1E7KA

Crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Spliceosomal 15.5Kd Protein Bound to a U4 Snrna Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords 15.5 KD RNA BINDING PROTEIN
total genus 38
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1e7kA00
1CK2A 1VQ5F 1X52A 1M1KH 3CCRF 1ZWZA 5FJ4C 1YJWF 2LBXA 2JNBA 3NK7A 5DCVA 3OW2F 1GO0A 3CXCF 1YJNF 3AGKA 3LWOC 1VQNF 2OTLF 1NMUB 3G4SF 3LWPC 1YI2F 4BY9D 3N4YA 1VQMF 1VQ9F 3SIVA 2OZBA 1RA4A 3G71F 4X3MA 3RA5A 1VQ7F 1VQ6F 3SIUA 3PLAC 1Q82H 2ALEA 1VQPF 2AIFA 3CC2F 1T0KB 1X7OA 2KTUA 5IT9M 1NJIH 5EO3A 2VGMA 3CCEF 1K73H 5FLXM 2QA4F 3CCVF 3LFOA 2LBWA 1GZ0A 3VMFB 5GIOC 2QEXF 1E7KA 2CZWA 1S72F 3JCMM 3CCMF 1N8RH 1QVFF 2FC3A 1YHQF 1GO1A 3J7AR 3NVIB 2OTJF 3I56F 4TZZA 3MCAB 3JAMM 1VQKF 3IR9A 1RLGA 4BW0B 3E1YA 1K9MH 3V7EA 5GAPK 3CCQF 3CCUF 1IPAA 2VGNA 1YITF 1W42A 1KC8H 3E20B 3CCSF 3GYQA 3CD6F 5GANK 5A2QM 1KD1H 1W41A 3VI6A 3I55F 1K8AH 3CCJF 3OBYA 1X7PA 1VQ4F 2BO1A 2KTVA 3CG6A 5G4VC 3CPQA 1W40A 3HJWC 1CN7A 3PAFA 4C4WC 1W3EX 1YIJF 1PXWA 3LWQC 4LCKA 3J80M 5GINC 1XBIA 3V7QA 3CMEF 1VQ8F 1DT9A 4X3LA 2OHWA 3WXMB 3LWVC 1Q7YH 3J81M 3NVKE 2KG4A 2WALA 1W2BF 1VQLF 3CPWF 1M90H 1H7MA 3HAXD 1Q81H 3CMAF 3FFMA 1YJ9F 3CC7F 2I6DA 2HVYD 3LWRC 3O85A 1JJ2F 5GIPC 5EWRA 1SDSA 4NUTA 3G6EF 5G4UC 3RA6A 1Q86H 1QVGF 3CC4F 3CCLF 3ON1A 3NK6A 3N4ZA 1VQOF 1KQSF 2QI2A 3NMUC 3OBWA
chains in the Genus database with same CATH superfamily
1CK2A 1RLUA 3T80A 1TVKA 3HKCA 3N2KA 3VYTC 4C81A 5HWEA 2R6R1 1M1KH 1YJWF 1XRGA 3K12A 3CYPB 4YJ3B 3S02A 3NK7A 5DCVA 1GO0A 3C9UA 1VQNF 4I55A 1FSZA 5LA6B 2H6LA 1JD1A 4BY9D 3JAWB 1VQMF 5EAZA 2R751 5AVMA 3RA5A 4LNUA 3HKEA 2LCAA 2CHSA 2HS4A 5IJ0A 1Q82H 3HWUA 1RQ7A 1X7OA 4F6RA 5KMGA 1QU9A 5IT9M 4G4VA 2VGMA 1Z5VA 1U3PA 3LMEA 2G9IA 4O2AB 5FLXM 5KMGB 2UZHA 3RE3A 4DRXB 1GZ0A 3VMFB 5GIOC 2MQEA 3CCMF 5JQGB 3IEQA 4BVSA 3D54A 3WJQA 3WJRA 2FC3A 1GO1A 4EI9A 3RYCB 4U39A 4TV8A 4HNAA 4I55B 3VYUC 2OTMA 1GX1A 3WGLA 1K9MH 1U43A 3RYCA 2RHJA 5LOVA 1YITF 1KC8H 1X25A 3E20B 3CCSF 4YJ3A 2W8BC 5LP6A 2UYPA 5A2QM 3I55F 3BYQA 4O4HB 4I50A 4RHAA 3B6NA 3F6MA 2KTVA 5G4VC 4X1KB 1CN7A 5BMVB 4O4LA 3F0DA 2PHNA 1W581 3ERNA 3F0EA 2AIZP 1W57A 2RHOA 4LCKA 3V7QA 3CMEF 4ZHWA 1W5BA 3LYBA 3WGNA 1DT9A 3VOAA 5GONB 3RYIB 4C8IA 2UYNA 3KJJA 5MN5A 2N48A 1W5EA 5EIBC 3HAXD 5GONA 3JALB 3JASA 5EZYA 1Q81H 5EYPB 1YJ9F 3VIUA 5CA0B 1VHAA 2VAPA 4TV9A 3C9TA 2ZF8A 4TUYA 2K1SA 5MN4A 1JJ2F 3K0TA 5EWRA 3IEWA 3KIZA 1FFXA 4O4LB 3ON1A 5LYJA 3MDOA 3TD3A 1VQOF 4C8GA 1KQSF 1XHOA 3JATB 5C8YA 2HS0A 1OAPA 1W5FA 1DBFA 1CLIA 4ZOLA 2HP3A 2B33A 2GVIA 1VH8A 5JVDA 5LYJB 2LBXA 1TUBB 3WJPA 2JNBA 2UYKA 5ITZA 2BTQB 3OW2F 5KX5A 5LA6A 4WBNA 3IKEA 3G4SF 1QD9A 1YI2F 3N4YA 4O4IB 3K14A 3KHNA 3G71F 5CA1B 1VQ6F 4G4XA 3SIUA 4I4TA 3ZOPA 4EB6A 1OFUA 1VQPF 4BT4A 2KTUA 5JH7B 1NJIH 5BMVA 2QA4F 2HX0A 2LBWA 5IJ9B 2QEXF 4ZI7A 2CZWA 4M8IA 2PMPA 4ZHQA 3U0OA 1Z5WA 4G4ZA 2H8EA 3D00A 5CA1A 3JAKA 5EB1B 1QVFF 3J7AR 4IHJB 5EB0A 3HKDB 3M1XA 3JAMM 3IR9A 1RLGA 2RHLA 4WBNB 3E1YA 3FD5A 5KX5B 3HKDA 2UYJA 3V7EA 3VCZA 5J2UB 3CCUF 1IPAA 2VGNA 3K2XA 1W42A 1JN1A 2GLZA 4ZK7A 5GANK 3VI6A 3VO8A 1K8AH 3N2KB 4O4HA 2CW4A 1X7PA 1PF5A 3RYFA 3CG6A 3CPQA 2YYEA 4BVRA 1R1MA 2Z1UA 4NWOB 4BVQA 1W3EX 2GZLA 2HS3A 2YXZA 5JH7A 1YIJF 1PXWA 5CA0A 2HP0B 4X20B 3JASB 4IHJA 2OHWA 4X3LA 4PWTA 3LWVC 3J81M 2Q1XA 1Q7YH 2WALA 1VQLF 3CPWF 2Z01A 1M90H 3ZO8A 5B8FA 5HP8A 3CMAF 3FFMA 2I6DA 5HXZA 5CB4A 3R0PA 3O85A 5GIPC 1FNJA 3M84A 1SDSA 4NUTA 1QVGF 3C9RA 4X1KA 3NK6A 5JVDB 2QI2A 2ZVYA 5J2TB 4E6EA 1KNKA 1X52A 2VAMA 3CCRF 5FJ4C 3I7TA 2Q1YA 2KGWA 4EI8A 1RQ2A 1SA0A 3JAWA 1VQVA 1YJNF 1IV2A 4X1IB 4B62A 3AGKA 3ZP4A 4HNAB 2AMTA 5EZYB 3MBMA 1XV2A 1VQ9F 4U3JB 1W5AA 1RA4A 5LXTB 4BT5A 4X1YB 3EORA 4G4WA 2HRYA 4ZHQB 3C8LA 1ONIA 2EWCA 4BT7A 2ALEA 1T0KB 4ZI7B 5JCOC 2HP0A 4X20A 4DRXA 2DYYA 4BT2A 4ZHVA 3HKBB 3I3FA 3FPIA 3HTNA 2BTUA 5EO3A 3WGMA 3CCEF 1J7HA 3WGKA 4R40B 1NQ3A 4TUYB 4F6RB 3LFOA 4KWEA 3MQWA 1E7KA 3RYHA 4IIJB 3JCMM 4I4TB 3ZP7A 4BT6A 4C82A 4EB6B 3GTZA 3HKEB 4B5CA 4X1YA 1N8RH 1YHQF 2FGYA 3QTYA 3RYIA 2OTJF 3I56F 3P10A 1Q8RA 2RB9A 3V4DA 3S06A 1JFFA 5GAPK 3CCQF 1QAHA 5HY2A 3FBAA 5ITZB 3ELCA 3JVHA 3Q8HA 3CD6F 2RHHA 3LDTA 4B46A 2V9YA 5HP7A 2IG8A 3OBYA 3JATA 1T0AA 4O4JB 3RYHB 5C8YB 3E22A 3M4SA 3L7QA 1W55A 1W40A 3PAFA 3CB2A 3QHDA 3WPWA 1COMA 3HKBA 5HY0A 3P4EA 3D01A 2H8CA 2Z1FA 5CB4B 5EYPA 4O2BB 5GINC 2VXYA 1VQ8F 3JALA 3VOBA 3TD5A 4YJ2A 5HXUA 2ZOVA 3NVKE 1W2BF 2ZAUA 3IKFA 5HY4A 5HY1A 1H7MA 3MCQA 4YJ2B 1IV3A 1SZQA 3V3TA 2P6YA 3UT5B 5EIBD 2HVYD 3WPXA 5G4UC 1Q86H 3CC4F 3CCLF 1UFYA 4FFBB 3E22B 3OBWA 1KNJA 3KE1A 3RYFB 2HRUA 1H48A 1VQ5F 3F0GA 4NQ3A 3S03A 4I50B 1ZWZA 5IYZB 4ERHA 5JCOA 3P0ZA 4B45A 4FFBA 5LOVB 1FFXB 4DXDA 4XCQA 1JFFB 3CXCF 2CVLA 2HQSC 3LWOC 2OTLF 3UT5A 1NMUB 5FNVB 4TV8B 3LWPC 3SIVA 2OZBA 3WGJA 1UI9A 3JAKB 4BT3A 4X3MA 1VQ7F 3JARA 2UYNB 3GHZA 4ZOLB 5JQGA 3TD4A 3PLAC 2QTPA 3FD6A 1JY8A 2AIFA 3CC2F 5J2TA 3OONA 5IJ9A 3S0HA 3QUWA 1K73H 3VTIC 3DDNA 3CCVF 3S0WA 1S72F 2IQQA 5IJ0B 3S0YA 1IV4A 5LP6B 3JARB 4G88A 3KJKA 1W59A 3NVIB 2NMUA 1VK3A 5J2UA 4TZZA 3MCAB 5FNVA 1IV1A 3VYSC 3F0FA 1VQKF 2CSLA 4BW0B 4G4YA 2Z1TA 1H47A 3DC2A 4X1IA 4BVTA 1SA0B 1U40A 4EI7A 1TUBA 3GYQA 3N2GB 1KD1H 1W41A 3CYQA 4O4JA 5IYZA 3CCJF 3HKCB 1TVKB 5LP6C 3IMPA 1VQ4F 3C9SA 2BO1A 3N2GA 4C8EA 3HJWC 2CWJA 4O2AA 5MN6A 4C4WC 1U3LA 2LBTA 1ODEA 4TV9B 2F9ZC 3LWQC 3J80M 1XBIA 2ZODA 4RQOA 2CHTA 3WXMB 4LNUB 2I6RA 2KG4A 3ESJA 5LXTA 2ZVZA 4U3JA 1YGYA 4O4IA 1YQNA 2DT4A 4IIJA 1FNKA 4O2BA 3CC7F 3LWRC 2BTOA 4ZHYB 2L26A 2Z1EA 3G6EF 3RA6A 2VAWA 2IAFA 3NMUC 3N4ZA
chains in the Genus database with same CATH topology
1CK2A 1VQ5F 1X52A 4NQ3A 5HWEA 1M1KH 3CCRF 1ZWZA 5FJ4C 1YJWF 2LBXA 4EI8A 2JNBA 4XCQA 3NK7A 5DCVA 3OW2F 1GO0A 3CXCF 1YJNF 3AGKA 3LWOC 1VQNF 2OTLF 1NMUB 3G4SF 3LWPC 1YI2F 4BY9D 3N4YA 1VQMF 1VQ9F 3SIVA 2OZBA 1RA4A 3G71F 4X3MA 3RA5A 1VQ7F 1VQ6F 3SIUA 3PLAC 1Q82H 2ALEA 1VQPF 2AIFA 3CC2F 1T0KB 1X7OA 2KTUA 5IT9M 1NJIH 5EO3A 2VGMA 3CCEF 1K73H 5FLXM 2QA4F 3CCVF 3LFOA 2LBWA 1GZ0A 3VMFB 5GIOC 2QEXF 1E7KA 2CZWA 1S72F 3JCMM 3CCMF 4BVSA 3D00A 1N8RH 1QVFF 2FC3A 1YHQF 1GO1A 3J7AR 3NVIB 2FGYA 2OTJF 3I56F 4TZZA 4EI9A 3MCAB 3JAMM 1VQKF 3IR9A 1RLGA 4BW0B 3E1YA 1K9MH 4BVTA 3V7EA 5GAPK 3CCQF 3CCUF 1IPAA 2VGNA 5HY2A 1YITF 1W42A 1KC8H 4EI7A 3E20B 3CCSF 2GLZA 3GYQA 3CD6F 5GANK 5A2QM 1KD1H 1W41A 3VI6A 3I55F 1K8AH 3CCJF 3OBYA 1X7PA 1VQ4F 2BO1A 2KTVA 3CG6A 5G4VC 3CPQA 1W40A 3HJWC 1CN7A 3PAFA 4BVRA 4C4WC 4BVQA 1W3EX 5HY0A 1YIJF 2F9ZC 1PXWA 3LWQC 4LCKA 3J80M 5GINC 1XBIA 3V7QA 3CMEF 1VQ8F 1DT9A 4X3LA 2OHWA 3WXMB 5HXUA 3LWVC 1Q7YH 3J81M 3NVKE 2KG4A 2WALA 1W2BF 1VQLF 3CPWF 5HY4A 5HY1A 1H7MA 1M90H 3HAXD 1Q81H 3CMAF 3V3TA 3FFMA 1YJ9F 3CC7F 2I6DA 5HXZA 2HVYD 3LWRC 3O85A 1JJ2F 5GIPC 5EWRA 1SDSA 4NUTA 3G6EF 5G4UC 3RA6A 1Q86H 1QVGF 3CC4F 3CCLF 3ON1A 3NK6A 3N4ZA 1VQOF 1KQSF 2QI2A 3NMUC 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK2 A;  1VQ5 F;  1X52 A;  1M1K H;  3CCR F;  1ZWZ A;  5FJ4 C;  1YJW F;  2LBX A;  2JNB A;  3NK7 A;  5DCV A;  3OW2 F;  1GO0 A;  3CXC F;  1YJN F;  3AGK A;  3LWO C;  1VQN F;  2OTL F;  1NMU B;  3G4S F;  3LWP C;  1YI2 F;  4BY9 D;  3N4Y A;  1VQM F;  1VQ9 F;  3SIV A;  2OZB A;  1RA4 A;  3G71 F;  4X3M A;  3RA5 A;  1VQ7 F;  1VQ6 F;  3SIU A;  3PLA C;  1Q82 H;  2ALE A;  1VQP F;  2AIF A;  3CC2 F;  1T0K B;  1X7O A;  2KTU A;  5IT9 M;  1NJI H;  5EO3 A;  2VGM A;  3CCE F;  1K73 H;  5FLX M;  2QA4 F;  3CCV F;  3LFO A;  2LBW A;  1GZ0 A;  3VMF B;  5GIO C;  2QEX F;  1E7K A;  2CZW A;  1S72 F;  3JCM M;  3CCM F;  1N8R H;  1QVF F;  2FC3 A;  1YHQ F;  1GO1 A;  3J7A R;  3NVI B;  2OTJ F;  3I56 F;  4TZZ A;  3MCA B;  3JAM M;  1VQK F;  3IR9 A;  1RLG A;  4BW0 B;  3E1Y A;  1K9M H;  3V7E A;  5GAP K;  3CCQ F;  3CCU F;  1IPA A;  2VGN A;  1YIT F;  1W42 A;  1KC8 H;  3E20 B;  3CCS F;  3GYQ A;  3CD6 F;  5GAN K;  5A2Q M;  1KD1 H;  1W41 A;  3VI6 A;  3I55 F;  1K8A H;  3CCJ F;  3OBY A;  1X7P A;  1VQ4 F;  2BO1 A;  2KTV A;  3CG6 A;  5G4V C;  3CPQ A;  1W40 A;  3HJW C;  1CN7 A;  3PAF A;  4C4W C;  1W3E X;  1YIJ F;  1PXW A;  3LWQ C;  4LCK A;  3J80 M;  5GIN C;  1XBI A;  3V7Q A;  3CME F;  1VQ8 F;  1DT9 A;  4X3L A;  2OHW A;  3WXM B;  3LWV C;  1Q7Y H;  3J81 M;  3NVK E;  2KG4 A;  2WAL A;  1W2B F;  1VQL F;  3CPW F;  1M90 H;  1H7M A;  3HAX D;  1Q81 H;  3CMA F;  3FFM A;  1YJ9 F;  3CC7 F;  2I6D A;  2HVY D;  3LWR C;  3O85 A;  1JJ2 F;  5GIP C;  5EWR A;  1SDS A;  4NUT A;  3G6E F;  5G4U C;  3RA6 A;  1Q86 H;  1QVG F;  3CC4 F;  3CCL F;  3ON1 A;  3NK6 A;  3N4Z A;  1VQO F;  1KQS F;  2QI2 A;  3NMU C;  3OBW A; 
#chains in the Genus database with same CATH topology
 1CK2 A;  1RLU A;  3T80 A;  1TVK A;  3HKC A;  3N2K A;  3VYT C;  4C81 A;  5HWE A;  2R6R 1;  1M1K H;  1YJW F;  1XRG A;  3K12 A;  3CYP B;  4YJ3 B;  3S02 A;  3NK7 A;  5DCV A;  1GO0 A;  3C9U A;  1VQN F;  4I55 A;  1FSZ A;  5LA6 B;  2H6L A;  1JD1 A;  4BY9 D;  3JAW B;  1VQM F;  5EAZ A;  2R75 1;  5AVM A;  3RA5 A;  4LNU A;  3HKE A;  2LCA A;  2CHS A;  2HS4 A;  5IJ0 A;  1Q82 H;  3HWU A;  1RQ7 A;  1X7O A;  4F6R A;  5KMG A;  1QU9 A;  5IT9 M;  4G4V A;  2VGM A;  1Z5V A;  1U3P A;  3LME A;  2G9I A;  4O2A B;  5FLX M;  5KMG B;  2UZH A;  3RE3 A;  4DRX B;  1GZ0 A;  3VMF B;  5GIO C;  2MQE A;  3CCM F;  5JQG B;  3IEQ A;  4BVS A;  3D54 A;  3WJQ A;  3WJR A;  2FC3 A;  1GO1 A;  4EI9 A;  3RYC B;  4U39 A;  4TV8 A;  4HNA A;  4I55 B;  3VYU C;  2OTM A;  1GX1 A;  3WGL A;  1K9M H;  1U43 A;  3RYC A;  2RHJ A;  5LOV A;  1YIT F;  1KC8 H;  1X25 A;  3E20 B;  3CCS F;  4YJ3 A;  2W8B C;  5LP6 A;  2UYP A;  5A2Q M;  3I55 F;  3BYQ A;  4O4H B;  4I50 A;  4RHA A;  3B6N A;  3F6M A;  2KTV A;  5G4V C;  4X1K B;  1CN7 A;  5BMV B;  4O4L A;  3F0D A;  2PHN A;  1W58 1;  3ERN A;  3F0E A;  2AIZ P;  1W57 A;  2RHO A;  4LCK A;  3V7Q A;  3CME F;  4ZHW A;  1W5B A;  3LYB A;  3WGN A;  1DT9 A;  3VOA A;  5GON B;  3RYI B;  4C8I A;  2UYN A;  3KJJ A;  5MN5 A;  2N48 A;  1W5E A;  5EIB C;  3HAX D;  5GON A;  3JAL B;  3JAS A;  5EZY A;  1Q81 H;  5EYP B;  1YJ9 F;  3VIU A;  5CA0 B;  1VHA A;  2VAP A;  4TV9 A;  3C9T A;  2ZF8 A;  4TUY A;  2K1S A;  5MN4 A;  1JJ2 F;  3K0T A;  5EWR A;  3IEW A;  3KIZ A;  1FFX A;  4O4L B;  3ON1 A;  5LYJ A;  3MDO A;  3TD3 A;  1VQO F;  4C8G A;  1KQS F;  1XHO A;  3JAT B;  5C8Y A;  2HS0 A;  1OAP A;  1W5F A;  1DBF A;  1CLI A;  4ZOL A;  2HP3 A;  2B33 A;  2GVI A;  1VH8 A;  5JVD A;  5LYJ B;  2LBX A;  1TUB B;  3WJP A;  2JNB A;  2UYK A;  5ITZ A;  2BTQ B;  3OW2 F;  5KX5 A;  5LA6 A;  4WBN A;  3IKE A;  3G4S F;  1QD9 A;  1YI2 F;  3N4Y A;  4O4I B;  3K14 A;  3KHN A;  3G71 F;  5CA1 B;  1VQ6 F;  4G4X A;  3SIU A;  4I4T A;  3ZOP A;  4EB6 A;  1OFU A;  1VQP F;  4BT4 A;  2KTU A;  5JH7 B;  1NJI H;  5BMV A;  2QA4 F;  2HX0 A;  2LBW A;  5IJ9 B;  2QEX F;  4ZI7 A;  2CZW A;  4M8I A;  2PMP A;  4ZHQ A;  3U0O A;  1Z5W A;  4G4Z A;  2H8E A;  3D00 A;  5CA1 A;  3JAK A;  5EB1 B;  1QVF F;  3J7A R;  4IHJ B;  5EB0 A;  3HKD B;  3M1X A;  3JAM M;  3IR9 A;  1RLG A;  2RHL A;  4WBN B;  3E1Y A;  3FD5 A;  5KX5 B;  3HKD A;  2UYJ A;  3V7E A;  3VCZ A;  5J2U B;  3CCU F;  1IPA A;  2VGN A;  3K2X A;  1W42 A;  1JN1 A;  2GLZ A;  4ZK7 A;  5GAN K;  3VI6 A;  3VO8 A;  1K8A H;  3N2K B;  4O4H A;  2CW4 A;  1X7P A;  1PF5 A;  3RYF A;  3CG6 A;  3CPQ A;  2YYE A;  4BVR A;  1R1M A;  2Z1U A;  4NWO B;  4BVQ A;  1W3E X;  2GZL A;  2HS3 A;  2YXZ A;  5JH7 A;  1YIJ F;  1PXW A;  5CA0 A;  2HP0 B;  4X20 B;  3JAS B;  4IHJ A;  2OHW A;  4X3L A;  4PWT A;  3LWV C;  3J81 M;  2Q1X A;  1Q7Y H;  2WAL A;  1VQL F;  3CPW F;  2Z01 A;  1M90 H;  3ZO8 A;  5B8F A;  5HP8 A;  3CMA F;  3FFM A;  2I6D A;  5HXZ A;  5CB4 A;  3R0P A;  3O85 A;  5GIP C;  1FNJ A;  3M84 A;  1SDS A;  4NUT A;  1QVG F;  3C9R A;  4X1K A;  3NK6 A;  5JVD B;  2QI2 A;  2ZVY A;  5J2T B;  4E6E A;  1KNK A;  1X52 A;  2VAM A;  3CCR F;  5FJ4 C;  3I7T A;  2Q1Y A;  2KGW A;  4EI8 A;  1RQ2 A;  1SA0 A;  3JAW A;  1VQV A;  1YJN F;  1IV2 A;  4X1I B;  4B62 A;  3AGK A;  3ZP4 A;  4HNA B;  2AMT A;  5EZY B;  3MBM A;  1XV2 A;  1VQ9 F;  4U3J B;  1W5A A;  1RA4 A;  5LXT B;  4BT5 A;  4X1Y B;  3EOR A;  4G4W A;  2HRY A;  4ZHQ B;  3C8L A;  1ONI A;  2EWC A;  4BT7 A;  2ALE A;  1T0K B;  4ZI7 B;  5JCO C;  2HP0 A;  4X20 A;  4DRX A;  2DYY A;  4BT2 A;  4ZHV A;  3HKB B;  3I3F A;  3FPI A;  3HTN A;  2BTU A;  5EO3 A;  3WGM A;  3CCE F;  1J7H A;  3WGK A;  4R40 B;  1NQ3 A;  4TUY B;  4F6R B;  3LFO A;  4KWE A;  3MQW A;  1E7K A;  3RYH A;  4IIJ B;  3JCM M;  4I4T B;  3ZP7 A;  4BT6 A;  4C82 A;  4EB6 B;  3GTZ A;  3HKE B;  4B5C A;  4X1Y A;  1N8R H;  1YHQ F;  2FGY A;  3QTY A;  3RYI A;  2OTJ F;  3I56 F;  3P10 A;  1Q8R A;  2RB9 A;  3V4D A;  3S06 A;  1JFF A;  5GAP K;  3CCQ F;  1QAH A;  5HY2 A;  3FBA A;  5ITZ B;  3ELC A;  3JVH A;  3Q8H A;  3CD6 F;  2RHH A;  3LDT A;  4B46 A;  2V9Y A;  5HP7 A;  2IG8 A;  3OBY A;  3JAT A;  1T0A A;  4O4J B;  3RYH B;  5C8Y B;  3E22 A;  3M4S A;  3L7Q A;  1W55 A;  1W40 A;  3PAF A;  3CB2 A;  3QHD A;  3WPW A;  1COM A;  3HKB A;  5HY0 A;  3P4E A;  3D01 A;  2H8C A;  2Z1F A;  5CB4 B;  5EYP A;  4O2B B;  5GIN C;  2VXY A;  1VQ8 F;  3JAL A;  3VOB A;  3TD5 A;  4YJ2 A;  5HXU A;  2ZOV A;  3NVK E;  1W2B F;  2ZAU A;  3IKF A;  5HY4 A;  5HY1 A;  1H7M A;  3MCQ A;  4YJ2 B;  1IV3 A;  1SZQ A;  3V3T A;  2P6Y A;  3UT5 B;  5EIB D;  2HVY D;  3WPX A;  5G4U C;  1Q86 H;  3CC4 F;  3CCL F;  1UFY A;  4FFB B;  3E22 B;  3OBW A;  1KNJ A;  3KE1 A;  3RYF B;  2HRU A;  1H48 A;  1VQ5 F;  3F0G A;  4NQ3 A;  3S03 A;  4I50 B;  1ZWZ A;  5IYZ B;  4ERH A;  5JCO A;  3P0Z A;  4B45 A;  4FFB A;  5LOV B;  1FFX B;  4DXD A;  4XCQ A;  1JFF B;  3CXC F;  2CVL A;  2HQS C;  3LWO C;  2OTL F;  3UT5 A;  1NMU B;  5FNV B;  4TV8 B;  3LWP C;  3SIV A;  2OZB A;  3WGJ A;  1UI9 A;  3JAK B;  4BT3 A;  4X3M A;  1VQ7 F;  3JAR A;  2UYN B;  3GHZ A;  4ZOL B;  5JQG A;  3TD4 A;  3PLA C;  2QTP A;  3FD6 A;  1JY8 A;  2AIF A;  3CC2 F;  5J2T A;  3OON A;  5IJ9 A;  3S0H A;  3QUW A;  1K73 H;  3VTI C;  3DDN A;  3CCV F;  3S0W A;  1S72 F;  2IQQ A;  5IJ0 B;  3S0Y A;  1IV4 A;  5LP6 B;  3JAR B;  4G88 A;  3KJK A;  1W59 A;  3NVI B;  2NMU A;  1VK3 A;  5J2U A;  4TZZ A;  3MCA B;  5FNV A;  1IV1 A;  3VYS C;  3F0F A;  1VQK F;  2CSL A;  4BW0 B;  4G4Y A;  2Z1T A;  1H47 A;  3DC2 A;  4X1I A;  4BVT A;  1SA0 B;  1U40 A;  4EI7 A;  1TUB A;  3GYQ A;  3N2G B;  1KD1 H;  1W41 A;  3CYQ A;  4O4J A;  5IYZ A;  3CCJ F;  3HKC B;  1TVK B;  5LP6 C;  3IMP A;  1VQ4 F;  3C9S A;  2BO1 A;  3N2G A;  4C8E A;  3HJW C;  2CWJ A;  4O2A A;  5MN6 A;  4C4W C;  1U3L A;  2LBT A;  1ODE A;  4TV9 B;  2F9Z C;  3LWQ C;  3J80 M;  1XBI A;  2ZOD A;  4RQO A;  2CHT A;  3WXM B;  4LNU B;  2I6R A;  2KG4 A;  3ESJ A;  5LXT A;  2ZVZ A;  4U3J A;  1YGY A;  4O4I A;  1YQN A;  2DT4 A;  4IIJ A;  1FNK A;  4O2B A;  3CC7 F;  3LWR C;  2BTO A;  4ZHY B;  2L26 A;  2Z1E A;  3G6E F;  3RA6 A;  2VAW A;  2IAF A;  3NMU C;  3N4Z A; 
#chains in the Genus database with same CATH homology
 1CK2 A;  1VQ5 F;  1X52 A;  4NQ3 A;  5HWE A;  1M1K H;  3CCR F;  1ZWZ A;  5FJ4 C;  1YJW F;  2LBX A;  4EI8 A;  2JNB A;  4XCQ A;  3NK7 A;  5DCV A;  3OW2 F;  1GO0 A;  3CXC F;  1YJN F;  3AGK A;  3LWO C;  1VQN F;  2OTL F;  1NMU B;  3G4S F;  3LWP C;  1YI2 F;  4BY9 D;  3N4Y A;  1VQM F;  1VQ9 F;  3SIV A;  2OZB A;  1RA4 A;  3G71 F;  4X3M A;  3RA5 A;  1VQ7 F;  1VQ6 F;  3SIU A;  3PLA C;  1Q82 H;  2ALE A;  1VQP F;  2AIF A;  3CC2 F;  1T0K B;  1X7O A;  2KTU A;  5IT9 M;  1NJI H;  5EO3 A;  2VGM A;  3CCE F;  1K73 H;  5FLX M;  2QA4 F;  3CCV F;  3LFO A;  2LBW A;  1GZ0 A;  3VMF B;  5GIO C;  2QEX F;  1E7K A;  2CZW A;  1S72 F;  3JCM M;  3CCM F;  4BVS A;  3D00 A;  1N8R H;  1QVF F;  2FC3 A;  1YHQ F;  1GO1 A;  3J7A R;  3NVI B;  2FGY A;  2OTJ F;  3I56 F;  4TZZ A;  4EI9 A;  3MCA B;  3JAM M;  1VQK F;  3IR9 A;  1RLG A;  4BW0 B;  3E1Y A;  1K9M H;  4BVT A;  3V7E A;  5GAP K;  3CCQ F;  3CCU F;  1IPA A;  2VGN A;  5HY2 A;  1YIT F;  1W42 A;  1KC8 H;  4EI7 A;  3E20 B;  3CCS F;  2GLZ A;  3GYQ A;  3CD6 F;  5GAN K;  5A2Q M;  1KD1 H;  1W41 A;  3VI6 A;  3I55 F;  1K8A H;  3CCJ F;  3OBY A;  1X7P A;  1VQ4 F;  2BO1 A;  2KTV A;  3CG6 A;  5G4V C;  3CPQ A;  1W40 A;  3HJW C;  1CN7 A;  3PAF A;  4BVR A;  4C4W C;  4BVQ A;  1W3E X;  5HY0 A;  1YIJ F;  2F9Z C;  1PXW A;  3LWQ C;  4LCK A;  3J80 M;  5GIN C;  1XBI A;  3V7Q A;  3CME F;  1VQ8 F;  1DT9 A;  4X3L A;  2OHW A;  3WXM B;  5HXU A;  3LWV C;  1Q7Y H;  3J81 M;  3NVK E;  2KG4 A;  2WAL A;  1W2B F;  1VQL F;  3CPW F;  5HY4 A;  5HY1 A;  1H7M A;  1M90 H;  3HAX D;  1Q81 H;  3CMA F;  3V3T A;  3FFM A;  1YJ9 F;  3CC7 F;  2I6D A;  5HXZ A;  2HVY D;  3LWR C;  3O85 A;  1JJ2 F;  5GIP C;  5EWR A;  1SDS A;  4NUT A;  3G6E F;  5G4U C;  3RA6 A;  1Q86 H;  1QVG F;  3CC4 F;  3CCL F;  3ON1 A;  3NK6 A;  3N4Z A;  1VQO F;  1KQS F;  2QI2 A;  3NMU C;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...