3M4SA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, orthorhombic form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
b'KLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
molecule tags Unknown function
source organism Entamoeba histolytica
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, orthorhombic form
rcsb
total genus 38
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m4sA00
1COMA 3L7QA 1ONIA 3LYBA 2CVLA 2UYPA 1PF5A 3K12A 3LMEA 1UI9A 1JD1A 3M4SA 1UFYA 3M1XA 1QAHA 3VCZA 2CWJA 1J7HA 4ZK7A 3ZP7A 1QU9A 3V4DA 1FNKA 1NQ3A 2IG8A 3D01A 3GTZA 5HP8A 1ODEA 3K0TA 3ZO8A 3MQWA 1DBFA 2UYNB 3ZOPA 3KJKA 5HP7A 1X25A 1XHOA 2DYYA 2UYNA 2CW4A 1QD9A 3I7TA 2UYJA 2CHSA 1XRGA 3QUWA 2OTMA 2CSLA 3I3FA 4NWOB 1FNJA 2B33A 3ZP4A 3R0PA 2UYKA 2EWCA 3KJJA 2CHTA
chains in the Genus database with same CATH superfamily
3NMUC 5LA6A 2QTPA 3U0OA 2GZLA 3LMEA 1S72F 1FFXB 3VYUC 2CWJA 5HXZA 1H7MA 3HKDB 1U3LA 3MDOA 1QU9A 1RLUA 3F0DA 2RHOA 1FSZA 1W5EA 4ZHQA 3ZOPA 2K1SA 5FLXM 4BW0B 2N48A 5C8YA 5MN6A 3WXMB 1GZ0A 3P10A 3HKEA 2BTUA 2Z1TA 1VQ8F 2CSLA 4BVSA 1SZQA 4EI7A 1VQOF 2ZAUA 3ESJA 2JNBA 2ZVZA 3AGKA 3KHNA 3N2KA 3VOAA 4TUYA 1Q7YH 4HNAA 1FFXA 1ONIA 2HP0A 4LNUB 1M1KH 4ERHA 4O4JA 3Q8HA 4ZI7A 1VQVA 3DC2A 5LP6C 1IV2A 3CPQA 1YIJF 3E1YA 5C8YB 2RHHA 4TV8B 3GTZA 1RLGA 2VGNA 3GYQA 4G4WA 4I55A 3TD3A 3CCLF 1U3PA 2UYNB 4O4JB 2H6LA 5EAZA 3OBYA 2Z1EA 5G4VC 5GIOC 4DXDA 3E22B 2KG4A 3CG6A 2CHSA 3LWVC 3JALA 3F0GA 3JVHA 4RQOA 3V7EA 3FD5A 5LOVA 1Q82H 1K9MH 1W5AA 3SIUA 5CA0A 3L7QA 3CMAF 3CCJF 1KC8H 3MBMA 3RYFB 5KX5A 4O4LA 4O2AA 1TUBA 3HTNA 2HQSC 4KWEA 5MN4A 1W581 2AIZP 3IR9A 2ZOVA 3RYHA 3HWUA 2OZBA 4G88A 3RYFA 5LP6A 1W41A 3I55F 1XRGA 3WGKA 4TV9A 3ERNA 5J2TA 3R0PA 2LBWA 5IT9M 2V9YA 5GANK 2H8CA 3D00A 4ZHYB 2AMTA 3E20B 4C8IA 1SA0B 4X20A 1T0KB 1RQ2A 3UT5B 1YITF 4O4HB 2AIFA 1KNKA 5HP8A 4LCKA 1JJ2F 5DCVA 3MQWA 2VGMA 5J2UB 5A2QM 1XHOA 3M84A 3CCSF 2P6YA 4F6RB 2HP3A 1QD9A 4X3MA 2RB9A 1N8RH 1VQ9F 4EI8A 3JARB 2RHJA 2HS4A 4HNAB 2LCAA 3GHZA 3RYIA 4O2AB 2BO1A 4BT7A 4PWTA 5EYPB 4TV8A 2G9IA 5EIBD 4BT6A 3JASA 3JAKA 3HKBB 3JATA 3KJKA 1X25A 5JH7B 2DYYA 1IV1A 4YJ3A 5LXTB 2R6R1 3JAWA 3I3FA 5IYZB 1JN1A 1FNJA 5B8FA 5IJ0B 2ZF8A 1CK2A 1COMA 5EO3A 1Q8RA 4IIJB 1VQ5F 4B62A 5CA0B 5LXTA 3RA6A 3CYQA 3CCVF 4U39A 3CC2F 3JAWB 1J7HA 3N4YA 5IJ9A 3S02A 5GAPK 4I4TA 5EZYB 5GINC 3V4DA 3CCUF 3S0WA 2HS0A 1ODEA 3FFMA 3BYQA 2L26A 1W5BA 3SIVA 5JCOA 3TD5A 3VYTC 3CCEF 3S0YA 1JFFA 2Z1UA 4X1IA 3HKDA 3JATB 5KMGB 1ZWZA 1JD1A 1E7KA 3VCZA 1NMUB 1VHAA 3VTIC 2VXYA 3JCMM 2KTUA 1TVKA 1FNKA 4BY9D 1RA4A 1Q81H 1Q86H 1W5FA 3RE3A 2Q1YA 3WGMA 5MN5A 2QA4F 3CYPB 5IYZA 4O4HA 4LNUA 3OONA 4RHAA 4BT3A 4X3LA 3I7TA 4C8EA 1XBIA 1W3EX 3WGJA 3J7AR 5IJ9B 2WALA 3LWOC 1K73H 3IEWA 1XV2A 3WPXA 2FGYA 4FFBB 2UYPA 4TV9B 5JCOC 1Z5VA 5BMVB 2PMPA 1GO0A 3NK7A 3P4EA 2BTQB 2LBTA 2QEXF 5CB4B 5EB1B 2HX0A 4X1IB 1YI2F 2ZVYA 1Z5WA 2VAMA 3JASB 5GIPC 2UYJA 1KNJA 2I6DA 3VYSC 2IAFA 3EORA 2B33A 2HRYA 3V3TA 2HS3A 4NQ3A 3WJQA 5LP6B 1VQ4F 1NJIH 3IEQA 4C81A 3I56F 2MQEA 3C9SA 1VQMF 5HY2A 5JVDA 3E22A 3IKFA 2Q1XA 2H8EA 3MCQA 4B5CA 5FNVB 1CLIA 1X52A 5LYJA 5J2TB 4BT5A 1W42A 3CPWF 4FFBA 3N2GA 4X20B 2OTLF 3HKCA 5CA1A 4DRXB 2UYKA 3IKEA 2OHWA 3S06A 4U3JB 5KMGA 1R1MA 1TUBB 4XCQA 2CZWA 1W59A 3DDNA 1VH8A 3N2KB 5KX5B 1PF5A 1UI9A 2R751 4YJ2A 5LA6B 1VQLF 1QVFF 5ITZA 3PAFA 5G4UC 3C9RA 1RQ7A 4ZK7A 4X1YA 3KE1A 5IJ0A 3K0TA 3B6NA 4TZZA 4I50B 1X7PA 4ZOLB 3CCMF 3HAXD 3HKCB 2W8BC 1W57A 3K2XA 5CA1B 5JQGA 3ZP4A 2Z01A 3F0EA 3N4ZA 2CHTA 2VAWA 3FD6A 5EYPA 3LDTA 3LYBA 4X1KA 5HXUA 2GLZA 3G71F 5FNVA 4C82A 2I6RA 1IPAA 2DT4A 3ZP7A 3RYHB 1W55A 4G4XA 1KD1H 1YQNA 1DBFA 5EWRA 3CMEF 4G4YA 4U3JA 3RYCB 2UYNA 1VQ7F 2ZODA 2UZHA 3QUWA 5AVMA 4O4IA 4WBNA 4ZHQB 3C8LA 2GVIA 4YJ2B 1PXWA 3QHDA 1YGYA 4B45A 1VQNF 3FBAA 3J80M 3O85A 3K14A 4BT4A 1W2BF 3C9TA 3JAKB 2KTVA 1VQ6F 3LWRC 1NQ3A 3NK6A 2KGWA 3ZO8A 1M90H 4O4IB 4WBNB 5HY4A 1SDSA 1TVKB 2IQQA 4BT2A 3IMPA 3TD4A 1KQSF 3WGNA 5CB4A 3CB2A 2F9ZC 2EWCA 3F6MA 3V7QA 3ON1A 3WJPA 3FPIA 3M4SA 1UFYA 2ALEA 1QAHA 1T0AA 3NVIB 5EB0A 1H47A 3JALB 1GX1A 1OFUA 3G6EF 1SA0A 5HP7A 3WGLA 4O2BA 4G4VA 2CW4A 3ELCA 4TUYB 4ZOLA 1JFFB 4I50A 3KIZA 4R40B 5HY1A 3T80A 4E6EA 1YJNF 4X1KB 3VIUA 3OW2F 2CVLA 1OAPA 3RYIB 3M1XA 3LFOA 3RA5A 4M8IA 2IG8A 1U43A 3CD6F 4O2BB 3MCAB 4BVRA 5GONB 1GO1A 1CN7A 4ZHWA 2FC3A 2RHLA 3C9UA 3CXCF 1H48A 1U40A 3LWQC 2OTJF 4NWOB 3JAMM 1YJWF 3RYCA 3KJJA 5EIBC 2HP0B 5JVDB 3J81M 5GONA 3UT5A 5HWEA 2HVYD 4BVTA 4G4ZA 4YJ3B 2Z1FA 3G4SF 4ZHVA 3D54A 3K12A 3VOBA 3NVKE 3JARA 3WPWA 4IHJB 4DRXA 3S03A 5J2UA 3F0FA 3VMFB 4I55B 4BVQA 4F6RA 3PLAC 5LYJB 3D01A 1X7OA 4IIJA 1IV3A 2NMUA 3VI6A 1JY8A 5ITZB 4EI9A 3OBWA 5LOVB 1QVGF 4IHJA 4EB6A 2VAPA 5JH7A 2HRUA 1VK3A 5HY0A 3CC4F 3HKBA 4C8GA 4B46A 1VQKF 1K8AH 2YXZA 4O4LB 1VQPF 3HKEB 3CCRF 1W40A 4X1YB 3S0HA 1YHQF 3HJWC 2YYEA 4ZI7B 4NUTA 5JQGB 2LBXA 3QTYA 5FJ4C 4I4TB 2BTOA 1IV4A 5EZYA 4EB6B 3LWPC 3VO8A 2QI2A 5BMVA 3WJRA 1DT9A 3N2GB 4C4WC 1YJ9F 2OTMA 3CCQF 3P0ZA 2PHNA 3CC7F
chains in the Genus database with same CATH topology
1COMA 3L7QA 1ONIA 3LYBA 2CVLA 2UYPA 1PF5A 3K12A 3LMEA 1UI9A 1JD1A 3M4SA 1UFYA 3M1XA 1QAHA 3VCZA 2CWJA 1J7HA 4ZK7A 3ZP7A 1QU9A 3V4DA 1FNKA 1NQ3A 2IG8A 3D01A 3GTZA 5HP8A 1ODEA 3K0TA 3ZO8A 3MQWA 1DBFA 2UYNB 3ZOPA 3KJKA 5HP7A 1X25A 1XHOA 2DYYA 2UYNA 2CW4A 1QD9A 3I7TA 2UYJA 2CHSA 1XRGA 3QUWA 2OTMA 2CSLA 3I3FA 4NWOB 1FNJA 2B33A 3ZP4A 3R0PA 2UYKA 2EWCA 3KJJA 2CHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COM A;  3L7Q A;  1ONI A;  3LYB A;  2CVL A;  2UYP A;  1PF5 A;  3K12 A;  3LME A;  1UI9 A;  1JD1 A;  3M4S A;  1UFY A;  3M1X A;  1QAH A;  3VCZ A;  2CWJ A;  1J7H A;  4ZK7 A;  3ZP7 A;  1QU9 A;  3V4D A;  1FNK A;  1NQ3 A;  2IG8 A;  3D01 A;  3GTZ A;  5HP8 A;  1ODE A;  3K0T A;  3ZO8 A;  3MQW A;  1DBF A;  2UYN B;  3ZOP A;  3KJK A;  5HP7 A;  1X25 A;  1XHO A;  2DYY A;  2UYN A;  2CW4 A;  1QD9 A;  3I7T A;  2UYJ A;  2CHS A;  1XRG A;  3QUW A;  2OTM A;  2CSL A;  3I3F A;  4NWO B;  1FNJ A;  2B33 A;  3ZP4 A;  3R0P A;  2UYK A;  2EWC A;  3KJJ A;  2CHT A; 
#chains in the Genus database with same CATH topology
 3NMU C;  5LA6 A;  2QTP A;  3U0O A;  2GZL A;  3LME A;  1S72 F;  1FFX B;  3VYU C;  2CWJ A;  5HXZ A;  1H7M A;  3HKD B;  1U3L A;  3MDO A;  1QU9 A;  1RLU A;  3F0D A;  2RHO A;  1FSZ A;  1W5E A;  4ZHQ A;  3ZOP A;  2K1S A;  5FLX M;  4BW0 B;  2N48 A;  5C8Y A;  5MN6 A;  3WXM B;  1GZ0 A;  3P10 A;  3HKE A;  2BTU A;  2Z1T A;  1VQ8 F;  2CSL A;  4BVS A;  1SZQ A;  4EI7 A;  1VQO F;  2ZAU A;  3ESJ A;  2JNB A;  2ZVZ A;  3AGK A;  3KHN A;  3N2K A;  3VOA A;  4TUY A;  1Q7Y H;  4HNA A;  1FFX A;  1ONI A;  2HP0 A;  4LNU B;  1M1K H;  4ERH A;  4O4J A;  3Q8H A;  4ZI7 A;  1VQV A;  3DC2 A;  5LP6 C;  1IV2 A;  3CPQ A;  1YIJ F;  3E1Y A;  5C8Y B;  2RHH A;  4TV8 B;  3GTZ A;  1RLG A;  2VGN A;  3GYQ A;  4G4W A;  4I55 A;  3TD3 A;  3CCL F;  1U3P A;  2UYN B;  4O4J B;  2H6L A;  5EAZ A;  3OBY A;  2Z1E A;  5G4V C;  5GIO C;  4DXD A;  3E22 B;  2KG4 A;  3CG6 A;  2CHS A;  3LWV C;  3JAL A;  3F0G A;  3JVH A;  4RQO A;  3V7E A;  3FD5 A;  5LOV A;  1Q82 H;  1K9M H;  1W5A A;  3SIU A;  5CA0 A;  3L7Q A;  3CMA F;  3CCJ F;  1KC8 H;  3MBM A;  3RYF B;  5KX5 A;  4O4L A;  4O2A A;  1TUB A;  3HTN A;  2HQS C;  4KWE A;  5MN4 A;  1W58 1;  2AIZ P;  3IR9 A;  2ZOV A;  3RYH A;  3HWU A;  2OZB A;  4G88 A;  3RYF A;  5LP6 A;  1W41 A;  3I55 F;  1XRG A;  3WGK A;  4TV9 A;  3ERN A;  5J2T A;  3R0P A;  2LBW A;  5IT9 M;  2V9Y A;  5GAN K;  2H8C A;  3D00 A;  4ZHY B;  2AMT A;  3E20 B;  4C8I A;  1SA0 B;  4X20 A;  1T0K B;  1RQ2 A;  3UT5 B;  1YIT F;  4O4H B;  2AIF A;  1KNK A;  5HP8 A;  4LCK A;  1JJ2 F;  5DCV A;  3MQW A;  2VGM A;  5J2U B;  5A2Q M;  1XHO A;  3M84 A;  3CCS F;  2P6Y A;  4F6R B;  2HP3 A;  1QD9 A;  4X3M A;  2RB9 A;  1N8R H;  1VQ9 F;  4EI8 A;  3JAR B;  2RHJ A;  2HS4 A;  4HNA B;  2LCA A;  3GHZ A;  3RYI A;  4O2A B;  2BO1 A;  4BT7 A;  4PWT A;  5EYP B;  4TV8 A;  2G9I A;  5EIB D;  4BT6 A;  3JAS A;  3JAK A;  3HKB B;  3JAT A;  3KJK A;  1X25 A;  5JH7 B;  2DYY A;  1IV1 A;  4YJ3 A;  5LXT B;  2R6R 1;  3JAW A;  3I3F A;  5IYZ B;  1JN1 A;  1FNJ A;  5B8F A;  5IJ0 B;  2ZF8 A;  1CK2 A;  1COM A;  5EO3 A;  1Q8R A;  4IIJ B;  1VQ5 F;  4B62 A;  5CA0 B;  5LXT A;  3RA6 A;  3CYQ A;  3CCV F;  4U39 A;  3CC2 F;  3JAW B;  1J7H A;  3N4Y A;  5IJ9 A;  3S02 A;  5GAP K;  4I4T A;  5EZY B;  5GIN C;  3V4D A;  3CCU F;  3S0W A;  2HS0 A;  1ODE A;  3FFM A;  3BYQ A;  2L26 A;  1W5B A;  3SIV A;  5JCO A;  3TD5 A;  3VYT C;  3CCE F;  3S0Y A;  1JFF A;  2Z1U A;  4X1I A;  3HKD A;  3JAT B;  5KMG B;  1ZWZ A;  1JD1 A;  1E7K A;  3VCZ A;  1NMU B;  1VHA A;  3VTI C;  2VXY A;  3JCM M;  2KTU A;  1TVK A;  1FNK A;  4BY9 D;  1RA4 A;  1Q81 H;  1Q86 H;  1W5F A;  3RE3 A;  2Q1Y A;  3WGM A;  5MN5 A;  2QA4 F;  3CYP B;  5IYZ A;  4O4H A;  4LNU A;  3OON A;  4RHA A;  4BT3 A;  4X3L A;  3I7T A;  4C8E A;  1XBI A;  1W3E X;  3WGJ A;  3J7A R;  5IJ9 B;  2WAL A;  3LWO C;  1K73 H;  3IEW A;  1XV2 A;  3WPX A;  2FGY A;  4FFB B;  2UYP A;  4TV9 B;  5JCO C;  1Z5V A;  5BMV B;  2PMP A;  1GO0 A;  3NK7 A;  3P4E A;  2BTQ B;  2LBT A;  2QEX F;  5CB4 B;  5EB1 B;  2HX0 A;  4X1I B;  1YI2 F;  2ZVY A;  1Z5W A;  2VAM A;  3JAS B;  5GIP C;  2UYJ A;  1KNJ A;  2I6D A;  3VYS C;  2IAF A;  3EOR A;  2B33 A;  2HRY A;  3V3T A;  2HS3 A;  4NQ3 A;  3WJQ A;  5LP6 B;  1VQ4 F;  1NJI H;  3IEQ A;  4C81 A;  3I56 F;  2MQE A;  3C9S A;  1VQM F;  5HY2 A;  5JVD A;  3E22 A;  3IKF A;  2Q1X A;  2H8E A;  3MCQ A;  4B5C A;  5FNV B;  1CLI A;  1X52 A;  5LYJ A;  5J2T B;  4BT5 A;  1W42 A;  3CPW F;  4FFB A;  3N2G A;  4X20 B;  2OTL F;  3HKC A;  5CA1 A;  4DRX B;  2UYK A;  3IKE A;  2OHW A;  3S06 A;  4U3J B;  5KMG A;  1R1M A;  1TUB B;  4XCQ A;  2CZW A;  1W59 A;  3DDN A;  1VH8 A;  3N2K B;  5KX5 B;  1PF5 A;  1UI9 A;  2R75 1;  4YJ2 A;  5LA6 B;  1VQL F;  1QVF F;  5ITZ A;  3PAF A;  5G4U C;  3C9R A;  1RQ7 A;  4ZK7 A;  4X1Y A;  3KE1 A;  5IJ0 A;  3K0T A;  3B6N A;  4TZZ A;  4I50 B;  1X7P A;  4ZOL B;  3CCM F;  3HAX D;  3HKC B;  2W8B C;  1W57 A;  3K2X A;  5CA1 B;  5JQG A;  3ZP4 A;  2Z01 A;  3F0E A;  3N4Z A;  2CHT A;  2VAW A;  3FD6 A;  5EYP A;  3LDT A;  3LYB A;  4X1K A;  5HXU A;  2GLZ A;  3G71 F;  5FNV A;  4C82 A;  2I6R A;  1IPA A;  2DT4 A;  3ZP7 A;  3RYH B;  1W55 A;  4G4X A;  1KD1 H;  1YQN A;  1DBF A;  5EWR A;  3CME F;  4G4Y A;  4U3J A;  3RYC B;  2UYN A;  1VQ7 F;  2ZOD A;  2UZH A;  3QUW A;  5AVM A;  4O4I A;  4WBN A;  4ZHQ B;  3C8L A;  2GVI A;  4YJ2 B;  1PXW A;  3QHD A;  1YGY A;  4B45 A;  1VQN F;  3FBA A;  3J80 M;  3O85 A;  3K14 A;  4BT4 A;  1W2B F;  3C9T A;  3JAK B;  2KTV A;  1VQ6 F;  3LWR C;  1NQ3 A;  3NK6 A;  2KGW A;  3ZO8 A;  1M90 H;  4O4I B;  4WBN B;  5HY4 A;  1SDS A;  1TVK B;  2IQQ A;  4BT2 A;  3IMP A;  3TD4 A;  1KQS F;  3WGN A;  5CB4 A;  3CB2 A;  2F9Z C;  2EWC A;  3F6M A;  3V7Q A;  3ON1 A;  3WJP A;  3FPI A;  3M4S A;  1UFY A;  2ALE A;  1QAH A;  1T0A A;  3NVI B;  5EB0 A;  1H47 A;  3JAL B;  1GX1 A;  1OFU A;  3G6E F;  1SA0 A;  5HP7 A;  3WGL A;  4O2B A;  4G4V A;  2CW4 A;  3ELC A;  4TUY B;  4ZOL A;  1JFF B;  4I50 A;  3KIZ A;  4R40 B;  5HY1 A;  3T80 A;  4E6E A;  1YJN F;  4X1K B;  3VIU A;  3OW2 F;  2CVL A;  1OAP A;  3RYI B;  3M1X A;  3LFO A;  3RA5 A;  4M8I A;  2IG8 A;  1U43 A;  3CD6 F;  4O2B B;  3MCA B;  4BVR A;  5GON B;  1GO1 A;  1CN7 A;  4ZHW A;  2FC3 A;  2RHL A;  3C9U A;  3CXC F;  1H48 A;  1U40 A;  3LWQ C;  2OTJ F;  4NWO B;  3JAM M;  1YJW F;  3RYC A;  3KJJ A;  5EIB C;  2HP0 B;  5JVD B;  3J81 M;  5GON A;  3UT5 A;  5HWE A;  2HVY D;  4BVT A;  4G4Z A;  4YJ3 B;  2Z1F A;  3G4S F;  4ZHV A;  3D54 A;  3K12 A;  3VOB A;  3NVK E;  3JAR A;  3WPW A;  4IHJ B;  4DRX A;  3S03 A;  5J2U A;  3F0F A;  3VMF B;  4I55 B;  4BVQ A;  4F6R A;  3PLA C;  5LYJ B;  3D01 A;  1X7O A;  4IIJ A;  1IV3 A;  2NMU A;  3VI6 A;  1JY8 A;  5ITZ B;  4EI9 A;  3OBW A;  5LOV B;  1QVG F;  4IHJ A;  4EB6 A;  2VAP A;  5JH7 A;  2HRU A;  1VK3 A;  5HY0 A;  3CC4 F;  3HKB A;  4C8G A;  4B46 A;  1VQK F;  1K8A H;  2YXZ A;  4O4L B;  1VQP F;  3HKE B;  3CCR F;  1W40 A;  4X1Y B;  3S0H A;  1YHQ F;  3HJW C;  2YYE A;  4ZI7 B;  4NUT A;  5JQG B;  2LBX A;  3QTY A;  5FJ4 C;  4I4T B;  2BTO A;  1IV4 A;  5EZY A;  4EB6 B;  3LWP C;  3VO8 A;  2QI2 A;  5BMV A;  3WJR A;  1DT9 A;  3N2G B;  4C4W C;  1YJ9 F;  2OTM A;  3CCQ F;  3P0Z A;  2PHN A;  3CC7 F; 
#chains in the Genus database with same CATH homology
 1COM A;  3L7Q A;  1ONI A;  3LYB A;  2CVL A;  2UYP A;  1PF5 A;  3K12 A;  3LME A;  1UI9 A;  1JD1 A;  3M4S A;  1UFY A;  3M1X A;  1QAH A;  3VCZ A;  2CWJ A;  1J7H A;  4ZK7 A;  3ZP7 A;  1QU9 A;  3V4D A;  1FNK A;  1NQ3 A;  2IG8 A;  3D01 A;  3GTZ A;  5HP8 A;  1ODE A;  3K0T A;  3ZO8 A;  3MQW A;  1DBF A;  2UYN B;  3ZOP A;  3KJK A;  5HP7 A;  1X25 A;  1XHO A;  2DYY A;  2UYN A;  2CW4 A;  1QD9 A;  3I7T A;  2UYJ A;  2CHS A;  1XRG A;  3QUW A;  2OTM A;  2CSL A;  3I3F A;  4NWO B;  1FNJ A;  2B33 A;  3ZP4 A;  3R0P A;  2UYK A;  2EWC A;  3KJJ A;  2CHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...