3M4SA

Crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, orthorhombic form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
KLTVVASPLAPEAVGAYSQAIICNGMVYCSGQIGLDRKTGDFAGKTIEEQSKQVMTNLKYVLEEAGSSMDKVVKTTCLLADIKDFGVFNGIYAEAFGNHKPARACFAAAALPKGALVEVECIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Endoribonuclease L-PSP
publication title Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica, orthorhombic form
rcsb
source organism Entamoeba histolytica
molecule tags Unknown function
total genus 38
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3m4sA00
1FNKA 3LYBA 2DYYA 3I7TA 1FNJA 1ONIA 1QD9A 1UFYA 1UI9A 1X25A 2UYNA 2UYPA 2CWJA 1DBFA 1JD1A 4NWOB 2UYJA 1XHOA 2CHSA 3ZOPA 3ZP4A 3MQWA 2EWCA 3K0TA 1QU9A 3V4DA 1QAHA 2IG8A 3ZO8A 3L7QA 3KJJA 3VCZA 3KJKA 3GTZA 1XRGA 3I3FA 1NQ3A 3K12A 1PF5A 2CHTA 3LMEA 2UYNB 3M1XA 3M4SA 1COMA 5HP8A 1J7HA 2CVLA 2CW4A 3D01A 3R0PA 2CSLA 2OTMA 3ZP7A 3QUWA 1ODEA 2B33A 4ZK7A 5HP7A 2UYKA
chains in the Genus database with same CATH superfamily
3T80A 1KQSF 5J2TB 3RYHA 1CLIA 1VQLF 3F0EA 1Z5VA 1SA0B 3VI6A 3V3TA 3IR9A 4BY9D 5JH7B 3C9RA 5C8YA 3K0TA 3C9UA 4O2AA 4C8IA 3VCZA 4ZOLB 1W3EX 2HQSC 1Q81H 2UYNB 5HP8A 4BT5A 4O2BB 1E7KA 4C82A 2VGMA 2F9ZC 1N8RH 4U3JA 3CCVF 1RLGA 2GVIA 4ZK7A 4FFBA 2OHWA 2H8EA 5GIOC 4B45A 3MBMA 3C9SA 1W581 4IHJB 2OZBA 1ONIA 3WGJA 2I6RA 3LDTA 5GAPK 1IV3A 4BVRA 1W2BF 1VK3A 4ZHQB 3CPWF 2NMUA 2IQQA 2YYEA 2ZAUA 3RE3A 3TD5A 2CZWA 5IJ9A 3J81M 3P10A 1GO1A 2R751 1TVKA 5JCOC 3HKDA 4TZZA 1VQNF 5LXTB 3G6EF 2CSLA 2ZODA 3SIUA 3RA5A 1OFUA 3G71F 1ODEA 1R1MA 3Q8HA 3CCEF 3WJQA 4X3MA 3WGLA 4DXDA 5FNVB 1VH8A 2K1SA 1TUBB 3CCRF 1JD1A 3JARB 3FBAA 5KX5A 5DCVA 1W5AA 2Z1EA 3DC2A 3NK7A 1XBIA 3FPIA 1NQ3A 5CA1B 3LWRC 4DRXA 4BT2A 4BW0B 5BMVA 3HKEA 5EZYA 2QEXF 3MCAB 3JAWA 1W5FA 1YJ9F 3GHZA 3KIZA 1CN7A 4ZHYB 4G4ZA 3JALB 4X1KB 4IIJA 1FNKA 3HKBA 4X1IA 5CB4B 1IV1A 2HX0A 1X52A 2VAWA 3M84A 5LP6A 3QTYA 4YJ2B 3NVIB 3OONA 2P6YA 2W8BC 1XHOA 3ZP4A 3E20B 1DT9A 1IV2A 2MQEA 3WPWA 4C81A 4C8EA 4EB6B 1FSZA 3RYFB 1K9MH 4B46A 4TV8B 4NQ3A 1YIJF 4HNAB 4I55B 2AIZP 4BVTA 2Z1UA 3VYUC 4EI8A 1VQ7F 1JFFB 1W57A 4G4WA 3LWVC 1VQ8F 3PAFA 3QHDA 4KWEA 1U40A 3JASA 4WBNB 4O4IA 4O4LB 5FLXM 4F6RA 3CPQA 3K12A 5G4UC 5JQGA 2QTPA 2BTQB 1VQ6F 1RLUA 3HKCA 3D01A 3R0PA 4ZHWA 3J7AR 1W55A 1W42A 5IYZA 4BT3A 2Z1FA 2HRUA 3I56F 4ZHVA 5HXZA 3P4EA 4I4TA 1M1KH 5GIPC 1Q86H 3EORA 4X20A 3JATA 5ITZA 5HY1A 1X7PA 3V7QA 4X1YA 5EO3A 1NMUB 5LA6B 3ZO8A 3CYPB 4LNUA 2KGWA 3VMFB 4EI9A 2RHJA 2ZOVA 2RHHA 4U39A 1IV4A 2CW4A 3MDOA 3DDNA 4BVSA 5CA0A 4I50A 3RYCB 5GANK 2HP0A 5HWEA 3VOBA 5GONA 3S0WA 2LBWA 3UT5A 5IJ0B 5MN6A 4O4HA 4BT7A 3N2KB 3SIVA 2BO1A 4PWTA 3IKEA 5LYJA 5KMGA 3S0YA 2EWCA 2H8CA 1RQ7A 2VAPA 3C8LA 2PMPA 4O4JA 1X7OA 2Z01A 2LCAA 3ERNA 5J2TA 1H47A 3VYTC 1SA0A 1VQOF 2QI2A 1ZWZA 3E22B 1VQMF 5JH7A 4G4YA 3F6MA 1KNJA 1JY8A 1VQPF 4X3LA 5GINC 4ZOLA 2ZF8A 2H6LA 3VYSC 3F0GA 2UYNA 3IKFA 3RYIB 2HS3A 2JNBA 2BTUA 4NWOB 4O2BA 2G9IA 3ELCA 3RA6A 1Q82H 3OBWA 1FFXB 2AMTA 3CC4F 5JCOA 4TV9B 3C9TA 1GX1A 3IEWA 4XCQA 3WJRA 4IHJA 2VXYA 5JVDB 2YXZA 1OAPA 3G4SF 3IMPA 2AIFA 4ZHQA 3D00A 5B8FA 5LOVB 3S03A 2RB9A 1UFYA 3JAKB 2VAMA 3ZOPA 5FJ4C 3HWUA 1T0KB 1QU9A 5LXTA 4YJ3A 3JAMM 1XRGA 4TUYA 1YI2F 3K14A 3LFOA 2HS0A 5EAZA 1VQ9F 3U0OA 4G4VA 5FNVA 1W5BA 2ZVYA 3VOAA 2DT4A 1TUBA 5J2UB 5G4VC 3JARA 5EYPB 3N2GB 5MN5A 5CA1A 1UI9A 2GZLA 4ZI7B 3HJWC 1DBFA 3O85A 2FC3A 2IAFA 3K2XA 4B5CA 2RHOA 4RQOA 3V7EA 3RYHB 2V9YA 1YQNA 3GTZA 1KD1H 1W41A 3JALA 2ZVZA 2Q1XA 4X1KA 2WALA 1YHQF 3F0FA 5CB4A 5C8YB 3CCMF 3CG6A 4O2AB 4YJ2A 3VO8A 3WGKA 3VTIC 2B33A 1CK2A 1K73H 3N4YA 4EB6A 3NK6A 4R40B 2HRYA 3WXMB 1Q7YH 3BYQA 3RYFA 4U3JB 4TV8A 2Q1YA 3FFMA 1W59A 5HY0A 2IG8A 4FFBB 1U43A 4HNAA 2KG4A 4I55A 2R6R1 3S02A 3NMUC 1Q8RA 1JFFA 3CCQF 3CXCF 1COMA 3CYQA 5KMGB 2HVYD 5EB0A 1H7MA 4G4XA 1GO0A 1U3PA 4RHAA 5IJ9B 4WBNA 3NVKE 5HP7A 5EIBD 1YGYA 3LYBA 1TVKB 4O4LA 5MN4A 3CMEF 3HKDB 3CCUF 3E1YA 1W5EA 2UYPA 2L26A 3CCLF 1VQKF 1KC8H 3N4ZA 5EB1B 4C8GA 3CB2A 5EWRA 3KJJA 1YJWF 3M1XA 5EIBC 3FD5A 5KX5B 1JN1A 2N48A 3LWOC 1YJNF 3WGNA 3LWQC 2HS4A 3OBYA 3QUWA 5LA6A 3CD6F 1QVFF 4DRXB 1RA4A 5BMVB 3HKEB 5EZYB 1JJ2F 1QD9A 3JAWB 2CWJA 1T0AA 3D54A 4BT6A 4BVQA 3V4DA 1QAHA 3CC2F 4IIJB 2HP3A 3HKBB 3L7QA 4X1IB 3S0HA 3RYCA 5AVMA 1YITF 3OW2F 1PF5A 1PXWA 5LP6B 3TD3A 3P0ZA 1QVGF 1NJIH 2I6DA 2UZHA 4YJ3B 4NUTA 1KNKA 2GLZA 5IJ0A 3N2KA 4TUYB 2KTVA 3KE1A 2OTJF 3I7TA 1FNJA 3HTNA 3CCJF 3JVHA 2Z1TA 4G88A 5A2QM 5LP6C 2KTUA 2VGNA 3E22A 4M8IA 3KJKA 4EI7A 1RQ2A 4ERHA 2CHTA 5IT9M 3M4SA 3WJPA 3VIUA 1VQ5F 3JASB 4O4IB 3WPXA 3WGMA 4F6RB 3RYIA 2OTLF 1W40A 1VQVA 5JQGB 1VHAA 2RHLA 1FFXA 3CCSF 3PLAC 1S72F 2DYYA 4BT4A 3J80M 3HKCB 4TV9A 3ESJA 5IYZB 1IPAA 2CHSA 5JVDA 2BTOA 2PHNA 4I4TB 3F0DA 1Z5WA 2FGYA 4X20B 3GYQA 3LMEA 1H48A 3JATB 5ITZB 5LOVA 1J7HA 4C4WC 2CVLA 2LBXA 4X1YB 3JAKA 5HY2A 3I55F 4LNUB 3S06A 3TD4A 2ALEA 3HAXD 3AGKA 5HY4A 3MCQA 3CMAF 1SZQA 1VQ4F 5CA0B 4I50B 2QA4F 2UYJA 2HP0B 4E6EA 3MQWA 3JCMM 5GONB 1K8AH 5J2UA 3I3FA 3LWPC 5EYPA 3N2GA 3ON1A 2LBTA 3UT5B 3CC7F 3FD6A 4O4HB 3B6NA 1SDSA 1GZ0A 5LYJB 1XV2A 2OTMA 4LCKA 3ZP7A 5HXUA 4ZI7A 1U3LA 3IEQA 4B62A 4O4JB 3KHNA 1X25A 1M90H 2UYKA
chains in the Genus database with same CATH topology
1FNKA 3LYBA 2DYYA 3I7TA 1FNJA 1ONIA 1QD9A 1UFYA 1UI9A 1X25A 2UYNA 2UYPA 2CWJA 1DBFA 1JD1A 4NWOB 2UYJA 1XHOA 2CHSA 3ZOPA 3ZP4A 3MQWA 2EWCA 3K0TA 1QU9A 3V4DA 1QAHA 2IG8A 3ZO8A 3L7QA 3KJJA 3VCZA 3KJKA 3GTZA 1XRGA 3I3FA 1NQ3A 3K12A 1PF5A 2CHTA 3LMEA 2UYNB 3M1XA 3M4SA 1COMA 5HP8A 1J7HA 2CVLA 2CW4A 3D01A 3R0PA 2CSLA 2OTMA 3ZP7A 3QUWA 1ODEA 2B33A 4ZK7A 5HP7A 2UYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNK A;  3LYB A;  2DYY A;  3I7T A;  1FNJ A;  1ONI A;  1QD9 A;  1UFY A;  1UI9 A;  1X25 A;  2UYN A;  2UYP A;  2CWJ A;  1DBF A;  1JD1 A;  4NWO B;  2UYJ A;  1XHO A;  2CHS A;  3ZOP A;  3ZP4 A;  3MQW A;  2EWC A;  3K0T A;  1QU9 A;  3V4D A;  1QAH A;  2IG8 A;  3ZO8 A;  3L7Q A;  3KJJ A;  3VCZ A;  3KJK A;  3GTZ A;  1XRG A;  3I3F A;  1NQ3 A;  3K12 A;  1PF5 A;  2CHT A;  3LME A;  2UYN B;  3M1X A;  3M4S A;  1COM A;  5HP8 A;  1J7H A;  2CVL A;  2CW4 A;  3D01 A;  3R0P A;  2CSL A;  2OTM A;  3ZP7 A;  3QUW A;  1ODE A;  2B33 A;  4ZK7 A;  5HP7 A;  2UYK A; 
#chains in the Genus database with same CATH topology
 3T80 A;  1KQS F;  5J2T B;  3RYH A;  1CLI A;  1VQL F;  3F0E A;  1Z5V A;  1SA0 B;  3VI6 A;  3V3T A;  3IR9 A;  4BY9 D;  5JH7 B;  3C9R A;  5C8Y A;  3K0T A;  3C9U A;  4O2A A;  4C8I A;  3VCZ A;  4ZOL B;  1W3E X;  2HQS C;  1Q81 H;  2UYN B;  5HP8 A;  4BT5 A;  4O2B B;  1E7K A;  4C82 A;  2VGM A;  2F9Z C;  1N8R H;  4U3J A;  3CCV F;  1RLG A;  2GVI A;  4ZK7 A;  4FFB A;  2OHW A;  2H8E A;  5GIO C;  4B45 A;  3MBM A;  3C9S A;  1W58 1;  4IHJ B;  2OZB A;  1ONI A;  3WGJ A;  2I6R A;  3LDT A;  5GAP K;  1IV3 A;  4BVR A;  1W2B F;  1VK3 A;  4ZHQ B;  3CPW F;  2NMU A;  2IQQ A;  2YYE A;  2ZAU A;  3RE3 A;  3TD5 A;  2CZW A;  5IJ9 A;  3J81 M;  3P10 A;  1GO1 A;  2R75 1;  1TVK A;  5JCO C;  3HKD A;  4TZZ A;  1VQN F;  5LXT B;  3G6E F;  2CSL A;  2ZOD A;  3SIU A;  3RA5 A;  1OFU A;  3G71 F;  1ODE A;  1R1M A;  3Q8H A;  3CCE F;  3WJQ A;  4X3M A;  3WGL A;  4DXD A;  5FNV B;  1VH8 A;  2K1S A;  1TUB B;  3CCR F;  1JD1 A;  3JAR B;  3FBA A;  5KX5 A;  5DCV A;  1W5A A;  2Z1E A;  3DC2 A;  3NK7 A;  1XBI A;  3FPI A;  1NQ3 A;  5CA1 B;  3LWR C;  4DRX A;  4BT2 A;  4BW0 B;  5BMV A;  3HKE A;  5EZY A;  2QEX F;  3MCA B;  3JAW A;  1W5F A;  1YJ9 F;  3GHZ A;  3KIZ A;  1CN7 A;  4ZHY B;  4G4Z A;  3JAL B;  4X1K B;  4IIJ A;  1FNK A;  3HKB A;  4X1I A;  5CB4 B;  1IV1 A;  2HX0 A;  1X52 A;  2VAW A;  3M84 A;  5LP6 A;  3QTY A;  4YJ2 B;  3NVI B;  3OON A;  2P6Y A;  2W8B C;  1XHO A;  3ZP4 A;  3E20 B;  1DT9 A;  1IV2 A;  2MQE A;  3WPW A;  4C81 A;  4C8E A;  4EB6 B;  1FSZ A;  3RYF B;  1K9M H;  4B46 A;  4TV8 B;  4NQ3 A;  1YIJ F;  4HNA B;  4I55 B;  2AIZ P;  4BVT A;  2Z1U A;  3VYU C;  4EI8 A;  1VQ7 F;  1JFF B;  1W57 A;  4G4W A;  3LWV C;  1VQ8 F;  3PAF A;  3QHD A;  4KWE A;  1U40 A;  3JAS A;  4WBN B;  4O4I A;  4O4L B;  5FLX M;  4F6R A;  3CPQ A;  3K12 A;  5G4U C;  5JQG A;  2QTP A;  2BTQ B;  1VQ6 F;  1RLU A;  3HKC A;  3D01 A;  3R0P A;  4ZHW A;  3J7A R;  1W55 A;  1W42 A;  5IYZ A;  4BT3 A;  2Z1F A;  2HRU A;  3I56 F;  4ZHV A;  5HXZ A;  3P4E A;  4I4T A;  1M1K H;  5GIP C;  1Q86 H;  3EOR A;  4X20 A;  3JAT A;  5ITZ A;  5HY1 A;  1X7P A;  3V7Q A;  4X1Y A;  5EO3 A;  1NMU B;  5LA6 B;  3ZO8 A;  3CYP B;  4LNU A;  2KGW A;  3VMF B;  4EI9 A;  2RHJ A;  2ZOV A;  2RHH A;  4U39 A;  1IV4 A;  2CW4 A;  3MDO A;  3DDN A;  4BVS A;  5CA0 A;  4I50 A;  3RYC B;  5GAN K;  2HP0 A;  5HWE A;  3VOB A;  5GON A;  3S0W A;  2LBW A;  3UT5 A;  5IJ0 B;  5MN6 A;  4O4H A;  4BT7 A;  3N2K B;  3SIV A;  2BO1 A;  4PWT A;  3IKE A;  5LYJ A;  5KMG A;  3S0Y A;  2EWC A;  2H8C A;  1RQ7 A;  2VAP A;  3C8L A;  2PMP A;  4O4J A;  1X7O A;  2Z01 A;  2LCA A;  3ERN A;  5J2T A;  1H47 A;  3VYT C;  1SA0 A;  1VQO F;  2QI2 A;  1ZWZ A;  3E22 B;  1VQM F;  5JH7 A;  4G4Y A;  3F6M A;  1KNJ A;  1JY8 A;  1VQP F;  4X3L A;  5GIN C;  4ZOL A;  2ZF8 A;  2H6L A;  3VYS C;  3F0G A;  2UYN A;  3IKF A;  3RYI B;  2HS3 A;  2JNB A;  2BTU A;  4NWO B;  4O2B A;  2G9I A;  3ELC A;  3RA6 A;  1Q82 H;  3OBW A;  1FFX B;  2AMT A;  3CC4 F;  5JCO A;  4TV9 B;  3C9T A;  1GX1 A;  3IEW A;  4XCQ A;  3WJR A;  4IHJ A;  2VXY A;  5JVD B;  2YXZ A;  1OAP A;  3G4S F;  3IMP A;  2AIF A;  4ZHQ A;  3D00 A;  5B8F A;  5LOV B;  3S03 A;  2RB9 A;  1UFY A;  3JAK B;  2VAM A;  3ZOP A;  5FJ4 C;  3HWU A;  1T0K B;  1QU9 A;  5LXT A;  4YJ3 A;  3JAM M;  1XRG A;  4TUY A;  1YI2 F;  3K14 A;  3LFO A;  2HS0 A;  5EAZ A;  1VQ9 F;  3U0O A;  4G4V A;  5FNV A;  1W5B A;  2ZVY A;  3VOA A;  2DT4 A;  1TUB A;  5J2U B;  5G4V C;  3JAR A;  5EYP B;  3N2G B;  5MN5 A;  5CA1 A;  1UI9 A;  2GZL A;  4ZI7 B;  3HJW C;  1DBF A;  3O85 A;  2FC3 A;  2IAF A;  3K2X A;  4B5C A;  2RHO A;  4RQO A;  3V7E A;  3RYH B;  2V9Y A;  1YQN A;  3GTZ A;  1KD1 H;  1W41 A;  3JAL A;  2ZVZ A;  2Q1X A;  4X1K A;  2WAL A;  1YHQ F;  3F0F A;  5CB4 A;  5C8Y B;  3CCM F;  3CG6 A;  4O2A B;  4YJ2 A;  3VO8 A;  3WGK A;  3VTI C;  2B33 A;  1CK2 A;  1K73 H;  3N4Y A;  4EB6 A;  3NK6 A;  4R40 B;  2HRY A;  3WXM B;  1Q7Y H;  3BYQ A;  3RYF A;  4U3J B;  4TV8 A;  2Q1Y A;  3FFM A;  1W59 A;  5HY0 A;  2IG8 A;  4FFB B;  1U43 A;  4HNA A;  2KG4 A;  4I55 A;  2R6R 1;  3S02 A;  3NMU C;  1Q8R A;  1JFF A;  3CCQ F;  3CXC F;  1COM A;  3CYQ A;  5KMG B;  2HVY D;  5EB0 A;  1H7M A;  4G4X A;  1GO0 A;  1U3P A;  4RHA A;  5IJ9 B;  4WBN A;  3NVK E;  5HP7 A;  5EIB D;  1YGY A;  3LYB A;  1TVK B;  4O4L A;  5MN4 A;  3CME F;  3HKD B;  3CCU F;  3E1Y A;  1W5E A;  2UYP A;  2L26 A;  3CCL F;  1VQK F;  1KC8 H;  3N4Z A;  5EB1 B;  4C8G A;  3CB2 A;  5EWR A;  3KJJ A;  1YJW F;  3M1X A;  5EIB C;  3FD5 A;  5KX5 B;  1JN1 A;  2N48 A;  3LWO C;  1YJN F;  3WGN A;  3LWQ C;  2HS4 A;  3OBY A;  3QUW A;  5LA6 A;  3CD6 F;  1QVF F;  4DRX B;  1RA4 A;  5BMV B;  3HKE B;  5EZY B;  1JJ2 F;  1QD9 A;  3JAW B;  2CWJ A;  1T0A A;  3D54 A;  4BT6 A;  4BVQ A;  3V4D A;  1QAH A;  3CC2 F;  4IIJ B;  2HP3 A;  3HKB B;  3L7Q A;  4X1I B;  3S0H A;  3RYC A;  5AVM A;  1YIT F;  3OW2 F;  1PF5 A;  1PXW A;  5LP6 B;  3TD3 A;  3P0Z A;  1QVG F;  1NJI H;  2I6D A;  2UZH A;  4YJ3 B;  4NUT A;  1KNK A;  2GLZ A;  5IJ0 A;  3N2K A;  4TUY B;  2KTV A;  3KE1 A;  2OTJ F;  3I7T A;  1FNJ A;  3HTN A;  3CCJ F;  3JVH A;  2Z1T A;  4G88 A;  5A2Q M;  5LP6 C;  2KTU A;  2VGN A;  3E22 A;  4M8I A;  3KJK A;  4EI7 A;  1RQ2 A;  4ERH A;  2CHT A;  5IT9 M;  3M4S A;  3WJP A;  3VIU A;  1VQ5 F;  3JAS B;  4O4I B;  3WPX A;  3WGM A;  4F6R B;  3RYI A;  2OTL F;  1W40 A;  1VQV A;  5JQG B;  1VHA A;  2RHL A;  1FFX A;  3CCS F;  3PLA C;  1S72 F;  2DYY A;  4BT4 A;  3J80 M;  3HKC B;  4TV9 A;  3ESJ A;  5IYZ B;  1IPA A;  2CHS A;  5JVD A;  2BTO A;  2PHN A;  4I4T B;  3F0D A;  1Z5W A;  2FGY A;  4X20 B;  3GYQ A;  3LME A;  1H48 A;  3JAT B;  5ITZ B;  5LOV A;  1J7H A;  4C4W C;  2CVL A;  2LBX A;  4X1Y B;  3JAK A;  5HY2 A;  3I55 F;  4LNU B;  3S06 A;  3TD4 A;  2ALE A;  3HAX D;  3AGK A;  5HY4 A;  3MCQ A;  3CMA F;  1SZQ A;  1VQ4 F;  5CA0 B;  4I50 B;  2QA4 F;  2UYJ A;  2HP0 B;  4E6E A;  3MQW A;  3JCM M;  5GON B;  1K8A H;  5J2U A;  3I3F A;  3LWP C;  5EYP A;  3N2G A;  3ON1 A;  2LBT A;  3UT5 B;  3CC7 F;  3FD6 A;  4O4H B;  3B6N A;  1SDS A;  1GZ0 A;  5LYJ B;  1XV2 A;  2OTM A;  4LCK A;  3ZP7 A;  5HXU A;  4ZI7 A;  1U3L A;  3IEQ A;  4B62 A;  4O4J B;  3KHN A;  1X25 A;  1M90 H;  2UYK A; 
#chains in the Genus database with same CATH homology
 1FNK A;  3LYB A;  2DYY A;  3I7T A;  1FNJ A;  1ONI A;  1QD9 A;  1UFY A;  1UI9 A;  1X25 A;  2UYN A;  2UYP A;  2CWJ A;  1DBF A;  1JD1 A;  4NWO B;  2UYJ A;  1XHO A;  2CHS A;  3ZOP A;  3ZP4 A;  3MQW A;  2EWC A;  3K0T A;  1QU9 A;  3V4D A;  1QAH A;  2IG8 A;  3ZO8 A;  3L7Q A;  3KJJ A;  3VCZ A;  3KJK A;  3GTZ A;  1XRG A;  3I3F A;  1NQ3 A;  3K12 A;  1PF5 A;  2CHT A;  3LME A;  2UYN B;  3M1X A;  3M4S A;  1COM A;  5HP8 A;  1J7H A;  2CVL A;  2CW4 A;  3D01 A;  3R0P A;  2CSL A;  2OTM A;  3ZP7 A;  3QUW A;  1ODE A;  2B33 A;  4ZK7 A;  5HP7 A;  2UYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...