3M4SA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, orthorhombic form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
KLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, orthorhombic form
rcsb
source organism Entamoeba histolytica
total genus 38
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m4sA00
1FNJA 1X25A 3VCZA 1DBFA 1QAHA 4ZK7A 4NWOB 3D01A 3K12A 1COMA 2OTMA 1UI9A 3KJKA 2CW4A 1QU9A 1PF5A 2CHTA 3LYBA 3MQWA 1JD1A 3ZP7A 3QUWA 2UYJA 1NQ3A 5HP8A 2UYKA 2CSLA 2CVLA 3ZO8A 1UFYA 2CWJA 3I7TA 3I3FA 2CHSA 2UYPA 3GTZA 3R0PA 2UYNA 1J7HA 3L7QA 1XRGA 2DYYA 3KJJA 3M4SA 3ZP4A 2EWCA 3K0TA 1XHOA 2B33A 2UYNB 1ONIA 3M1XA 2IG8A 1ODEA 3ZOPA 3LMEA 5HP7A 1QD9A 1FNKA 3V4DA
chains in the Genus database with same CATH superfamily
1E7KA 1RA4A 4I55A 3OBYA 5EAZA 4WBNB 2ZODA 3HAXD 4B45A 4I50A 1YHQF 1SZQA 4C82A 3LWOC 5CA1B 4YJ2B 3RE3A 2RHOA 3WXMB 3FD6A 2FGYA 3K2XA 4BT6A 3LWQC 2BTQB 4BVTA 5LYJB 5JQGA 2UYNB 3M1XA 4ZI7A 3ZOPA 3PAFA 1T0KB 4C4WC 3DDNA 5JVDA 1K8AH 2OTMA 1GO1A 4M8IA 1GZ0A 1GO0A 5HY4A 3VOBA 3JAKB 1NQ3A 3WGNA 5EYPB 3Q8HA 2CVLA 3RA5A 5EWRA 2RB9A 2UYPA 3GTZA 1FFXB 4DXDA 3RYCA 4G4ZA 3JASB 3JALB 1IPAA 2LBTA 1W3EX 1SDSA 5GONA 5EIBC 2GLZA 3E20B 3BYQA 3CCMF 5HP7A 3CCQF 3CC7F 4ZHVA 3OBWA 5LXTB 5J2UA 2ZVZA 3JAMM 4G4YA 4X1IB 4DRXA 5LOVB 3HKCB 3CCRF 3JARB 3RYHB 5MN4A 3ZO8A 3RYIB 1W57A 4BT4A 4ZHYB 5J2TB 5C8YA 3CMEF 3F0DA 3JAWA 5IYZA 1M90H 1W5FA 5KX5A 4TUYB 3VYTC 4F6RA 1TVKA 5LP6A 1Q86H 3HKDA 3KHNA 2N48A 2PHNA 3VYSC 2JNBA 4O2BB 1W5AA 4IIJB 4G4VA 1DBFA 3E22B 4HNAA 3DC2A 1YQNA 3F6MA 5KMGA 3IR9A 2UYJA 1XV2A 5HP8A 4ZOLB 2IQQA 2QTPA 1JN1A 3N4YA 3F0FA 3VMFB 4X3MA 4BW0B 4KWEA 2KTVA 1GX1A 3CYPB 3D54A 2NMUA 3UT5B 4FFBA 4TZZA 2HVYD 4O4IB 2AIZP 3VYUC 4BT3A 3M84A 3CCLF 2MQEA 3C9RA 4I4TA 4O2AB 2AIFA 4U3JB 4LNUB 5IJ9A 3QTYA 4R40B 2Z1UA 2LBXA 3P4EA 1CN7A 5GANK 5GIOC 3VTIC 2H8EA 5JCOC 5BMVB 3S0WA 4EI9A 3N2GB 1JJ2F 3J81M 3G4SF 3TD5A 2FC3A 3WGKA 1W59A 3VO8A 2LCAA 1ZWZA 2GZLA 3KIZA 3ELCA 4TV9A 3IKEA 1SA0B 1J7HA 3P10A 2HX0A 5G4UC 2LBWA 3ON1A 1YI2F 3K12A 5ITZB 3V3TA 2HS0A 3MQWA 2P6YA 3LWRC 5AVMA 4G4WA 3CCVF 3CG6A 2QI2A 5G4VC 2VAPA 3C9SA 2BTOA 3N2KA 3CMAF 3LWPC 1Z5WA 4BVQA 4O4JB 2VGNA 1W41A 3CC4F 3JATB 1PXWA 1YJWF 3V4DA 5JQGB 1KD1H 2W8BC 3VCZA 4NUTA 5LA6B 5FLXM 4YJ3B 2HS3A 4YJ2A 1W5BA 1IV4A 4TV8A 3CCUF 1IV3A 5DCVA 2HRYA 5GINC 1VK3A 3RA6A 1JFFB 5LYJA 3HKEB 2DT4A 2UYNA 3CPQA 2Q1XA 1T0AA 1CK2A 3MCQA 1VQ4F 4BT7A 3WJPA 4XCQA 3CXCF 3WPWA 2KGWA 3RYCB 4EI7A 3J80M 1YITF 3RYFA 2YXZA 1H48A 1YJNF 3I56F 1FNKA 3D00A 3JAKA 1OAPA 5EYPA 4RQOA 2HQSC 2KTUA 3HKBA 4NWOB 5EO3A 3KJKA 3C8LA 1YGYA 5HXZA 1VQ5F 4ZHQB 1W40A 1JD1A 1H47A 4X1KA 4C81A 3JASA 2OTJF 1M1KH 5CA0B 4X1YB 1UFYA 1RQ2A 1YJ9F 2ALEA 2BO1A 3R0PA 4DRXB 3JCMM 1Q81H 5FNVB 2F9ZC 3C9TA 3M4SA 1VQMF 3CPWF 5C8YB 3GHZA 1W55A 3GYQA 2HP0B 3KE1A 4F6RB 3HWUA 3FPIA 5LXTA 1N8RH 4ZHWA 4X1IA 4C8IA 3JARA 3RYHA 5J2TA 3D01A 1COMA 1YIJF 2CHTA 4TUYA 5GAPK 2CSLA 1TUBB 1VQ6F 2CWJA 4O4HB 5KMGB 3NK6A 5IJ0B 2Z1EA 2DYYA 1X7OA 1JY8A 1X52A 2Q1YA 1KQSF 2RHHA 4X20B 2HRUA 2I6DA 4X3LA 3T80A 1W2BF 3ZP4A 1W42A 5B8FA 4FFBB 1X25A 2UZHA 4RHAA 4PWTA 3PLAC 3WGJA 3LYBA 4O4LB 5EZYB 2UYKA 1VQKF 3ERNA 1CLIA 2RHJA 3C9UA 3G71F 5EB1B 3UT5A 3FBAA 3IKFA 4O2AA 3HJWC 1IV1A 3MDOA 4U3JA 1VQNF 3CCJF 3LWVC 2V9YA 3WJRA 3CCSF 1U40A 5BMVA 5JH7A 1KNJA 1PF5A 4IHJB 2HP3A 3N2GA 1FSZA 3CYQA 3ZP7A 4E6EA 2I6RA 3LDTA 3WPXA 4I55B 2K1SA 3CCEF 4EB6A 3S02A 3LFOA 3VI6A 3CC2F 3FD5A 5HXUA 4I50B 5CB4A 3V7QA 3KJJA 4U39A 1SA0A 1K73H 5JCOA 3S03A 3QHDA 1VQ8F 2VGMA 2Z1FA 2B33A 3IMPA 5ITZA 3SIVA 2ZAUA 3JVHA 1VQLF 4WBNA 1QD9A 1Q7YH 3O85A 3ESJA 1Q8RA 3U0OA 5HY0A 5CA1A 4ZI7B 3AGKA 2OHWA 4BVSA 1RLGA 2L26A 5JVDB 4BVRA 5A2QM 1QVFF 4O4JA 1W5EA 4TV8B 1U3PA 2PMPA 1OFUA 3L7QA 3E1YA 3N4ZA 3OW2F 3JATA 4B5CA 1VH8A 1IV2A 5LA6A 1Q82H 4YJ3A 1ODEA 5MN6A 3B6NA 3WJQA 3NVIB 5MN5A 1QAHA 5GONB 1X7PA 1JFFA 3RYFB 1VQOF 3HTNA 3HKEA 4B62A 3S0HA 1FFXA 5LP6C 2CZWA 3J7AR 3HKBB 1QVGF 2Z01A 3JALA 3VOAA 1NJIH 3CD6F 2ZOVA 5J2UB 5FJ4C 2Z1TA 3MCAB 4X1KB 5IT9M 5EIBD 1XRGA 4C8GA 2H8CA 3OONA 2YYEA 4BY9D 3P0ZA 3K0TA 1H7MA 3JAWB 5IYZB 3WGLA 1ONIA 5KX5B 4NQ3A 2OTLF 5LP6B 1TVKB 4ZHQA 3S06A 3HKDB 5LOVA 3HKCA 5CA0A 4X1YA 2QA4F 2OZBA 1NMUB 3RYIA 2CW4A 1QU9A 3IEWA 2HS4A 3QUWA 4BT2A 5FNVA 1VQ7F 4ERHA 3VIUA 3G6EF 3MBMA 4HNAB 3I7TA 2CHSA 2HP0A 2ZF8A 2GVIA 3TD4A 5GIPC 2VXYA 3K14A 4O2BA 1VQVA 4IIJA 4LCKA 1U43A 3I55F 2ZVYA 3E22A 3WGMA 2VAMA 2WALA 1W581 1U3LA 1RQ7A 1KNKA 3NMUC 1FNJA 3NK7A 1R1MA 1TUBA 4ZK7A 4ZOLA 5HY2A 4O4HA 1VHAA 3TD3A 3NVKE 2RHLA 5IJ0A 1Z5VA 4I4TB 4G4XA 5IJ9B 4X20A 2AMTA 4O4IA 1VQ9F 4G88A 2EWCA 5HY1A 1RLUA 2H6LA 4C8EA 2QEXF 2IG8A 3F0GA 1S72F 4LNUA 4O4LA 5EZYA 3IEQA 3S0YA 2R751 3F0EA 1UI9A 3FFMA 4TV9B 2VAWA 3EORA 1XBIA 2KG4A 4BT5A 1KC8H 3SIUA 4B46A 5JH7B 3V7EA 3I3FA 2R6R1 4EI8A 2BTUA 2G9IA 2IAFA 3CB2A 4EB6B 1VQPF 1XHOA 3N2KB 5EB0A 5CB4B 5HWEA 1DT9A 4IHJA 1K9MH 3LMEA
chains in the Genus database with same CATH topology
1FNJA 1X25A 3VCZA 1DBFA 1QAHA 4ZK7A 4NWOB 3D01A 3K12A 1COMA 2OTMA 1UI9A 3KJKA 2CW4A 1QU9A 1PF5A 2CHTA 3LYBA 3MQWA 1JD1A 3ZP7A 3QUWA 2UYJA 1NQ3A 5HP8A 2UYKA 2CSLA 2CVLA 3ZO8A 1UFYA 2CWJA 3I7TA 3I3FA 2CHSA 2UYPA 3GTZA 3R0PA 2UYNA 1J7HA 3L7QA 1XRGA 2DYYA 3KJJA 3M4SA 3ZP4A 2EWCA 3K0TA 1XHOA 2B33A 2UYNB 1ONIA 3M1XA 2IG8A 1ODEA 3ZOPA 3LMEA 5HP7A 1QD9A 1FNKA 3V4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNJ A;  1X25 A;  3VCZ A;  1DBF A;  1QAH A;  4ZK7 A;  4NWO B;  3D01 A;  3K12 A;  1COM A;  2OTM A;  1UI9 A;  3KJK A;  2CW4 A;  1QU9 A;  1PF5 A;  2CHT A;  3LYB A;  3MQW A;  1JD1 A;  3ZP7 A;  3QUW A;  2UYJ A;  1NQ3 A;  5HP8 A;  2UYK A;  2CSL A;  2CVL A;  3ZO8 A;  1UFY A;  2CWJ A;  3I7T A;  3I3F A;  2CHS A;  2UYP A;  3GTZ A;  3R0P A;  2UYN A;  1J7H A;  3L7Q A;  1XRG A;  2DYY A;  3KJJ A;  3M4S A;  3ZP4 A;  2EWC A;  3K0T A;  1XHO A;  2B33 A;  2UYN B;  1ONI A;  3M1X A;  2IG8 A;  1ODE A;  3ZOP A;  3LME A;  5HP7 A;  1QD9 A;  1FNK A;  3V4D A; 
#chains in the Genus database with same CATH topology
 1E7K A;  1RA4 A;  4I55 A;  3OBY A;  5EAZ A;  4WBN B;  2ZOD A;  3HAX D;  4B45 A;  4I50 A;  1YHQ F;  1SZQ A;  4C82 A;  3LWO C;  5CA1 B;  4YJ2 B;  3RE3 A;  2RHO A;  3WXM B;  3FD6 A;  2FGY A;  3K2X A;  4BT6 A;  3LWQ C;  2BTQ B;  4BVT A;  5LYJ B;  5JQG A;  2UYN B;  3M1X A;  4ZI7 A;  3ZOP A;  3PAF A;  1T0K B;  4C4W C;  3DDN A;  5JVD A;  1K8A H;  2OTM A;  1GO1 A;  4M8I A;  1GZ0 A;  1GO0 A;  5HY4 A;  3VOB A;  3JAK B;  1NQ3 A;  3WGN A;  5EYP B;  3Q8H A;  2CVL A;  3RA5 A;  5EWR A;  2RB9 A;  2UYP A;  3GTZ A;  1FFX B;  4DXD A;  3RYC A;  4G4Z A;  3JAS B;  3JAL B;  1IPA A;  2LBT A;  1W3E X;  1SDS A;  5GON A;  5EIB C;  2GLZ A;  3E20 B;  3BYQ A;  3CCM F;  5HP7 A;  3CCQ F;  3CC7 F;  4ZHV A;  3OBW A;  5LXT B;  5J2U A;  2ZVZ A;  3JAM M;  4G4Y A;  4X1I B;  4DRX A;  5LOV B;  3HKC B;  3CCR F;  3JAR B;  3RYH B;  5MN4 A;  3ZO8 A;  3RYI B;  1W57 A;  4BT4 A;  4ZHY B;  5J2T B;  5C8Y A;  3CME F;  3F0D A;  3JAW A;  5IYZ A;  1M90 H;  1W5F A;  5KX5 A;  4TUY B;  3VYT C;  4F6R A;  1TVK A;  5LP6 A;  1Q86 H;  3HKD A;  3KHN A;  2N48 A;  2PHN A;  3VYS C;  2JNB A;  4O2B B;  1W5A A;  4IIJ B;  4G4V A;  1DBF A;  3E22 B;  4HNA A;  3DC2 A;  1YQN A;  3F6M A;  5KMG A;  3IR9 A;  2UYJ A;  1XV2 A;  5HP8 A;  4ZOL B;  2IQQ A;  2QTP A;  1JN1 A;  3N4Y A;  3F0F A;  3VMF B;  4X3M A;  4BW0 B;  4KWE A;  2KTV A;  1GX1 A;  3CYP B;  3D54 A;  2NMU A;  3UT5 B;  4FFB A;  4TZZ A;  2HVY D;  4O4I B;  2AIZ P;  3VYU C;  4BT3 A;  3M84 A;  3CCL F;  2MQE A;  3C9R A;  4I4T A;  4O2A B;  2AIF A;  4U3J B;  4LNU B;  5IJ9 A;  3QTY A;  4R40 B;  2Z1U A;  2LBX A;  3P4E A;  1CN7 A;  5GAN K;  5GIO C;  3VTI C;  2H8E A;  5JCO C;  5BMV B;  3S0W A;  4EI9 A;  3N2G B;  1JJ2 F;  3J81 M;  3G4S F;  3TD5 A;  2FC3 A;  3WGK A;  1W59 A;  3VO8 A;  2LCA A;  1ZWZ A;  2GZL A;  3KIZ A;  3ELC A;  4TV9 A;  3IKE A;  1SA0 B;  1J7H A;  3P10 A;  2HX0 A;  5G4U C;  2LBW A;  3ON1 A;  1YI2 F;  3K12 A;  5ITZ B;  3V3T A;  2HS0 A;  3MQW A;  2P6Y A;  3LWR C;  5AVM A;  4G4W A;  3CCV F;  3CG6 A;  2QI2 A;  5G4V C;  2VAP A;  3C9S A;  2BTO A;  3N2K A;  3CMA F;  3LWP C;  1Z5W A;  4BVQ A;  4O4J B;  2VGN A;  1W41 A;  3CC4 F;  3JAT B;  1PXW A;  1YJW F;  3V4D A;  5JQG B;  1KD1 H;  2W8B C;  3VCZ A;  4NUT A;  5LA6 B;  5FLX M;  4YJ3 B;  2HS3 A;  4YJ2 A;  1W5B A;  1IV4 A;  4TV8 A;  3CCU F;  1IV3 A;  5DCV A;  2HRY A;  5GIN C;  1VK3 A;  3RA6 A;  1JFF B;  5LYJ A;  3HKE B;  2DT4 A;  2UYN A;  3CPQ A;  2Q1X A;  1T0A A;  1CK2 A;  3MCQ A;  1VQ4 F;  4BT7 A;  3WJP A;  4XCQ A;  3CXC F;  3WPW A;  2KGW A;  3RYC B;  4EI7 A;  3J80 M;  1YIT F;  3RYF A;  2YXZ A;  1H48 A;  1YJN F;  3I56 F;  1FNK A;  3D00 A;  3JAK A;  1OAP A;  5EYP A;  4RQO A;  2HQS C;  2KTU A;  3HKB A;  4NWO B;  5EO3 A;  3KJK A;  3C8L A;  1YGY A;  5HXZ A;  1VQ5 F;  4ZHQ B;  1W40 A;  1JD1 A;  1H47 A;  4X1K A;  4C81 A;  3JAS A;  2OTJ F;  1M1K H;  5CA0 B;  4X1Y B;  1UFY A;  1RQ2 A;  1YJ9 F;  2ALE A;  2BO1 A;  3R0P A;  4DRX B;  3JCM M;  1Q81 H;  5FNV B;  2F9Z C;  3C9T A;  3M4S A;  1VQM F;  3CPW F;  5C8Y B;  3GHZ A;  1W55 A;  3GYQ A;  2HP0 B;  3KE1 A;  4F6R B;  3HWU A;  3FPI A;  5LXT A;  1N8R H;  4ZHW A;  4X1I A;  4C8I A;  3JAR A;  3RYH A;  5J2T A;  3D01 A;  1COM A;  1YIJ F;  2CHT A;  4TUY A;  5GAP K;  2CSL A;  1TUB B;  1VQ6 F;  2CWJ A;  4O4H B;  5KMG B;  3NK6 A;  5IJ0 B;  2Z1E A;  2DYY A;  1X7O A;  1JY8 A;  1X52 A;  2Q1Y A;  1KQS F;  2RHH A;  4X20 B;  2HRU A;  2I6D A;  4X3L A;  3T80 A;  1W2B F;  3ZP4 A;  1W42 A;  5B8F A;  4FFB B;  1X25 A;  2UZH A;  4RHA A;  4PWT A;  3PLA C;  3WGJ A;  3LYB A;  4O4L B;  5EZY B;  2UYK A;  1VQK F;  3ERN A;  1CLI A;  2RHJ A;  3C9U A;  3G71 F;  5EB1 B;  3UT5 A;  3FBA A;  3IKF A;  4O2A A;  3HJW C;  1IV1 A;  3MDO A;  4U3J A;  1VQN F;  3CCJ F;  3LWV C;  2V9Y A;  3WJR A;  3CCS F;  1U40 A;  5BMV A;  5JH7 A;  1KNJ A;  1PF5 A;  4IHJ B;  2HP3 A;  3N2G A;  1FSZ A;  3CYQ A;  3ZP7 A;  4E6E A;  2I6R A;  3LDT A;  3WPX A;  4I55 B;  2K1S A;  3CCE F;  4EB6 A;  3S02 A;  3LFO A;  3VI6 A;  3CC2 F;  3FD5 A;  5HXU A;  4I50 B;  5CB4 A;  3V7Q A;  3KJJ A;  4U39 A;  1SA0 A;  1K73 H;  5JCO A;  3S03 A;  3QHD A;  1VQ8 F;  2VGM A;  2Z1F A;  2B33 A;  3IMP A;  5ITZ A;  3SIV A;  2ZAU A;  3JVH A;  1VQL F;  4WBN A;  1QD9 A;  1Q7Y H;  3O85 A;  3ESJ A;  1Q8R A;  3U0O A;  5HY0 A;  5CA1 A;  4ZI7 B;  3AGK A;  2OHW A;  4BVS A;  1RLG A;  2L26 A;  5JVD B;  4BVR A;  5A2Q M;  1QVF F;  4O4J A;  1W5E A;  4TV8 B;  1U3P A;  2PMP A;  1OFU A;  3L7Q A;  3E1Y A;  3N4Z A;  3OW2 F;  3JAT A;  4B5C A;  1VH8 A;  1IV2 A;  5LA6 A;  1Q82 H;  4YJ3 A;  1ODE A;  5MN6 A;  3B6N A;  3WJQ A;  3NVI B;  5MN5 A;  1QAH A;  5GON B;  1X7P A;  1JFF A;  3RYF B;  1VQO F;  3HTN A;  3HKE A;  4B62 A;  3S0H A;  1FFX A;  5LP6 C;  2CZW A;  3J7A R;  3HKB B;  1QVG F;  2Z01 A;  3JAL A;  3VOA A;  1NJI H;  3CD6 F;  2ZOV A;  5J2U B;  5FJ4 C;  2Z1T A;  3MCA B;  4X1K B;  5IT9 M;  5EIB D;  1XRG A;  4C8G A;  2H8C A;  3OON A;  2YYE A;  4BY9 D;  3P0Z A;  3K0T A;  1H7M A;  3JAW B;  5IYZ B;  3WGL A;  1ONI A;  5KX5 B;  4NQ3 A;  2OTL F;  5LP6 B;  1TVK B;  4ZHQ A;  3S06 A;  3HKD B;  5LOV A;  3HKC A;  5CA0 A;  4X1Y A;  2QA4 F;  2OZB A;  1NMU B;  3RYI A;  2CW4 A;  1QU9 A;  3IEW A;  2HS4 A;  3QUW A;  4BT2 A;  5FNV A;  1VQ7 F;  4ERH A;  3VIU A;  3G6E F;  3MBM A;  4HNA B;  3I7T A;  2CHS A;  2HP0 A;  2ZF8 A;  2GVI A;  3TD4 A;  5GIP C;  2VXY A;  3K14 A;  4O2B A;  1VQV A;  4IIJ A;  4LCK A;  1U43 A;  3I55 F;  2ZVY A;  3E22 A;  3WGM A;  2VAM A;  2WAL A;  1W58 1;  1U3L A;  1RQ7 A;  1KNK A;  3NMU C;  1FNJ A;  3NK7 A;  1R1M A;  1TUB A;  4ZK7 A;  4ZOL A;  5HY2 A;  4O4H A;  1VHA A;  3TD3 A;  3NVK E;  2RHL A;  5IJ0 A;  1Z5V A;  4I4T B;  4G4X A;  5IJ9 B;  4X20 A;  2AMT A;  4O4I A;  1VQ9 F;  4G88 A;  2EWC A;  5HY1 A;  1RLU A;  2H6L A;  4C8E A;  2QEX F;  2IG8 A;  3F0G A;  1S72 F;  4LNU A;  4O4L A;  5EZY A;  3IEQ A;  3S0Y A;  2R75 1;  3F0E A;  1UI9 A;  3FFM A;  4TV9 B;  2VAW A;  3EOR A;  1XBI A;  2KG4 A;  4BT5 A;  1KC8 H;  3SIU A;  4B46 A;  5JH7 B;  3V7E A;  3I3F A;  2R6R 1;  4EI8 A;  2BTU A;  2G9I A;  2IAF A;  3CB2 A;  4EB6 B;  1VQP F;  1XHO A;  3N2K B;  5EB0 A;  5CB4 B;  5HWE A;  1DT9 A;  4IHJ A;  1K9M H;  3LME A; 
#chains in the Genus database with same CATH homology
 1FNJ A;  1X25 A;  3VCZ A;  1DBF A;  1QAH A;  4ZK7 A;  4NWO B;  3D01 A;  3K12 A;  1COM A;  2OTM A;  1UI9 A;  3KJK A;  2CW4 A;  1QU9 A;  1PF5 A;  2CHT A;  3LYB A;  3MQW A;  1JD1 A;  3ZP7 A;  3QUW A;  2UYJ A;  1NQ3 A;  5HP8 A;  2UYK A;  2CSL A;  2CVL A;  3ZO8 A;  1UFY A;  2CWJ A;  3I7T A;  3I3F A;  2CHS A;  2UYP A;  3GTZ A;  3R0P A;  2UYN A;  1J7H A;  3L7Q A;  1XRG A;  2DYY A;  3KJJ A;  3M4S A;  3ZP4 A;  2EWC A;  3K0T A;  1XHO A;  2B33 A;  2UYN B;  1ONI A;  3M1X A;  2IG8 A;  1ODE A;  3ZOP A;  3LME A;  5HP7 A;  1QD9 A;  1FNK A;  3V4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...