3M4SA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, orthorhombic form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
b'KLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, orthorhombic form
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 38
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m4sA00
5HP8A 3R0PA 1JD1A 3KJJA 5HP7A 2CSLA 3ZP7A 3VCZA 1X25A 3L7QA 3D01A 2CW4A 2OTMA 2B33A 2UYPA 2CWJA 1J7HA 2UYJA 3K0TA 1COMA 3ZP4A 1DBFA 3M1XA 1FNKA 1QAHA 1UI9A 1XRGA 3KJKA 3QUWA 2CHSA 3V4DA 1FNJA 3LMEA 3LYBA 1QU9A 1ONIA 4ZK7A 2UYNB 1QD9A 2CHTA 2DYYA 2UYKA 3I3FA 3I7TA 2EWCA 4NWOB 2UYNA 3ZOPA 3M4SA 1NQ3A 1ODEA 3ZO8A 1PF5A 3GTZA 3K12A 1XHOA 1UFYA 2IG8A 3MQWA 2CVLA
chains in the Genus database with same CATH superfamily
3JAWA 3ON1A 4EI7A 4ZHVA 5IYZB 5HP7A 4R40B 4YJ2B 5JH7A 3WGMA 2RHHA 4TV8B 2RB9A 4TV9A 3VTIC 5JCOC 5KX5B 1J7HA 2QTPA 3RA6A 2KGWA 1DBFA 1VK3A 1FNKA 5J2TB 3D00A 4G4YA 3U0OA 1K9MH 2KG4A 3KJKA 3QUWA 4WBNB 5C8YA 3P10A 5GONA 2P6YA 2R751 3O85A 3CPWF 1OFUA 4RHAA 2ZODA 2UYNA 1W59A 1R1MA 2PMPA 3QHDA 2ZVZA 4I55B 5EAZA 2OTLF 1FFXA 2Q1XA 2RHOA 2OTMA 2UYPA 5MN4A 3VYSC 1IV3A 3CD6F 3IKFA 1FNJA 5EYPA 1QVFF 4ZK7A 1X52A 4X1KB 5IJ0A 1M90H 5ITZA 4ZHWA 4EI8A 3CYPB 2R6R1 3OONA 1VQ4F 4ZHQA 4O4JB 3JASB 4X1IB 3F0EA 2L26A 3RYHA 1M1KH 1JJ2F 1H48A 3RYIB 5GAPK 3RYFA 3LWRC 3LFOA 3WPXA 4IHJA 4B62A 2AIZP 3CG6A 3M1XA 5CA0A 1H47A 1QAHA 5JVDB 3WJPA 4DXDA 3VYTC 3HAXD 5HXZA 4O2AA 3HKCA 2YYEA 1VQVA 2ALEA 4G88A 3I55F 4G4XA 3TD3A 3I7TA 3MDOA 1IPAA 3LWVC 3N4ZA 5HXUA 4BT2A 1YITF 2HP0B 3KIZA 3CCEF 2RHLA 2Z01A 2I6RA 3IEQA 3VMFB 3K14A 2IAFA 3JARB 3ZP7A 1Q7YH 3VCZA 4G4VA 3MCAB 3JATA 3FD6A 3IR9A 2CW4A 1PXWA 2BTQB 5KX5A 3F0FA 1KD1H 2QI2A 3E22B 1KNKA 3HKBB 1Q81H 3LWQC 3CMAF 2IQQA 5BMVB 1SDSA 1NQ3A 4O4HB 1XBIA 3K12A 3NK6A 3RYCB 4IIJB 3ELCA 3G71F 4NQ3A 1T0KB 1VQ6F 3BYQA 3ERNA 1TUBB 3T80A 3VIUA 5JQGB 3SIVA 2Z1EA 1JFFA 2UZHA 5EB0A 4O4IB 1W5BA 1T0AA 3ZP4A 3JAMM 3AGKA 1UI9A 1XRGA 1NMUB 4X3LA 3CB2A 3NMUC 2KTUA 3J7AR 1QD9A 3CCLF 3J81M 3IMPA 1VQKF 5DCVA 2K1SA 4ZOLA 4X3MA 2GZLA 3JCMM 5IT9M 3CCVF 3QTYA 4O2BB 3KE1A 3DC2A 5KMGA 2GVIA 3HKDB 4FFBB 1W581 5HWEA 1YJNF 3L7QA 5FNVB 3N4YA 4I4TB 2AIFA 2HS4A 1YQNA 5A2QM 4EB6B 5JVDA 2Z1TA 3N2KA 3V3TA 4TUYB 4C81A 2OHWA 3CYQA 5G4VC 5J2UA 2W8BC 3LWPC 2OZBA 4G4ZA 4NUTA 1UFYA 5HP8A 5EIBC 5GANK 5AVMA 3HWUA 3V7EA 1W57A 4DRXA 1GO1A 4LNUA 1U3LA 3JALB 4O4LA 5CA1B 5CB4A 4ZI7B 3E1YA 2FC3A 2CHSA 3NVIB 4X1YA 1VH8A 1YJ9F 3Q8HA 4ZHYB 4C4WC 3N2GA 4BT3A 1SA0A 3IKEA 4NWOB 5EZYB 1VQOF 3M4SA 1RA4A 4I50B 3VOAA 4O4HA 1CLIA 4C82A 5LA6B 5LP6A 2CVLA 3LWOC 2HX0A 2KTVA 4YJ3A 1RLGA 4BT5A 1ZWZA 2CSLA 1TUBA 2ZOVA 5LXTA 4G4WA 1W42A 3F0GA 5LYJA 2AMTA 1VQ5F 4XCQA 5EIBD 3V4DA 2LBXA 3LMEA 1Q82H 4X20A 5LOVB 1Q86H 3JAKB 1VQ8F 4BT4A 2VAPA 3HKEA 3UT5A 1TVKB 4F6RB 3RA5A 4U3JA 3S0YA 1JN1A 3GTZA 5IJ9A 3JAWB 2QEXF 3MQWA 3D54A 4HNAA 4B45A 5JH7B 2BTOA 3OBYA 1CN7A 4BVRA 4TV9B 5IYZA 3I56F 1VQPF 3F6MA 4YJ2A 3CCSF 5G4UC 2WALA 1KC8H 4TV8A 2BO1A 3CC2F 3RE3A 1H7MA 2HRUA 3WJQA 5GONB 5C8YB 2LCAA 5J2TA 3CCUF 2H8EA 3CCMF 4WBNA 1GO0A 3C9TA 2UYNB 3C9UA 2HVYD 1YJWF 3FBAA 4C8IA 2HQSC 3OBWA 2ZVYA 2LBTA 2MQEA 1YHQF 1FFXB 2V9YA 5B8FA 4ERHA 3IEWA 3R0PA 1JD1A 4I55A 4U39A 1W5EA 1W41A 2ZF8A 5FLXM 1W55A 2BTUA 3TD5A 1YGYA 2B33A 1Z5VA 3VOBA 4BT7A 2I6DA 3S06A 2VGNA 3HTNA 3WGKA 1E7KA 2OTJF 2QA4F 5EYPB 5IJ0B 1W40A 1K8AH 5ITZB 4TZZA 1VQLF 2CZWA 2CHTA 4X1KA 2JNBA 2UYKA 3I3FA 3FPIA 2H6LA 4BT6A 2G9IA 4ZHQB 3WJRA 3GHZA 1YIJF 3RYHB 4O4JA 3JVHA 3JASA 4X1IA 3RYFB 1X25A 1KNJA 3CCQF 3PAFA 2VAWA 4IHJB 3RYIA 2CWJA 3M84A 5CA0B 5HY1A 1COMA 3C8LA 3LDTA 1W5FA 2VAMA 5HY4A 3CC7F 4O2AB 4BW0B 3HKCB 5JCOA 1VQ7F 1W3EX 1W5AA 2DYYA 1U3PA 2EWCA 2NMUA 3EORA 3NK7A 2HP0A 2RHJA 3CXCF 3JATB 5MN6A 3JARA 3K2XA 4BVSA 4BVTA 3C9RA 3MBMA 1Q8RA 2UYJA 4C8EA 4PWTA 2N48A 1Z5WA 3TD4A 3HJWC 3WGJA 1RQ7A 3E22A 1QU9A 1ONIA 4B5CA 3HKBA 4BVQA 1X7OA 5FJ4C 3ZOPA 4EI9A 1GX1A 5GINC 3NVKE 3ZO8A 5BMVA 3CMEF 3S0WA 1IV4A 3RYCA 3K0TA 4KWEA 1U43A 5GIOC 4IIJA 5GIPC 3GYQA 3KJJA 1JFFB 3S03A 2HP3A 5JQGA 1SZQA 4BY9D 4B46A 4O4IA 3VO8A 2HRYA 3SIUA 2H8CA 3LYBA 1K73H 5LP6C 2Z1FA 4ZOLB 5EO3A 3E20B 3VYUC 1NJIH 1XHOA 5KMGB 2IG8A 3CC4F 3B6NA 1W2BF 4O2BA 2GLZA 5EWRA 1VQMF 2Z1UA 1CK2A 2HS0A 3WPWA 3HKDA 4FFBA 3D01A 1S72F 1VHAA 5FNVA 4I4TA 3KHNA 3N2KB 1YI2F 3P4EA 4EB6A 5J2UB 4TUYA 3CPQA 2YXZA 2FGYA 3CCRF 2ZAUA 3WGNA 3WXMB 3C9SA 3P0ZA 1PF5A 1GZ0A 3G6EF 1JY8A 4LCKA 1DT9A 3FFMA 4M8IA 4DRXB 4LNUB 3PLAC 4O4LB 2LBWA 3S02A 2PHNA 5CB4B 5MN5A 3G4SF 2HS3A 3ESJA 3JALA 5CA1A 4X1YB 3V7QA 4ZI7A 2DT4A 1VQNF 4RQOA 3N2GB 1SA0B 5EB1B 5HY0A 2VGMA 1RLUA 3J80M 3FD5A 1FSZA 1KQSF 5EZYA 3VI6A 5LP6B 1VQ9F 4I50A 3WGLA 4YJ3B 5LA6A 2F9ZC 3OW2F 5LXTB 1IV2A 3F0DA 1QVGF 1IV1A 2VXYA 5LYJB 2Q1YA 1RQ2A 4E6EA 1OAPA 1U40A 1XV2A 4X20B 3HKEB 3CCJF 3UT5B 5LOVA 3JAKA 3S0HA 4U3JB 3DDNA 4C8GA 1X7PA 5IJ9B 1N8RH 1ODEA 1TVKA 4F6RA 5HY2A 4HNAB 3MCQA
chains in the Genus database with same CATH topology
5HP8A 3R0PA 1JD1A 3KJJA 5HP7A 2CSLA 3ZP7A 3VCZA 1X25A 3L7QA 3D01A 2CW4A 2OTMA 2B33A 2UYPA 2CWJA 1J7HA 2UYJA 3K0TA 1COMA 3ZP4A 1DBFA 3M1XA 1FNKA 1QAHA 1UI9A 1XRGA 3KJKA 3QUWA 2CHSA 3V4DA 1FNJA 3LMEA 3LYBA 1QU9A 1ONIA 4ZK7A 2UYNB 1QD9A 2CHTA 2DYYA 2UYKA 3I3FA 3I7TA 2EWCA 4NWOB 2UYNA 3ZOPA 3M4SA 1NQ3A 1ODEA 3ZO8A 1PF5A 3GTZA 3K12A 1XHOA 1UFYA 2IG8A 3MQWA 2CVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HP8 A;  3R0P A;  1JD1 A;  3KJJ A;  5HP7 A;  2CSL A;  3ZP7 A;  3VCZ A;  1X25 A;  3L7Q A;  3D01 A;  2CW4 A;  2OTM A;  2B33 A;  2UYP A;  2CWJ A;  1J7H A;  2UYJ A;  3K0T A;  1COM A;  3ZP4 A;  1DBF A;  3M1X A;  1FNK A;  1QAH A;  1UI9 A;  1XRG A;  3KJK A;  3QUW A;  2CHS A;  3V4D A;  1FNJ A;  3LME A;  3LYB A;  1QU9 A;  1ONI A;  4ZK7 A;  2UYN B;  1QD9 A;  2CHT A;  2DYY A;  2UYK A;  3I3F A;  3I7T A;  2EWC A;  4NWO B;  2UYN A;  3ZOP A;  3M4S A;  1NQ3 A;  1ODE A;  3ZO8 A;  1PF5 A;  3GTZ A;  3K12 A;  1XHO A;  1UFY A;  2IG8 A;  3MQW A;  2CVL A; 
#chains in the Genus database with same CATH topology
 3JAW A;  3ON1 A;  4EI7 A;  4ZHV A;  5IYZ B;  5HP7 A;  4R40 B;  4YJ2 B;  5JH7 A;  3WGM A;  2RHH A;  4TV8 B;  2RB9 A;  4TV9 A;  3VTI C;  5JCO C;  5KX5 B;  1J7H A;  2QTP A;  3RA6 A;  2KGW A;  1DBF A;  1VK3 A;  1FNK A;  5J2T B;  3D00 A;  4G4Y A;  3U0O A;  1K9M H;  2KG4 A;  3KJK A;  3QUW A;  4WBN B;  5C8Y A;  3P10 A;  5GON A;  2P6Y A;  2R75 1;  3O85 A;  3CPW F;  1OFU A;  4RHA A;  2ZOD A;  2UYN A;  1W59 A;  1R1M A;  2PMP A;  3QHD A;  2ZVZ A;  4I55 B;  5EAZ A;  2OTL F;  1FFX A;  2Q1X A;  2RHO A;  2OTM A;  2UYP A;  5MN4 A;  3VYS C;  1IV3 A;  3CD6 F;  3IKF A;  1FNJ A;  5EYP A;  1QVF F;  4ZK7 A;  1X52 A;  4X1K B;  5IJ0 A;  1M90 H;  5ITZ A;  4ZHW A;  4EI8 A;  3CYP B;  2R6R 1;  3OON A;  1VQ4 F;  4ZHQ A;  4O4J B;  3JAS B;  4X1I B;  3F0E A;  2L26 A;  3RYH A;  1M1K H;  1JJ2 F;  1H48 A;  3RYI B;  5GAP K;  3RYF A;  3LWR C;  3LFO A;  3WPX A;  4IHJ A;  4B62 A;  2AIZ P;  3CG6 A;  3M1X A;  5CA0 A;  1H47 A;  1QAH A;  5JVD B;  3WJP A;  4DXD A;  3VYT C;  3HAX D;  5HXZ A;  4O2A A;  3HKC A;  2YYE A;  1VQV A;  2ALE A;  4G88 A;  3I55 F;  4G4X A;  3TD3 A;  3I7T A;  3MDO A;  1IPA A;  3LWV C;  3N4Z A;  5HXU A;  4BT2 A;  1YIT F;  2HP0 B;  3KIZ A;  3CCE F;  2RHL A;  2Z01 A;  2I6R A;  3IEQ A;  3VMF B;  3K14 A;  2IAF A;  3JAR B;  3ZP7 A;  1Q7Y H;  3VCZ A;  4G4V A;  3MCA B;  3JAT A;  3FD6 A;  3IR9 A;  2CW4 A;  1PXW A;  2BTQ B;  5KX5 A;  3F0F A;  1KD1 H;  2QI2 A;  3E22 B;  1KNK A;  3HKB B;  1Q81 H;  3LWQ C;  3CMA F;  2IQQ A;  5BMV B;  1SDS A;  1NQ3 A;  4O4H B;  1XBI A;  3K12 A;  3NK6 A;  3RYC B;  4IIJ B;  3ELC A;  3G71 F;  4NQ3 A;  1T0K B;  1VQ6 F;  3BYQ A;  3ERN A;  1TUB B;  3T80 A;  3VIU A;  5JQG B;  3SIV A;  2Z1E A;  1JFF A;  2UZH A;  5EB0 A;  4O4I B;  1W5B A;  1T0A A;  3ZP4 A;  3JAM M;  3AGK A;  1UI9 A;  1XRG A;  1NMU B;  4X3L A;  3CB2 A;  3NMU C;  2KTU A;  3J7A R;  1QD9 A;  3CCL F;  3J81 M;  3IMP A;  1VQK F;  5DCV A;  2K1S A;  4ZOL A;  4X3M A;  2GZL A;  3JCM M;  5IT9 M;  3CCV F;  3QTY A;  4O2B B;  3KE1 A;  3DC2 A;  5KMG A;  2GVI A;  3HKD B;  4FFB B;  1W58 1;  5HWE A;  1YJN F;  3L7Q A;  5FNV B;  3N4Y A;  4I4T B;  2AIF A;  2HS4 A;  1YQN A;  5A2Q M;  4EB6 B;  5JVD A;  2Z1T A;  3N2K A;  3V3T A;  4TUY B;  4C81 A;  2OHW A;  3CYQ A;  5G4V C;  5J2U A;  2W8B C;  3LWP C;  2OZB A;  4G4Z A;  4NUT A;  1UFY A;  5HP8 A;  5EIB C;  5GAN K;  5AVM A;  3HWU A;  3V7E A;  1W57 A;  4DRX A;  1GO1 A;  4LNU A;  1U3L A;  3JAL B;  4O4L A;  5CA1 B;  5CB4 A;  4ZI7 B;  3E1Y A;  2FC3 A;  2CHS A;  3NVI B;  4X1Y A;  1VH8 A;  1YJ9 F;  3Q8H A;  4ZHY B;  4C4W C;  3N2G A;  4BT3 A;  1SA0 A;  3IKE A;  4NWO B;  5EZY B;  1VQO F;  3M4S A;  1RA4 A;  4I50 B;  3VOA A;  4O4H A;  1CLI A;  4C82 A;  5LA6 B;  5LP6 A;  2CVL A;  3LWO C;  2HX0 A;  2KTV A;  4YJ3 A;  1RLG A;  4BT5 A;  1ZWZ A;  2CSL A;  1TUB A;  2ZOV A;  5LXT A;  4G4W A;  1W42 A;  3F0G A;  5LYJ A;  2AMT A;  1VQ5 F;  4XCQ A;  5EIB D;  3V4D A;  2LBX A;  3LME A;  1Q82 H;  4X20 A;  5LOV B;  1Q86 H;  3JAK B;  1VQ8 F;  4BT4 A;  2VAP A;  3HKE A;  3UT5 A;  1TVK B;  4F6R B;  3RA5 A;  4U3J A;  3S0Y A;  1JN1 A;  3GTZ A;  5IJ9 A;  3JAW B;  2QEX F;  3MQW A;  3D54 A;  4HNA A;  4B45 A;  5JH7 B;  2BTO A;  3OBY A;  1CN7 A;  4BVR A;  4TV9 B;  5IYZ A;  3I56 F;  1VQP F;  3F6M A;  4YJ2 A;  3CCS F;  5G4U C;  2WAL A;  1KC8 H;  4TV8 A;  2BO1 A;  3CC2 F;  3RE3 A;  1H7M A;  2HRU A;  3WJQ A;  5GON B;  5C8Y B;  2LCA A;  5J2T A;  3CCU F;  2H8E A;  3CCM F;  4WBN A;  1GO0 A;  3C9T A;  2UYN B;  3C9U A;  2HVY D;  1YJW F;  3FBA A;  4C8I A;  2HQS C;  3OBW A;  2ZVY A;  2LBT A;  2MQE A;  1YHQ F;  1FFX B;  2V9Y A;  5B8F A;  4ERH A;  3IEW A;  3R0P A;  1JD1 A;  4I55 A;  4U39 A;  1W5E A;  1W41 A;  2ZF8 A;  5FLX M;  1W55 A;  2BTU A;  3TD5 A;  1YGY A;  2B33 A;  1Z5V A;  3VOB A;  4BT7 A;  2I6D A;  3S06 A;  2VGN A;  3HTN A;  3WGK A;  1E7K A;  2OTJ F;  2QA4 F;  5EYP B;  5IJ0 B;  1W40 A;  1K8A H;  5ITZ B;  4TZZ A;  1VQL F;  2CZW A;  2CHT A;  4X1K A;  2JNB A;  2UYK A;  3I3F A;  3FPI A;  2H6L A;  4BT6 A;  2G9I A;  4ZHQ B;  3WJR A;  3GHZ A;  1YIJ F;  3RYH B;  4O4J A;  3JVH A;  3JAS A;  4X1I A;  3RYF B;  1X25 A;  1KNJ A;  3CCQ F;  3PAF A;  2VAW A;  4IHJ B;  3RYI A;  2CWJ A;  3M84 A;  5CA0 B;  5HY1 A;  1COM A;  3C8L A;  3LDT A;  1W5F A;  2VAM A;  5HY4 A;  3CC7 F;  4O2A B;  4BW0 B;  3HKC B;  5JCO A;  1VQ7 F;  1W3E X;  1W5A A;  2DYY A;  1U3P A;  2EWC A;  2NMU A;  3EOR A;  3NK7 A;  2HP0 A;  2RHJ A;  3CXC F;  3JAT B;  5MN6 A;  3JAR A;  3K2X A;  4BVS A;  4BVT A;  3C9R A;  3MBM A;  1Q8R A;  2UYJ A;  4C8E A;  4PWT A;  2N48 A;  1Z5W A;  3TD4 A;  3HJW C;  3WGJ A;  1RQ7 A;  3E22 A;  1QU9 A;  1ONI A;  4B5C A;  3HKB A;  4BVQ A;  1X7O A;  5FJ4 C;  3ZOP A;  4EI9 A;  1GX1 A;  5GIN C;  3NVK E;  3ZO8 A;  5BMV A;  3CME F;  3S0W A;  1IV4 A;  3RYC A;  3K0T A;  4KWE A;  1U43 A;  5GIO C;  4IIJ A;  5GIP C;  3GYQ A;  3KJJ A;  1JFF B;  3S03 A;  2HP3 A;  5JQG A;  1SZQ A;  4BY9 D;  4B46 A;  4O4I A;  3VO8 A;  2HRY A;  3SIU A;  2H8C A;  3LYB A;  1K73 H;  5LP6 C;  2Z1F A;  4ZOL B;  5EO3 A;  3E20 B;  3VYU C;  1NJI H;  1XHO A;  5KMG B;  2IG8 A;  3CC4 F;  3B6N A;  1W2B F;  4O2B A;  2GLZ A;  5EWR A;  1VQM F;  2Z1U A;  1CK2 A;  2HS0 A;  3WPW A;  3HKD A;  4FFB A;  3D01 A;  1S72 F;  1VHA A;  5FNV A;  4I4T A;  3KHN A;  3N2K B;  1YI2 F;  3P4E A;  4EB6 A;  5J2U B;  4TUY A;  3CPQ A;  2YXZ A;  2FGY A;  3CCR F;  2ZAU A;  3WGN A;  3WXM B;  3C9S A;  3P0Z A;  1PF5 A;  1GZ0 A;  3G6E F;  1JY8 A;  4LCK A;  1DT9 A;  3FFM A;  4M8I A;  4DRX B;  4LNU B;  3PLA C;  4O4L B;  2LBW A;  3S02 A;  2PHN A;  5CB4 B;  5MN5 A;  3G4S F;  2HS3 A;  3ESJ A;  3JAL A;  5CA1 A;  4X1Y B;  3V7Q A;  4ZI7 A;  2DT4 A;  1VQN F;  4RQO A;  3N2G B;  1SA0 B;  5EB1 B;  5HY0 A;  2VGM A;  1RLU A;  3J80 M;  3FD5 A;  1FSZ A;  1KQS F;  5EZY A;  3VI6 A;  5LP6 B;  1VQ9 F;  4I50 A;  3WGL A;  4YJ3 B;  5LA6 A;  2F9Z C;  3OW2 F;  5LXT B;  1IV2 A;  3F0D A;  1QVG F;  1IV1 A;  2VXY A;  5LYJ B;  2Q1Y A;  1RQ2 A;  4E6E A;  1OAP A;  1U40 A;  1XV2 A;  4X20 B;  3HKE B;  3CCJ F;  3UT5 B;  5LOV A;  3JAK A;  3S0H A;  4U3J B;  3DDN A;  4C8G A;  1X7P A;  5IJ9 B;  1N8R H;  1ODE A;  1TVK A;  4F6R A;  5HY2 A;  4HNA B;  3MCQ A; 
#chains in the Genus database with same CATH homology
 5HP8 A;  3R0P A;  1JD1 A;  3KJJ A;  5HP7 A;  2CSL A;  3ZP7 A;  3VCZ A;  1X25 A;  3L7Q A;  3D01 A;  2CW4 A;  2OTM A;  2B33 A;  2UYP A;  2CWJ A;  1J7H A;  2UYJ A;  3K0T A;  1COM A;  3ZP4 A;  1DBF A;  3M1X A;  1FNK A;  1QAH A;  1UI9 A;  1XRG A;  3KJK A;  3QUW A;  2CHS A;  3V4D A;  1FNJ A;  3LME A;  3LYB A;  1QU9 A;  1ONI A;  4ZK7 A;  2UYN B;  1QD9 A;  2CHT A;  2DYY A;  2UYK A;  3I3F A;  3I7T A;  2EWC A;  4NWO B;  2UYN A;  3ZOP A;  3M4S A;  1NQ3 A;  1ODE A;  3ZO8 A;  1PF5 A;  3GTZ A;  3K12 A;  1XHO A;  1UFY A;  2IG8 A;  3MQW A;  2CVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...