1E7KA

Crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
b'ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 15.5 KD RNA BINDING PROTEIN
publication title Crystal Structure of the Spliceosomal 15.5Kd Protein Bound to a U4 Snrna Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 38
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1e7kA00
3AGKA 1W42A 2JNBA 3VMFB 5FLXM 2I6DA 5GAPK 3CC7F 1SDSA 3OBWA 1VQ5F 3CMAF 1X7PA 3I56F 3LWPC 3I55F 3O85A 5EO3A 2QA4F 1X7OA 2AIFA 5GINC 3LWRC 3GYQA 1RA4A 3G6EF 2QEXF 5DCVA 2OTLF 1RLGA 1W3EX 2BO1A 5GIPC 1VQLF 4BW0B 1Q81H 3CPQA 3CMEF 2OHWA 3J81M 4TZZA 1NJIH 2WALA 3N4ZA 4BY9D 3SIUA 1KD1H 2VGNA 2QI2A 3CCQF 1M90H 1GZ0A 5G4UC 3HAXD 3RA6A 2HVYD 1VQOF 1JJ2F 3IR9A 3NK6A 1NMUB 1XBIA 3OBYA 3LWOC 1K8AH 3E1YA 3NVKE 3LWVC 3V7EA 5G4VC 1W40A 3CC2F 1VQ7F 1ZWZA 3PLAC 1Q7YH 3SIVA 1YITF 1KQSF 1VQ4F 3CCVF 3N4YA 4LCKA 3NVIB 3LWQC 1VQNF 5GANK 1VQ9F 5FJ4C 1N8RH 5EWRA 2KTVA 1W41A 3HJWC 3OW2F 2KG4A 1VQ6F 2FC3A 4C4WC 1VQPF 1Q86H 1DT9A 3JAMM 3PAFA 3LFOA 1VQMF 3RA5A 1K73H 3CCJF 3CCUF 1S72F 3CCMF 1T0KB 3VI6A 2ALEA 4X3MA 3G4SF 3CPWF 3NMUC 1H7MA 3CCEF 3E20B 1YIJF 3J80M 1PXWA 3CCSF 2OTJF 1CN7A 3CD6F 2OZBA 2VGMA 1YI2F 1X52A 3ON1A 3JCMM 2LBWA 1QVGF 4X3LA 3CCRF 1VQ8F 5IT9M 1YJNF 1K9MH 1GO1A 5GIOC 3CXCF 1E7KA 3WXMB 1W2BF 3MCAB 1QVFF 1IPAA 1YJ9F 1KC8H 4NUTA 1YHQF 1CK2A 3V7QA 1YJWF 2CZWA 3FFMA 1M1KH 2LBXA 3J7AR 3CG6A 3CC4F 1Q82H 5A2QM 3G71F 1GO0A 1VQKF 3NK7A 2KTUA 3CCLF
chains in the Genus database with same CATH superfamily
4C8EA 5GAPK 3CC7F 4U3JA 3VMFB 2I6DA 3S0YA 1SDSA 3UT5A 2HP3A 3E22A 3I3FA 3VTIC 5MN6A 4IHJA 3QTYA 4TUYA 3WJPA 1QD9A 3CMAF 3K12A 1COMA 1ONIA 4O2AB 3I56F 2H6LA 4BVSA 3I55F 5EO3A 5LP6A 3HKCB 3GYQA 1RA4A 5IYZB 2QEXF 4G4VA 3V4DA 4DRXA 1RLGA 1XV2A 3D54A 3JATA 1FNKA 2PMPA 2OHWA 3D00A 4NQ3A 4TZZA 1NJIH 1IV2A 1H47A 4BY9D 2RHLA 3JASA 3S02A 5CB4A 4F6RA 4X20B 1KD1H 3IMPA 2UYPA 2VGNA 4ZHVA 3I7TA 2R751 3F0FA 3WPWA 3ZO8A 4YJ3A 3RE3A 4I4TA 1JFFB 3TD4A 1OAPA 3VYTC 3HKEB 4FFBB 5JH7B 2UYJA 2B33A 3P0ZA 4O4IA 2ZODA 3GHZA 3JALB 4HNAA 4C81A 1Q7YH 1YITF 4LCKA 3FPIA 4ZOLA 5LA6B 4G4YA 3LWQC 1CLIA 1IV3A 5J2UB 5HWEA 1U3PA 3JAKA 4O4HA 3VIUA 2Z1UA 4ERHA 1VQPF 1DT9A 3RA5A 5J2TA 3CCJF 2CVLA 3KE1A 3CCUF 1S72F 3G4SF 3RYCA 4ZI7A 3CCEF 3MCQA 5C8YA 3E20B 4I50B 2OTJF 5EYPA 3U0OA 3JARB 2VGMA 4LNUA 5LOVB 1YI2F 3CD6F 2F9ZC 3WXMB 1KNJA 1IV1A 4YJ2A 4U3JB 5CA1A 1YQNA 1UI9A 3E22B 3KIZA 3LMEA 5LYJA 4IHJB 3UT5B 5HY1A 4TUYB 1Q8RA 3OONA 2CZWA 4O2BA 2Q1YA 2H8EA 2ZF8A 3G71F 5LP6B 5EZYA 3WGNA 1VQKF 3NK7A 1GO0A 3WJQA 3IEQA 5FLXM 4DRXB 3T80A 3P10A 3JATB 3OBWA 3DC2A 3HTNA 1VQ5F 1X7PA 2YYEA 4RHAA 2CHSA 4G4ZA 5HXZA 3JAWA 3MBMA 3JASB 2QA4F 5CB4B 4G4WA 1X7OA 2AIFA 4F6RB 3LWRC 5FNVA 3GTZA 1W57A 3IKFA 3S06A 5GIPC 2G9IA 3S03A 1Q81H 3CPQA 2HS4A 2FGYA 2UYNA 4YJ3B 4I4TB 3WGMA 4E6EA 2HS0A 3SIUA 2PHNA 4O4IB 3ERNA 4M8IA 2IAFA 3C9SA 3HAXD 4BVTA 2CW4A 3RA6A 2HVYD 4HNAB 3VYSC 3NK6A 2DT4A 1NMUB 3LYBA 3OBYA 4G88A 3JVHA 4ZOLB 1K8AH 2BTQB 3LWVC 3V7EA 5G4VC 5CA0A 3CC2F 3VOAA 5HY0A 1ZWZA 5MN5A 3C9TA 3JAKB 2VAWA 4KWEA 4O4HB 3SIVA 3M84A 4BT7A 4C8GA 2I6RA 2EWCA 5J2TB 1FFXA 5GANK 2HQSC 3FD5A 4DXDA 3WGKA 4ZHYB 5FJ4C 3L7QA 2KTVA 1W41A 3RYCB 2RHHA 4ZI7B 4NWOB 3OW2F 1GX1A 1NQ3A 2FC3A 1W55A 5C8YB 2K1SA 1Q86H 3N2GA 1VQMF 5EYPB 4LNUB 1FSZA 1XHOA 5EAZA 3K0TA 4BT2A 1T0KB 3WGJA 1DBFA 1W5EA 5LP6C 3M1XA 1H7MA 2OTMA 5IJ9A 5KMGA 1YIJF 3RYIA 2P6YA 4ZHQA 1PXWA 4YJ2B 5GONA 4I55A 5CA1B 5LYJB 2KGWA 2HS3A 1QVGF 2N48A 4XCQA 4O2BB 1SZQA 1GO1A 1H48A 4WBNA 5EZYB 5KX5A 3BYQA 3MCAB 2Z1TA 2Q1XA 1KC8H 1YHQF 5EB0A 1CK2A 3P4EA 3CYQA 1W5AA 2CHTA 3CG6A 3F0DA 3JAWB 3NMUC 1YGYA 3QHDA 5FNVB 3MQWA 3R0PA 3HWUA 2W8BC 3C9RA 5HY4A 3F0EA 2UYNB 4O4LA 2RHOA 2HP0A 3O85A 5IJ0B 3VO8A 5GINC 5DCVA 1X25A 4G4XA 2OTLF 1VQLF 2CWJA 5JCOC 3RYFA 1TVKA 2VXYA 2WALA 3N4ZA 1Z5VA 3ESJA 5EIBC 1QAHA 2BTUA 2QI2A 1M90H 3KJJA 3TD3A 2HRUA 2ZOVA 5CA0B 1VQOF 1JJ2F 4B46A 1VQVA 3IR9A 2RHJA 4O4JA 2QTPA 4X1KA 1IV4A 4BT5A 4U39A 1XBIA 5JVDB 3F6MA 1Z5WA 2ZAUA 4BVRA 1FFXB 3LDTA 3DDNA 1R1MA 1W40A 1PF5A 4EI7A 5EB1B 2MQEA 2IG8A 1QU9A 1U40A 3PLAC 3EORA 1VQ4F 3K14A 3HKDA 4X1YA 3NVIB 3N2GB 4C82A 5IJ0A 2AIZP 1VQNF 4IIJA 5BMVA 1U3LA 2R6R1 5EWRA 2Z1FA 5IJ9B 2Z01A 2KG4A 1VQ6F 2GZLA 1W581 5KMGB 3RYIB 3MDOA 3JAMM 4ZHQB 5GONB 3PAFA 3LFOA 4I55B 1K73H 2ALEA 5LXTA 3CPWF 1JN1A 2HRYA 3B6NA 4B62A 4WBNB 4BT6A 1SA0A 5KX5B 3J80M 3KHNA 1CN7A 5JVDA 1X52A 3ON1A 1TUBA 4X3LA 3CCRF 1VQ8F 1K9MH 5GIOC 3VYUC 3CXCF 5AVMA 3C9UA 2UZHA 4X1IA 2UYKA 1YJ9F 2LCAA 3RYHB 3ELCA 3ZP4A 2Z1EA 2GVIA 1M1KH 2LBXA 4O4LB 3KJKA 5JQGA 2HP0B 3CC4F 5HY2A 1Q82H 1VHAA 5IT9M 1VK3A 3VCZA 3AGKA 1W42A 2JNBA 4TV9A 3N2KA 3CB2A 3RYFB 4EI8A 1TVKB 2GLZA 1U43A 3LWPC 3FD6A 3HKBA 4BVQA 2H8CA 3WJRA 2VAMA 5MN4A 3G6EF 2LBTA 2YXZA 1W3EX 2BO1A 3QUWA 3ZP7A 4BW0B 4B45A 3CMEF 1JD1A 1RQ7A 4O2AA 4O4JB 4X1KB 3J81M 3V3TA 5HP7A 2VAPA 4B5CA 1UFYA 3D01A 1RQ2A 3HKCA 5IYZA 1ODEA 2L26A 3CCQF 1GZ0A 5G4UC 3RYHA 3TD5A 4RQOA 5JCOA 5ITZB 3FBAA 3HKDB 4EB6B 4X1YB 3LWOC 1RLUA 4X20A 1J7HA 3E1YA 2HX0A 4IIJB 3NVKE 5BMVB 1VQ7F 4TV8B 2DYYA 1JFFA 1W5FA 2CSLA 1KQSF 3CCVF 3N4YA 3Q8HA 3HKEA 4FFBA 3S0HA 5JH7A 1VQ9F 5LXTB 1N8RH 4ZK7A 3JALA 3HJWC 1SA0B 4C4WC 3VOBA 3IKEA 4PWTA 1T0AA 5LA6A 3CCMF 1TUBB 3VI6A 4X3MA 4EI9A 3C8LA 5J2UA 1KNKA 3IEWA 3WGLA 5HXUA 3CCLF 4X1IB 5ITZA 2IQQA 3F0GA 4EB6A 2ZVZA 3CCSF 4ZHWA 2OZBA 1XRGA 3JCMM 5EIBD 2LBWA 2AMTA 2V9YA 1OFUA 4BT4A 2RB9A 5JQGB 2NMUA 1YJNF 4TV8A 1FNJA 3ZOPA 5HP8A 4BT3A 1E7KA 2ZVYA 4R40B 1W2BF 1W59A 3K2XA 1QVFF 4I50A 1IPAA 1W5BA 4NUTA 3JARA 1JY8A 5LOVA 4TV9B 1VH8A 2BTOA 3V7QA 1YJWF 3N2KB 5B8FA 3FFMA 3J7AR 3M4SA 3S0WA 4C8IA 3HKBB 5A2QM 3CYPB 2KTUA 3WPXA
chains in the Genus database with same CATH topology
3AGKA 1W42A 2JNBA 3VMFB 5FLXM 2I6DA 5GAPK 3CC7F 1SDSA 3OBWA 5HY4A 1VQ5F 3CMAF 1X7PA 3I56F 4EI8A 5HXZA 2GLZA 3LWPC 4BVSA 3I55F 3O85A 4BVQA 5EO3A 2QA4F 1X7OA 2AIFA 5GINC 3LWRC 3GYQA 1RA4A 3G6EF 2QEXF 5DCVA 2OTLF 1RLGA 1W3EX 2BO1A 5GIPC 1VQLF 4BW0B 1Q81H 3CPQA 2FGYA 3CMEF 4NQ3A 2OHWA 3D00A 3J81M 4TZZA 3V3TA 1NJIH 2WALA 3N4ZA 4BY9D 3SIUA 1KD1H 2VGNA 2QI2A 3CCQF 1M90H 1GZ0A 5G4UC 3HAXD 4BVTA 3RA6A 2HVYD 1VQOF 1JJ2F 3IR9A 3NK6A 1NMUB 1XBIA 3OBYA 3LWOC 1K8AH 3E1YA 4BVRA 3NVKE 3LWVC 3V7EA 1W40A 5G4VC 3CC2F 4EI7A 1VQ7F 5HY0A 1ZWZA 3PLAC 1Q7YH 3SIVA 1YITF 1KQSF 1VQ4F 3CCVF 3N4YA 4LCKA 3NVIB 3LWQC 1VQNF 5GANK 1VQ9F 5FJ4C 1N8RH 5EWRA 2KTVA 1W41A 5HWEA 3HJWC 3OW2F 2KG4A 1VQ6F 2FC3A 4C4WC 1VQPF 1Q86H 1DT9A 3JAMM 3PAFA 3LFOA 1VQMF 3RA5A 1K73H 3CCJF 3CCUF 1S72F 3CCMF 1T0KB 3VI6A 2ALEA 4X3MA 4EI9A 3G4SF 3CPWF 3NMUC 1H7MA 3CCEF 5HXUA 3E20B 1YIJF 3J80M 1PXWA 3CCSF 2OTJF 1CN7A 3CD6F 2OZBA 2VGMA 1YI2F 1X52A 3ON1A 3JCMM 2LBWA 1QVGF 4X3LA 4XCQA 3CCRF 1VQ8F 5IT9M 1YJNF 1K9MH 1GO1A 5GIOC 3CXCF 1E7KA 2F9ZC 3WXMB 1W2BF 3MCAB 1QVFF 1IPAA 1YJ9F 1KC8H 4NUTA 1YHQF 5HY1A 1CK2A 3V7QA 1YJWF 2CZWA 3FFMA 1M1KH 2LBXA 3J7AR 3CG6A 3CC4F 5HY2A 1Q82H 5A2QM 3G71F 1GO0A 1VQKF 3NK7A 2KTUA 3CCLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGK A;  1W42 A;  2JNB A;  3VMF B;  5FLX M;  2I6D A;  5GAP K;  3CC7 F;  1SDS A;  3OBW A;  1VQ5 F;  3CMA F;  1X7P A;  3I56 F;  3LWP C;  3I55 F;  3O85 A;  5EO3 A;  2QA4 F;  1X7O A;  2AIF A;  5GIN C;  3LWR C;  3GYQ A;  1RA4 A;  3G6E F;  2QEX F;  5DCV A;  2OTL F;  1RLG A;  1W3E X;  2BO1 A;  5GIP C;  1VQL F;  4BW0 B;  1Q81 H;  3CPQ A;  3CME F;  2OHW A;  3J81 M;  4TZZ A;  1NJI H;  2WAL A;  3N4Z A;  4BY9 D;  3SIU A;  1KD1 H;  2VGN A;  2QI2 A;  3CCQ F;  1M90 H;  1GZ0 A;  5G4U C;  3HAX D;  3RA6 A;  2HVY D;  1VQO F;  1JJ2 F;  3IR9 A;  3NK6 A;  1NMU B;  1XBI A;  3OBY A;  3LWO C;  1K8A H;  3E1Y A;  3NVK E;  3LWV C;  3V7E A;  5G4V C;  1W40 A;  3CC2 F;  1VQ7 F;  1ZWZ A;  3PLA C;  1Q7Y H;  3SIV A;  1YIT F;  1KQS F;  1VQ4 F;  3CCV F;  3N4Y A;  4LCK A;  3NVI B;  3LWQ C;  1VQN F;  5GAN K;  1VQ9 F;  5FJ4 C;  1N8R H;  5EWR A;  2KTV A;  1W41 A;  3HJW C;  3OW2 F;  2KG4 A;  1VQ6 F;  2FC3 A;  4C4W C;  1VQP F;  1Q86 H;  1DT9 A;  3JAM M;  3PAF A;  3LFO A;  1VQM F;  3RA5 A;  1K73 H;  3CCJ F;  3CCU F;  1S72 F;  3CCM F;  1T0K B;  3VI6 A;  2ALE A;  4X3M A;  3G4S F;  3CPW F;  3NMU C;  1H7M A;  3CCE F;  3E20 B;  1YIJ F;  3J80 M;  1PXW A;  3CCS F;  2OTJ F;  1CN7 A;  3CD6 F;  2OZB A;  2VGM A;  1YI2 F;  1X52 A;  3ON1 A;  3JCM M;  2LBW A;  1QVG F;  4X3L A;  3CCR F;  1VQ8 F;  5IT9 M;  1YJN F;  1K9M H;  1GO1 A;  5GIO C;  3CXC F;  1E7K A;  3WXM B;  1W2B F;  3MCA B;  1QVF F;  1IPA A;  1YJ9 F;  1KC8 H;  4NUT A;  1YHQ F;  1CK2 A;  3V7Q A;  1YJW F;  2CZW A;  3FFM A;  1M1K H;  2LBX A;  3J7A R;  3CG6 A;  3CC4 F;  1Q82 H;  5A2Q M;  3G71 F;  1GO0 A;  1VQK F;  3NK7 A;  2KTU A;  3CCL F; 
#chains in the Genus database with same CATH topology
 4C8E A;  5GAP K;  3CC7 F;  4U3J A;  3VMF B;  2I6D A;  3S0Y A;  1SDS A;  3UT5 A;  2HP3 A;  3E22 A;  3I3F A;  3VTI C;  5MN6 A;  4IHJ A;  3QTY A;  4TUY A;  3WJP A;  1QD9 A;  3CMA F;  3K12 A;  1COM A;  1ONI A;  4O2A B;  3I56 F;  2H6L A;  4BVS A;  3I55 F;  5EO3 A;  5LP6 A;  3HKC B;  3GYQ A;  1RA4 A;  5IYZ B;  2QEX F;  4G4V A;  3V4D A;  4DRX A;  1RLG A;  1XV2 A;  3D54 A;  3JAT A;  1FNK A;  2PMP A;  2OHW A;  3D00 A;  4NQ3 A;  4TZZ A;  1NJI H;  1IV2 A;  1H47 A;  4BY9 D;  2RHL A;  3JAS A;  3S02 A;  5CB4 A;  4F6R A;  4X20 B;  1KD1 H;  3IMP A;  2UYP A;  2VGN A;  4ZHV A;  3I7T A;  2R75 1;  3F0F A;  3WPW A;  3ZO8 A;  4YJ3 A;  3RE3 A;  4I4T A;  1JFF B;  3TD4 A;  1OAP A;  3VYT C;  3HKE B;  4FFB B;  5JH7 B;  2UYJ A;  2B33 A;  3P0Z A;  4O4I A;  2ZOD A;  3GHZ A;  3JAL B;  4HNA A;  4C81 A;  1Q7Y H;  1YIT F;  4LCK A;  3FPI A;  4ZOL A;  5LA6 B;  4G4Y A;  3LWQ C;  1CLI A;  1IV3 A;  5J2U B;  5HWE A;  1U3P A;  3JAK A;  4O4H A;  3VIU A;  2Z1U A;  4ERH A;  1VQP F;  1DT9 A;  3RA5 A;  5J2T A;  3CCJ F;  2CVL A;  3KE1 A;  3CCU F;  1S72 F;  3G4S F;  3RYC A;  4ZI7 A;  3CCE F;  3MCQ A;  5C8Y A;  3E20 B;  4I50 B;  2OTJ F;  5EYP A;  3U0O A;  3JAR B;  2VGM A;  4LNU A;  5LOV B;  1YI2 F;  3CD6 F;  2F9Z C;  3WXM B;  1KNJ A;  1IV1 A;  4YJ2 A;  4U3J B;  5CA1 A;  1YQN A;  1UI9 A;  3E22 B;  3KIZ A;  3LME A;  5LYJ A;  4IHJ B;  3UT5 B;  5HY1 A;  4TUY B;  1Q8R A;  3OON A;  2CZW A;  4O2B A;  2Q1Y A;  2H8E A;  2ZF8 A;  3G71 F;  5LP6 B;  5EZY A;  3WGN A;  1VQK F;  3NK7 A;  1GO0 A;  3WJQ A;  3IEQ A;  5FLX M;  4DRX B;  3T80 A;  3P10 A;  3JAT B;  3OBW A;  3DC2 A;  3HTN A;  1VQ5 F;  1X7P A;  2YYE A;  4RHA A;  2CHS A;  4G4Z A;  5HXZ A;  3JAW A;  3MBM A;  3JAS B;  2QA4 F;  5CB4 B;  4G4W A;  1X7O A;  2AIF A;  4F6R B;  3LWR C;  5FNV A;  3GTZ A;  1W57 A;  3IKF A;  3S06 A;  5GIP C;  2G9I A;  3S03 A;  1Q81 H;  3CPQ A;  2HS4 A;  2FGY A;  2UYN A;  4YJ3 B;  4I4T B;  3WGM A;  4E6E A;  2HS0 A;  3SIU A;  2PHN A;  4O4I B;  3ERN A;  4M8I A;  2IAF A;  3C9S A;  3HAX D;  4BVT A;  2CW4 A;  3RA6 A;  2HVY D;  4HNA B;  3VYS C;  3NK6 A;  2DT4 A;  1NMU B;  3LYB A;  3OBY A;  4G88 A;  3JVH A;  4ZOL B;  1K8A H;  2BTQ B;  3LWV C;  3V7E A;  5G4V C;  5CA0 A;  3CC2 F;  3VOA A;  5HY0 A;  1ZWZ A;  5MN5 A;  3C9T A;  3JAK B;  2VAW A;  4KWE A;  4O4H B;  3SIV A;  3M84 A;  4BT7 A;  4C8G A;  2I6R A;  2EWC A;  5J2T B;  1FFX A;  5GAN K;  2HQS C;  3FD5 A;  4DXD A;  3WGK A;  4ZHY B;  5FJ4 C;  3L7Q A;  2KTV A;  1W41 A;  3RYC B;  2RHH A;  4ZI7 B;  4NWO B;  3OW2 F;  1GX1 A;  1NQ3 A;  2FC3 A;  1W55 A;  5C8Y B;  2K1S A;  1Q86 H;  3N2G A;  1VQM F;  5EYP B;  4LNU B;  1FSZ A;  1XHO A;  5EAZ A;  3K0T A;  4BT2 A;  1T0K B;  3WGJ A;  1DBF A;  1W5E A;  5LP6 C;  3M1X A;  1H7M A;  2OTM A;  5IJ9 A;  5KMG A;  1YIJ F;  3RYI A;  2P6Y A;  4ZHQ A;  1PXW A;  4YJ2 B;  5GON A;  4I55 A;  5CA1 B;  5LYJ B;  2KGW A;  2HS3 A;  1QVG F;  2N48 A;  4XCQ A;  4O2B B;  1SZQ A;  1GO1 A;  1H48 A;  4WBN A;  5EZY B;  5KX5 A;  3BYQ A;  3MCA B;  2Z1T A;  2Q1X A;  1KC8 H;  1YHQ F;  5EB0 A;  1CK2 A;  3P4E A;  3CYQ A;  1W5A A;  2CHT A;  3CG6 A;  3F0D A;  3JAW B;  3NMU C;  1YGY A;  3QHD A;  5FNV B;  3MQW A;  3R0P A;  3HWU A;  2W8B C;  3C9R A;  5HY4 A;  3F0E A;  2UYN B;  4O4L A;  2RHO A;  2HP0 A;  3O85 A;  5IJ0 B;  3VO8 A;  5GIN C;  5DCV A;  1X25 A;  4G4X A;  2OTL F;  1VQL F;  2CWJ A;  5JCO C;  3RYF A;  1TVK A;  2VXY A;  2WAL A;  3N4Z A;  1Z5V A;  3ESJ A;  5EIB C;  1QAH A;  2BTU A;  2QI2 A;  1M90 H;  3KJJ A;  3TD3 A;  2HRU A;  2ZOV A;  5CA0 B;  1VQO F;  1JJ2 F;  4B46 A;  1VQV A;  3IR9 A;  2RHJ A;  4O4J A;  2QTP A;  4X1K A;  1IV4 A;  4BT5 A;  4U39 A;  1XBI A;  5JVD B;  3F6M A;  1Z5W A;  2ZAU A;  4BVR A;  1FFX B;  3LDT A;  3DDN A;  1R1M A;  1W40 A;  1PF5 A;  4EI7 A;  5EB1 B;  2MQE A;  2IG8 A;  1QU9 A;  1U40 A;  3PLA C;  3EOR A;  1VQ4 F;  3K14 A;  3HKD A;  4X1Y A;  3NVI B;  3N2G B;  4C82 A;  5IJ0 A;  2AIZ P;  1VQN F;  4IIJ A;  5BMV A;  1U3L A;  2R6R 1;  5EWR A;  2Z1F A;  5IJ9 B;  2Z01 A;  2KG4 A;  1VQ6 F;  2GZL A;  1W58 1;  5KMG B;  3RYI B;  3MDO A;  3JAM M;  4ZHQ B;  5GON B;  3PAF A;  3LFO A;  4I55 B;  1K73 H;  2ALE A;  5LXT A;  3CPW F;  1JN1 A;  2HRY A;  3B6N A;  4B62 A;  4WBN B;  4BT6 A;  1SA0 A;  5KX5 B;  3J80 M;  3KHN A;  1CN7 A;  5JVD A;  1X52 A;  3ON1 A;  1TUB A;  4X3L A;  3CCR F;  1VQ8 F;  1K9M H;  5GIO C;  3VYU C;  3CXC F;  5AVM A;  3C9U A;  2UZH A;  4X1I A;  2UYK A;  1YJ9 F;  2LCA A;  3RYH B;  3ELC A;  3ZP4 A;  2Z1E A;  2GVI A;  1M1K H;  2LBX A;  4O4L B;  3KJK A;  5JQG A;  2HP0 B;  3CC4 F;  5HY2 A;  1Q82 H;  1VHA A;  5IT9 M;  1VK3 A;  3VCZ A;  3AGK A;  1W42 A;  2JNB A;  4TV9 A;  3N2K A;  3CB2 A;  3RYF B;  4EI8 A;  1TVK B;  2GLZ A;  1U43 A;  3LWP C;  3FD6 A;  3HKB A;  4BVQ A;  2H8C A;  3WJR A;  2VAM A;  5MN4 A;  3G6E F;  2LBT A;  2YXZ A;  1W3E X;  2BO1 A;  3QUW A;  3ZP7 A;  4BW0 B;  4B45 A;  3CME F;  1JD1 A;  1RQ7 A;  4O2A A;  4O4J B;  4X1K B;  3J81 M;  3V3T A;  5HP7 A;  2VAP A;  4B5C A;  1UFY A;  3D01 A;  1RQ2 A;  3HKC A;  5IYZ A;  1ODE A;  2L26 A;  3CCQ F;  1GZ0 A;  5G4U C;  3RYH A;  3TD5 A;  4RQO A;  5JCO A;  5ITZ B;  3FBA A;  3HKD B;  4EB6 B;  4X1Y B;  3LWO C;  1RLU A;  4X20 A;  1J7H A;  3E1Y A;  2HX0 A;  4IIJ B;  3NVK E;  5BMV B;  1VQ7 F;  4TV8 B;  2DYY A;  1JFF A;  1W5F A;  2CSL A;  1KQS F;  3CCV F;  3N4Y A;  3Q8H A;  3HKE A;  4FFB A;  3S0H A;  5JH7 A;  1VQ9 F;  5LXT B;  1N8R H;  4ZK7 A;  3JAL A;  3HJW C;  1SA0 B;  4C4W C;  3VOB A;  3IKE A;  4PWT A;  1T0A A;  5LA6 A;  3CCM F;  1TUB B;  3VI6 A;  4X3M A;  4EI9 A;  3C8L A;  5J2U A;  1KNK A;  3IEW A;  3WGL A;  5HXU A;  3CCL F;  4X1I B;  5ITZ A;  2IQQ A;  3F0G A;  4EB6 A;  2ZVZ A;  3CCS F;  4ZHW A;  2OZB A;  1XRG A;  3JCM M;  5EIB D;  2LBW A;  2AMT A;  2V9Y A;  1OFU A;  4BT4 A;  2RB9 A;  5JQG B;  2NMU A;  1YJN F;  4TV8 A;  1FNJ A;  3ZOP A;  5HP8 A;  4BT3 A;  1E7K A;  2ZVY A;  4R40 B;  1W2B F;  1W59 A;  3K2X A;  1QVF F;  4I50 A;  1IPA A;  1W5B A;  4NUT A;  3JAR A;  1JY8 A;  5LOV A;  4TV9 B;  1VH8 A;  2BTO A;  3V7Q A;  1YJW F;  3N2K B;  5B8F A;  3FFM A;  3J7A R;  3M4S A;  3S0W A;  4C8I A;  3HKB B;  5A2Q M;  3CYP B;  2KTU A;  3WPX A; 
#chains in the Genus database with same CATH homology
 3AGK A;  1W42 A;  2JNB A;  3VMF B;  5FLX M;  2I6D A;  5GAP K;  3CC7 F;  1SDS A;  3OBW A;  5HY4 A;  1VQ5 F;  3CMA F;  1X7P A;  3I56 F;  4EI8 A;  5HXZ A;  2GLZ A;  3LWP C;  4BVS A;  3I55 F;  3O85 A;  4BVQ A;  5EO3 A;  2QA4 F;  1X7O A;  2AIF A;  5GIN C;  3LWR C;  3GYQ A;  1RA4 A;  3G6E F;  2QEX F;  5DCV A;  2OTL F;  1RLG A;  1W3E X;  2BO1 A;  5GIP C;  1VQL F;  4BW0 B;  1Q81 H;  3CPQ A;  2FGY A;  3CME F;  4NQ3 A;  2OHW A;  3D00 A;  3J81 M;  4TZZ A;  3V3T A;  1NJI H;  2WAL A;  3N4Z A;  4BY9 D;  3SIU A;  1KD1 H;  2VGN A;  2QI2 A;  3CCQ F;  1M90 H;  1GZ0 A;  5G4U C;  3HAX D;  4BVT A;  3RA6 A;  2HVY D;  1VQO F;  1JJ2 F;  3IR9 A;  3NK6 A;  1NMU B;  1XBI A;  3OBY A;  3LWO C;  1K8A H;  3E1Y A;  4BVR A;  3NVK E;  3LWV C;  3V7E A;  1W40 A;  5G4V C;  3CC2 F;  4EI7 A;  1VQ7 F;  5HY0 A;  1ZWZ A;  3PLA C;  1Q7Y H;  3SIV A;  1YIT F;  1KQS F;  1VQ4 F;  3CCV F;  3N4Y A;  4LCK A;  3NVI B;  3LWQ C;  1VQN F;  5GAN K;  1VQ9 F;  5FJ4 C;  1N8R H;  5EWR A;  2KTV A;  1W41 A;  5HWE A;  3HJW C;  3OW2 F;  2KG4 A;  1VQ6 F;  2FC3 A;  4C4W C;  1VQP F;  1Q86 H;  1DT9 A;  3JAM M;  3PAF A;  3LFO A;  1VQM F;  3RA5 A;  1K73 H;  3CCJ F;  3CCU F;  1S72 F;  3CCM F;  1T0K B;  3VI6 A;  2ALE A;  4X3M A;  4EI9 A;  3G4S F;  3CPW F;  3NMU C;  1H7M A;  3CCE F;  5HXU A;  3E20 B;  1YIJ F;  3J80 M;  1PXW A;  3CCS F;  2OTJ F;  1CN7 A;  3CD6 F;  2OZB A;  2VGM A;  1YI2 F;  1X52 A;  3ON1 A;  3JCM M;  2LBW A;  1QVG F;  4X3L A;  4XCQ A;  3CCR F;  1VQ8 F;  5IT9 M;  1YJN F;  1K9M H;  1GO1 A;  5GIO C;  3CXC F;  1E7K A;  2F9Z C;  3WXM B;  1W2B F;  3MCA B;  1QVF F;  1IPA A;  1YJ9 F;  1KC8 H;  4NUT A;  1YHQ F;  5HY1 A;  1CK2 A;  3V7Q A;  1YJW F;  2CZW A;  3FFM A;  1M1K H;  2LBX A;  3J7A R;  3CG6 A;  3CC4 F;  5HY2 A;  1Q82 H;  5A2Q M;  3G71 F;  1GO0 A;  1VQK F;  3NK7 A;  2KTU A;  3CCL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...