1E7KA

Crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Spliceosomal 15.5Kd Protein Bound to a U4 Snrna Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords 15.5 KD RNA BINDING PROTEIN
total genus 38
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1e7kA00
3CCJF 3RA6A 3GYQA 1S72F 2KTUA 1RLGA 1XBIA 3VI6A 4TZZA 3CMAF 1YJWF 1KC8H 3OBYA 3N4YA 5FLXM 1K73H 3NK7A 3CPWF 2ALEA 3JCMM 3V7EA 1VQPF 3SIUA 3J7AR 3PLAC 3CD6F 3MCAB 1W40A 1T0KB 3N4ZA 3J81M 5A2QM 3LWQC 1KD1H 3LFOA 3RA5A 3I56F 1YJNF 1W2BF 1GZ0A 1VQ4F 2OZBA 3HJWC 3CXCF 3O85A 1VQNF 2AIFA 1YI2F 3CCRF 1VQMF 3E1YA 1VQ5F 1W42A 4X3MA 2HVYD 5G4VC 1X52A 5GANK 1YJ9F 3NMUC 5GINC 5DCVA 3E20B 2OHWA 3ON1A 2QI2A 4C4WC 5GIPC 3CC7F 1QVGF 3V7QA 1W41A 3CCVF 2I6DA 1Q81H 1M1KH 2OTLF 4X3LA 3LWRC 1QVFF 2BO1A 1VQKF 3AGKA 3WXMB 3CCQF 1YHQF 3NK6A 2FC3A 3FFMA 3CC4F 5EO3A 2KTVA 1DT9A 2WALA 4BY9D 3CG6A 1NMUB 3CPQA 3JAMM 3LWPC 1VQLF 3LWOC 4BW0B 5G4UC 3IR9A 5GAPK 3NVKE 4LCKA 1IPAA 1NJIH 1YIJF 1K8AH 1VQ7F 2LBXA 1Q82H 1VQ8F 3CCEF 3NVIB 1ZWZA 2LBWA 3I55F 3CMEF 1CK2A 1E7KA 1GO0A 1VQOF 5EWRA 1K9MH 3J80M 2KG4A 3OBWA 3G71F 1RA4A 1X7OA 1SDSA 1H7MA 2QA4F 1N8RH 5FJ4C 5GIOC 3VMFB 3CCLF 2CZWA 1Q7YH 3G4SF 3CCSF 2JNBA 3SIVA 3LWVC 2VGMA 1W3EX 2QEXF 1YITF 1X7PA 3PAFA 3OW2F 1Q86H 3HAXD 4NUTA 1CN7A 1VQ9F 1VQ6F 1KQSF 1JJ2F 3CCUF 1M90H 5IT9M 1GO1A 1PXWA 3G6EF 3CCMF 2OTJF 2VGNA 3CC2F
chains in the Genus database with same CATH superfamily
2DYYA 3RYFA 4O4IB 1W581 2KTUA 3FPIA 1U3LA 4TZZA 4BT3A 3CMAF 3WJPA 1KC8H 1JFFB 1W5AA 2HRUA 5EYPB 2Z1TA 2F9ZC 3V3TA 4I4TA 2AIZP 3V7EA 3J7AR 3PLAC 1KNKA 2HS0A 3UT5B 3K0TA 4ZI7A 5A2QM 4I50A 1KD1H 3KJJA 2KGWA 3I56F 1W5FA 3CYQA 4WBNA 1W2BF 2OZBA 3HJWC 4BT2A 1Z5WA 5EYPA 2RHHA 1DBFA 4ERHA 2ZVZA 3JASA 3JAKA 4TV9A 4U3JA 5EZYB 5GANK 1YJ9F 3NMUC 1SZQA 5GINC 5C8YA 4G4XA 3E20B 2OHWA 5J2TA 2GLZA 4ZI7B 3CC7F 2K1SA 2Z01A 5MN4A 3VYTC 1IV4A 4FFBA 3R0PA 3S0HA 3JATB 1Q81H 1W59A 2HP3A 2OTLF 3WJRA 3WGLA 3WGJA 3HKCB 3ELCA 4G4WA 2BO1A 5LP6C 4G4YA 3JALA 3P0ZA 3AGKA 4DXDA 3ZO8A 5CA1B 3C9TA 4ZOLB 2RHLA 3CPQA 3HKDB 3LWOC 5IJ0B 5G4UC 3VYSC 3NVKE 4NWOB 3VYUC 5GONB 3D00A 4X1YA 3HKBB 1VQ8F 4IHJB 3CCEF 1ZWZA 2ZODA 4X1KA 2RHOA 4LNUB 4O4JB 3CMEF 5EWRA 5CB4A 5JQGB 1K9MH 5ITZA 2PMPA 1VH8A 3OBWA 3HKEB 5JH7B 5LYJB 3RYIB 1RA4A 3J80M 3DC2A 3CYPB 5FJ4C 3CB2A 3VMFB 1Q7YH 3WGKA 3G4SF 1CLIA 3N2KA 3RYHA 5JVDA 1ONIA 1X7PA 3LDTA 1GX1A 1Q86H 3VO8A 3DDNA 3E22B 1IV2A 2MQEA 4EI7A 1VQ9F 1JJ2F 4PWTA 3N2GA 2OTJF 2YXZA 1YQNA 2B33A 4X20A 3CCJF 2RB9A 3FD6A 4TV8B 2HX0A 3GYQA 4BT4A 4C8IA 4I55A 5HWEA 1RLGA 3HKBA 1YJWF 3C9RA 3N4YA 4ZHQB 2H8EA 1SA0B 3IEWA 5FLXM 1K73H 3NK7A 3ZP7A 3F0DA 2VAMA 3JAKB 2ZVYA 2UZHA 5KMGA 1T0KB 3RYFB 3J81M 5BMVB 3S06A 4NQ3A 2IAFA 4ZHWA 2CW4A 2UYNB 1T0AA 4LNUA 4O4JA 2H6LA 2IG8A 5HY2A 3O85A 4O4HA 1YI2F 3S02A 1VQMF 3JASB 1VQ5F 4B5CA 2EWCA 1W42A 2HVYD 2CHTA 5LA6A 5DCVA 5AVMA 5CA1A 2LCAA 4O2BA 1QVGF 3V4DA 3V7QA 5MN6A 4O4LB 4R40B 3JATA 3WJQA 2I6DA 4X1IB 2CHSA 3L7QA 4O4IA 4X3LA 2Z1EA 5JQGA 1COMA 2HP0A 2HQSC 4KWEA 2GZLA 3WXMB 2ZAUA 1IV3A 1FFXA 3F0FA 1YHQF 3NK6A 1RLUA 1RQ2A 3HTNA 2R6R1 1U43A 1VHAA 2AMTA 1DT9A 2FGYA 1H47A 2WALA 3JARA 3KIZA 1QAHA 3CG6A 2UYJA 3ZOPA 4BT5A 1VQLF 2HRYA 1YIJF 4O2AA 3KHNA 4I55B 3VOBA 4G88A 2V9YA 2LBWA 1CK2A 1E7KA 3JALB 1TVKB 1FFXB 1ODEA 3HKCA 3OONA 3U0OA 5ITZB 2RHJA 5LA6B 3N2GB 3VOAA 1X7OA 1UI9A 2ZF8A 3QHDA 5EB1B 3WPXA 1N8RH 1RQ7A 5KX5B 1JY8A 2Z1UA 4F6RB 3SIVA 3TD4A 3CCSF 3LWVC 2CVLA 3OW2F 1PF5A 1U3PA 4NUTA 1XV2A 1W5BA 3LYBA 1PXWA 5LOVB 5LYJA 3CCMF 4O4LA 2VGNA 4HNAA 5J2TB 5EIBD 3JVHA 4ZHVA 4C81A 3VTIC 1FNKA 5HP7A 3JAWA 4EI9A 4O4HB 3KE1A 1FSZA 3RE3A 2ALEA 5JH7A 3P10A 2Z1FA 3JARB 1VQPF 4U39A 3CD6F 3F0GA 1JD1A 2I6RA 5IJ9A 3GHZA 3MCAB 5KX5A 4B62A 4YJ3A 5MN5A 3RA5A 5IJ0A 3ZP4A 3ERNA 3MDOA 2H8CA 3QUWA 3CXCF 3BYQA 3N2KB 3RYHB 1VQNF 3RYCB 3E1YA 3M84A 5J2UA 3LMEA 1KNJA 1U40A 1X52A 1XHOA 4IIJA 3VIUA 1NQ3A 3HKEA 4C4WC 3WGNA 3C9UA 3CCVF 5EB0A 4BVRA 3B6NA 4EB6B 5KMGB 3D54A 4TV8A 3S03A 4ZHYB 2QTPA 3LWRC 1QVFF 4O2AB 2HP0B 3FBAA 5LXTB 1VQKF 1W5EA 2UYKA 2HS3A 3VCZA 2FC3A 3FFMA 1TUBB 5EO3A 5LP6A 2NMUA 1JN1A 4O2BB 3GTZA 3T80A 1NMUB 2UYNA 5B8FA 4F6RA 4B46A 4BW0B 3M4SA 3IR9A 1IPAA 1NJIH 1K8AH 1VQ7F 1Q82H 4BT7A 3IEQA 3NVIB 4X1IA 4YJ2A 2N48A 3KJKA 4HNAB 3ESJA 4I4TB 1R1MA 3UT5A 3F6MA 5LOVA 1H7MA 4XCQA 3JAWB 4C8GA 2Q1XA 4C82A 3MCQA 2VGMA 2QEXF 4G4VA 4RQOA 3PAFA 4BVSA 3HWUA 1SA0A 1VQVA 2YYEA 4TV9B 4U3JB 1TVKA 4E6EA 3HAXD 3I3FA 4DRXB 4G4ZA 1VQ6F 1XRGA 5EIBC 5CA0A 3RYIA 3F0EA 3Q8HA 3CC2F 2R751 5C8YB 4TUYA 3RA6A 2BTQB 1W57A 2OTMA 1S72F 3WPWA 4X1YB 1XBIA 2HS4A 1JFFA 3VI6A 3OBYA 5HY0A 3CPWF 3JCMM 2PHNA 3C8LA 5EAZA 3K14A 3SIUA 5IYZB 1UFYA 2BTOA 1Q8RA 4FFBB 5HXZA 1W40A 3N4ZA 2VAWA 3LWQC 1Z5VA 2CWJA 2P6YA 3LFOA 1OFUA 3QTYA 5FNVB 1YJNF 1QU9A 3HKDA 1GZ0A 1VQ4F 3M1XA 5JCOA 3IKFA 5JCOC 3IKEA 1W55A 2AIFA 3C9SA 2IQQA 3MBMA 3CCRF 1X25A 3P4EA 4ZK7A 5J2UB 3RYCA 3TD3A 4X3MA 1TUBA 5G4VC 2G9IA 2BTUA 4X20B 1IV1A 2VXYA 3ON1A 2QI2A 1J7HA 4I50B 4B45A 5GIPC 2ZOVA 1W41A 4YJ3B 4EI8A 4X1KB 4C8EA 4BT6A 1M1KH 3E22A 5GONA 3K12A 4YJ2B 2CSLA 5EZYA 3CCQF 4M8IA 2W8BC 3I7TA 4IIJB 3TD5A 3CC4F 1H48A 2KTVA 1FNJA 3K2XA 5LP6B 1VK3A 3EORA 4BY9D 3S0WA 3JAMM 3LWPC 1QD9A 4LCKA 5HXUA 5GAPK 2LBTA 2DT4A 2LBXA 2Q1YA 4IHJA 4EB6A 1OAPA 3WGMA 3I55F 1GO0A 3S0YA 1VQOF 3MQWA 5LXTA 3G71F 2KG4A 5CA0B 2GVIA 4ZOLA 5BMVA 1SDSA 2QA4F 5IJ9B 3FD5A 5GIOC 4RHAA 1YGYA 2L26A 3CCLF 2CZWA 2JNBA 4TUYB 1YITF 1W3EX 2UYPA 5JVDB 3D01A 5FNVA 4WBNB 5CB4B 2VAPA 4ZHQA 1CN7A 5HY1A 5HY4A 1KQSF 4DRXA 3CCUF 1M90H 5IT9M 1GO1A 3IMPA 3G6EF 4BVTA 5HP8A 4BVQA 5IYZA
chains in the Genus database with same CATH topology
3CCJF 3RA6A 3GYQA 5HWEA 1S72F 2KTUA 1RLGA 1XBIA 3VI6A 4TZZA 3CMAF 1YJWF 1KC8H 3OBYA 3N4YA 4EI9A 5FLXM 1K73H 3NK7A 2F9ZC 3V3TA 5HY0A 3CPWF 2ALEA 3JCMM 3V7EA 1VQPF 3SIUA 3J7AR 3PLAC 3CD6F 3MCAB 5HXZA 1W40A 1T0KB 3N4ZA 3J81M 5A2QM 3LWQC 1KD1H 4NQ3A 3LFOA 3RA5A 3I56F 1YJNF 1W2BF 1GZ0A 1VQ4F 2OZBA 3HJWC 5HY2A 3CXCF 3O85A 1VQNF 2AIFA 1YI2F 3CCRF 1VQMF 3E1YA 1VQ5F 1W42A 4X3MA 2HVYD 5G4VC 1X52A 5GANK 1YJ9F 3NMUC 5GINC 5DCVA 3E20B 2OHWA 3ON1A 2QI2A 4C4WC 5GIPC 2GLZA 1QVGF 3V7QA 3CC7F 1W41A 3CCVF 4BVRA 4EI8A 2I6DA 1Q81H 1M1KH 2OTLF 4X3LA 3LWRC 1QVFF 2BO1A 1VQKF 3AGKA 3WXMB 3CCQF 1YHQF 3NK6A 2FC3A 3FFMA 3CC4F 5EO3A 2KTVA 1DT9A 2FGYA 2WALA 4BY9D 3CG6A 1NMUB 3CPQA 3JAMM 3LWPC 1VQLF 3LWOC 4BW0B 5G4UC 3IR9A 5HXUA 5GAPK 3NVKE 4LCKA 1IPAA 1NJIH 1YIJF 1K8AH 1VQ7F 3D00A 2LBXA 1Q82H 1VQ8F 3CCEF 3NVIB 1ZWZA 2LBWA 3I55F 3CMEF 1CK2A 1E7KA 1GO0A 1VQOF 5EWRA 1K9MH 3J80M 2KG4A 3OBWA 3G71F 1RA4A 1X7OA 1SDSA 1H7MA 2QA4F 4XCQA 1N8RH 5FJ4C 5GIOC 3VMFB 3CCLF 2CZWA 1Q7YH 3G4SF 3CCSF 2JNBA 3SIVA 3LWVC 2VGMA 1W3EX 2QEXF 1YITF 1X7PA 3PAFA 3OW2F 4BVSA 1Q86H 3HAXD 4NUTA 1CN7A 5HY1A 4EI7A 1VQ9F 1VQ6F 5HY4A 1KQSF 1JJ2F 3CCUF 1M90H 5IT9M 1GO1A 1PXWA 3G6EF 3CCMF 2OTJF 4BVTA 4BVQA 2VGNA 3CC2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ F;  3RA6 A;  3GYQ A;  1S72 F;  2KTU A;  1RLG A;  1XBI A;  3VI6 A;  4TZZ A;  3CMA F;  1YJW F;  1KC8 H;  3OBY A;  3N4Y A;  5FLX M;  1K73 H;  3NK7 A;  3CPW F;  2ALE A;  3JCM M;  3V7E A;  1VQP F;  3SIU A;  3J7A R;  3PLA C;  3CD6 F;  3MCA B;  1W40 A;  1T0K B;  3N4Z A;  3J81 M;  5A2Q M;  3LWQ C;  1KD1 H;  3LFO A;  3RA5 A;  3I56 F;  1YJN F;  1W2B F;  1GZ0 A;  1VQ4 F;  2OZB A;  3HJW C;  3CXC F;  3O85 A;  1VQN F;  2AIF A;  1YI2 F;  3CCR F;  1VQM F;  3E1Y A;  1VQ5 F;  1W42 A;  4X3M A;  2HVY D;  5G4V C;  1X52 A;  5GAN K;  1YJ9 F;  3NMU C;  5GIN C;  5DCV A;  3E20 B;  2OHW A;  3ON1 A;  2QI2 A;  4C4W C;  5GIP C;  3CC7 F;  1QVG F;  3V7Q A;  1W41 A;  3CCV F;  2I6D A;  1Q81 H;  1M1K H;  2OTL F;  4X3L A;  3LWR C;  1QVF F;  2BO1 A;  1VQK F;  3AGK A;  3WXM B;  3CCQ F;  1YHQ F;  3NK6 A;  2FC3 A;  3FFM A;  3CC4 F;  5EO3 A;  2KTV A;  1DT9 A;  2WAL A;  4BY9 D;  3CG6 A;  1NMU B;  3CPQ A;  3JAM M;  3LWP C;  1VQL F;  3LWO C;  4BW0 B;  5G4U C;  3IR9 A;  5GAP K;  3NVK E;  4LCK A;  1IPA A;  1NJI H;  1YIJ F;  1K8A H;  1VQ7 F;  2LBX A;  1Q82 H;  1VQ8 F;  3CCE F;  3NVI B;  1ZWZ A;  2LBW A;  3I55 F;  3CME F;  1CK2 A;  1E7K A;  1GO0 A;  1VQO F;  5EWR A;  1K9M H;  3J80 M;  2KG4 A;  3OBW A;  3G71 F;  1RA4 A;  1X7O A;  1SDS A;  1H7M A;  2QA4 F;  1N8R H;  5FJ4 C;  5GIO C;  3VMF B;  3CCL F;  2CZW A;  1Q7Y H;  3G4S F;  3CCS F;  2JNB A;  3SIV A;  3LWV C;  2VGM A;  1W3E X;  2QEX F;  1YIT F;  1X7P A;  3PAF A;  3OW2 F;  1Q86 H;  3HAX D;  4NUT A;  1CN7 A;  1VQ9 F;  1VQ6 F;  1KQS F;  1JJ2 F;  3CCU F;  1M90 H;  5IT9 M;  1GO1 A;  1PXW A;  3G6E F;  3CCM F;  2OTJ F;  2VGN A;  3CC2 F; 
#chains in the Genus database with same CATH topology
 2DYY A;  3RYF A;  4O4I B;  1W58 1;  2KTU A;  3FPI A;  1U3L A;  4TZZ A;  4BT3 A;  3CMA F;  3WJP A;  1KC8 H;  1JFF B;  1W5A A;  2HRU A;  5EYP B;  2Z1T A;  2F9Z C;  3V3T A;  4I4T A;  2AIZ P;  3V7E A;  3J7A R;  3PLA C;  1KNK A;  2HS0 A;  3UT5 B;  3K0T A;  4ZI7 A;  5A2Q M;  4I50 A;  1KD1 H;  3KJJ A;  2KGW A;  3I56 F;  1W5F A;  3CYQ A;  4WBN A;  1W2B F;  2OZB A;  3HJW C;  4BT2 A;  1Z5W A;  5EYP A;  2RHH A;  1DBF A;  4ERH A;  2ZVZ A;  3JAS A;  3JAK A;  4TV9 A;  4U3J A;  5EZY B;  5GAN K;  1YJ9 F;  3NMU C;  1SZQ A;  5GIN C;  5C8Y A;  4G4X A;  3E20 B;  2OHW A;  5J2T A;  2GLZ A;  4ZI7 B;  3CC7 F;  2K1S A;  2Z01 A;  5MN4 A;  3VYT C;  1IV4 A;  4FFB A;  3R0P A;  3S0H A;  3JAT B;  1Q81 H;  1W59 A;  2HP3 A;  2OTL F;  3WJR A;  3WGL A;  3WGJ A;  3HKC B;  3ELC A;  4G4W A;  2BO1 A;  5LP6 C;  4G4Y A;  3JAL A;  3P0Z A;  3AGK A;  4DXD A;  3ZO8 A;  5CA1 B;  3C9T A;  4ZOL B;  2RHL A;  3CPQ A;  3HKD B;  3LWO C;  5IJ0 B;  5G4U C;  3VYS C;  3NVK E;  4NWO B;  3VYU C;  5GON B;  3D00 A;  4X1Y A;  3HKB B;  1VQ8 F;  4IHJ B;  3CCE F;  1ZWZ A;  2ZOD A;  4X1K A;  2RHO A;  4LNU B;  4O4J B;  3CME F;  5EWR A;  5CB4 A;  5JQG B;  1K9M H;  5ITZ A;  2PMP A;  1VH8 A;  3OBW A;  3HKE B;  5JH7 B;  5LYJ B;  3RYI B;  1RA4 A;  3J80 M;  3DC2 A;  3CYP B;  5FJ4 C;  3CB2 A;  3VMF B;  1Q7Y H;  3WGK A;  3G4S F;  1CLI A;  3N2K A;  3RYH A;  5JVD A;  1ONI A;  1X7P A;  3LDT A;  1GX1 A;  1Q86 H;  3VO8 A;  3DDN A;  3E22 B;  1IV2 A;  2MQE A;  4EI7 A;  1VQ9 F;  1JJ2 F;  4PWT A;  3N2G A;  2OTJ F;  2YXZ A;  1YQN A;  2B33 A;  4X20 A;  3CCJ F;  2RB9 A;  3FD6 A;  4TV8 B;  2HX0 A;  3GYQ A;  4BT4 A;  4C8I A;  4I55 A;  5HWE A;  1RLG A;  3HKB A;  1YJW F;  3C9R A;  3N4Y A;  4ZHQ B;  2H8E A;  1SA0 B;  3IEW A;  5FLX M;  1K73 H;  3NK7 A;  3ZP7 A;  3F0D A;  2VAM A;  3JAK B;  2ZVY A;  2UZH A;  5KMG A;  1T0K B;  3RYF B;  3J81 M;  5BMV B;  3S06 A;  4NQ3 A;  2IAF A;  4ZHW A;  2CW4 A;  2UYN B;  1T0A A;  4LNU A;  4O4J A;  2H6L A;  2IG8 A;  5HY2 A;  3O85 A;  4O4H A;  1YI2 F;  3S02 A;  1VQM F;  3JAS B;  1VQ5 F;  4B5C A;  2EWC A;  1W42 A;  2HVY D;  2CHT A;  5LA6 A;  5DCV A;  5AVM A;  5CA1 A;  2LCA A;  4O2B A;  1QVG F;  3V4D A;  3V7Q A;  5MN6 A;  4O4L B;  4R40 B;  3JAT A;  3WJQ A;  2I6D A;  4X1I B;  2CHS A;  3L7Q A;  4O4I A;  4X3L A;  2Z1E A;  5JQG A;  1COM A;  2HP0 A;  2HQS C;  4KWE A;  2GZL A;  3WXM B;  2ZAU A;  1IV3 A;  1FFX A;  3F0F A;  1YHQ F;  3NK6 A;  1RLU A;  1RQ2 A;  3HTN A;  2R6R 1;  1U43 A;  1VHA A;  2AMT A;  1DT9 A;  2FGY A;  1H47 A;  2WAL A;  3JAR A;  3KIZ A;  1QAH A;  3CG6 A;  2UYJ A;  3ZOP A;  4BT5 A;  1VQL F;  2HRY A;  1YIJ F;  4O2A A;  3KHN A;  4I55 B;  3VOB A;  4G88 A;  2V9Y A;  2LBW A;  1CK2 A;  1E7K A;  3JAL B;  1TVK B;  1FFX B;  1ODE A;  3HKC A;  3OON A;  3U0O A;  5ITZ B;  2RHJ A;  5LA6 B;  3N2G B;  3VOA A;  1X7O A;  1UI9 A;  2ZF8 A;  3QHD A;  5EB1 B;  3WPX A;  1N8R H;  1RQ7 A;  5KX5 B;  1JY8 A;  2Z1U A;  4F6R B;  3SIV A;  3TD4 A;  3CCS F;  3LWV C;  2CVL A;  3OW2 F;  1PF5 A;  1U3P A;  4NUT A;  1XV2 A;  1W5B A;  3LYB A;  1PXW A;  5LOV B;  5LYJ A;  3CCM F;  4O4L A;  2VGN A;  4HNA A;  5J2T B;  5EIB D;  3JVH A;  4ZHV A;  4C81 A;  3VTI C;  1FNK A;  5HP7 A;  3JAW A;  4EI9 A;  4O4H B;  3KE1 A;  1FSZ A;  3RE3 A;  2ALE A;  5JH7 A;  3P10 A;  2Z1F A;  3JAR B;  1VQP F;  4U39 A;  3CD6 F;  3F0G A;  1JD1 A;  2I6R A;  5IJ9 A;  3GHZ A;  3MCA B;  5KX5 A;  4B62 A;  4YJ3 A;  5MN5 A;  3RA5 A;  5IJ0 A;  3ZP4 A;  3ERN A;  3MDO A;  2H8C A;  3QUW A;  3CXC F;  3BYQ A;  3N2K B;  3RYH B;  1VQN F;  3RYC B;  3E1Y A;  3M84 A;  5J2U A;  3LME A;  1KNJ A;  1U40 A;  1X52 A;  1XHO A;  4IIJ A;  3VIU A;  1NQ3 A;  3HKE A;  4C4W C;  3WGN A;  3C9U A;  3CCV F;  5EB0 A;  4BVR A;  3B6N A;  4EB6 B;  5KMG B;  3D54 A;  4TV8 A;  3S03 A;  4ZHY B;  2QTP A;  3LWR C;  1QVF F;  4O2A B;  2HP0 B;  3FBA A;  5LXT B;  1VQK F;  1W5E A;  2UYK A;  2HS3 A;  3VCZ A;  2FC3 A;  3FFM A;  1TUB B;  5EO3 A;  5LP6 A;  2NMU A;  1JN1 A;  4O2B B;  3GTZ A;  3T80 A;  1NMU B;  2UYN A;  5B8F A;  4F6R A;  4B46 A;  4BW0 B;  3M4S A;  3IR9 A;  1IPA A;  1NJI H;  1K8A H;  1VQ7 F;  1Q82 H;  4BT7 A;  3IEQ A;  3NVI B;  4X1I A;  4YJ2 A;  2N48 A;  3KJK A;  4HNA B;  3ESJ A;  4I4T B;  1R1M A;  3UT5 A;  3F6M A;  5LOV A;  1H7M A;  4XCQ A;  3JAW B;  4C8G A;  2Q1X A;  4C82 A;  3MCQ A;  2VGM A;  2QEX F;  4G4V A;  4RQO A;  3PAF A;  4BVS A;  3HWU A;  1SA0 A;  1VQV A;  2YYE A;  4TV9 B;  4U3J B;  1TVK A;  4E6E A;  3HAX D;  3I3F A;  4DRX B;  4G4Z A;  1VQ6 F;  1XRG A;  5EIB C;  5CA0 A;  3RYI A;  3F0E A;  3Q8H A;  3CC2 F;  2R75 1;  5C8Y B;  4TUY A;  3RA6 A;  2BTQ B;  1W57 A;  2OTM A;  1S72 F;  3WPW A;  4X1Y B;  1XBI A;  2HS4 A;  1JFF A;  3VI6 A;  3OBY A;  5HY0 A;  3CPW F;  3JCM M;  2PHN A;  3C8L A;  5EAZ A;  3K14 A;  3SIU A;  5IYZ B;  1UFY A;  2BTO A;  1Q8R A;  4FFB B;  5HXZ A;  1W40 A;  3N4Z A;  2VAW A;  3LWQ C;  1Z5V A;  2CWJ A;  2P6Y A;  3LFO A;  1OFU A;  3QTY A;  5FNV B;  1YJN F;  1QU9 A;  3HKD A;  1GZ0 A;  1VQ4 F;  3M1X A;  5JCO A;  3IKF A;  5JCO C;  3IKE A;  1W55 A;  2AIF A;  3C9S A;  2IQQ A;  3MBM A;  3CCR F;  1X25 A;  3P4E A;  4ZK7 A;  5J2U B;  3RYC A;  3TD3 A;  4X3M A;  1TUB A;  5G4V C;  2G9I A;  2BTU A;  4X20 B;  1IV1 A;  2VXY A;  3ON1 A;  2QI2 A;  1J7H A;  4I50 B;  4B45 A;  5GIP C;  2ZOV A;  1W41 A;  4YJ3 B;  4EI8 A;  4X1K B;  4C8E A;  4BT6 A;  1M1K H;  3E22 A;  5GON A;  3K12 A;  4YJ2 B;  2CSL A;  5EZY A;  3CCQ F;  4M8I A;  2W8B C;  3I7T A;  4IIJ B;  3TD5 A;  3CC4 F;  1H48 A;  2KTV A;  1FNJ A;  3K2X A;  5LP6 B;  1VK3 A;  3EOR A;  4BY9 D;  3S0W A;  3JAM M;  3LWP C;  1QD9 A;  4LCK A;  5HXU A;  5GAP K;  2LBT A;  2DT4 A;  2LBX A;  2Q1Y A;  4IHJ A;  4EB6 A;  1OAP A;  3WGM A;  3I55 F;  1GO0 A;  3S0Y A;  1VQO F;  3MQW A;  5LXT A;  3G71 F;  2KG4 A;  5CA0 B;  2GVI A;  4ZOL A;  5BMV A;  1SDS A;  2QA4 F;  5IJ9 B;  3FD5 A;  5GIO C;  4RHA A;  1YGY A;  2L26 A;  3CCL F;  2CZW A;  2JNB A;  4TUY B;  1YIT F;  1W3E X;  2UYP A;  5JVD B;  3D01 A;  5FNV A;  4WBN B;  5CB4 B;  2VAP A;  4ZHQ A;  1CN7 A;  5HY1 A;  5HY4 A;  1KQS F;  4DRX A;  3CCU F;  1M90 H;  5IT9 M;  1GO1 A;  3IMP A;  3G6E F;  4BVT A;  5HP8 A;  4BVQ A;  5IYZ A; 
#chains in the Genus database with same CATH homology
 3CCJ F;  3RA6 A;  3GYQ A;  5HWE A;  1S72 F;  2KTU A;  1RLG A;  1XBI A;  3VI6 A;  4TZZ A;  3CMA F;  1YJW F;  1KC8 H;  3OBY A;  3N4Y A;  4EI9 A;  5FLX M;  1K73 H;  3NK7 A;  2F9Z C;  3V3T A;  5HY0 A;  3CPW F;  2ALE A;  3JCM M;  3V7E A;  1VQP F;  3SIU A;  3J7A R;  3PLA C;  3CD6 F;  3MCA B;  5HXZ A;  1W40 A;  1T0K B;  3N4Z A;  3J81 M;  5A2Q M;  3LWQ C;  1KD1 H;  4NQ3 A;  3LFO A;  3RA5 A;  3I56 F;  1YJN F;  1W2B F;  1GZ0 A;  1VQ4 F;  2OZB A;  3HJW C;  5HY2 A;  3CXC F;  3O85 A;  1VQN F;  2AIF A;  1YI2 F;  3CCR F;  1VQM F;  3E1Y A;  1VQ5 F;  1W42 A;  4X3M A;  2HVY D;  5G4V C;  1X52 A;  5GAN K;  1YJ9 F;  3NMU C;  5GIN C;  5DCV A;  3E20 B;  2OHW A;  3ON1 A;  2QI2 A;  4C4W C;  5GIP C;  2GLZ A;  1QVG F;  3V7Q A;  3CC7 F;  1W41 A;  3CCV F;  4BVR A;  4EI8 A;  2I6D A;  1Q81 H;  1M1K H;  2OTL F;  4X3L A;  3LWR C;  1QVF F;  2BO1 A;  1VQK F;  3AGK A;  3WXM B;  3CCQ F;  1YHQ F;  3NK6 A;  2FC3 A;  3FFM A;  3CC4 F;  5EO3 A;  2KTV A;  1DT9 A;  2FGY A;  2WAL A;  4BY9 D;  3CG6 A;  1NMU B;  3CPQ A;  3JAM M;  3LWP C;  1VQL F;  3LWO C;  4BW0 B;  5G4U C;  3IR9 A;  5HXU A;  5GAP K;  3NVK E;  4LCK A;  1IPA A;  1NJI H;  1YIJ F;  1K8A H;  1VQ7 F;  3D00 A;  2LBX A;  1Q82 H;  1VQ8 F;  3CCE F;  3NVI B;  1ZWZ A;  2LBW A;  3I55 F;  3CME F;  1CK2 A;  1E7K A;  1GO0 A;  1VQO F;  5EWR A;  1K9M H;  3J80 M;  2KG4 A;  3OBW A;  3G71 F;  1RA4 A;  1X7O A;  1SDS A;  1H7M A;  2QA4 F;  4XCQ A;  1N8R H;  5FJ4 C;  5GIO C;  3VMF B;  3CCL F;  2CZW A;  1Q7Y H;  3G4S F;  3CCS F;  2JNB A;  3SIV A;  3LWV C;  2VGM A;  1W3E X;  2QEX F;  1YIT F;  1X7P A;  3PAF A;  3OW2 F;  4BVS A;  1Q86 H;  3HAX D;  4NUT A;  1CN7 A;  5HY1 A;  4EI7 A;  1VQ9 F;  1VQ6 F;  5HY4 A;  1KQS F;  1JJ2 F;  3CCU F;  1M90 H;  5IT9 M;  1GO1 A;  1PXW A;  3G6E F;  3CCM F;  2OTJ F;  4BVT A;  4BVQ A;  2VGN A;  3CC2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...