1E7KA

Crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 15.5 KD RNA BINDING PROTEIN
publication title Crystal Structure of the Spliceosomal 15.5Kd Protein Bound to a U4 Snrna Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 38
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1e7kA00
1RLGA 3E20B 1T0KB 3NK6A 2FC3A 1Q7YH 1VQLF 5GIPC 3VI6A 4C4WC 3CG6A 3OBYA 3CCQF 5DCVA 1M90H 1PXWA 1CN7A 3LWQC 1SDSA 1X52A 3N4YA 3CCEF 4BW0B 1NJIH 3RA5A 1VQ5F 3J7AR 2CZWA 1GZ0A 3CPWF 3CMAF 3LFOA 3J81M 2QA4F 1YITF 3G6EF 1JJ2F 4BY9D 1VQ9F 3CCLF 3NK7A 1VQNF 1K9MH 1VQ6F 1M1KH 1VQMF 1S72F 4X3MA 3VMFB 2I6DA 1W40A 3HJWC 5G4UC 3CMEF 3O85A 3PLAC 1W42A 1Q82H 1VQ8F 3JAMM 5GIOC 1YIJF 1Q81H 1KC8H 3NMUC 2KTUA 1E7KA 1VQPF 1GO0A 1QVGF 3NVIB 5EO3A 3LWRC 3RA6A 3SIUA 2VGNA 2OTJF 2ALEA 1W41A 3G4SF 5FLXM 1VQOF 1YJWF 3CD6F 1X7OA 3NVKE 1X7PA 1VQKF 3I55F 1W2BF 1KD1H 3CC4F 5G4VC 3CC2F 3FFMA 3V7EA 1K73H 3CCJF 2VGMA 5EWRA 3CC7F 1ZWZA 2LBWA 3PAFA 3CCMF 1VQ4F 3CCVF 1H7MA 2JNBA 2QI2A 4NUTA 4TZZA 2OTLF 3HAXD 1GO1A 3GYQA 3MCAB 3V7QA 3LWVC 2OHWA 1QVFF 1YJ9F 3CCRF 3I56F 1YI2F 3CPQA 2BO1A 3N4ZA 1NMUB 1XBIA 3LWOC 1VQ7F 5FJ4C 2AIFA 5GANK 5GAPK 1YHQF 3CCSF 1DT9A 3CXCF 3JCMM 1W3EX 3G71F 3OW2F 1RA4A 2KTVA 3LWPC 5IT9M 1K8AH 1N8RH 2LBXA 2QEXF 2KG4A 3J80M 1CK2A 3IR9A 1Q86H 4LCKA 3WXMB 2OZBA 1IPAA 2WALA 3OBWA 1YJNF 3E1YA 3AGKA 5A2QM 4X3LA 3SIVA 3CCUF 2HVYD 5GINC 1KQSF 3ON1A
chains in the Genus database with same CATH superfamily
3R0PA 1U43A 5GONA 5HY0A 1PF5A 4ZOLB 1TUBA 4M8IA 5GIPC 5KX5A 1VHAA 2HS0A 1M90H 3S03A 5LXTA 1CN7A 1NJIH 3RA5A 5ITZA 4BVQA 1JN1A 4NWOB 4ZHWA 4B45A 5LA6A 3CPWF 2Z01A 5JH7A 1YITF 3G6EF 1JJ2F 1VQ9F 3CCLF 3NK7A 4O4LA 1VQNF 4BT2A 2ZOVA 1W40A 2DYYA 2ZODA 3CB2A 3K0TA 3MDOA 3WJQA 3KJJA 1FSZA 3VYUC 3ZP7A 1CLIA 1KC8H 3IEWA 1E7KA 1VQPF 2GZLA 3RYCB 3SIUA 3D54A 4X1YB 3DDNA 2P6YA 1W41A 3E22A 1U3PA 3G4SF 4F6RB 4O4JB 3ESJA 3DC2A 4X20A 3UT5B 1X7PA 3NVKE 1KD1H 5JQGA 2HS3A 4BT5A 3FFMA 3V7EA 4RHAA 1W5AA 2VGMA 3CC7F 1UFYA 3ZOPA 1ZWZA 5J2UB 3PAFA 3ELCA 3GHZA 5CA0B 4BT3A 5FNVB 3JALA 4TUYB 3P0ZA 2QI2A 4FFBA 4NUTA 1SA0A 3FBAA 3JVHA 3Q8HA 5IJ9A 2MQEA 3GYQA 3N2GB 3V7QA 5EIBD 3F0EA 5LP6B 1YJ9F 3RYFB 2IQQA 1YI2F 5IJ0B 4YJ2A 1XBIA 4X1IB 4C8EA 2RHLA 5GANK 2CHSA 3WPXA 3I3FA 4ZI7A 5GAPK 3HKCB 1W3EX 3B6NA 4I50A 1YGYA 5CA1B 5KMGA 3HKBB 1Q86H 1W581 3TD4A 3RYHA 2OZBA 1Z5WA 3JAWA 3C9TA 2N48A 1Z5VA 2F9ZC 1GX1A 1NQ3A 4BVSA 3CCUF 2HVYD 3JAKB 1XRGA 1DBFA 4LNUB 4TV8A 2HP0A 3JASB 2ZF8A 5LYJB 1RLGA 1T0KB 1FFXB 3L7QA 1VQLF 2Z1EA 4IIJB 3S0WA 3CG6A 3K12A 3VTIC 2ZVZA 3ZO8A 5CB4A 1JFFA 1R1MA 4YJ3B 3CYQA 1PXWA 1SDSA 3N4YA 2ZAUA 1VQ5F 3F0FA 3HKEB 3M1XA 2CZWA 4EB6B 3LFOA 2IG8A 1U40A 5EYPB 4U3JB 1K9MH 1XHOA 5EZYA 4EI8A 1S72F 4X3MA 3VYSC 4O2AB 4ZHQB 5GONB 5G4UC 1W42A 1TUBB 1Q82H 5C8YA 3WJPA 4BT4A 5KX5B 3HKDA 1ODEA 1YIJF 1OFUA 4I4TA 2I6RA 1QVGF 5EO3A 5LXTB 3RA6A 5HY4A 5JVDB 2VGNA 4I55B 4ZHVA 2OTJF 2UZHA 3WGLA 5LA6B 3ERNA 2UYKA 2VAWA 3CC4F 5G4VC 3CC2F 3LDTA 2CSLA 4RQOA 3CCMF 2QTPA 4O4IA 5MN4A 3D00A 4G4YA 3JARA 1QU9A 4TZZA 1GO1A 4DRXA 5BMVB 2HQSC 2OHWA 4B5CA 1QVFF 1W5BA 1XV2A 3QTYA 2BTUA 3E22B 4ZK7A 4G4XA 3MBMA 1OAPA 2UYPA 2H6LA 3JATB 5JQGB 4DXDA 3GTZA 3V4DA 1DT9A 5MN6A 4TV9A 3C9SA 3VIUA 2VAMA 3JCMM 3M84A 5EB1B 3RE3A 3CXCF 4EI9A 3RYCA 3K2XA 3HTNA 5EB0A 3VCZA 1K8AH 1SA0B 1N8RH 3HWUA 2LBXA 2CVLA 3F6MA 1ONIA 5IJ9B 2QEXF 4E6EA 3WXMB 2R751 2WALA 3TD5A 5LP6C 5HWEA 2DT4A 3SIVA 3BYQA 5AVMA 4YJ2B 4ERHA 4WBNB 2VXYA 4O2BB 3ON1A 4BVTA 3N2KB 3LMEA 2LBTA 1FNKA 2FC3A 5FNVA 4ZI7B 3T80A 3VI6A 3S02A 4C4WC 3CYPB 3OBYA 2BTOA 1W5EA 2HRUA 4BT6A 3CCQF 5DCVA 2V9YA 2K1SA 4X1KA 4IHJB 3LWQC 5HP8A 3CCEF 1UI9A 1GZ0A 2UYNB 4PWTA 4X1IA 4C8GA 5HY1A 3RYHB 5B8FA 2H8CA 3KJKA 3JAWB 2QA4F 3IEQA 5J2TA 4BY9D 2CW4A 2CWJA 3QHDA 1VQMF 3VMFB 2I6DA 5EAZA 5IYZB 3HJWC 2HP0B 2GLZA 2R6R1 3CMEF 3O85A 1VQ8F 3C8LA 3WGMA 5GIOC 3P4EA 3LYBA 4HNAA 4O4HB 2KTUA 1Q81H 5JCOC 1QAHA 3IKFA 3V3TA 1GO0A 1FNJA 1RQ2A 3VOAA 2HP3A 2CHTA 3RYIA 2VAPA 1YJWF 3JAKA 4LNUA 2HRYA 3M4SA 1X7OA 1FFXA 3I55F 1W2BF 1COMA 3MCQA 3QUWA 4IIJA 5EWRA 2Z1FA 3FD5A 2HS4A 3C9RA 2RHOA 2LBWA 5LOVA 1VQ4F 4R40B 2EWCA 1TVKA 1IV2A 2JNBA 4C81A 1W59A 5C8YB 4EI7A 3C9UA 3HKDB 1RLUA 2RB9A 4I4TB 3K14A 1JD1A 3OONA 3WPWA 4U3JA 3CPQA 5ITZB 3N4ZA 4B62A 1NMUB 4XCQA 2YYEA 1U3LA 5JH7B 1RQ7A 2GVIA 5HXUA 4ZOLA 2G9IA 4O4LB 1YHQF 2AMTA 3OW2F 2B33A 1RA4A 1YQNA 2KTVA 4O4IB 3LWPC 5IT9M 3JARB 5JVDA 4I55A 5HY2A 1QD9A 1CK2A 3D01A 3IR9A 4LCKA 4C8IA 4DRXB 1IPAA 4BVRA 3S06A 1YJNF 3E1YA 3AGKA 5A2QM 5GINC 1J7HA 4X20B 3E20B 2BTQB 1W55A 1VK3A 3IKEA 3NK6A 1Q7YH 1VH8A 3F0DA 1W5FA 2H8EA 1JY8A 4TV9B 4U39A 5BMVA 2HX0A 2OTMA 3JALB 4X1YA 4FFBB 1X52A 4G4VA 4BW0B 4F6RA 3J7AR 4O4JA 2LCAA 3S0HA 3TD3A 3CMAF 1Q8RA 3UT5A 3J81M 1W57A 1IV1A 1X25A 3JATA 3I7TA 3EORA 2Z1UA 2NMUA 5HXZA 1M1KH 1VQ6F 5J2UA 3FPIA 2PHNA 5CA0A 2UYJA 4BT7A 4TUYA 3PLAC 2L26A 3U0OA 1KNJA 1KNKA 3N2GA 3JAMM 3NMUC 5LP6A 4I50B 3RYFA 3NVIB 4X1KB 3LWRC 5IJ0A 3P10A 4G4WA 2ALEA 1IV3A 5KMGB 5FLXM 4WBNA 1VQOF 4O2BA 3N2KA 3VO8A 3WGNA 3CD6F 1VQKF 1K73H 5J2TB 3CCJF 5EIBC 3WGKA 3HKCA 2RHJA 3VYTC 2PMPA 4TV8B 3CCVF 1H7MA 5HP7A 3ZP4A 5CA1A 4IHJA 4KWEA 3IMPA 2OTLF 3HKBA 3HAXD 3WGJA 3LWVC 3MCAB 4ZHQA 2UYNA 5CB4B 2AIZP 4HNAB 1JFFB 3S0YA 2YXZA 3CCRF 3I56F 2Q1XA 3KIZA 1IV4A 2BO1A 5MN5A 3RYIB 4NQ3A 2ZVYA 2IAFA 3LWOC 1H47A 3FD6A 3KHNA 4G88A 5LYJA 3JASA 1VQ7F 5IYZA 5FJ4C 2AIFA 3F0GA 5EZYB 2Q1YA 2KGWA 3KE1A 3CCSF 5JCOA 4B46A 5LOVB 2Z1TA 4O4HA 4ZHYB 4YJ3A 3G71F 1H48A 2W8BC 2RHHA 1TVKB 4G4ZA 2KG4A 3HKEA 2FGYA 1VQVA 4EB6A 3J80M 4C82A 3OBWA 5EYPA 1T0AA 3MQWA 1SZQA 4X3LA 3WJRA 3VOBA 1KQSF 4O2AA
chains in the Genus database with same CATH topology
1RLGA 3E20B 1T0KB 5HY0A 3NK6A 2FC3A 1Q7YH 1VQLF 5GIPC 3VI6A 4C4WC 3CG6A 3OBYA 3CCQF 5DCVA 1M90H 1PXWA 1CN7A 3LWQC 1SDSA 1X52A 3N4YA 3CCEF 4BW0B 1NJIH 3RA5A 4BVQA 1VQ5F 3J7AR 2CZWA 1GZ0A 3CPWF 5HY1A 3CMAF 3LFOA 3J81M 2QA4F 1YITF 3G6EF 1JJ2F 4BY9D 1VQ9F 3CCLF 3NK7A 1VQNF 1K9MH 1VQ6F 5HXZA 1M1KH 4EI8A 1VQMF 1S72F 4X3MA 3VMFB 2I6DA 1W40A 3HJWC 2GLZA 5G4UC 3CMEF 3O85A 3PLAC 1W42A 1Q82H 1VQ8F 3JAMM 5GIOC 1YIJF 1Q81H 1KC8H 3NMUC 2KTUA 1E7KA 3V3TA 1VQPF 1GO0A 1QVGF 3NVIB 5EO3A 3LWRC 3RA6A 5HY4A 3SIUA 2VGNA 2OTJF 2ALEA 1W41A 3G4SF 5FLXM 1VQOF 1YJWF 3CD6F 1X7OA 3NVKE 1X7PA 1VQKF 3I55F 1W2BF 1KD1H 3CC4F 5G4VC 3CC2F 3FFMA 3V7EA 1K73H 3CCJF 2VGMA 5EWRA 3CC7F 1ZWZA 2LBWA 3PAFA 3CCMF 1VQ4F 3CCVF 1H7MA 3D00A 2JNBA 2QI2A 4NUTA 4EI7A 4TZZA 2OTLF 3HAXD 1GO1A 3GYQA 3MCAB 3V7QA 3LWVC 2OHWA 1QVFF 1YJ9F 3CCRF 3I56F 1YI2F 3CPQA 2BO1A 3N4ZA 4NQ3A 1NMUB 4XCQA 1XBIA 3LWOC 1VQ7F 5FJ4C 2AIFA 5HXUA 5GANK 5GAPK 1YHQF 3CCSF 1DT9A 3CXCF 3JCMM 1W3EX 3G71F 3OW2F 1RA4A 2KTVA 4EI9A 3LWPC 5IT9M 1K8AH 5HY2A 1N8RH 2LBXA 2QEXF 2KG4A 3J80M 1CK2A 2FGYA 3IR9A 1Q86H 4LCKA 3WXMB 2OZBA 1IPAA 2WALA 3OBWA 4BVRA 5HWEA 1YJNF 3E1YA 3AGKA 5A2QM 4X3LA 2F9ZC 3SIVA 3CCUF 4BVSA 2HVYD 5GINC 1KQSF 4BVTA 3ON1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLG A;  3E20 B;  1T0K B;  3NK6 A;  2FC3 A;  1Q7Y H;  1VQL F;  5GIP C;  3VI6 A;  4C4W C;  3CG6 A;  3OBY A;  3CCQ F;  5DCV A;  1M90 H;  1PXW A;  1CN7 A;  3LWQ C;  1SDS A;  1X52 A;  3N4Y A;  3CCE F;  4BW0 B;  1NJI H;  3RA5 A;  1VQ5 F;  3J7A R;  2CZW A;  1GZ0 A;  3CPW F;  3CMA F;  3LFO A;  3J81 M;  2QA4 F;  1YIT F;  3G6E F;  1JJ2 F;  4BY9 D;  1VQ9 F;  3CCL F;  3NK7 A;  1VQN F;  1K9M H;  1VQ6 F;  1M1K H;  1VQM F;  1S72 F;  4X3M A;  3VMF B;  2I6D A;  1W40 A;  3HJW C;  5G4U C;  3CME F;  3O85 A;  3PLA C;  1W42 A;  1Q82 H;  1VQ8 F;  3JAM M;  5GIO C;  1YIJ F;  1Q81 H;  1KC8 H;  3NMU C;  2KTU A;  1E7K A;  1VQP F;  1GO0 A;  1QVG F;  3NVI B;  5EO3 A;  3LWR C;  3RA6 A;  3SIU A;  2VGN A;  2OTJ F;  2ALE A;  1W41 A;  3G4S F;  5FLX M;  1VQO F;  1YJW F;  3CD6 F;  1X7O A;  3NVK E;  1X7P A;  1VQK F;  3I55 F;  1W2B F;  1KD1 H;  3CC4 F;  5G4V C;  3CC2 F;  3FFM A;  3V7E A;  1K73 H;  3CCJ F;  2VGM A;  5EWR A;  3CC7 F;  1ZWZ A;  2LBW A;  3PAF A;  3CCM F;  1VQ4 F;  3CCV F;  1H7M A;  2JNB A;  2QI2 A;  4NUT A;  4TZZ A;  2OTL F;  3HAX D;  1GO1 A;  3GYQ A;  3MCA B;  3V7Q A;  3LWV C;  2OHW A;  1QVF F;  1YJ9 F;  3CCR F;  3I56 F;  1YI2 F;  3CPQ A;  2BO1 A;  3N4Z A;  1NMU B;  1XBI A;  3LWO C;  1VQ7 F;  5FJ4 C;  2AIF A;  5GAN K;  5GAP K;  1YHQ F;  3CCS F;  1DT9 A;  3CXC F;  3JCM M;  1W3E X;  3G71 F;  3OW2 F;  1RA4 A;  2KTV A;  3LWP C;  5IT9 M;  1K8A H;  1N8R H;  2LBX A;  2QEX F;  2KG4 A;  3J80 M;  1CK2 A;  3IR9 A;  1Q86 H;  4LCK A;  3WXM B;  2OZB A;  1IPA A;  2WAL A;  3OBW A;  1YJN F;  3E1Y A;  3AGK A;  5A2Q M;  4X3L A;  3SIV A;  3CCU F;  2HVY D;  5GIN C;  1KQS F;  3ON1 A; 
#chains in the Genus database with same CATH topology
 3R0P A;  1U43 A;  5GON A;  5HY0 A;  1PF5 A;  4ZOL B;  1TUB A;  4M8I A;  5GIP C;  5KX5 A;  1VHA A;  2HS0 A;  1M90 H;  3S03 A;  5LXT A;  1CN7 A;  1NJI H;  3RA5 A;  5ITZ A;  4BVQ A;  1JN1 A;  4NWO B;  4ZHW A;  4B45 A;  5LA6 A;  3CPW F;  2Z01 A;  5JH7 A;  1YIT F;  3G6E F;  1JJ2 F;  1VQ9 F;  3CCL F;  3NK7 A;  4O4L A;  1VQN F;  4BT2 A;  2ZOV A;  1W40 A;  2DYY A;  2ZOD A;  3CB2 A;  3K0T A;  3MDO A;  3WJQ A;  3KJJ A;  1FSZ A;  3VYU C;  3ZP7 A;  1CLI A;  1KC8 H;  3IEW A;  1E7K A;  1VQP F;  2GZL A;  3RYC B;  3SIU A;  3D54 A;  4X1Y B;  3DDN A;  2P6Y A;  1W41 A;  3E22 A;  1U3P A;  3G4S F;  4F6R B;  4O4J B;  3ESJ A;  3DC2 A;  4X20 A;  3UT5 B;  1X7P A;  3NVK E;  1KD1 H;  5JQG A;  2HS3 A;  4BT5 A;  3FFM A;  3V7E A;  4RHA A;  1W5A A;  2VGM A;  3CC7 F;  1UFY A;  3ZOP A;  1ZWZ A;  5J2U B;  3PAF A;  3ELC A;  3GHZ A;  5CA0 B;  4BT3 A;  5FNV B;  3JAL A;  4TUY B;  3P0Z A;  2QI2 A;  4FFB A;  4NUT A;  1SA0 A;  3FBA A;  3JVH A;  3Q8H A;  5IJ9 A;  2MQE A;  3GYQ A;  3N2G B;  3V7Q A;  5EIB D;  3F0E A;  5LP6 B;  1YJ9 F;  3RYF B;  2IQQ A;  1YI2 F;  5IJ0 B;  4YJ2 A;  1XBI A;  4X1I B;  4C8E A;  2RHL A;  5GAN K;  2CHS A;  3WPX A;  3I3F A;  4ZI7 A;  5GAP K;  3HKC B;  1W3E X;  3B6N A;  4I50 A;  1YGY A;  5CA1 B;  5KMG A;  3HKB B;  1Q86 H;  1W58 1;  3TD4 A;  3RYH A;  2OZB A;  1Z5W A;  3JAW A;  3C9T A;  2N48 A;  1Z5V A;  2F9Z C;  1GX1 A;  1NQ3 A;  4BVS A;  3CCU F;  2HVY D;  3JAK B;  1XRG A;  1DBF A;  4LNU B;  4TV8 A;  2HP0 A;  3JAS B;  2ZF8 A;  5LYJ B;  1RLG A;  1T0K B;  1FFX B;  3L7Q A;  1VQL F;  2Z1E A;  4IIJ B;  3S0W A;  3CG6 A;  3K12 A;  3VTI C;  2ZVZ A;  3ZO8 A;  5CB4 A;  1JFF A;  1R1M A;  4YJ3 B;  3CYQ A;  1PXW A;  1SDS A;  3N4Y A;  2ZAU A;  1VQ5 F;  3F0F A;  3HKE B;  3M1X A;  2CZW A;  4EB6 B;  3LFO A;  2IG8 A;  1U40 A;  5EYP B;  4U3J B;  1K9M H;  1XHO A;  5EZY A;  4EI8 A;  1S72 F;  4X3M A;  3VYS C;  4O2A B;  4ZHQ B;  5GON B;  5G4U C;  1W42 A;  1TUB B;  1Q82 H;  5C8Y A;  3WJP A;  4BT4 A;  5KX5 B;  3HKD A;  1ODE A;  1YIJ F;  1OFU A;  4I4T A;  2I6R A;  1QVG F;  5EO3 A;  5LXT B;  3RA6 A;  5HY4 A;  5JVD B;  2VGN A;  4I55 B;  4ZHV A;  2OTJ F;  2UZH A;  3WGL A;  5LA6 B;  3ERN A;  2UYK A;  2VAW A;  3CC4 F;  5G4V C;  3CC2 F;  3LDT A;  2CSL A;  4RQO A;  3CCM F;  2QTP A;  4O4I A;  5MN4 A;  3D00 A;  4G4Y A;  3JAR A;  1QU9 A;  4TZZ A;  1GO1 A;  4DRX A;  5BMV B;  2HQS C;  2OHW A;  4B5C A;  1QVF F;  1W5B A;  1XV2 A;  3QTY A;  2BTU A;  3E22 B;  4ZK7 A;  4G4X A;  3MBM A;  1OAP A;  2UYP A;  2H6L A;  3JAT B;  5JQG B;  4DXD A;  3GTZ A;  3V4D A;  1DT9 A;  5MN6 A;  4TV9 A;  3C9S A;  3VIU A;  2VAM A;  3JCM M;  3M84 A;  5EB1 B;  3RE3 A;  3CXC F;  4EI9 A;  3RYC A;  3K2X A;  3HTN A;  5EB0 A;  3VCZ A;  1K8A H;  1SA0 B;  1N8R H;  3HWU A;  2LBX A;  2CVL A;  3F6M A;  1ONI A;  5IJ9 B;  2QEX F;  4E6E A;  3WXM B;  2R75 1;  2WAL A;  3TD5 A;  5LP6 C;  5HWE A;  2DT4 A;  3SIV A;  3BYQ A;  5AVM A;  4YJ2 B;  4ERH A;  4WBN B;  2VXY A;  4O2B B;  3ON1 A;  4BVT A;  3N2K B;  3LME A;  2LBT A;  1FNK A;  2FC3 A;  5FNV A;  4ZI7 B;  3T80 A;  3VI6 A;  3S02 A;  4C4W C;  3CYP B;  3OBY A;  2BTO A;  1W5E A;  2HRU A;  4BT6 A;  3CCQ F;  5DCV A;  2V9Y A;  2K1S A;  4X1K A;  4IHJ B;  3LWQ C;  5HP8 A;  3CCE F;  1UI9 A;  1GZ0 A;  2UYN B;  4PWT A;  4X1I A;  4C8G A;  5HY1 A;  3RYH B;  5B8F A;  2H8C A;  3KJK A;  3JAW B;  2QA4 F;  3IEQ A;  5J2T A;  4BY9 D;  2CW4 A;  2CWJ A;  3QHD A;  1VQM F;  3VMF B;  2I6D A;  5EAZ A;  5IYZ B;  3HJW C;  2HP0 B;  2GLZ A;  2R6R 1;  3CME F;  3O85 A;  1VQ8 F;  3C8L A;  3WGM A;  5GIO C;  3P4E A;  3LYB A;  4HNA A;  4O4H B;  2KTU A;  1Q81 H;  5JCO C;  1QAH A;  3IKF A;  3V3T A;  1GO0 A;  1FNJ A;  1RQ2 A;  3VOA A;  2HP3 A;  2CHT A;  3RYI A;  2VAP A;  1YJW F;  3JAK A;  4LNU A;  2HRY A;  3M4S A;  1X7O A;  1FFX A;  3I55 F;  1W2B F;  1COM A;  3MCQ A;  3QUW A;  4IIJ A;  5EWR A;  2Z1F A;  3FD5 A;  2HS4 A;  3C9R A;  2RHO A;  2LBW A;  5LOV A;  1VQ4 F;  4R40 B;  2EWC A;  1TVK A;  1IV2 A;  2JNB A;  4C81 A;  1W59 A;  5C8Y B;  4EI7 A;  3C9U A;  3HKD B;  1RLU A;  2RB9 A;  4I4T B;  3K14 A;  1JD1 A;  3OON A;  3WPW A;  4U3J A;  3CPQ A;  5ITZ B;  3N4Z A;  4B62 A;  1NMU B;  4XCQ A;  2YYE A;  1U3L A;  5JH7 B;  1RQ7 A;  2GVI A;  5HXU A;  4ZOL A;  2G9I A;  4O4L B;  1YHQ F;  2AMT A;  3OW2 F;  2B33 A;  1RA4 A;  1YQN A;  2KTV A;  4O4I B;  3LWP C;  5IT9 M;  3JAR B;  5JVD A;  4I55 A;  5HY2 A;  1QD9 A;  1CK2 A;  3D01 A;  3IR9 A;  4LCK A;  4C8I A;  4DRX B;  1IPA A;  4BVR A;  3S06 A;  1YJN F;  3E1Y A;  3AGK A;  5A2Q M;  5GIN C;  1J7H A;  4X20 B;  3E20 B;  2BTQ B;  1W55 A;  1VK3 A;  3IKE A;  3NK6 A;  1Q7Y H;  1VH8 A;  3F0D A;  1W5F A;  2H8E A;  1JY8 A;  4TV9 B;  4U39 A;  5BMV A;  2HX0 A;  2OTM A;  3JAL B;  4X1Y A;  4FFB B;  1X52 A;  4G4V A;  4BW0 B;  4F6R A;  3J7A R;  4O4J A;  2LCA A;  3S0H A;  3TD3 A;  3CMA F;  1Q8R A;  3UT5 A;  3J81 M;  1W57 A;  1IV1 A;  1X25 A;  3JAT A;  3I7T A;  3EOR A;  2Z1U A;  2NMU A;  5HXZ A;  1M1K H;  1VQ6 F;  5J2U A;  3FPI A;  2PHN A;  5CA0 A;  2UYJ A;  4BT7 A;  4TUY A;  3PLA C;  2L26 A;  3U0O A;  1KNJ A;  1KNK A;  3N2G A;  3JAM M;  3NMU C;  5LP6 A;  4I50 B;  3RYF A;  3NVI B;  4X1K B;  3LWR C;  5IJ0 A;  3P10 A;  4G4W A;  2ALE A;  1IV3 A;  5KMG B;  5FLX M;  4WBN A;  1VQO F;  4O2B A;  3N2K A;  3VO8 A;  3WGN A;  3CD6 F;  1VQK F;  1K73 H;  5J2T B;  3CCJ F;  5EIB C;  3WGK A;  3HKC A;  2RHJ A;  3VYT C;  2PMP A;  4TV8 B;  3CCV F;  1H7M A;  5HP7 A;  3ZP4 A;  5CA1 A;  4IHJ A;  4KWE A;  3IMP A;  2OTL F;  3HKB A;  3HAX D;  3WGJ A;  3LWV C;  3MCA B;  4ZHQ A;  2UYN A;  5CB4 B;  2AIZ P;  4HNA B;  1JFF B;  3S0Y A;  2YXZ A;  3CCR F;  3I56 F;  2Q1X A;  3KIZ A;  1IV4 A;  2BO1 A;  5MN5 A;  3RYI B;  4NQ3 A;  2ZVY A;  2IAF A;  3LWO C;  1H47 A;  3FD6 A;  3KHN A;  4G88 A;  5LYJ A;  3JAS A;  1VQ7 F;  5IYZ A;  5FJ4 C;  2AIF A;  3F0G A;  5EZY B;  2Q1Y A;  2KGW A;  3KE1 A;  3CCS F;  5JCO A;  4B46 A;  5LOV B;  2Z1T A;  4O4H A;  4ZHY B;  4YJ3 A;  3G71 F;  1H48 A;  2W8B C;  2RHH A;  1TVK B;  4G4Z A;  2KG4 A;  3HKE A;  2FGY A;  1VQV A;  4EB6 A;  3J80 M;  4C82 A;  3OBW A;  5EYP A;  1T0A A;  3MQW A;  1SZQ A;  4X3L A;  3WJR A;  3VOB A;  1KQS F;  4O2A A; 
#chains in the Genus database with same CATH homology
 1RLG A;  3E20 B;  1T0K B;  5HY0 A;  3NK6 A;  2FC3 A;  1Q7Y H;  1VQL F;  5GIP C;  3VI6 A;  4C4W C;  3CG6 A;  3OBY A;  3CCQ F;  5DCV A;  1M90 H;  1PXW A;  1CN7 A;  3LWQ C;  1SDS A;  1X52 A;  3N4Y A;  3CCE F;  4BW0 B;  1NJI H;  3RA5 A;  4BVQ A;  1VQ5 F;  3J7A R;  2CZW A;  1GZ0 A;  3CPW F;  5HY1 A;  3CMA F;  3LFO A;  3J81 M;  2QA4 F;  1YIT F;  3G6E F;  1JJ2 F;  4BY9 D;  1VQ9 F;  3CCL F;  3NK7 A;  1VQN F;  1K9M H;  1VQ6 F;  5HXZ A;  1M1K H;  4EI8 A;  1VQM F;  1S72 F;  4X3M A;  3VMF B;  2I6D A;  1W40 A;  3HJW C;  2GLZ A;  5G4U C;  3CME F;  3O85 A;  3PLA C;  1W42 A;  1Q82 H;  1VQ8 F;  3JAM M;  5GIO C;  1YIJ F;  1Q81 H;  1KC8 H;  3NMU C;  2KTU A;  1E7K A;  3V3T A;  1VQP F;  1GO0 A;  1QVG F;  3NVI B;  5EO3 A;  3LWR C;  3RA6 A;  5HY4 A;  3SIU A;  2VGN A;  2OTJ F;  2ALE A;  1W41 A;  3G4S F;  5FLX M;  1VQO F;  1YJW F;  3CD6 F;  1X7O A;  3NVK E;  1X7P A;  1VQK F;  3I55 F;  1W2B F;  1KD1 H;  3CC4 F;  5G4V C;  3CC2 F;  3FFM A;  3V7E A;  1K73 H;  3CCJ F;  2VGM A;  5EWR A;  3CC7 F;  1ZWZ A;  2LBW A;  3PAF A;  3CCM F;  1VQ4 F;  3CCV F;  1H7M A;  3D00 A;  2JNB A;  2QI2 A;  4NUT A;  4EI7 A;  4TZZ A;  2OTL F;  3HAX D;  1GO1 A;  3GYQ A;  3MCA B;  3V7Q A;  3LWV C;  2OHW A;  1QVF F;  1YJ9 F;  3CCR F;  3I56 F;  1YI2 F;  3CPQ A;  2BO1 A;  3N4Z A;  4NQ3 A;  1NMU B;  4XCQ A;  1XBI A;  3LWO C;  1VQ7 F;  5FJ4 C;  2AIF A;  5HXU A;  5GAN K;  5GAP K;  1YHQ F;  3CCS F;  1DT9 A;  3CXC F;  3JCM M;  1W3E X;  3G71 F;  3OW2 F;  1RA4 A;  2KTV A;  4EI9 A;  3LWP C;  5IT9 M;  1K8A H;  5HY2 A;  1N8R H;  2LBX A;  2QEX F;  2KG4 A;  3J80 M;  1CK2 A;  2FGY A;  3IR9 A;  1Q86 H;  4LCK A;  3WXM B;  2OZB A;  1IPA A;  2WAL A;  3OBW A;  4BVR A;  5HWE A;  1YJN F;  3E1Y A;  3AGK A;  5A2Q M;  4X3L A;  2F9Z C;  3SIV A;  3CCU F;  4BVS A;  2HVY D;  5GIN C;  1KQS F;  4BVT A;  3ON1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...