4Y A;  4X1I A;  2QI2 A;  4DRX B;  4YJ3 A;  3E20 B;  1Z5W A;  4WBN A;  1CN7 A;  4M8I A;  3JAT A;  4TV8 B;  3JAM M;  1RQ7 A;  1SA0 A;  5HY4 A;  3UT5 A;  5HXU A;  4ZOL A;  5MN4 A;  4LCK A;  3GTZ A;  2FGY A;  3IEW A;  3S0Y A;  1VQ5 F;  3D54 A;  2G9I A;  2H8E A;  3V7Q A;  4BT4 A;  1JFF A;  1Q82 H;  1RA4 A;  3F0G A;  4X1Y A;  1Q81 H;  3JCM M;  3VI6 A;  3RA6 A;  3IR9 A;  2HS4 A;  2YYE A;  4ZHY B;  3I56 F;  2N48 A;  5IT9 M;  3NK6 A;  4BT3 A;  2UYK A;  2RHH A;  4O2B B;  5J2U B;  3CC7 F;  1JY8 A;  1KNK A;  4IIJ B;  5LXT B;  3WGN A;  2NMU A;  2UZH A;  5J2T B;  5HP7 A;  3CD6 F;  5IJ9 A;  2ZVY A;  1IV4 A;  2LCA A;  2UYP A;  1Z5V A;  2H6L A;  2W8B C;  3ERN A;  1X52 A;  3S03 A;  3JAR A;  5CA0 B;  3ELC A;  3JAK B;  3AGK A;  4TUY B;  2JNB A;  1KC8 H;  2Q1X A;  1CLI A;  3CCS F;  5JQG B;  3C9S A;  5KX5 A;  1R1M A;  3BYQ A;  3KIZ A;  3K2X A;  2UYN B;  3WJP A;  1JD1 A;  2RHO A;  2P6Y A;  2K1S A;  3TD3 A;  4BVR A;  1QD9 A;  3CMA F;  1VK3 A;  4I50 B;  4X1K A;  4O2A A;  3J80 M;  5A2Q M;  3LME A;  3VOA A;  5CA1 A;  1W42 A;  4BVT A;  4FFB A;  5LP6 B;  1DT9 A;  3KJJ A;  3P10 A;  3RYI B;  5HY1 A;  3VMF B;  1W5A A;  1IV3 A;  2HP0 B;  2DYY A;  2ZOV A;  4BVS A;  4KWE A;  4BT2 A;  3JVH A;  5HY0 A;  3CCV F;  2AIZ P;  5GIO C;  3G71 F;  2HP3 A;  1M1K H;  1W40 A;  2Q1Y A;  1TUB A;  1OAP A;  2CHT A;  5MN6 A;  4U3J B;  3QTY A;  3GYQ A;  3M4S A;  3LWR C;  1XV2 A;  4O4L A;  2OHW A;  1DBF A;  1VQ6 F;  4RQO A;  2LBW A;  5JCO A;  3MDO A;  5LA6 B;  5IYZ B;  3V3T A;  1PXW A;  3Q8H A;  3R0P A;  4BT7 A;  3I3F A;  4E6E A;  1SZQ A;  1RLU A;  4EB6 A;  5FNV B;  3LWV C;  2HS3 A;  1JN1 A;  4X3L A;  3WPX A;  2LBT A;  2AIF A;  4YJ2 B;  4C81 A;  5EYP A;  1UI9 A;  2HX0 A;  3LWO C;  1Q7Y H;  5FLX M;  4O4I B;  5ITZ A;  3FD6 A;  4I55 B;  3D00 A;  3NVK E;  1PF5 A;  3CC2 F;  1GO0 A;  2VGN A;  1W2B F;  3RYH B;  4LNU B;  3EOR A;  1YJN F;  1VQ8 F;  3P4E A;  4B45 A;  3OBY A;  3RE3 A;  4O4J B;  3I7T A;  3KE1 A;  4TV9 A;  3RA5 A;  1VQ9 F;  3TD5 A;  4ZI7 A;  2IAF A;  1Q8R A;  4EI8 A;  3L7Q A;  1TVK B;  2CW4 A;  3VYU C;  3WXM B;  3FFM A;  3N2G A;  1JJ2 F;  3CCM F;  1ODE A;  1IPA A;  5IJ0 B;  3C9T A;  3FBA A;  3WGL A;  1U40 A;  2PMP A;  5LP6 C;  1ZWZ A;  3C9R A;  4ZHW A;  3WGK A;  3HKC B;  1N8R H;  5LYJ A;  5GON A;  3WPW A;  4NQ3 A;  4O4H A;  1YJ9 F;  3IKF A;  5BMV A;  3VYS C;  1UFY A;  5EAZ A;  5C8Y B;  2UYJ A;  1OFU A;  1KQS F;  2FC3 A;  3C8L A;  2PHN A;  3SIV A;  4F6R B;  3N2K A;  4IHJ A;  1KNJ A;  5CB4 A;  3HAX D;  2Z1U A;  3ESJ A;  4X1I B;  4YJ3 B;  4WBN B;  3K0T A;  3JAT B;  3M1X A;  1KD1 H;  1SA0 B;  3UT5 B;  3RYC A;  1K8A H;  4ZOL B;  3CPW F;  2ALE A;  2CSL A;  5KMG A;  1T0K B;  3HKB B;  2CHS A;  3IKE A;  3HWU A;  5GAP K;  1JFF B;  1YHQ F;  3ON1 A;  3JAL A;  2H8C A;  2RHL A;  1SDS A;  2ZAU A;  3HKE A;  1XRG A;  5GIN C;  4X1Y B;  1VQ4 F;  3VYT C;  1XBI A;  4I50 A;  1X7O A;  3NK7 A;  5EIB C;  2OZB A;  2RB9 A;  1GX1 A;  3MBM A;  3O85 A;  2ZVZ A;  3RYF A;  1K73 H;  1NJI H;  5DCV A;  4ERH A;  1X25 A;  1FFX A;  1M90 H;  4EI9 A;  1FSZ A;  2HP0 A;  3DDN A;  3QHD A;  1T0A A;  3WGM A;  2R6R 1;  2I6D A;  1YJW F;  3NVI B;  5IJ9 B;  5JH7 A;  1COM A;  1U3L A;  4I4T A;  1ONI A;  2V9Y A;  3B6N A;  2EWC A;  3JAR B;  2DT4 A;  3D01 A;  4C8E A;  1YQN A;  1IV2 A;  4G4X A;  4ZHQ A;  3VOB A;  3JAW A;  5LA6 A;  3T80 A;  1VQL F;  5EZY A;  5KX5 B;  1H48 A;  2BO1 A;  2VAP A;  2R75 1;  2HS0 A;  1QVF F;  1QAH A;  3NMU C;  1YIJ F;  3CYQ A;  4X1K B;  4R40 B;  2OTL F;  4O2A B;  4BVQ A;  5CA1 B;  3VTI C;  3S06 A;  1QVG F;  4X20 A;  4FFB B;  3LFO A;  2ZOD A;  4HNA A;  3WJQ A;  4TZZ A;  1VQN F;  3F0E A;  2Z1F A;  4BT6 A;  2VAM A;  3K12 A;  1W59 A;  3S02 A;  3I55 F;  1U43 A;  1W3E X;  4ZK7 A;  1H7M A;  5LOV A;  1FNK A;  3HKD A;  5JVD A;  1TUB B;  1RLG A;  1X7P A;  3JAS A;  3HJW C;  4G88 A;  2VGM A;  3CC4 F;  2LBX A;  4O4L B;  3SIU A;  5B8F A;  2HRY A;  3OBW A;  3E22 A;  3E1Y A;  4PWT A;  4G4Z A;  4NWO B;  1E7K A;  4EB6 B;  4DRX A;  5AVM A;  3ZOP A;  4TV8 A;  2Z1T A;  3MCQ A;  4U39 A;  5EYP B;  5EO3 A;  1YGY A;  1CK2 A;  3IEQ A;  5HP8 A;  2OTJ F;  5ITZ B;  1VHA A;  2BTO A;  5HY2 A;  5G4V C;  4G4W A;  1VH8 A;  3PLA C;  2Z1E A;  3WGJ A;  4DXD A;  1J7H A;  3TD4 A;  3CCJ F;  2OTM A;  3ZO8 A;  1GZ0 A;  4O2B A;  3ZP4 A;  5J2U A;  2ZF8 A;  4C8G A;  3K14 A;  4XCQ A;  2KTV A;  2L26 A;  3FPI A;  4IIJ A;  3WJR A;  5LXT A;  2QEX F;  5J2T A;  1QU9 A;  2YXZ A;  4TV9 B;  4B46 A;  4BY9 D;  2I6R A;  3LDT A;  3P0Z A;  1VQP F;  1GO1 A;  4ZI7 B;  3F6M A;  4NUT A;  5CA0 A;  3HKB A;  3JAK A;  5HWE A;  2VAW A;  4TUY A;  3FD5 A;  3VIU A;  1W55 A;  3N2G B;  4C8I A;  5JQG A;  3CB2 A;  5EB0 A;  3ZP7 A;  1W5B A;  2UYN A;  1VQK F;  5HXZ A;  4B62 A;  1VQO F;  2GZL A;  1Q86 H;  3CME F;  1RQ2 A;  2HVY D;  5LYJ B;  5GON B;  1FNJ A;  4O4H B;  4B5C A;  2QA4 F;  5BMV B;  2BTQ B;  3LWP C;  3CXC F;  3CCE F;  2BTU A;  2WAL A;  5LP6 A;  3MQW A;  3RYI A;  2MQE A;  3N2K B;  3CCQ F;  4IHJ B;  4ZHV A;  1H47 A;  5CB4 B;  3MCA B;  5JCO C;  3QUW A;  1U3P A;  2IQQ A;  4X3M A;  1NQ3 A;  3RYC B;  3OW2 F;  2VXY A;  4U3J A;  5KMG B;  2KGW A;  2F9Z C;  5EB1 B;  3G4S F;  3F0F A;  3J7A R;  1NMU B;  5GAN K;  3JAL B;  5GIP C;  3HKE B;  5IYZ A;  3S0H A;  1XHO A;  2AMT A;  5FNV A;  2CVL A;  3RYF B;  4YJ2 A;  1FFX B;  3IMP A;  1VQM F;  4G4Y A;  4RHA A;  2IG8 A;  5EIB D;  3VCZ A;  3CCU F;  5EWR A;  2GLZ A;  4O4I A;  1K9M H;  3CPQ A;  5JH7 B;  3CYP B;  4I55 A;  4I4T B;  1YIT F;  3DC2 A;  3S0W A;  3HTN A;  2RHJ A;  3LYB A;  2B33 A;  3RYH A;  4LNU A;  4BT5 A;  1VQV A;  4ZHQ B;  3JAW B;  3M84 A;  3LWQ C;  3G6E F;  5EZY B;  3F0D A;  3J81 M;  4O4J A;  1W41 A;  1W5E A;  1VQ7 F;  3PAF A;  4EI7 A;  1IV1 A;  3CCL F;  4C82 A;  1W58 1;  2Z01 A;  3VO8 A;  1W57 A;  4BW0 B; 
#chains in the Genus database with same CATH homology
 1YI2 F;  5HY0 A;  3CCV F;  5GIN C;  4XCQ A;  5GIO C;  3G71 F;  1XBI A;  2KTV A;  1VQ4 F;  1X7O A;  3NK7 A;  2QEX F;  1M1K H;  1W40 A;  2KTU A;  4BY9 D;  2OZB A;  3GYQ A;  1NJI H;  3O85 A;  1VQP F;  4C4W C;  3LWR C;  1K73 H;  1GO1 A;  5DCV A;  3V7E A;  2OHW A;  1VQ6 F;  4NUT A;  2LBW A;  1M90 H;  5HWE A;  4EI9 A;  3V3T A;  1PXW A;  2KG4 A;  3CCR F;  5G4U C;  3CG6 A;  2I6D A;  1YJW F;  3NVI B;  3LWV C;  4X3L A;  2AIF A;  2CZW A;  1VQK F;  5HXZ A;  3LWO C;  1VQO F;  1Q7Y H;  5FJ4 C;  1Q86 H;  3CME F;  1S72 F;  3N4Z A;  2HVY D;  5FLX M;  3N4Y A;  1VQL F;  2QI2 A;  2QA4 F;  3LWP C;  3E20 B;  3CXC F;  1CN7 A;  3CCE F;  3D00 A;  3NVK E;  3JAM M;  2WAL A;  5HY4 A;  5HXU A;  3CC2 F;  1GO0 A;  2BO1 A;  2VGN A;  1W2B F;  4LCK A;  3CCQ F;  2FGY A;  1YJN F;  1QVF F;  1VQ5 F;  1VQ8 F;  3NMU C;  3V7Q A;  1YIJ F;  3MCA B;  1Q82 H;  2OTL F;  4BVQ A;  3OBY A;  1RA4 A;  1Q81 H;  4X3M A;  3JCM M;  1QVG F;  3VI6 A;  3LFO A;  3RA6 A;  3IR9 A;  3OW2 F;  4TZZ A;  1VQN F;  3RA5 A;  1VQ9 F;  2F9Z C;  3I56 F;  3G4S F;  5IT9 M;  3I55 F;  3J7A R;  3NK6 A;  4EI8 A;  1NMU B;  1W3E X;  5GAN K;  5GIP C;  1H7M A;  3CC7 F;  3WXM B;  3FFM A;  3CD6 F;  1JJ2 F;  3CCM F;  1RLG A;  1X7P A;  3HJW C;  1IPA A;  2VGM A;  3CC4 F;  2LBX A;  1X52 A;  3SIU A;  1VQM F;  3AGK A;  1ZWZ A;  3OBW A;  3CCU F;  3E1Y A;  5EWR A;  2JNB A;  1N8R H;  1KC8 H;  2GLZ A;  3CCS F;  4NQ3 A;  1YJ9 F;  1E7K A;  1K9M H;  3CPQ A;  1KQS F;  2FC3 A;  1YIT F;  3SIV A;  5EO3 A;  4BVR A;  1CK2 A;  3CMA F;  3HAX D;  3LWQ C;  3J80 M;  3G6E F;  5A2Q M;  2OTJ F;  3J81 M;  1W41 A;  1VQ7 F;  1W42 A;  3PAF A;  4BVT A;  4EI7 A;  5HY2 A;  5G4V C;  1KD1 H;  1K8A H;  1DT9 A;  3CPW F;  3PLA C;  5HY1 A;  3VMF B;  2ALE A;  1T0K B;  3CCL F;  1GZ0 A;  3CCJ F;  4BVS A;  5GAP K;  1YHQ F;  3ON1 A;  1SDS A;  4BW0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...