4WBNB

Crystal structure of tubulin-stathmin-ttl complex solved by native-sad phasing
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 178
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4wbnB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4wbnB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4wbnB01
1W5BA 4I4TA 4TV8B 4U3JA 2VAWA 3JAKA 5EIBD 4X1IB 3JASB 5MN5A 4IIJB 1TUBB 4EB6A 5JQGA 5LA6B 5LYJA 4E6EA 4TUYB 5LP6C 1TVKA 3RYFB 3E22A 3HKEA 4LNUA 1W5AA 5C8YA 3JALA 4O4JA 3N2GA 4IHJA 1FFXA 3JARB 4DRXA 5JH7A 4O4LA 5KMGB 3WGJA 4O4IA 3N2KB 3HKBA 4X1KA 1JFFB 5LP6A 4ZOLA 5LXTB 5EZYA 5ITZA 4FFBB 5CB4B 4F6RA 4ZHQB 3RYCB 5J2TB 3V3TA 4I55B 4X1YA 5JQGB 4DRXB 5GONB 5KX5B 2RHOA 4EI7A 1OFUA 5C8YB 2BTQB 4I50A 5CA1B 5LXTA 5EIBC 4U39A 5J2UB 4YJ3B 2Q1YA 4O2AB 3C8LA 4KWEA 3ZBPA 3HKBB 3UT5B 5BMVB 3VPAA 5EZYB 2GVIA 2RHJA 1SA0A 3HKCB 4M8IA 2XKBA 5JVDB 1W581 1Z5VA 4WBNA 5IYZB 2R751 5IJ9A 5GONA 5MN4A 3ZIDA 4O4HA 1TUBA 4EB6B 4I55A 4X1YB 4B46A 3WGMA 5LOVB 3JATA 4U3JB 4DXDA 5M7EA 3HKDA 5CA0A 3JAWA 3WGLA 5IJ9B 2R6R1 3M8KA 3ZBQA 5KMGA 3M89A 1W5FA 4EI8A 3JALB 3RYHB 4WBNB 3RYCA 1RQ7A 5JCOA 5ITZB 5LOVA 2XKAA 4ZI7B 1JFFA 3WGNA 2BTQA 3JATB 3VOAA 3RYIB 3R4VA 4HNAA 3VO9A 4TV8A 4I4TB 4O2AA 3RB8A 3JAWB 1FSZA 4TV9B 2RHLA 4X20B 5J2UA 4I50B 5CA1A 5IJ0B 5KX5A 1TVKB 3UT5A 5BMVA 5LA6A 2VXYA 5FNVB 4HNAB 3WGKA 1Z5WA 4YJ3A 5IYZA 1RQ2A 1FFXB 3JARA 5JH7B 3VOBA 4O4JB 4YJ2A 3CB2A 4TV9A 4X20A 4X1KB 3HKEB 3E22B 4O4IB 5LP6B 5FNVA 4O4LB 4F6RB 3N2GB 4IHJB 4ZHQA 5IJ0A 5JCOC 3N2KA 4ZOLB 3HKDB 5CA0B 4B45A 4XCQA 4FFBA 5CB4A 5J2TA 5EYPA 5MN6A 4YJ2B 3VO8A 2RHHA 1RLUA 1W59A 4O2BA 4LNUB 5LYJB 2BTOA 3RYIA 4TUYA 3RYHA 4X1IA 2VAMA 1SA0B 3HKCA 4IIJA 2Q1XA 4EI9A 3JAKB 5EYPB 4ZI7A 3JASA 1W5EA 2VAPA 4O4HB 3RYFA 4O2BB 5JVDA
chains in the Genus database with same CATH superfamily
3EG9A 1HKHA 2YZGA 4YJDA 3Q0EA 2ZIFA 5TLSA 4FLUA 4DUYB 1ZW6A 2XITA 4EENA 4Y3UA 1WDKA 5REQA 3T5TA 1J99A 1E9EA 4LFBB 3BMOA 3B3QA 4D9HA 3C7KA 5LOVF 2O2SA 4RJTA 5B6JA 1OB2A 1T8UA 1JZTA 4YHHO 1YKFA 1Z07A 2DLDA 4K3AA 2NO9A 3IR5A 3AM5A 4HAOA 4UVHA 4WZZA 5DFAA 5IMBA 1V6AA 5EG5A 1X7ZB 3WLAA 4LHSA 3R44A 3WB0A 4DRXA 1NNSA 3I6QA 2R1ZA 1QGUB 3DF7A 2P1DA 3R0JA 4GZMA 1WDTA 3MGKA 4LQLA 3H2KA 3CUKA 1RKBA 1JFFB 1T1IA 2BI4A 4X62O 2UYNA 1GNVA 5H68A 4BB0A 5KYNA 4I1RA 5LQKA 3LYUA 1OJ7A 3ZHOA 1KZ9A 4NBVA 3J80A 2WUVA 3AFIA 4ZQGA 2P06A 1OZ0A 4FFRA 2QUKA 3LV8A 4WD3A 3WGOA 1EBBA 4RW0A 5B7QA 2PNFA 1J97A 2P5YA 4R2JA 1ODJA 3K0TA 4X91A 3AG3B 3PQFA 3SPXA 4CM7A 4Z4GA 3RKSA 1K75A 2OFWA 3AZOA 3LSSA 1C3OA 3GUVA 2B9ZA 1OILA 3KVYA 3LFUA 4LOKA 5JEEA 2GZ3A 4LFCO 4JSTA 3QNEA 1KMIY 3OW2F 4KAFA 1YFZA 3FUCA 2YHIB 3FR7A 1N36O 4D9BA 5FPOA 3SYLA 1US8A 1FBNA 1RAEA 4ZGWA 1ORQC 1COZA 5KTOA 3K96A 3NI2A 2YRXA 1TJ4A 2FOLA 5D7NA 3VNQA 2QDXA 2ZUWA 4UNSA 5TE9A 3K1JA 2VOEA 1T0UA 2LWIA 4A6PA 1G66A 1VA4A 2XLCA 2YXPX 3C3JA 4CMBA 4KRFA 5FI1B 5AVJA 4K86A 2WU4A 5A9GA 2X14A 1G20E 4NABA 1XN1A 4BZPA 1AF7A 3W5JA 1CEZA 2H59A 3FDIA 4OSEA 1BC5A 4X7PA 4DSUA 5BN4B 2R4TA 1E5XA 1T9DA 4PGGA 5JARA 5LNK6 2IH4A 4OPAA 1MOQA 1JU9A 5DLQC 4C0AC 2PD3A 3I5DA 3BMCA 1TM5E 5EMJA 1WDWB 2J67A 5B6IA 2XNDD 1F8FA 4OU4A 3ZJ4A 3K1TA 1AB3A 2C2BA 3N8KA 3D6NB 1PFVA 1U4OA 2AX4A 3CMAV 4ARBA 4C4SA 1LUWA 2XJ9A 4TT3G 4HGOA 3FMPB 4L07A 1YFKA 4A0RA 2BTEA 2CL6X 4ZYVA 3FWNA 2OV3A 2WU3A 3K5NA 4R01A 1ZGGA 4GL4A 4P33A 2E75B 1UBTS 3LUHA 2CLKB 1RWPA 2OEPA 2CGOA 2ZZKA 3W6UA 1R4ZA 1SRQA 3HA3A 5JI2E 1TGYA 2GTIA 3BIXA 4JMPA 2VZ9A 1YSCA 4LXHA 5E1BA 5IW8A 1QNMA 3T0FA 5BRJA 6REQB 2OWEA 1CFZA 3WNBA 1JNYA 4W4TA 2IHZA 3P97A 1DQNA 3IDOA 2QI2A 2H4WA 3KL2A 1B00A 1XF9A 5KSYA 2CVQA 3K59A 1KP2A 4KK4A 1WMBA 2FZWA 2GAFA 1RAFA 3NEAA 4GBMA 5A06A 1N2ZA 3IRVA 4YTEA 1M2HA 1Z4QA 2G28A 4N65A 3A2NA 4G36A 4QRHA 4BMYA 4LH6A 4ZMRA 1AQNA 1CRPA 2PX6A 5IJXA 5JANA 3E8MA 3KTDA 3CCQV 1PZMA 2QTFA 3CCUF 1E1RD 4P2ZA 5EERA 2YWCA 4TWIA 5REQB 2C7RA 1HE1C 1TMGE 4Z53A 2JJ1G 4YT4A 2AOVA 3W04A 4EF5A 4ZFNA 4DUZO 3NJRA 1T3GA 1LI7A 2I1LA 1SXJE 2NTYC 3KHUA 2FR8A 2GEJA 2ZXEA 4FUTA 4Y9SA 1JSRA 2OHGA 2DLCX 1LY1A 2MK3A 4S0ZA 4KI0A 4N48A 1FVHA 3NBUA 4IJUA 3ZBQA 3RVLA 1DBWA 2R79A 5LP6C 5J40A 2LBWA 2JLQA 2V59A 2B4YA 2QSYA 3TJRA 1OQAA 2OFFA 3SX2A 1L5GB 3MLBA 4FONA 3CLTD 4DDMA 2C9DA 3PGJA 4ALJA 1N0JA 3CMEV 5AVYA 3MCQA 3ETHA 5DWQA 4YPFA 4PPQA 4JX9A 3D9QX 1XTTA 5I9IA 1WXIA 4BVTA 3D6MA 1VL5A 1H05A 4N82A 1LZLA 3AUFA 2NO7A 2GFHA 1C9MA 1T36A 2ZWIA 3KPUA 4TKMA 3V3TA 4Y6RA 4DV0B 2DT8A 3L04A 3SICE 4YIHA 3DHEA 1EWTA 3WAKA 4TZZA 4Z49A 2ZYRA 4FE7A 1U8UA 3LGAA 3OCZA 1VMIA 1OTXA 5LIRA 1N2HA 2A0KA 5JISA 4MW0A 2FG5A 2Z3ZA 1XT6A 1GRQA 3VYWA 3QKRB 1EP9A 5FLKA 5CUQA 1TPYA 3EH2A 2JBAA 5TVGA 4BVGA 4IDFA 1RRMA 3C6ZA 1YZHA 4HRYA 5A5GA 2Q5IA 5DHPA 1AB5A 2W93A 4WH0A 1JVMA 2VH2A 2Z3YA 3SJCA 1ZUIA 3H13A 5EHGA 1GV1A 2IV2X 2HF7A 1GTMA 4W9RA 3K4QA 4IMIB 5JPIA 5BN4A 1MENA 4BOYA 2ZRNA 1T1EA 4N41A 1YA8A 4E4EA 3CRW1 1L5NA 2JI6A 2CAZC 2PNJA 2FTKA 4H35A 3WRVA 4CYMA 2GCPA 2LNDA 2OHXA 3QQPA 2YBEA 2ZVDA 4LY0A 4MW5A 3WDKA 1YQGA 4CWAA 3KDAA 3EIQA 2XUQA 4TMYA 5BW6B 2WLNA 5EPEA 3ROQA 3P2YA 1SQXH 1XBLA 3BORA 3L6EA 2WMDA 1W0KD 2B7BA 3GUCA 3IP1A 1A77A 4Z7OB 3BJMA 4Q6WA 4L74A 1E2JA 5AK4A 3QBTA 4QJBA 4BFWA 5F12A 5BN3A 5IUJC 2ETNA 1XCBA 4UEWA 1AZWA 4M1KA 3KT0A 5T4FA 3MJVA 4ILKA 4IMPA 5D7BA 3V2HA 3PZRA 4C4YA 3ECSA 2Z56A 4TYPA 3K9AA 1E7KA 1B26A 1MAWA 2XLBA 3AU8A 3PQCA 4FNOA 4TPKA 4X6YA 4EH1A 4AKSA 3QLUC 4DZZA 4RE5A 4BN5A 1GRJA 3L5KA 3N6XA 3WG7C 1JMYA 5GIPC 3CR7A 3JARA 1GN9A 2ZIZA 4K2AA 3WIEA 2Z6AA 4FZ0A 3FJ1A 4RIEA 1NC3A 3O92A 5H80A 5LLSA 4EG6A 1PL0A 1QP4A 3NHUA 1VARA 3M6VA 3E0XA 4QYMA 2VXOA 2WKSA 4IOLA 4ZPXA 4B6SA 1RQRA 4R2IA 3N2GB 2J4DA 5IJ0A 1ONBA 3B6JA 2VDNB 4ZQEA 2DFLA 4L9RA 4LBEC 3LOPA 3RU7A 4QJIA 4Y7DA 5SZIA 4RTNA 3ZGZA 2P0EA 4X3CA 3DBHA 5IAJA 2A06H 4I19A 2DFDA 3UMBA 3O74A 4U7WA 1WNSA 2P3SA 3EXHB 3BH7A 4XDHA 1GEGA 2HA7A 4Q00A 3GJ3A 1KFKB 2FMFA 4D7TA 2PLRA 3ANLA 3C9TA 4LK2A 1NVAA 3ZXYA 7GPBA 3QF4B 3ZJZA 4ZJUA 1ZM2A 2AD5A 2A5FA 3V2UA 1BQ0A 1CY2A 4NZPA 5IC4A 4DEVA 3IBYA 2E7ZA 4G5SA 5ENVA 4HOYA 3BXXA 3ZRVA 4KODA 4EFBA 4FLZA 5CCDA 3TZKA 2ADFA 3R41A 2JH9A 1HDOA 4ZAYA 1GTG1 3OCWA 1YBVA 2XVYA 3P0HA 5EEHA 2LBTA 2YWXA 4IRMA 2HK6A 3BQNB 4BMVA 3RA6A 4D1YA 1R0WA 5EJGA 3RARA 2XRZA 1IEVA 1KU6A 1V11A 5GZ3A 4LAFA 1OIVA 5KMGB 1EIZA 1MFPA 3ELYA 4P7JA 4YRFA 3U40A 2O8CB 4Z6KA 1E2LA 1OT3A 1P33A 3G7UA 3COVA 2D7CA 3PFIA 4JJAA 4NP6A 1GCAA 3VVCA 1PNTA 2WEKA 4A6EA 2RHRA 2YWFA 4JZYA 4KLRA 2YMLA 5AW9A 3MCAA 2FWAA 1ZRNA 3E9RA 2XQKA 1EWRA 3QU4A 3G2IA 1N2BA 4BIMA 4PA6A 4KREA 4BNUA 1JALA 1V11B 2R9VA 3N05A 4PONA 4Z0NA 2BEKA 1GTVA 4RAQA 1RYYA 4P84A 2D4AA 4D4IA 4M0MA 5IZCC 5AK3A 5BMVB 1GO1A 2C2XA 3QTTA 4NATA 2OCAA 2IS4A 3GA7A 1NQTA 2VF5X 1G42A 1N0WA 5B53A 4LVCA 5HILA 5TMBA 1SQ0A 1FSPA 4L8WB 4Y0NA 4PDVA 2NO0A 3H11B 4K9KA 4LZOA 4F5ZA 3ETDA 1EN5A 2ZINA 5FJ4C 2WIJA 3VQYA 3FX2A 1ISGA 3GGSA 4JLBA 4QOIA 4JPRA 1DEHA 2VYCA 4QUGA 3LKZA 1V54C 2JVDA 4CG0A 2KS6A 3AHEA 5B1EA 3HJGA 1L5VA 2K7FA 4L8VA 3SYOA 4UAJA 1AI6A 3NHSA 3QBVA 1MHTA 1JE0A 2BISA 2JVKA 5K0EA 2E74B 5KUKA 4QSMA 3L7KA 4RUKA 4DBLE 1F1JA 4BZXA 4CKZA 4US2R 1BGYH 2HJGA 1AQUA 2D2XA 3D3IA 1CK2A 1RYNA 1Q3EA 1AT1A 4Y2YA 5C1BA 3D4PA 4J9VA 2MMCA 2DUJA 5AHXA 4MB0A 4B3RB 2CY0A 5EJ2A 4CFYA 1DJLA 4FKZA 3FR8A 1E9BA 5FHQA 1E6CA 4U2DA 1GFWA 5E3IA 3SZUA 3R6TA 4CEJA 4Q9HA 4UNIA 4BLVA 3A4IA 1H1LB 4HBNA 2AFHA 4LDPA 1YC2A 1N7GA 2BEVB 3L82B 1T5IA 3PWSA 4IGKA 2QWRB 5LA6A 4GOXA 4JHXA 4QODA 4BCBA 5JNTA 1K97A 4HNAB 2BHTA 3DSQA 1U2SA 3D36A 3PC4A 1Z5WA 4L0CA 4RJJA 4DM3A 5F9FA 2BP7A 3WYEA 3L72H 2DKOA 2WWRA 5H3LA 4MI9A 3OT5A 1L5HB 4GVXA 4KZPA 1Q8IA 4MVCA 1OPRA 1NAIA 3PWTA 4KYVA 5DTEA 1VQ8V 4M9UA 3ZY5A 4CM5A 5HDQA 5IXSA 3FPIA 1JDSA 1Q8RA 2EL9A 2JI7A 3ENKA 3LA8A 3ME5A 4FC6A 1A82A 1XPJA 2GEFA 3AHGA 2RFLA 3LBIA 1KI8A 3LLVA 2BOCC 2ZITA 1ECGA 5C51B 4XIFA 3CEAA 1MRZA 1AI5A 2ODEA 4OREX 3I56V 5T3UA 1RPRA 3CNNA 4FR2A 1OHHG 3DNFA 4RF4A 5JJ5A 3FGPA 4B3TO 3L7QA 3FIUA 4HXEB 3QVVA 4Z8XA 2BR3A 4MUAA 1P7GA 1AE1A 1JS1X 3E9CA 5FR2A 3UTCA 2HHHB 5HR5A 3QG5A 3THOA 1G9TA 1N8TA 3M0EA 4WOJA 5DNCA 1Y7PA 1T8YA 3EVNA 4DBVO 1T3HA 1MO6A 1SCNE 3OE7A 1I0HA 3RRJA 2QTPA 3DC2A 3UJDA 4H1UA 2PYZA 3EEYA 1BAPA 1B42A 5CLIA 1VJ0A 1KU0A 3K57A 1SKBA 2NR5A 1JI0A 1IDN1 1O1YA 1MO5A 1N0HA 1UR5A 3H9CA 3H1PA 1XJ5A 2AEMA 4Q9LA 4AQDA 4FS8A 1D6SA 2NG1A 1GNLA 2HSZA 2NO5A 3A0RB 3I3SR 4XAQA 2PQ2A 3VQTA 3WLLA 2QYTA 4E2ZA 2C2KA 3BN3A 3OJFA 5LZ7A 3WRXA 3D3KA 1LNSA 3OOHA 3ZBTA 1E1KA 4GPTA 4LJKA 4NDZA 3SPGA 2OB1A 4JVMA 3K94A 4XWYA 4BKUA 4CM6A 4J2OA 1M34B 1QRTA 4E5MA 5EJMA 5LBIA 3K5MA 4EW6A 4DIOA 2VQ3A 3X3HA 1T0JB 1TC1A 3DEKA 3G9XA 1UJ5A 3GWGA 3OCYA 3U9LA 4CG1A 1T9CA 4MUBA 5EZSA 2BZ1A 1BX1A 3N0XA 4P3PA 4B4VA 4OGGA 4PXAA 1YJQA 4OL9A 2QPTA 3OJCA 5JD6A 2R2AA 2OXCA 3OHMA 2JZCA 4PGHA 3WAJA 1L9XA 3D6AA 4EFNA 3E35A 2Z1TA 3AK4A 3GLFA 3QBEA 2CK3G 1WW8A 4GOOD 3GQBB 5L3QA 4NF2A 1FJ2A 2WJPA 4HH0A 4LGMA 3NOXA 4XKJA 2BFEA 1HE5A 2P68A 5IJ9A 3NTVA 1J0XO 2Y2VA 2I1VB 4J4TA 4NESA 2QIOA 4J43A 4YQYA 5ALWA 4PM4A 5E6UB 3D1LA 5H70A 3ZWVA 1VLHA 2W8BB 1HC7A 3ECCA 2QL5A 4QQ8A 4EFMA 3UWMA 2KG7B 1MA1A 1H2YA 1Z4OA 1Q0TA 1TYEB 2JLVA 5A2GA 2D0OB 5DLYA 2ZG6A 2ZIMA 4QXOA 2GBLA 3U49A 1R0ZA 4AIRA 1M2JA 1LD3A 1Y7HA 1WTCA 3H5OA 3OOEA 3KZNA 4Q37A 1NQWA 1UPXA 4NEQA 3T3DA 5KSWB 3IHLA 4N21A 1YKSA 3OOSA 4IZ6A 5JQGF 2CZGA 1HTWA 4TTRA 2JJ1D 1VLMA 1N2JA 4JT4A 1F6DA 4LE0A 3ZCQA 4DQXA 5BWOA 3FKSG 1P6XA 2FZEA 5KNLA 3FTPA 4NYJR 5CT9A 4L51A 5AT1A 1ADGA 5ALFA 3JZIA 4TMWA 2UZ4A 1WBBA 2IJGX 1ZHOA 1E1CA 1ECCA 2JBWA 4M88A 4RDCA 3EGXB 3NTLA 2GF2A 1UKCA 2J3EA 4UDNA 4DMLA 3ESRA 1TKBA 3CNOA 4H60A 5F76A 5AXCA 2BSXA 3GG2A 4N7BA 1KAGA 3BX1A 3W7BA 4B73A 3GGDA 4ETWA 3PFWO 4EY4A 2W43A 1G21E 4HFNA 3WICA 3GP3A 4MVRA 1ZK4A 1CUVA 3IFSA 4LYGA 1XOUA 2YC2C 3QY0A 2PZLA 4PX3A 5FNZA 3GLIE 1ADFA 2JAOA 3SIPA 2V7BA 3CEHA 5TISZ 4DVGA 2FPMA 4C05A 2FN4A 3CU5A 3WJQA 4GI2A 1SWWA 5B37A 1Z13A 3I42A 1F8XA 1FE8A 1OBFO 1SMKA 1T3ZA 4WA8A 1I2AA 3VPFA 3B2EE 1EKXA 2BFOA 3H8SA 3HA2A 4N7JA 4UBMA 4DJJA 4F4IA 3GMDA 1RRGA 3QOYA 5HJ5A 2Q5LA 3EGIA 3SJAA 1ZCZA 1ZI9A 1T4GA 4L22A 3G6WA 5JRZA 2WAYA 2QRLA 4B8WA 1SD2A 5E7QA 3OZRA 2IBZH 1QYXA 1VQOV 2P91A 5AM5A 2VXCA 1DSSG 4FFDA 2YHSA 3HDHA 3L9WA 4EHNA 3K2EA 1J39A 2P9HA 4EMUA 2JDIA 2DHQA 2JIDA 1HMYA 1U40A 1S3GA 1XDZA 2JIQA 3NOOA 4YUVA 5L95A 3I9OA 2DUWA 2J3HA 5LL6Y 3AWIA 1UMCA 1FVFA 3L84A 3L8GA 4QOJA 5THXA 1D04A 3TPZA 5A4JA 5J4HA 2OV6A 5GAJA 2DQKA 4CM9D 4JLJA 3F0GA 3VAZA 1P9OA 3AY0A 4IGFA 4LS3A 2C8KA 4X7MA 5BV2P 3RFUA 1KIFA 3PUZA 5DSTA 1KZ7B 4X1KA 2JFXA 4W6ZA 3SHQA 2PBFA 2VZEA 2X9NA 3NBKA 4LYYA 4E2FA 1SB8A 1OKKD 3F1LA 5JXHA 3SZLA 2A1TS 3B36A 4B7KA 2CCJA 3DLBA 1IXBA 1Z08A 1Z2CA 5J1TB 4JTCB 5DTQA 2NN4A 1G8YA 2DR3A 2E87A 1SO8A 3DL0A 4QT0A 4TYYA 3PEVA 3ES9A 4CC6A 5FTWA 3I4FA 1Y3FE 4RVOA 2JIZD 4TTVA 2ISCA 3UWOA 3ZWAA 1WWKA 2GD6A 2EKBA 2R6FA 4HMQA 4MINA 3SC3A 3IKEA 2DBZA 2CWDA 3L8MA 3FPHA 2VDKB 4Q4AA 2NSDA 2ZYSA 4UPEA 4Z1MA 4X97A 4F4LA 4CTJA 2GHYA 1WW2A 1H1DA 3DMFA 4DSTA 4CRWB 2R9IA 2OMKA 2QTAA 4BE9A 5JZBA 2EZOA 1J9EA 3PT5A 2YYYA 2G5CA 3UH0A 2ZJ0A 4I1YA 4QPCA 2WW8A 4MS2A 3SEAA 1KF0A 1YR8A 2HA3A 3JX9A 3OZDA 3CNEA 3CO5A 3M83A 3ESBA 3CUUA 5GGYA 2QTNA 4IILA 4Z5XA 2FDRA 3L1IA 4R8RA 4C6HA 4PA4A 2QT0A 3W7UA 2OBYA 4G67A 3EGCA 3RUDA 4C88A 2CKDA 5EXTA 2E76B 2AQIA 1YZYA 1VZ3A 2SNIE 3EIFA 4Z0TA 2WTEA 3ZHZA 1KJJA 2O50A 1G9SA 4ZAWA 1SG9A 1KY3A 4ZVKA 3OP1A 3RRNA 2H7CA 3QVTA 3RAJA 1W36C 4BASA 1T5HX 2FUKA 2TMGA 5TMPA 5HIAA 3PA6A 2AFIE 3U0BA 5BWLA 4L6AA 4ARZA 3R3VA 4RQFA 4WESB 1NXTA 2J07A 1XHOA 3NDIA 2X0LA 3SR3A 4ZI7F 4DQ0A 2QV7A 1EVYA 3PQEA 5FDFA 1N33O 4PEVA 1BHJA 3FN4A 1KYOF 1P60A 5E2IA 5DECA 3C87A 4F72A 3PFGA 1LX7A 4ZAXA 3FCOA 3BVOA 5F3DA 1YB5A 4DMFA 2R7KA 2ACKA 3FKJA 1BDJA 2YS8A 2IODA 4MPDA 4G9EA 3MQ2A 3J7TA 4MUYA 5BUCA 4XX0B 4EEZA 4HYOA 4LSWA 1RFLA 4PRYA 2XMBA 5CM9C 1J00A 6CHYA 4EG5A 1ULSA 1EGQA 5B1BC 4KPFC 1GDDA 4QO8A 2QRVA 3FPSA 1JKIA 3A27A 3KYCB 3OQHA 3YASA 1L4HA 1PEKE 1EX6A 1NUHA 3FGOA 3R5FA 1XDDA 2VCEA 4I5FA 4LQCA 3RJ9A 1MO2A 2NTVA 1T9KA 3KJKA 2X6RA 3WSTA 9ATCA 3QNMA 2BGUA 2GCOB 2UZHA 1S9HA 4GZ3A 4FIZA 3S81A 1NZDA 1DZIA 5ICSA 3F8SA 2VBGA 2X2FA 3ZD9A 4DJAA 3ENZA 2X9LA 2IPOA 4XASA 4KNYA 1E3TA 2I4LA 3B9PA 1FTNA 2YCBA 2GK6A 4YP0A 1IM5A 1N6PA 3KJJA 2OCGA 2X3UA 3G85A 3K0FA 5TV2A 3UFXB 2EIHA 2D5LA 5DNDA 3UK7A 4MS1B 2P65A 3M6XA 2LBXA 5KIAA 1F9AA 5KINB 2IS6A 1JEAA 4YVFA 3GQVA 1HG0A 2I9KA 1MQSA 1HNWO 3F6MA 3W1WA 2YH2A 4GZLA 4BO6A 3HK2A 4QPJA 4JYAB 1BOOA 2PMBA 4E5NA 4XVHA 4GLBA 4D9NA 1M0WA 1W35A 2XQFA 2FUG1 4B3HA 3D7LA 5DX1A 4Z2YA 2NPFA 4AI8A 2HO5A 2GEBA 1H2XA 1ISJA 1NLYA 1NVPD 1XMPA 4LZZA 4Q03A 4UUQA 5ADWA 2OQ2A 3FFBA 3O8LA 1L2TA 4XVQA 3N7TA 1ZSNA 1AGXA 4TZ6A 2QJ1A 2RGWA 2ZDIA 4I0XB 4MNTA 2FSPA 1YI0A 2Y1EA 1E89A 3U44A 4JX8A 1H6AA 1G63A 4TS9A 3WQSB 3O03A 2JJ2A 3PI6A 3CEIA 1O97C 2Q0XA 4HWTA 4GYYA 3T7IA 3WKDA 3FB6C 2QYSA 1XXLA 1XZFA 3ABZA 4M1QA 2VHJA 3CRMA 2V7VA 5EZYB 1SCUA 3AUYA 3G8DA 4J1SA 4TYMA 1ESMA 1XRJA 3E3NA 3K9WA 1CZKA 4JL5A 2K4MA 3U26A 3WLFA 1BMFA 4BCCA 2Q21A 4D74A 1A88A 5E4FA 4O4HA 2BMFA 4LF7O 3B89A 1I14A 2BGNA 3GA5A 4LXIA 4JNKA 1Y3BE 1EUQA 4XRGA 3SF0A 3NALA 1R1DA 4XBFA 3OLYA 1WR8A 2HQSC 3C5CA 1RI2A 1GKKA 4AB1A 3ND8A 6NULA 4MO9A 4TX1A 2HG5C 3G2JA 2IP1A 3QXSA 2Y4NA 1C3XA 2D0PB 2GD0A 3VTZA 4EL0A 1CE8A 5KYYA 1N2EA 4NOLA 2XAJA 1ZISA 3OX1A 4Q4LA 3WP1B 1PNRA 4F8YA 1YDWA 1OLSB 3OZWA 3HYRA 3NEPX 1FP6A 3V48A 3W06A 1Y9EA 1QLEC 2C1ZA 3I1JA 1CYEA 1E3WA 4QWWA 1XQ1A 4HHEA 1PWHA 2P90A 4JXKA 2F7SA 2ASEA 3HVKA 2WJAA 3QW2A 5EKSA 4J3NA 3MAGA 3KE8A 4PCVA 4Y9DA 1CULC 1U9YA 1XN4A 3AUUA 4M9RA 2P6UA 4LFAB 4IX9A 2B99A 4JBHA 1NGSA 2C4MA 1UPBA 2J30A 2JF0A 2MWMA 3SVZA 3ZI4A 3OC0A 1K4MA 2EW1A 3A2MA 4E22A 5IM4F 4MWBA 4MI1A 4R05A 1OGYA 4IJ6A 3HI6A 4IIBA 1JG2A 3UKOA 3VPCA 4ZMBA 2GTSA 1S7CA 2C2ZA 3IILA 5IPFA 2CF6A 2GXUA 1ZD2P 4R0MA 3KBBA 5G1OA 4L27A 3SDBA 4YBZA 4MIYA 3PIIA 1PHRA 4LC1A 4I9UA 2PU7A 2A0LA 4ZIRB 4YPOA 2EZTA 1SN7A 1WP8A 2AEEA 3FDZB 3OZEA 3N2KA 1ZVVA 3SC2A 4TQDA 1FLDA 4BFYA 4HI0E 3MNFA 4GZRB 1XP8A 3ESZA 1GLNA 4FYMA 2WOJA 4BTEA 1DS6A 2AW5A 2BLLA 2QGFA 3OM1A 1R6KA 4FNMA 1X52A 4FMTA 1J8FA 1KS2A 2B83A 3RU9A 1L4LA 2Y05A 3L73H 4ZVPA 5IH3A 4FFLA 3ZS8A 4AMBA 4BHTA 2A5DA 4BY9E 2P0YA 3PUVA 3RUCA 2H1SA 4LBWA 4CUJA 4WWHA 4YQEA 1ULTA 1PXWA 3IT0A 4JC5A 2IITA 3LCUA 2YS7A 1OMOA 1RHMA 4HB2A 4L7VA 3E3MA 3HXMA 3K0DA 1I4TD 4J76A 1P17A 3ZBHA 3JVDA 1NE2A 4IV0A 4YEDA 3CVUA 3VJKA 2CLIB 5EUQB 3SZ3A 4DR3O 2Q67A 1USVA 3R1IA 5G4KB 2GXAA 1H3NA 3PR1A 4YAFA 3Q3EA 1AP5A 2R8YA 1NXQA 1P1JA 4GOMD 2XUHA 1GQSA 3EODA 1QLEB 1DJMA 5A1TA 1ZKDA 1VQ5V 3Q7PA 4R0NA 5C8ZA 4IUDS 2XB4A 2Q0OC 3MW8A 4PTYA 3KG2A 3R76A 2RB5A 1FP1D 4J4BA 2HMWA 4IJ5A 3SYQA 4CIYA 3ULKA 1ZKMA 3RANA 3FJOA 4JAUA 5BRNA 3CRNA 3VOTA 4CVNA 1XYVA 4PDRA 1L0NH 4RHAA 3NTRA 4HD8A 1AJQA 4YWHA 1PKXA 1NJSA 5KTRA 1YJXA 4BFTA 1BD4A 1E9DA 3AJ8A 4MPRA 5AI4A 5JQGB 1GN2A 5KX5B 1QLHA 3B5JA 3JQ7A 4I3HA 5H2FZ 4DCJA 1U5AA 3JTMA 1G6UA 2IUUA 1HUQA 1OX6A 5LXTA 1ADCA 2PMKA 3KHKA 3CUTA 4ZAZA 5G02A 4F3TA 2NOAA 4DA8A 5TQVA 3I04M 4LDJA 5HGXA 4Q7QA 1U2RA 2V98A 4W5JA 1YB6A 1IXRC 3DMYA 3GNQA 3IVGA 1DTWB 3GRCA 4HUJA 4FZRA 1IQPA 4UMVA 5FBLB 2BW0A 1TZKA 3DOCA 5EHZA 3VI6A 1H23A 1QPGA 1HEIA 1Z0AA 1KK1A 1U9CA 4XE5A 3IC7A 3N0VA 2WUGA 4JZKA 3V4SA 3AJRA 2XNDG 3F5FA 2G0NA 1BYIA 3DT9A 5DEDA 3W79A 3SMVA 3ZRWA 4FYYA 2C95A 4XIGS 5DYNA 1H3FA 4B7ZA 3CPWF 1SXGA 1DJQA 1N7IA 1JJBA 2HAEA 1IBLB 2G9UA 4DV2O 4TWKA 5CA3A 5FPQA 3CWQA 1X39A 1DAEA 4NYKA 2UUOA 3VNRA 3WGZA 2XUPA 1W4BA 1F60A 4K88A 4MKRA 4N12A 4PHCA 4BN4A 3NG1A 3R0PA 3OZIA 3ZI7A 4A10A 4CFSA 3SR4A 3CCSF 1XTSA 4RK0A 1ZXLA 1NMSA 2CLSA 2CHUA 1MNQA 3N39C 4KL8S 2DWQA 1T4DA 1BO6A 1INLA 3C7TA 1VHJA 1HT0A 1ONSA 3CLKA 3KEOA 3DT6A 2WA3A 3LVBA 4JGGA 5KHLB 3VDXA 5CBGA 2EKQA 3A6JA 5IT0A 4J0KA 4LDQA 2OVFA 3JYHA 3UCSC 2ZBUA 1BXZA 2PMFA 3LUDA 1WPGA 4N0EA 2CHSA 6PFKA 2IS1A 3L1UA 3E20B 3K9QO 1FNNA 1VLJA 2NO4A 1Z6TA 3H3FA 1AQ6A 2B36A 1DO0A 1YS9A 1KC8H 4KOAA 4PFKA 3U3KA 1KU9A 1WMAA 2WF7A 2VO1A 1H2EA 4QOGA 2OO5C 2BHRA 3HB4X 1J5PA 2OT5A 1DBIA 5HBGA 1YDMA 1MX9A 3QSGA 4CHTA 2VUTA 5EL0A 2JD1A 2ZAIA 2TECE 1BN6A 4HTFA 5LWHA 1XYYA 4PAMA 4FU0A 4DY4A 1GYQA 1RDFA 4RVSA 4TM7A 3NP9A 5I5GA 5FV4A 1LBTA 2QMQA 4WW0A 3ANYB 4KFRA 4LV6A 3NVKE 1JBKA 1RYHA 1DWQA 3MTEA 3KQQA 1WSDA 2O1EA 5IK2A 2YWJA 4O2BA 1C4WA 4X3LA 1TADA 2CYAA 2RARA 1TCVA 3GELA 4RK6A 5FUVA 2QT1A 2VQFB 3KJQA 3NGMA 4PX9A 1RZ3A 4HFRA 4WFIA 4E07A 5BW8A 4ZI7A 1B8OA 2EEPA 5FNVF 2F55A 2MYTA 5L3DA 5T8KA 5L3EA 4H77A 4MV5A 4X00A 4WY2A 2YEVA 3RYFA 5JMWA 2OAP1 4Y18A 5HDBB 2JL1A 5HFMA 4YIOA 3G0DA 3GJZA 2GEKA 4ESHA 4P31A 3FNFA 1Y6FA 5FQOA 2R2GA 3LQRA 1D2GA 1XWIA 3LHKA 3U3XA 2WLIB 5ITWA 1A9ZA 4MDEA 5CLJA 5IFKA 4Q05A 4NJMB 4TUYB 1HZZA 1RLOA 2ZTMA 3R5HA 4JUBA 3S27A 1JAXA 4P38A 1L4MA 5FOXA 4EG4A 1BH6A 3JD3A 1Y5RA 3ZE6A 3RS9A 1KJZA 4JR2A 2MSNA 1NJ2A 1P3Y1 5KYWA 3RJZA 3Q3GE 3GUZA 4LGYA 3U4CA 5JATA 5JNUA 2VWPA 3G9QA 2HTFA 3CR8A 3HPQA 4RD4A 2FMIA 2OYRA 3WGVA 1CKEA 1PVDA 3IKMB 2KPOA 4PLPA 5DBHX 4L2IB 1OH8A 2F43B 1U4NA 3IKJA 5EBMC 2WJJA 1NF8A 1DF5A 1CF2O 4L5AA 2FFAA 4IBOA 4EKNB 1T35A 2X41A 2ZUUA 1ZVMA 3JY6A 3PK0A 4IFIA 4JEIA 1YNSA 2Q5CA 2UVPB 3GCDA 4R98A 2GCNA 4U7NA 4X1OA 2XGJA 3HADA 1H3EA 1HETA 4CQMB 3J7AU 3OMAB 1CP3A 3DQQA 3HEAA 1ENYA 2WYIA 1VEWA 4UCVA 4JP5A 3P71T 3SZMA 4EKEA 2AOTB 3U1TA 2GSWA 4GKJB 1YFJA 4KX5A 4C5BA 1I1HA 3C7CB 4G8CA 2O5EA 5FIUA 3DV2A 3BSWA 3AEUB 5CFMA 3K06A 4YAEA 3N70A 5B1OA 3ZWCA 5L6LB 2RI6A 1JIVA 3NX4A 3HEBA 4H7HA 1H5QA 1U1DA 2RGEA 3QTCA 3QENA 1JJ2F 4NS4A 1O2DA 4Z8YA 1U98A 5EPOA 3VU3A 1D07A 4XM2A 4C7MA 1A8PA 4RSHA 4CF3A 4PLFA 4F2WA 1M5IA 1JXOA 1COWD 1UC5B 3HCDA 5FRDA 2K5UA 3I4CA 3IB3A 1VF7A 1BJKA 2NVOA 4I8IA 4X8OA 5SZJA 2BFDB 2CD9A 3WYFA 3G2PA 1FXKA 1LPBB 4HNTA 1UC9A 1D9ZA 3DHYA 3QWBA 2ZANA 1SBHA 4XI9A 2KGWA 3M9WA 2WSBA 4WF9V 2W37A 4PINA 2VP2A 2H1OA 2ZPTX 3Q9SA 4RHYA 3OVMA 1EK6A 1JQEA 3OE7G 3NEJA 3HXQA 4JP2A 5EO3A 4M1ZA 4WK6A 2M6SA 4UCOA 2ZAUA 4ALIA 3GPDG 1MJHA 4UJ3A 2DR2A 2WLMA 2G5PA 1I3KA 4X9XA 4RIHA 2C4HA 2E49A 1M2OB 3ON5A 1L4YA 1ZC3A 1F0PA 1LPPA 5A5EA 3PGLA 3TJTA 2NTNA 4ZKDA 4K9NA 3FNBA 1JKJB 4Q47A 4ALKA 3R24A 3H1IH 3NONA 4J0DA 621PA 3T5AA 3CSXA 2P78A 1A5ZA 3T2MA 2AMVA 3OEHD 4YRTA 3UENA 5A5DA 2RJNA 4K05A 2G38A 1OZGA 3ADOA 5CBPB 2G4LA 3FF1A 1HW7A 2G76A 2IW1A 4WBXC 1LVGA 3GCGA 2R6CA 4FEGA 5A7FA 3F4KA 4OJNA 2VSNA 2CH7B 1ZOSA 2ZE5A 2ZRCA 1IYZA 2JFYA 3CG4A 2FG7C 4HNQA 4QO7A 4XGIA 3USES 3AYZB 1PEAA 1CTQA 3WL8A 3WL5A 2YQ4A 3IPRA 3E4DA 1SC1A 1OVMA 3QBDA 2LZ0A 2Y0BA 3IKVA 1M57B 4N76A 1N3BA 2XF8A 3VPDA 4LSGA 2Q62A 2OG1A 3QPBA 3V2IA 1O94D 1W30A 2IP2A 2XWQA 1WRBA 2OXRA 1I4EB 4FUQA 4O25A 3U6BA 1P5RA 4UVGA 4MLPA 3OF3A 1FPMA 4ISCA 4DCMA 5F9HA 3AEIA 5IH7A 3RHTA 1UAAA 1X8LA 3TQIA 1RXIA 3OONA 3D2LA 5IAAA 4QASA 4IHAA 5JC8A 2XVXA 4QJ4A 4CU5A 1BDBA 4LF4B 4PCUA 1Y8QA 2YV4A 3UB4A 3KYDA 2ZUFA 1W8DA 3GB9A 3NBXX 3NWOA 3I5AA 1SZPA 1AJEA 1CJTC 1MZFA 1DDOA 1P7VA 2BVNA 4LXGA 5CK4A 5IVDA 3ADBA 4UVAA 3MJDA 2M32A 2GKGA 2JS7A 2I8LA 4UMEA 1IH8A 1PD0A 3A2FA 1NHWA 1RRFA 3MTIA 4PSKA 1GTJ1 4FN5A 3IA2A 2EV9A 4QG3A 2BKAA 4HVTA 4RE6A 1CUDA 2ZVPX 4KO4S 2OYCA 5ESXA 3VYTC 4ZU1X 3JQ8A 5DHQA 3T1CA 3WZ2A 1GP2A 3KC2A 4I2VA 3AJDA 2UZIR 4UVDA 3RRFA 4DUPA 1WB6A 3KVNA 1KY4A 1GZUA 3RW0A 1YIOA 3N0RA 4H6VA 2QE7D 4LWQA 2CVPA 4YP9A 4DLSA 4EKDA 2CMFA 4O29A 1QF6A 2CLCX 3GVHA 3DXFA 4RY9A 3I32A 3T9BA 3L43A 1CZRA 1Z3CA 5KOYA 3OCXA 3JYNA 4MVJE 4YJGA 1Q16A 2VSOA 4LDRA 5CTAA 2XB8A 1V9PA 4ZQFA 3BXZA 2EFGA 4X65O 5EXDA 4UVBA 1PR9A 1IEQA 3TMYA 2MW2B 2E37A 1OCZB 5YASA 4G0ZA 2FNAA 1UK6A 2NO6A 4IZHA 5KVAA 1R64A 5LQNA 4KIFA 4KXFB 4C7JA 5C93A 2IELA 1CFJA 1SG6A 2P41A 3Q1KA 3QPCA 3QKWA 4V0NA 4OUKX 2B94A 1JQBA 2Z8YM 3OG9A 4V0KA 1THMA 1UCFA 3HACA 4OLJA 1NWHA 4D8UA 3KE1A 2ZSHA 1MMMA 4D7SA 4XR4A 1JHOA 1WP7A 2EAUA 2Q8VA 3ZHBA 2PV7A 1VIBA 1M1XB 4M86A 2REQB 3MUNA 1AKMA 3ZPXA 1NUSA 4CH4A 1E2IA 3EYAA 1YS4A 3OQOA 3T95A 1JFLA 2ZT9B 1R8XA 3W5HA 5L7TA 3ONEA 3ZMUA 2WJHA 4ZANA 2W42A 3UW3A 4UASA 1ZZGA 1WNTA 2UXXA 2QRMA 3WGKA 2Y9PB 4QC2A 4H6XA 4PQFA 1RM0A 4JU8A 5CDHA 3GRFA 4M0FA 4YA6A 1I94B 2C2MA 4OQFA 5DOZA 4QREA 1NH2B 3U9SA 3QVSA 4S24A 4V24A 5KYXA 1JG3A 2YW2A 1L5RA 1LPOA 3L0CA 4M83A 1NRIA 5I9MA 3CQ9A 1T5SA 3IIEA 2YIAA 3UVEA 1AUQA 1HPLA 2XAUA 2X0NA 3UZUA 5CCBA 1MC5A 4I36A 1SCBA 5K9ZA 4ZYLA 1X87A 2YBDA 3TCKA 4B9AA 2HP0A 1XNQB 1RQXA 1IXSB 2HK9A 3OOYA 2FMLA 2XD9A 4G2KA 1XJCA 2VPTA 4LNUB 2YYAA 2ATXA 1HT3A 3AVPA 2C5AA 1FYVA 2PMCA 3DDHA 3QU2A 2FPSA 3Q2KA 4MRVA 1UDXA 1H2NA 3WQRA 2YASA 1UXKA 2I2FA 4M8LA 3LGSA 5HTKA 5LA6F 4DLTA 3U9TA 5CYGA 1HE8B 4KUGA 2QNIA 4RESA 1TU4A 3KQUA 1FQOA 3ZD8A 1U2GC 2NZXA 2C5HA 1E7WA 2OGUA 3TBHA 4EJMA 2VRWA 4HL6A 3CURA 2GTPA 4FLYA 3INTA 3ER6A 2REBA 4U8HA 2WUEA 2FH5B 4W5RA 3PUKA 1N2XA 4ZVNA 2X1MA 1QVFF 1P81A 2BBTA 1VF5B 1DT9A 4FE4A 1KQGA 4DLRA 1QFJA 4PZZA 4NDAA 4DXAA 2C2OA 1U2QA 1GDTA 3LBHA 5LXTB 2OORA 3ICCA 3LUGA 4QYIA 2HBYA 1H2MA 2XGGA 3GXOA 5K2OA 3C43A 3SSAA 1QHYA 1P4RA 3KSRA 2L35A 3NBFA 1KQOA 1VE6A 4H4DA 3RF7A 4JB3A 5GGXA 1N78A 3H1AA 1Q95A 3GMSA 3INRA 1FTSA 1NXXA 3EW7A 4OGFA 1R6XA 2VF4X 3AR5A 2L2QA 2ZDQA 1YI2V 5L3SA 2Q5OA 1DQZA 1VG0B 2CNDA 3C4QA 3IT1A 1UBRS 3AGQA 4U8GA 1CG6A 1T8WA 1IG0A 2AZDA 1MT3A 3HE3A 3N8GA 4MUXA 2ZRBA 1M2VB 4AZ3B 5CXXA 1R16A 4PO8A 3OFND 5IXJA 1QG6A 4HB4A 3VC2A 1Y89A 1A76A 1GPUA 2XE6A 2QX4A 1IAVA 5AWFC 1EIWA 5L53A 4WKOA 2F43G 1OX5A 2ZULA 1QV6A 1K9MH 1XWFA 2XE8A 5EC8A 3SEFA 2B34A 4DDKA 1T5TA 1KTVA 5CLFA 2WE8A 2J1LA 4FINA 2FFJA 4KLZA 3R8XA 2EW8A 2BSQA 4OHFA 2I62A 4XIJA 5HCNA 1JFRA 3Q0IA 4EI8A 4L8GA 3ZV5A 1PJRA 4KQ9A 1XRPA 3TKYA 4AJLA 3BMXA 4P5PA 4BFSA 3OPXA 4UPDA 1Y6QA 4V3CA 1NJ8A 3OTGA 2CDNA 2E21A 3DZCA 4HSGA 4MYTA 4M53A 4WK2B 1K8AW 5E6UA 3AERA 1NVEA 1TEZA 5JH7F 2I6XA 4MARA 1T4CB 2JZOA 1R5BA 2XYQA 3DOHA 2NP6A 3WTBA 1MXHA 2Q4RA 2GVDC 3TD5A 3TBFA 1U3FA 2D3WA 3G2OA 1L5HA 1D0SA 2R9AA 3IURA 3U31A 2UU9B 1WVGA 3MBIA 3NHKA 2DWPA 3B1VA 3O8NA 5IUKC 4AICA 2JG3A 1OPXA 1CS0A 4WFBV 3O21A 1K66A 4KJZA 1GNTA 1V8FA 4G5OA 4WCEV 3E15A 3QTLA 4NU8X 5JPCA 4AMVA 2V7UA 2WSSA 4MWGA 4RF5A 3ZWWA 5IX8A 3DS8A 4YJFA 4XVUA 2F9LA 2HMVA 2EIXA 4JP3A 5EVCA 4V0LA 2R84A 5K09A 1DKOA 2Z5VA 5KSPA 4W9MC 5FPTA 2XHEA 2OECA 4HPXB 4RVHA 2R00A 5JCOC 5BT8A 6Q21A 3UJPA 1S5HC 3QO5A 1E60A 3F2IA 2OM2A 1K68A 2H8CA 4J0QA 4AUEA 1FZQA 4IPTA 2UUBB 3OQ6A 4CIXA 1RJDA 3ZNOA 2YV5A 1U7XA 4KHPB 1MPXA 4D3DA 2FW1A 1GG8A 4V2IA 4YO8A 4Z9AA 3PJGA 4I7ZB 1OWOA 2JJ2G 2H94A 2X42A 2J5RA 4N7MA 3SHOA 2C9YA 3I05A 3NIDB 1QPBA 3OP4A 3PTLA 4B87A 1COWG 4IYRA 4M8NE 1H0HA 1AN9A 2IXDA 4F04A 2LFSA 1XTRA 3RIHA 2H8PC 4JKIA 4HUQA 5G1PA 1SF9A 1O6ZA 3Q41A 2VHWA 1MMFB 3C24A 5HY0A 4KUHA 2YXHA 3SQOA 3U61B 3NPAA 1X86B 2VAWA 3L1HA 1ZBDA 3PGXA 4KO1S 3DAFA 5TGDA 3VKVA 4EMTA 1WP9A 3JASB 1YDXA 4OPHA 1CS4C 1ZSYA 1NH2D 1RABA 2J09A 2ZI4A 3ABKC 3C6KA 4R8LA 2ICAA 3Q5DA 1QKKA 5LZ9A 2Z9BA 1MXFA 1ISSA 2PWAA 2MINB 1PZEA 2Z2XA 3PDCA 4P7KA 3KTOA 2WSSG 2D7JA 3VM6A 1VJDA 2QROA 2CNOA 5GZ1A 3ZG6A 2PGOA 3QFCA 2E6KA 2BFBA 2ZTUA 1U1GA 3NVDA 4KQKA 4FVMA 3GJ4A 2WQ6A 2VPIA 1OB5A 1IRXA 2ZR7A 5FWDA 2RAPA 4AP9A 1CUCA 2RGAA 3FYTA 3GY0A 1HDRA 4CMKA 2I6TA 1XRNA 3IQWA 3N59A 4ZHQB 2R8EA 1NVVQ 1JIUA 2GPYA 4W7SA 5TF4A 3GT3A 2J0QA 4M0DA 1HYHA 2BAGA 1LNZA 2ZCEA 2G72A 3IIMA 3SKVA 1XKTA 4BMSA 1L3IA 3E70C 5A3SA 2XIJA 3AUTA 3STTA 5JJJB 3FZEA 6AT1A 2D4HA 2IQIA 4YP6A 4AIIA 2PQ0A 4J16A 3JS5A 1IUNA 1R1MA 2AOXA 4V0MA 4DL9A 2H8GA 2HIGA 5FADA 2ZJ5A 3OOJA 2JIZA 5C4GB 1COMA 3DONA 2UVPA 1O6CA 1XZ8A 4IH1A 4YRMA 4JEHA 3B12A 1AUPA 1GSHA 2ZAGA 4QE3A 2NZWA 2Q3BA 4ZT6A 3U4DA 3EA5A 4DG8A 4DMKA 2DW4A 4K87A 5BSEA 5FUMA 2D2EA 1GM9A 1SESA 2P9GA 1O03A 5KO2A 3NYWA 1HDGO 2PZ8A 3W5BA 3O8OA 4MHTA 3KKKA 3KBOA 3TSZA 3EDCA 5EZ5A 4LV5B 4MVJI 3ETQA 1RM4A 2YYSA 5H4HA 2GZ2A 5TIIA 2O2XA 4YV0A 5BNIA 5LU8A 3WBFA 1KD1H 3VSAA 4HXGA 3B51X 1HXHA 3RYHB 1CEXA 2GCOA 2OC4A 1XI1A 1Y42X 2W83A 3AHDA 4MVUA 4MEAA 4MJXA 4WN9B 5AVOA 5LQCA 2P67A 1GZVA 1IEWA 1ZGJA 3K03A 1IY0A 1ST2A 4H3SA 4IOJA 4PSDA 2GUGA 5E7IA 5F9MA 4GXRA 4ZD6A 1YJWV 2C4NA 3T94A 4KAAA 3GNSA 2KM1A 3AG4B 3KLPX 4DJTA 1PQPA 4U7FA 1HDEA 3F67A 3G49A 1ZM4A 1LA2A 3X43A 4G1BA 4B4DA 1JJIA 5IYCO 1TYCA 1TMYA 1G1XB 2OIEA 3E2PA 3EA0A 4MVJG 5U4QA 3RODA 1VYUA 2WJ6A 1AILA 5GIOC 4GSYA 1O57A 4X0EA 5TGZA 2VP0A 1U65A 2GRJA 3FPBA 3I5XA 3S3WA 4N5NA 1O77A 5HZKA 4WEQA 4XCXA 3OSZA 1BZYA 3IVCA 2VAXA 3DE1X 4OCZA 4AN1A 1QTRA 2BFFB 1V2HE 4IIJF 4N7RA 4K9RA 1EK5A 1X2BA 5KYWB 2YSUB 4NUTA 1VIYA 1XTBA 2XUDA 3AB3A 3DEIA 2R60A 4HSEA 4CGZA 3F2VA 5B66Z 5LZ5A 5ALPA 1SRRA 1PG2A 1QR9A 2Z30A 2X3FA 5KS2A 3NYQA 1GU0A 1L5SA 3DMHA 1D6NA 3H42B 3IEIA 4TZKA 1GGMA 3ZYCA 5TPWA 4EG1A 1GO3F 2JAXA 5KWIA 1VQ4V 4LRQA 2GV9A 3BBPA 3SG0A 3UB2A 3BB1A 3DGEA 4AY2A 3CYPB 1VDMA 2BELA 1ZL0A 2HY7A 5CFZA 1JEOA 5FQNA 3RS5A 1M9NA 2BM9A 1SC6A 2P7IA 4P83A 2VAPA 3RG2A 2OY0A 2X40A 1VGQA 1F4LA 1GGKA 2J5KA 4DIUA 2H31A 1J2TA 2Z2JA 4KVZA 2FUG6 5JO0A 3O91A 5A1JA 4U7HA 2HX1A 2F9ZC 2FEMA 1WZCA 2PR2A 4P3XA 1YU6A 3JQ9C 1SC5B 2CBXA 3V8NA 2OSBA 3GU3A 4JV5B 2JGDA 16PKA 2WPDD 2Y1WA 2ZXWC 4JGBA 4L0DA 4Q3LA 4C0XA 1NU1H 5IBCA 3CRVA 3O93A 4B6PA 4NTZA 5E8JA 1B4DA 1RZRD 4EHDA 5C35A 2ENWA 1HG1A 2PGLA 1U3LA 4CLHA 1I0ZA 3I6ZA 4BPRA 3B5EA 1Y1TA 3C6QA 1T2UA 4FPPA 1RSZA 4QOFA 1M7HA 4I3FA 3M1AA 4PR0A 4FFKA 4QDXA 4CLOA 3A1DA 4ZYWA 4M8KA 2NT4A 3TX2A 2GGSA 2VDJA 4AMUA 4F12A 4EKYA 3SXUB 3DQPA 4NFLA 4GGOA 2ZUDA 4ER0A 1PO7A 1F7YA 3OJXA 4XQ9A 4BNFA 5SV2A 4KR9A 3NBAA 5ALYA 5A9SA 2ABWA 2DPLA 2QE7A 2VPYA 2B3DA 2OAQ1 4K9OA 3L8HA 2P22C 1LPMA 1TJ3A 2KBEA 1T25A 3DBLA 3PDIA 2D5BA 5HZMA 3NLLA 4LHEA 1P0FA 4J8PA 5DGXA 3CW9A 1KMCA 1C4XA 1WCV1 3LAWA 3JQFA 3L9XA 4D6TH 1Q84A 5ECDA 3GX1A 1KPGA 4I55A 3NCTA 1Y7LA 2YJNA 4OOEA 3DE0X 3QI7A 3ZU3A 4BNIA 4TYNA 3GZNB 4LDNA 4UEJA 4ZP1A 2Q2NA 5IC5A 4JKOA 5BXYA 2IZ5A 5JCZA 3U09A 2YXBA 3I64A 2HQ1A 3FUWA 3W4JA 4DDHA 1F23A 2AMTA 4J0IA 1NFFA 1BVUA 4N39A 4BRSA 5C9ZA 3MJ4A 1TM2A 4FCTA 5ED0A 3WGYA 1CXZB 2G6BA 3NNDA 4WK4B 5TRTA 3TDKA 3CSSA 4ITVA 1T2AA 1V71A 3W05A 3UO3A 2L19A 4OK5A 3H75A 3KOOA 3S1AB 3SFZA 5C2JB 1E98A 2FWBA 1MTZA 2QK4A 5CFQA 4HRXA 1TZMA 3ABMC 1SQ6A 3PUJA 4M38A 3TXXA 5BXZA 1MBZA 4NXNO 2GESA 3R7BA 4NVPA 2FWMX 4HNAA 4N0QA 3AX6A 1KMMA 4KQMA 2A0XA 1N8RW 1KJ9A 1NBME 1T9BA 2Z09A 4QXAA 5CG2A 2D1QA 4A6DA 1AZLA 4GCZA 3MHHC 1LCIA 2Z4RA 4OIFA 1USIA 2CT8A 1Y7IA 5B3JA 5CDSA 1TDJA 4DMMA 5A5FA 1RYDA 3T15A 3EBOA 4WOPA 1NN1A 3G2MA 1SD1A 1ZD4A 4S04A 3OQBA 2ECKA 2FG6C 2QTCA 3I8XA 4P5EA 2XF2A 2ERCA 5G40A 4D42A 4DCOA 4MROA 3KKOA 1VG8A 2H5EA 1ECFA 1O5IA 4MWTA 4LNAA 1RYFA 1RZUA 1ZAKA 1FVXA 2J0UA 2QM4A 3EISA 3OCUA 4Q7EA 4UM9D 2WDPA 3GFVA 4BNDA 2HF9A 5LQDA 4RMHA 2R5WA 1MAHA 2MT9A 4XYEA 1CB7A 1DIGA 2QD3A 3LNCA 4JOCA 1T3SA 3AOGA 5CGQB 1BSMA 2YCLA 2Q41A 1PLKA 3S2SA 5JSUA 4XR9A 2W2LA 1BKYA 4TLEA 5ERXA 1ZS9A 3P9YA 1MJNA 4Q7MB 1K63A 2H18A 1DPGA 5AVRA 1Z15A 4KRGA 5B2ZA 4BKOA 5FL7G 1S2IA 2P2DA 4B3TB 3TW8A 1DKUA 2V9ZA 3BMOB 2HBRA 3D54D 4RPKA 2ZM6B 2I71A 3BE8A 2QAGA 1I7PA 4JUAA 5TQ0A 5BPHA 3U16A 2LBPA 1DBQA 1SRYA 1C1DB 2Y68A 5LQSA 1R50A 4S35A 1CR6A 1KXJA 1CHDA 2FWJA 1YZKA 3F7NA 3RUEA 3NPMA 1T13A 4BV8A 2AH5A 3WP0A 1XAIA 3L7OA 1ID1A 5EIBD 1PJAA 4ASUD 1J0AA 4YPVA 1TECE 2DQYA 5JBQA 5HSGA 4WRRA 4MCHA 1AHNA 1E0JA 7REQA 3C3MA 2PVCA 5JPDA 2Q1WA 1NIPA 2Q7GA 3E0QA 1D2CA 4TS1A 5EKXA 1U9JA 3TLZA 4FKMA 2GJ9A 1A7KA 1E3EA 2VNJA 4GQAA 4LJ8A 3B8NA 4BMCA 2IH5A 3CCLF 1NLZA 1P4SA 3HSSA 2HU8A 1EVJA 3GP5A 2AC4A 4YT8A 1EQAA 2CWWA 4LHZA 1PI3A 3FSGD 2Q46A 2JS3A 2VSYA 3LBFA 2NSHA 1X77A 2WR8A 3A3YA 1A4IA 3N0TA 4ITUA 4KAXA 5KHHA 4F5WA 1JEYB 4OATA 3RW9A 4HS4A 1KQNA 3PVCA 3S55A 1ODSA 1X7ZA 2FC3A 5EIFA 3R3UA 3EWNA 3HDYA 4A1OA 2DHEA 5JNSA 3AK1A 1T15A 3CE9A 4JU9A 3JWPA 4PYRA 1ZRSA 4RHUA 1CUFA 3ZQKA 2HZBA 5AW3A 2QN8A 3GPIA 3O6VA 3H2IA 1NP3A 3HHPA 3QLUA 2W00A 3LX6A 3Q8XB 4PLHA 2JEZA 3PAFA 4A8JA 1HLPA 3TLCA 4MUNA 4Z1MD 1NNEA 1ZL8A 2H5IA 4RK7A 1CUWA 1D2EA 1DUSA 1GM8A 3VTIC 4RLSA 1PP9H 1QHFA 1H4SA 4TMTA 2J6BA 2XYVA 2W0SA 3F7OA 5HQTA 3DLCA 2HNAA 1R6VA 2VK1A 3EMVA 5DHAA 4BT5A 1EK1A 2ITCC 3SDZA 5CFNA 1F2UB 2ZR2A 2XDAA 4LRYA 3VNAA 2H7VA 3ABQB 3ETGA 2PUGA 4LFCB 1YTFD 3E48A 4JXJA 1JLRA 5DCVA 1QQ6A 4MWDA 4UAVA 1HLGA 5CVEA 3S8EA 4UM8B 2ERYA 3EC2A 4Y1RA 2A5JA 5ARCA 1VLZA 2EJ7A 3NXSA 4J0GA 2XADA 5LZ8A 5IT5A 2I2XB 1E5VA 1Y63A 3TH5A 4ECEA 2VJDA 2GPWA 4UM9B 1WUHS 2G67A 3HBLA 2RGUA 1OT5A 1A8SA 3F74A 3A4YA 3IAS6 4HH3C 4MKFA 3AKZA 4OLHA 3AG2C 1J0DA 4YRDA 5CVCA 3W8DA 4Q4AB 2JEXA 1WCWA 1PLLA 1QZZA 1QH1A 1NLMA 1Y5MA 2Q9CA 3IAFA 4OMUA 4XH9B 2VZ8A 2RB9A 2QD1A 4F4HA 4BT4A 4GI1A 1S8NA 3AVTA 1P1CA 3NTOA 3ZP7A 2KQUA 3N5CA 4JI2O 3UG7A 1E1QD 2QTVA 1CLEA 2C0CA 4B2PA 5T4EA 3TSWA 1OU4A 2ZVQX 3RK4A 1X25A 2VRNA 4C0HA 4BEWA 2VYNA 4IHJB 3SPCA 4RKRA 1J4AA 1MLDA 2C8LA 5T64A 3VMFA 2WG0A 4V1CA 4NTXA 3HCCA 1VJGA 3U81A 4MIEA 1KI2A 2WD7B 2V9YA 2FZVA 1NPYA 2CXSA 2FJ0A 1BKSB 1GXSB 1XAJA 4UU1A 3UY4A 3X1MA 1PFUA 3BEDA 4MQ4A 3RV3A 4F9TA 3JQEA 8OHMA 5SY4A 1N2CA 4B2IA 3CTPA 3IVRA 3LRXA 4KXMA 2PXXA 3AJ9A 5DGHA 2QX8A 3PUXA 3TB4A 1ZNYA 1SA0B 2XCLA 4ARUA 3EOAI 3HCWA 2YIMA 4C7OA 2PGGA 1Y5IA 1U5BA 4LQDA 1RHJA 3RC3A 2DY0A 2C4TA 1D8AA 4FILA 4WI1A 4KUEA 3SMQA 3F6BX 1TOAA 2XZTA 4L08A 3W5UA 4ESEA 1Q3HA 4Y2RA 4EZBA 4WZAE 3K4HA 3HC7A 4RHXA 3ZLVA 5D01A 2RH9B 2OCCC 1T8SA 4DRYA 1VPLA 2ZTLA 3VSDA 4KSBA 1EXNA 1P4HA 1WXQA 2HK7A 3EZGA 4K26A 4QBIA 3LC0A 4OBXA 2FUNB 4IIHA 2XBUA 2D2CB 2WQZA 2G5TA 2ZWAA 3IVXA 4XX0A 2Y1XA 3GAFA 2FWNA 4URUR 4YMVA 3M7MX 4UE6A 5I48A 1JEYA 4LH7A 4BATA 4LHXA 3DFKA 2FMUA 4BKMA 1OWLA 2RDMA 1YJNV 3JWEA 1JTEA 1M8GA 2CUZA 1KP3A 1NOJA 4XQGA 3VZRA 4BEBA 5LLDA 3E5NA 1NW8A 1G5RA 2H1VA 1U8TA 3A3PA 3OFVA 4JVLA 1TW2A 3UPDA 1KOGA 1LF5A 1V7QA 3KAQA 3LXRA 3ZN1A 4KAJA 3FHOA 3HL0A 3MIZA 4DEXA 4DLYA 2WAXA 3SXPA 4CCSA 1MOPA 1TPZA 3I01M 3KVVA 1YOVA 1QGOA 1SIWA 1D5WA 3TI7A 1YE5A 3Q72A 5A05A 4JI5B 2YN0A 1JHXA 2QTMA 3I5UA 2LIPA 3B38A 4UCUA 3R3XA 1ZOOA 8MHTA 1YQWA 4PY2A 2BO1A 1TW3A 2A1TR 3AF3A 4RD6A 2EFCB 5C8DA 5KTYA 3BHMA 1FXKB 1JVNA 2O7NA 2W6CX 1MF7A 4FDLA 4BKPA 1A3CA 1G16A 1M90H 3FLAA 4PZ0A 5FI5A 4X8HA 2H17A 3KSMA 2I4IA 4J91A 2IEAA 5L3GA 3PF9A 5DEOA 2WWVD 4BNNA 5LP6F 1VQ7F 2QP3A 3IXMA 4Q1DA 3WLOA 1Z4PX 3DWIA 5IBRA 3PC7A 3HR4A 3M1IA 1C9NA 4GKKB 3NU1A 2BGTA 4JUFA 3GJXC 3V46A 5JCOA 1PL4A 4E5KA 3K6SA 2AD1A 1EWVA 2O0KA 2SECE 3L8DA 3OU2A 3VUEA 2M1ZA 5C5CA 2QNRA 5HEKA 2KB1A 4K8ZA 2HO4A 3R8CA 3SC6A 5ENDA 2W6JG 4FS3A 1Z0DA 3SDSA 2GBCA 3MB8A 3PG5A 4INAA 5LP1A 1CR4A 1GA4A 1GDHA 2C8JA 1EDEA 3DE3X 3QKUA 1UBUS 4GAEA 4IEEA 3WIOA 5IJ0B 3CXHF 4G88A 2XMDA 4UC0A 3NRJA 2QAIA 3CKKA 5KA6A 1U11A 2ZUSA 4FBGA 1Z8NA 4RQUA 1HDYA 2OO7A 4QPKA 1W0JD 1UF9A 4E0BA 4G85A 1RJWA 5TSDA 2ZRPA 3L7BA 4ACBA 5DHTA 4QM7A 3ERNA 1JAHA 1YZQA 3ETCA 3T4PA 1SVWA 2HJSA 2CLFB 1E2MA 1G18A 2EJCA 2JGMA 2PRYA 2ZJ8A 4G2TA 1Q0SA 2XE7A 3TAHA 1ZGZA 2FFRA 3TRKA 4JC0A 2QZ9A 4PHHA 2B2NA 5KQMA 1EWQA 4C3ZA 2RGRA 3RQSA 2VH5R 3M6FA 1OCOC 4IKPA 3E8FA 2H7YA 3BIWA 3LY5A 5CLQA 4EABA 1XZHA 3RVPA 4C89A 4UTRA 4AMYA 1E1QA 1VMEA 3IAUA 1WB9A 2IYNA 4TSFD 3PRKE 1NVUQ 3G9UA 2R6GA 3C5WP 9LDBA 1QMGA 1Y9AA 1PUXA 1JP7A 4CMJA 5KQRA 5AR1A 3VR6D 1I7SB 1NPTO 3FUXA 4XD7A 4M2LA 2NADA 5BUQA 1T9GS 3TFQA 1OH5A 2AXQA 4YJ2F 5HKOA 1KKLA 4DYLA 3MELA 1KMNA 3PNPA 4I5DA 5ENZA 2K7ZA 5JXGA 3P5SA 4A36A 3CEJA 3VYTB 3TIFA 3NDPA 3CM0A 3OKCA 4MUGA 1XUQA 2F6RA 1OW3B 3F73A 2QTSA 2YXZA 5CP8A 1P9LA 2J45A 3D1JA 3H1BA 3RIXA 4E4YA 5B3JC 2E5WA 3B3FA 5IEBA 3RASA 1XNJA 1O9HA 3V7WA 2LRHA 4JOSA 4A0SA 2XZOA 1ZR4A 1XZGA 5HRCA 3FB5C 1Q0HA 3DXXA 1RI1A 2A9VA 1JU3A 3IMCA 3T5BA 3V1NA 1XQYA 2JFOA 3IUBA 3MCUA 3TMAA 2DERA 2XCTB 4MV1A 2BRUC 4RGBA 2CFRA 2H1WA 3JCMM 1XMJA 5BWMA 3P3PA 3SVLA 1HK7A 1FTWA 4E11A 3W90A 4QEKA 1DAFA 3E9ZA 4K03A 4OMFG 1T0AA 1QAOA 1P4JA 3C6BA 3LX4A 4RGYA 1IQ0A 4DNOA 4KBYA 2AKAB 5K4GA 3PYMA 1KYXA 1VFNA 1QAQA 5JNRA 4NAUA 2DVMA 4FNAA 1DP4A 3OF5A 3GFTA 3A1CA 3LVFO 4N3CA 5EJ5A 1UK8A 2PV0A 2I54A 2OPBA 3QEAZ 3AFNA 4CEHA 4DMCA 4JT2A 1NVTA 4MWCA 2RJZA 3SGLA 3CT4A 1XTUA 3PHHA 1EX1A 5FLYA 4AI6A 5ALNA 1V5WA 1JBEA 3ZMSA 4MH0R 3RG8A 1M76A 1VJRA 1QONA 1QVRA 1CDOA 3HJTA 2B25A 1XJQA 4RAOA 4EFKA 4MAMA 1IQUA 1OYWA 4EJSC 3KO8A 1KPIA 2ZBEA 1K9MW 3SQXA 4MW3A 1R15A 3C5HA 2R85A 2WILA 1PS0A 2FLKA 4R9RA 1O6GA 4C3OB 4O4LF 2WY2D 3MJCA 4C2AA 1E1QG 3I58A 4A9AA 1NS1A 3A37A 3P2IA 3K0BA 1PF5A 2AWOA 1BFDA 4OEHA 3DUFB 2K1EA 4PQEA 1F9EA 3D3QA 1G6Q1 1WV1A 1P3JA 1EJBA 3FZYA 2Y0DA 1I24A 2XWJI 1U0HC 3MTGA 4KXVA 4MQ6A 1Q91A 4HLUA 3S0JA 4G5FA 4NBWA 1GARA 2UYGA 4FFNA 5TF0A 2HMUA 3EQZA 1FSZA 4QBTA 2CF5A 2YI9A 2OHIA 2AZXA 1NN0A 1NSTA 1BGXT 4IDEA 2IZOA 4N54A 3WQBA 2FMTA 2CLOB 4IFTA 3IJEB 4FD2A 3ZCRA 4Y6SA 4RK1A 3WJRA 2ODNA 4CNQA 4IRXA 3DBVO 4LY3A 3EEFA 3ELBA 3HCNA 3WMWA 4PZUA 4CZZA 4G4YA 1KGSA 2Z5GA 5U1PA 3NHPA 1NVXQ 3TR5A 2QKYA 3D7KA 2IYOA 3F7TA 2REQA 2IYFA 4X45A 4ZU6X 1DHRA 1X0VA 3BRWA 5IT4A 1WZ2A 2CXPA 3ZX5A 5K6RA 1HI9A 1FIUA 3U5TA 1AHPA 1C7ZA 3SZOA 2MTBA 2NO1A 2GJAA 3KTAB 3QVWA 5G0WA 3CLRC 1STOA 5KQPA 1JPVA 2AG1A 2GBLC 4RKYA 1D2HA 3RU2A 1GZ6A 2VNAA 4K6GA 4HDRA 4PIPA 1VP9A 5TJ9A 4DREA 1JR6A 2BMEA 3BMCB 3QYJA 3MCZA 2UUPA 1D1QA 3T5MA 3D3NA 2BJVA 3CSDA 3X1YA 2J3QA 1CDZA 2AOUA 2CTRA 3IHTA 3DCIA 2BZ0A 3GL9A 1V16B 5BVGA 1NXOA 2CUNA 1GJRA 4O0LA 4X60A 1DO8A 1IOVA 4ZOCA 3BM5A 4J94A 4ZEVA 3M1LA 4MP3A 3TLJA 1R3LC 2RI0A 3IOYA 4TLCA 2EJWA 4M8SA 4REQA 4XQ0A 3BYZA 4JVOA 1TF5A 4N3AA 1N9GB 3SBXA 1O5OA 2V4UA 2JEOA 2H8KA 4ZO8A 2GAJA 3EHEA 3I8SA 2QTVB 3KPJA 4UMFA 3VZQA 4AVYA 4KQHA 1JHVA 1NMZA 2GTHA 3T7RA 4GE3A 2FYUH 3QEKA 3EMBA 1I3LA 3EPHA 5AKEA 1IQRA 2Q8QA 1K89A 2BH9A 3VMFB 3E2MA 3EK2A 3VR6A 5L9AA 821PA 1UWVA 4S1PA 3W4KA 2GK4A 1OLUA 1KQFA 3OQNA 1U02A 2PT5A 4FLMA 4RHFA 2G9NA 3M6WA 2D5AA 4DM7A 2PKQP 3L4JA 3M99B 1YZVA 2NXCA 4D99A 1XVLA 4QDOA 3QM1A 5FWXB 3ROGA 3BFRA 4IDNA 4CW7A 1AMUA 4R1PA 5DN6D 4I50A 1Q2XA 4GR4A 1CS0B 4TKVA 3WAGA 2PSEA 1PW5A 1UFOA 4RKWA 3B53X 2JIOA 1PJ3A 4CCYB 4RMJA 5DLDA 3UKDA 1GLVA 2FK7A 1W5TA 1RKXA 1E2GA 3OR7C 5JHHB 3DUWA 5JYEA 4CV1A 1P73A 1Q0RA 3ELUA 5F3WB 1Z4MA 3EXEB 3FUTA 3NAZA 2IWHA 1W93A 1VQKV 1MFZA 1EG2A 1L7OA 2A14A 2J3IA 1A9OA 2IOHA 2NV0A 4G97A 4UTXA 2HXYA 4DXDA 2FOIA 2BKUA 2QUHA 2ZRMA 3J80N 4D9FA 2J59A 5AUPB 3T4EA 2W4MA 4KR3A 2Q3FA 3HCBA 1RJEA 2XUFA 4DQUA 5I7VA 4R84A 4YAOA 2PIAA 2YRWA 4WFHA 1HT2E 1H6BA 1BFKA 3PHGA 1BDHA 3V8EA 3CXUA 2Y69B 3N4ZA 1CQJB 1I7LA 4OX9Y 1ZR2A 4BTVA 1KFJB 3RWMB 3JATB 3VOAA 1U9IC 3UMMA 4EHJA 3GVIA 4V1CI 1SQBH 2IXEA 2WM3A 2WYWA 2YJZA 3C41J 2FWRA 3R9KA 2IX3A 4YS6A 1SKYB 2PEYA 4D43A 2DWCA 2FEXA 1UXJA 4XZ3A 1JAYA 5BW5A 2PUSA 2HSWA 1Q12A 1N2IA 3BS4A 3VHRA 2A59A 1CB0A 1NI8A 1Y76A 3PFBA 4ALNA 5L3BA 2P1ZA 4Y2XA 2QXTA 2ECOA 2ZRFA 1TK2A 2A33A 1PTJA 3O9OA 2IIVA 3CY6A 7ADHA 1I4OA 2OA0A 2PWZA 3OBYA 1NZJA 3B4SA 1UM9A 3G8AA 1T4CA 5E4TA 1G8MA 1W42A 4FSDA 3VFDA 4KDFA 3N8DA 3F96A 2P5OA 3P1JA 3RIYA 4BECA 4JJKA 4HNRA 5ED4A 1ZOIA 3IKLA 4MV6A 4UUJC 4B7AA 1YE3A 3T80A 2WTNA 3FE2A 3B1FA 3KJGA 3CKMA 3I1IA 3WS7A 1S2GA 1V4BA 1VTKA 5DCUA 5JJCA 2JKYA 4Y2JA 4WCFB 2XUMA 1EB9A 1PK8A 1S6YA 2GBFA 2PSJA 5SY6A 1NU8A 1Y4ZA 3KEMA 5JWOA 3WKAA 1AD2A 1GVHA 1BTOA 3VA7A 4D8YA 3JWJA 3COYA 5LQRA 4J80A 4CBVA 2OB2A 3HA7A 3BGIA 3H9EO 3FFAA 2V54A 2VC2B 3A11A 2E5LB 5I7AA 1A9XB 4LUCA 2QVCA 3ZIAG 1F38A 2W58A 3EGDA 3NMUC 2CE7A 5KUMA 4RUEA 2WOOA 3GARA 1XKXA 4JJ7A 5IANA 4A8JB 1OU0A 4CN9A 4KZKA 2P62A 3GWKC 1ZRHA 3E8SA 3B2QA 3L4BA 2AK2A 4Q9AA 4BX2A 2Q29A 4IHQA 4AULA 1PL8A 3CZQA 2BI7A 3RYFB 3HUFA 1HOTA 3OD5A 1FTGA 1JAIA 1QGZA 4ZAGA 3OIUA 1SOVA 2VDOB 3OFKA 2UXCB 2FW7A 3EF0A 1JZQA 4POAA 4V0QA 5F2VO 1SUBA 2DYSC 2GF0A 2BFAA 4PU0A 4CKEB 1J7JA 3WMGA 3H0CA 1Q1AA 4TKVB 2IU3A 2NAPA 3KU4A 5AXAA 1WB8A 2JH3A 3C8DA 5ANRB 3DNMA 3TWOA 3WLMA 2DSNA 4LJ9A 5IHPA 1NT2B 5CT5A 1LPNA 5CITA 3LWRC 1AQJA 1Q7EA 3PD1A 4EX6A 2CSXA 4JQYA 3NWEA 1ZH6A 4DGSA 3AIKA 4NMLA 1GEEA 2HHJA 3HUEA 1P5FA 1YZBA 2ADQB 2FXVA 2O6LA 2O8VA 2PBZA 3D6UA 4BNXA 3EORA 1CBUA 1DAMA 1IB0A 2IEBA 4ZT7A 4YWJA 4S1NA 1B04A 2I6UA 2WZQA 4FLEA 4D9IA 1OA0A 4KVAA 5AVMA 3GZJA 4Q7KA 3NAMA 5FUYA 4E5YA 5JZ9A 2JAPA 4DUZB 1P44A 2LKCA 2DYRC 1LFDB 4GX2A 3GHYA 5JCJD 5NULA 3T9AA 3CMMA 1A2KC 1M1YB 2AJCA 3HCOA 1ZVJA 2Q4TA 2ZI7A 4AKIA 3WYAA 2CK3A 1HRDA 2ZB4A 1JLSA 1GU1A 2PA0A 1ZCFA 4OXQA 3ZWQA 4EO9A 1QO7A 2VJQA 1OKKA 1QNLA 3KV3O 5GY7A 5IBPA 1FLNA 3VPXA 3VZDA 3TGLA 1PW7A 3RTDA 1JFFA 1AGPA 3D8UA 3MMZA 4KWIA 5CM8B 4ER7A 2JGFA 4IVNA 3PEUA 4RGQA 1CU1A 3QXGA 2KI5A 1NVGA 3Q3CA 1PT9A 2PD6A 3JAWB 3A6GA 3I12A 2PAFA 4N9QA 1KO7A 4OBBA 3VPSA 2O7VA 5IAKA 5A9RA 4CLEA 1SZXA 1V25A 3ISJA 5EE9A 2FLWA 3A7EA 3HN6A 5EJ9A 3K4PA 2IHVA 3VRHA 5IZCA 3VOBA 3ZDFA 1D5CA 1FUEA 5LVAA 1L4KA 1JFTA 4MW4A 1EFPA 1V3TA 2BUAA 2CXNA 3S02A 2XDWA 4W9NC 5KHAA 1HNXO 2XCSB 2QMHA 2FA9A 2D1FA 3P7MA 3AJEA 1EAYA 2DULA 4IOKA 5AICA 2ZLBA 3ILHA 1TGOA 3TOXA 2CCGA 4C0KA 2BKXA 1Y5NA 1O0SA 3SJQC 1G41A 1LS1A 3GJ5A 5FOTA 2NV2B 4YGYA 2JDIG 5LB4A 4C01A 3P4EA 4OGWA 2FN9A 2W70A 5JV5A 3R5SA 2VBCA 1EUYA 5A3JA 1M5RA 5MN6A 3CHXA 1OLOA 1QB8A 1T2FA 4AU1A 2CUKA 3D6HA 3ITEA 3N9IA 2AL7A 1OXTA 4LW8A 1P1IA 1V8BA 3WWZA 3NGXA 3IC5A 1GVNB 3V8BA 4EI2A 1MB2A 2F8SA 4GR9A 2UZ3A 4GOKA 3UWDA 2WV7A 3H0EA 4REOA 2B78A 4QDZA 4YO7A 1DPFA 3U4GA 3W3ZB 4YLEA 5LL6P 3QVNA 5CA1F 3HZZA 1SZTA 3CTMA 2NNLD 2FRXA 3EEBA 1EGHA 2Y1KA 3EVZA 4L4SA 2PWBA 3H1LH 1PT6A 1WQ4A 2VS1A 3HI4A 3FCAA 2Z2ZA 4GNRA 2NTJA 4JGIA 2HOQA 3P94A 2A0FA 4UOQA 3VH4A 3QPVA 2AWNA 3LG2A 1XZBA 1Z8DA 4C20A 2H2GA 3A26A 1QK4A 3F78A 4FX2A 4OXXA 3A6LA 3TGUH 4EY8A 2QE7G 1UBJS 4KQIA 1SQ5A 2QI9F 4GLJA 4QXMA 3SPJA 2P6YA 2IEYA 3K16A 4BQFA 1KZ4A 5BUZA 2HYIC 521PA 4MVJF 3CGGA 4NYIQ 3GLIA 4BIIA 1CJMA 1T4BA 3TFOA 5EZYA 1N6NA 1SCKA 1SCUB 2AZ0A 2YN2A 1IULA 1H65A 1ENZA 4QPDA 1GMGA 3BQMB 1P18A 2YHBA 1Z2GA 4R9NA 2IDZA 3FWPA 4R7ZA 1BJRE 4EI7A 4KN6A 1U0FA 4TT8A 4XB6B 2ILVA 4YXWA 3U17A 3UMVA 1LU9A 1P7ZA 3I0MA 3V1MA 3VVMA 4ARZB 3WNZA 3OIVA 5FR1A 3UQZA 2QUJA 5FAXA 2JLBA 3FJYA 3JQBC 1UEJA 4C5CA 4CT5A 2BEWA 2RC5A 3L05A 5EHIA 1M54A 3STZC 4JF3A 5CX1B 5G2OA 3RS2A 3VO1A 4PYIA 5GIOE 2RAFA 1SK8A 1T1JA 5AMXA 4Q21A 4IM7A 4UD6A 4R8MA 2WAAA 4KXLA 1B14A 1K6EA 3ROFA 2UZ0A 4BTLA 5HYVA 2R751 4BC1A 5C80A 1RXYA 2QORA 4LWSA 1YRHA 2Y27A 4LA4A 3SD7A 3KDPA 2HU2A 4R2XA 1M6NA 1JIKA 4TXHA 3GBVA 3H8WA 1CR1A 5KTMA 2WD9A 3TZEA 3KB1A 4UTVA 8ABPA 3ZRSA 1NJGA 4Q1VA 4OIMA 4JAVA 2CGNA 1JGTA 1P6UA 1P7PA 1V1JA 3DUFA 4FCVA 2PY6A 3HVRA 1EB8A 1ZJ6A 1JN0A 1Y81A 1VCHA 5C8XA 4HYQA 3AG2B 3OBIA 4LCEA 4CV3A 5K0SA 4FZJA 1CUZA 3HPLC 1ULUA 2QF7A 3TTSA 3K5PA 4JAVC 1QCYA 5C8YF 4EGSA 3TQRA 3ZHXA 3GJRA 4KR0A 1WSWA 2YJTD 4DILA 2FSFA 2KTVA 5HIJA 4AHCA 1QHTA 3DXRA 1OYVA 4Z2AA 3ZVMA 4FBMA 4OUDB 5KKCA 4ZRDA 3GJSA 4PLTA 1T3LA 1DNPA 3AK3A 1W48A 2W6ZA 5CFOA 2JLZA 2I78A 3KALA 3W3AA 3UA4A 1H8EA 3BD7A 3GEMA 1JJ7A 1ZNZA 3MT7A 4LF8O 3L2OB 2YXNA 1NNI1 3UATA 3VMMA 4A8PA 3VBBA 1R9NA 2UDPA 3APOA 2Q0QA 3K9NA 1T8PA 4M89A 4EQ6A 3AB8A 3E7PA 1NKSA 1SUFA 1NA5A 2H1IA 1U04A 4MS3A 4PRKA 2R3SA 5BSVA 2PXCA 3HR0A 1WO8A 3OGCC 1H1LA 2G1JA 2N75A 1PSDA 2ATVA 3E3LA 3IP8A 4ETIA 3P30A 1E4EA 1XVTA 4YMHA 2G40A 1XZKA 4PJ0Z 3TCXB 1QU7A 2AYZA 4I08A 1C1XB 2FZ4A 4RHTA 3QF4A 4X7BA 4A6XA 4GEKA 4FJCC 5I7FA 1R73A 4D46A 2QTZA 3GEPA 3LCVB 4DC9A 1V1RA 1IN6A 1YS6A 3EAGA 3EIOA 4IG9A 4JLAA 4KRXA 1N8RH 1T1SA 1T5OA 2A67A 5KYVA 3WBBA 3H01A 3ELWA 2Y1OA 4NECA 5FOSA 1DCTA 2XZLA 1Z5OA 2V4DA 1OBHA 1U5CA 1KYZA 1G3MA 4OFWA 1JDNA 3GBPA 2NSYA 3DLTA 1URFA 3EWIA 4B4KA 2NTEA 1IXZA 1QCZA 3LY9A 4IH9A 4II2A 4RMNA 4TLMB 3VO2A 3MHSC 3M34A 1NYRA 1BZKA 4IKEA 3OH8A 1RYMA 3GLTA 2DLNA 3A2LA 3CP1A 4O08A 4OJQA 5DU2A 1Y6RA 1I51A 1GILA 4G0XA 2X7XA 5K3SA 3EVDA 4PS1A 4WGFA 4DPKA 1E62A 1O6BA 1ENOA 2WRZA 4O1HA 4KWTA 5AOAA 2DOKA 5BVGB 4AQ7A 3CCSV 3D64A 1WLEA 3ZEIA 2WZBA 3NTQA 4FDTA 2VBFA 4QEDA 1JQKA 4A2QA 5H02A 2XZDA 3EHDA 3FAKA 1E1MA 1PD3A 1FFHA 1HOXA 4LISA 3WHLA 1DRUA 4MVSA 1G4HA 1IXKA 4D8TA 1QWOA 3CH6A 3KIZA 4X8AA 4X64O 1OX4A 3BAZA 4PE5B 3ZY3A 1K27A 5HXZA 3GJ0A 4LOAA 4Z1VA 3O47A 3ESDA 2P6OA 1RQGA 4OA5A 1CUSA 1QANA 2H4ZA 3ZZ0A 5CB4B 1YITF 2QTHA 1VMGA 1GQ2A 2ZRDA 4I1UA 2XRFA 2GN2A 1R8JA 4BLRA 1Q81H 1ZEMA 3E5RA 2D06A 4C08A 4EJFA 1FDVA 1U8ZA 4ZEOA 1QKIA 3AU9A 4YQZA 4D41A 3C8ZA 2B4RO 3MWDA 3W8NA 5JSHA 3CC4V 2GA8A 3TRIA 4R3NA 3WHKA 2FEKA 2FVXA 4JI4B 3UM9A 2HWKA 1TT5B 4Q4HB 5HW0A 3D2BA 1A96A 4NV0A 1N5RA 1EGVB 2VHYA 5E95A 5ETJA 2VK2A 3FMGA 3LVRE 4L85A 3WYBA 3R23A 1CJCA 3VR1A 5IYZB 1SKYE 1Q74A 4L4UA 5D00A 2VTDA 3LSQA 4PVDA 5FWYB 3AF5A 4I9NA 1M56C 1EHCA 1XI2A 3THXB 1KJQA 1Q6ZA 2EF0A 4L3OA 4DB4A 4D6YA 4NMWA 4F97A 2DYYA 4YH1A 1TF7A 1XDGA 4EUFA 1A4UA 4MVZA 4DB2A 2CTPA 4GZ6A 4XRRA 4GI7A 5AJUA 4BX8A 3HO1A 3P0IA 3ZN2A 1FY2A 5ALHA 5ECYA 5EE3A 3V8VA 5CVJA 2I7XA 3U2QA 1E3JA 4EPYA 1QUFA 1XALA 2EBUA 3IEWA 1BQ4A 1TA8A 2HKIA 5JEDA 3KJHA 1KOFA 1VQ9F 1YS2X 1FCJA 3MWKA 3MOSA 4LZLA 5DCLA 1ZESA 5HM6A 4ER5A 1RFYA 4I4TB 2BMDA 2VJCA 1FFTB 3CD6V 1PR0A 1Y1LA 3AETB 3OMWA 4OQXA 3NWPA 4E3ZA 3LMEA 3M8AA 3KXLA 3PDHA 5KYTA