4WBNB

Crystal structure of tubulin-stathmin-ttl complex solved by native-sad phasing
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
428
structure length
422
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 178
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4wbnB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4wbnB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4wbnB01
4B46A 5JH7A 3WGKA 3ZBQA 3N2KA 2RHLA 5GONA 5CA1B 2Q1XA 4X20B 4HNAA 3RYIA 3M89A 3N2GA 1TVKB 5EYPA 5IJ0A 5KX5A 3WGMA 1Z5VA 4EB6A 5EIBC 5EZYB 4O4IB 5FNVB 1FSZA 4IIJA 3VPAA 5LP6C 4IHJA 4YJ3B 1W5EA 4X1KA 3V3TA 3VO9A 1SA0B 1RQ7A 3RYHB 2BTOA 5IYZB 4FFBA 1W5BA 2R6R1 4X1IA 4LNUA 4ZOLB 4TV9A 4TUYB 3HKBB 3JATA 1TUBB 3HKEB 4X1YB 4ZI7A 4F6RA 4YJ2A 5J2UA 3RYFB 3RYCB 4TV8B 4O4HB 3JAWB 5LXTB 4E6EA 5ITZB 4X20A 5J2TB 2RHJA 5JVDB 1W581 1TVKA 3E22B 4O2AB 4XCQA 1W5AA 4EI9A 5EZYA 4O4IA 5FNVA 4WBNB 5LYJB 3WGJA 3RB8A 5C8YB 3JARB 4YJ3A 3WGLA 3JAKB 5IJ9B 1SA0A 4DRXB 3HKDB 3RYHA 5IYZA 3JASA 4U3JB 5LOVB 4ZOLA 3HKBA 3JALA 1TUBA 4TUYA 3HKEA 4O2BA 4X1YA 5LA6B 5LP6B 3WGNA 4I4TB 5JQGA 5CB4B 3N2KB 5JCOA 3RYFA 3RYCA 4O4HA 5GONB 2BTQA 3UT5B 4KWEA 4DXDA 3JAWA 3RYIB 5M7EA 5LXTA 3VOBA 2RHOA 5ITZA 1FFXB 1RQ2A 5EIBD 4I50B 5CA1A 5J2TA 2XKAA 2R751 5JVDA 5MN5A 3E22A 4O2AA 1Z5WA 2VAPA 3ZIDA 4I55B 4X1KB 4WBNA 5JCOC 1JFFB 4O4LB 5LYJA 3HKCB 5C8YA 5BMVA 3JARA 4TV9B 3JAKA 3JATB 5KMGB 4O4JB 4DRXA 3ZBPA 5CA0B 1OFUA 4B45A 4U3JA 5LOVA 4ZHQB 5BMVB 5LP6A 5JH7B 4I4TA 2GVIA 5CB4A 3R4VA 4TV8A 3UT5A 2RHHA 3VOAA 2XKBA 4HNAB 3C8LA 3N2GB 5EYPB 3CB2A 2VXYA 5IJ0B 5KX5B 1FFXA 4EB6B 4I50A 1W5FA 2VAWA 4IIJB 2VAMA 4I55A 4IHJB 5MN4A 4EI8A 1RLUA 1JFFA 4O4LA 4M8IA 3HKCA 4FFBB 3JASB 1W59A 4X1IB 4LNUB 3JALB 4U39A 4ZI7B 4O2BB 5IJ9A 5KMGA 4O4JA 3VO8A 5MN6A 4YJ2B 5CA0A 5J2UB 3HKDA 4F6RB 5JQGB 3M8KA 4EI7A 2Q1YA 2BTQB 4ZHQA 5LA6A
chains in the Genus database with same CATH superfamily
1KJ9A 1C0LA 3V4PB 1PJTA 4EVIA 5FP0A 3IOEA 3ISTA 721PA 3VX4A 3BA1A 1EGAA 5H1YA 3L6RA 4ND1A 5JS2A 2PYDA 2LD4A 1B0ZA 2Y66A 2HGSA 2OTMA 2I22A 5BN3B 4OQMA 5KBYA 1GG5A 1K75A 2QA5A 4LW8A 1WD7A 2PGJA 2CLSA 2ZUFA 5I9IA 1N6IA 1W8IA 4YWHA 3V4SA 3GGOA 4JQCA 4KQ9A 5JJCA 2FPGA 1XZHA 1Z22A 4OOEA 1LUWA 2PZKA 3SJCC 5GJBA 3IMKA 4F4CA 4KOEC 3UBMA 1OT3A 3O8NA 3FY4A 1BCRA 3C7TA 3CE2A 4DTIA 2VJKA 4G23A 5MFZA 1DAHA 2A9KA 1SCQA 4QJ5A 2XWQA 1R0LA 2N05A 2OBXA 1UZMA 2PKXA 2CLCX 2FPWA 1JDSA 2I2BA 3AF0A 4BWGA 1IZ8A 3HN6A 5DV9A 4GEGA 1UP6A 4PZAA 1V37A 5AKHA 4DW8A 1MJGA 1T8PA 3HL0A 1E0SA 4QXQA 4PHCA 4PPFA 1W2BF 5CB6A 3LT2A 1T9DA 4R8MA 5H6QA 1Q15A 3PEVA 1OX4B 3ZJZA 4YMTA 1JN1A 4UDNA 4N23A 1J0BA 2IYQA 2W70A 1GYQA 2RHMA 4RVDA 2XZTA 3VZSA 2FPSA 4WFHA 1JSRA 1WMEA 1YULA 4RTRA 4N40A 2HYIC 5JXJA 4BO7A 2IH4A 5EAZA 4XUGB 4EUEA 5A5DA 3ZCTA 1B1AA 1U9IC 2R6AA 1P5FA 2WINI 4WNYA 3EXG1 3S70A 3RT7A 2J67A 4BAUA 3ADBA 4FFVA 1R3DA 2ZWVA 4OGQB 1NMQA 1QTIA 2AF4C 4OH7A 1WZ2A 4G85A 1S3IA 2UZ0A 3D3IA 1FUEA 2NVWA 5FAXA 5JEDA 2IU0A 2K7FA 4GMFA 3U80A 2CV0A 3CX8A 1GKFA 4P5PA 4K6FA 2FWBA 1GCGA 5CM8B 3V4DA 1DEAA 3TAHA 5L3FA 3VPSA 1VI2A 2W0FC 4DC9A 4XFJA 4UTOA 4L0CA 1FS5A 4G24A 3WRYA 4W5TA 2NGRA 3X43A 4ZEVA 2A4MA 8ADHA 4NZMA 3SK0A 1IK6A 1SKUA 3GLHE 3D6HA 1R8JA 4G8BA 3BDIA 2A06H 2I3GA 4UHFA 2VRZA 3D0OA 2I67A 3LBFA 2WB2A 3NX4A 4LFBB 1IXYA 3L77A 4NU5A 2A30A 4XLZA 2R00C 5EXEA 1SXJA 4WUTA 1KK0A 1NKTA 2BJWA 2DUWA 1FNCA 5ICSA 2OCCB 3EVTA 1QHGA 1R50A 5EIHA 1ACJA 1VQKV 3G0OA 4Z1MG 1SK8A 3NJ8A 4GVXA 5KNBH 3QVWA 4EHDA 2VYFA 4TLDA 3IQXA 2X2FA 3U2QA 3UMVA 1GTJ1 2F43A 3A1UA 4M1MA 1CUXA 3PNVA 1LEHA 1PBTA 5DOVA 1HZZA 2OOKA 1PFVA 1WZCA 2B6HA 4MQEA 1CJCA 5MGBA 3GFPA 5F98A 4S24A 2WHYA 4G9BA 4R6ZA 4MHSA 3L05A 3FR8A 3ZHSA 1ZCFA 1G98A 1B6TA 4A0SA 1SZDA 3T41A 4NJMA 2IPNA 5B2EA 1E63A 1A7KA 5AI9A 1DL5A 4BQNA 2YIBA 2Q46A 5HQJA 3QKIA 3G5TA 4PGMA 3OMNB 2HMTA 2D1TA 4CMHA 4WH0A 1J2UA 2PY5A 1N2IA 1FVOA 3QMWA 3Q3JB 4AKTA 1QGOA 3L8CA 2R8YA 2JVDA 4X3PA 1P0MA 2PUSA 4Q4CA 4ED9A 1ZMOA 3FOWA 1OV6A 5JW6A 2JIQA 1YFLA 3PDIA 5HY4A 4G2KA 2VYVD 5JI3E 4FILA 3R3ZA 3IQWA 1T3ZA 5ALYA 2DHRA 4D0NA 2PQ2A 1DGSA 2GBLA 1YKGA 4GL2A 3N7UA 4YP1A 2NU9B 1EFCA 3CU5A 4TKUA 3CRW1 2GZHA 5KQPA 2OK8A 2Q8QA 4TKMA 1YJBA 1RLIA 3TI7A 3K1ZA 2GTIA 3QUQA 1ZHFA 4OA8A 4B6EA 3T7IA 4FI3F 2ADMA 4K1LA 4K6HA 1LF0A 1UPFA 4LOHA 2RHOA 1AMUA 1SVIA 4OYRA 4PRLA 4PCAA 4F2HA 1KKLA 1T3GA 5BSTA 3ZR4B 4Q4AA 4B0PA 4Z9XA 2YV1A 4ARAA 2F23A 2ZSDA 2OPBA 3E9RA 4RPKA 1FVFA 1QH8A 4IIXA 2QTVA 5KUKA 2D06A 2B9VA 1SG0A 4REQA 3V3KA 1Y3AA 1DRWA 1FXSA 3KKQA 5DHQA 4FS8A 3T8YA 2W2LD 2SBTA 4Q4HA 3EDQA 1P4RA 3N53A 2HVJC 3VU3A 1JJ2F 1EUCB 2ZRLA 1QG2A 4RH0A 4UQOA 2Z2IA 4FX5A 4D3DA 4KTVE 3QFRA 2HIGA 2EP8A 3SI7A 4LXIA 2V7XA 1PYOA 3BCHA 4R2XA 1UMDB 2GLUA 1RC8A 1Z29A 3GP8A 3N39C 2EL9A 2NPOA 3PTAA 2AHZA 4E15A 1TJYA 3EIEA 5EP4A 3SOPA 4CG0A 2WY2D 4N21A 1WE2A 2H4FA 3SZOA 3S99A 2UZ1B 4YUXA 3GJ7A 4KGDA 5A7GA 3F6YA 1XWIA 4Q34A 5DIFA 1M2VB 4OHWA 1R6AA 4NOKA 3BXFA 1YRLA 1Y3IA 3SIXA 4W5JA 1YQUA 2VUIB 1RW4A 1E1LA 4UV8A 4I5GA 2UUBB 2UUPA 1TX4B 3SSOA 5MN6A 1QFJA 2B1JA 1KARA 4EJSA 2A9QA 5HQTA 1KMNA 3DDOA 3PXDA 1YZQA 5JNWA 1MAWA 3E9YA 3JPWA 1CZNA 3MQFA 4GBMA 1DRKA 2FMTA 1KYQA 1NUQA 2IXFA 4B8WA 4HXGA 1PYGA 2IHYA 1RI1A 1JEQB 5CHYA 4OP1A 4X5OA 1L4LA 4MQ6A 1L5YA 5AM1A 3EC7A 1SHJA 3PFFA 3WGHA 4F46A 4C4TA 2FEMA 1J8YF 1ZL8B 2BGRA 1TQ4A 3DUWA 4CEIA 3HXQA 3EX7C 2WZDA 4FJ0A 2K9PA 3C3JA 3H2GA 2AOTA 2OCXA 3L1KA 1NVAA 1QRDA 1DELA 2IDMA 5M34A 2GZDA 3HNOA 3BE6A 4MW0A 1OU4A 2ZW9A 4KKVA 4RZUA 3KEOA 4KUEA 3ZCRA 3MWDB 3NM5A 1UMKA 4B1FA 2ZJ3A 3RVZA 4NP6A 2FQWA 1T0IA 1X0XA 2BV3A 4HNVA 2HBRA 3VC1A 4BZPA 1W59A 1P3JA 3I5DA 3DTUB 1T4MA 3BERA 3CIFA 2SCUA 5IWAO 4EMBA 2PMEA 4MA4A 5KA6A 3B5EA 5BV2P 4C7JA 2HP0B 3SAJA 3CEJA 3KIPA 4CG2A 2JATA 2Q5OA 3OM3B 1QQ5A 1H2MA 4MB6A 1YR6A 4H1HA 3D6FA 1ID8A 3DOEA 2DFDA 4EK9A 4EW2A 4QC2A 3V8EA 5K5EA 2JEYA 4RKRA 4OU5A 4E22A 1NAHA 2OTCA 2WTEA 5ECWA 1TECE 2JAWA 1N5MA 1BIFA 1BDJA 2X0RA 3D3WB 1N2CB 3T7KA 1CX9B 2EIKB 4GOOD 4KGVA 3EWSA 2PU7A 4A15A 3TQQA 2EKLA 3P2JA 4RF5A 3FKSD 5D01A 5A5GA 5LOVF 2X9VA 4KHPO 4JDUA 4QXRA 5LOVA 1G59A 1RHUA 1NRXA 3RFCA 3RIYA 4F5EA 4MICA 4UEKA 4US2R 1UJ4A 2JI4A 5AOVA 4JSTA 3G3EA 3ED5A 1SQVH 1JMVA 1NZJA 4JLUA 4PN7A 3QFSA 2GQ0A 3G71F 2DZDA 2WV9A 4BNFA 4U00A 4CGYA 5SZJA 3NIFB 4BJ5A 4RWUA 2DSTA 4R05A 4LCKA 4PC3A 1E7MA 4Y1RA 4D42A 4FFBA 3DV0A 2GUGA 4GQIA 1D2RA 1YITV 3NHRA 2OFPA 3LY9A 1OTXA 1KDPA 1JU9A 2BM0A 1PNLA 3UNXA 2OO7A 1KHHA 2H57A 1VCNA 4G5FA 3L9DA 4BY9D 3L7JA 4KLZA 2ICAA 3L1HA 2J3EA 4NY1A 1QK5A 4CKWB 1CR4A 4HQ6A 1H8HD 4UHEA 2CCKA 3LZ6A 4RTQA 4MJ7A 3I9NA 2NNLD 4JTAB 1AXEA 2FDCA 3DAGA 3CCRF 1X52A 4U7FA 4JLAA 1XNQO 3QWHA 3G0CA 3CRRA 1NV9A 1ADJA 4GWLA 4ZCTA 1J2TA 2KQXA 1DADA 2CZQA 1M34A 1OLXA 3C5VA 5F1PA 3QIVA 4OM7A 3FKSA 1ORTA 3UQZA 4BO1A 5C2JB 4ENUA 3OJWA 4MH0R 3TLXA 4D8UA 4CQMB 4KXNA 4OOFA 3E4DA 3PL1A 2PV0A 2GHRA 1FVHA 3NM6B 5FYDA 4CM6A 4WD3A 4BVGA 3EB9A 2GPBA 3OU2A 3WDSA 3QOXA 3BKWA 2ORIA 2R70A 2QORA 3AESA 4KFUA 3PNQA 1X3LA 2IPXA 2UVPB 3UFXB 4IXDA 2F9LA 4UUPA 5AD1A 3GRRA 1Y5RA 1W19A 4J9YB 3QX7A 1QVWA 3HI4A 4FJ2A 4BASA 1G9SA 1XA3A 2F90A 2VS1A 1JZQA 4L2IB 3M81A 1J7KA 3U7QB 4FEYA 1PT9A 1U7WA 1V3UA 3NPMA 2P0AA 1L5VA 5JJ5A 3A05A 2X0KA 2GHQA 3ROMA 4HH4A 4RLQA 2V7VA 5ESWA 5A71A 3BYZA 4FSXA 2W6ZA 4I55F 5KYVA 1VMKA 4I55A 1IVSA 4UARA 3KEGA 1I80A 1HMYA 3OOWA 4L9SA 2BH2A 2ID8A 2ODNA 4ASUA 3R0VA 2PUBA 3BORA 3NHZA 1WHSB 3EORA 5JJIA 2ACWA 3DAHA 1ZN7A 4CPDA 4WASA 5K45A 2EJVA 1QR2A 4IDNA 2PA0A 2BFEB 4OG2A 3RK1A 1A9SA 4AJPA 4CCYB 2VT7A 4IMJB 4R6WA 2ZDGA 5BSUA 5AVVA 4FM2A 1LZLA 4MW2A 5DLYA 2GTAA 3MOSA 3WX0A 4UVAA 5HMLA 3B6ZA 4AO7A 2A1UA 2BOVA 4ZC8A 2DFNA 2H1RA 2F8TA 4DQXA 1DT5A 3PEYA 4JI4O 4HRXA 3FH0A 2OSVA 4D02A 1E3MA 5AJVB 2QTPA 3BWYA 4NECA 3IDAA 3P3PA 4ZVNA 1V8OA 2BFOA 3ZWNA 5KTNA 2QDOA 2PX6A 4KVGA 1X80A 4MVJP 3I9LA 1SO8A 4AY5A 1DQRA 4CUZA 1E7YA 3T9BA 3E7DA 5CLIA 4L1KA 5C5DA 3B2NA 4B34A 2B30A 3BF7A 5BSHA 3C0KA 2LFSA 3ESAA 1MJGM 3BM5A 4OREX 1AHNA 3K3WA 1V2HE 5LCXA 1WSAA 5C4MA 4AB1A 1KZYC 2OFXA 4X95A 3FDJA 1JMKC 1A32A 1C3JA 3CJTA 2QD1A 3NDIA 1WVIA 2XGGA 3H1LH 3IP5A 4D4LA 2NG1A 4RY9A 1T36A 3WU2Z 3ICCA 1QBKC 2QMHA 1T8UA 2HDOA 4UVHA 2OG2A 4F4FA 3I28A 1WUHS 1GKKA 2OG1A 4G5XA 4C4WC 5E7JA 4D92A 2FKAA 1G4HA 5KKAA 1M8KA 2UXBB 2OUIA 3NT4A 3LQKA 4UEOA 4UCSA 1F9EA 4PC6A 5HCIA 2DT8A 4OK5A 5LHHA 3NOQA 3F5MA 3T5CA 1DKMA 4D8XA 3VIUA 1ZC3A 1DBSA 1UJWB 1SM4A 3WMEA 1RM4A 3TXYA 1NOJA 2ZZKA 3JR3A 5LBIA 4DA7A 4MULA 3WIVA 2WT8A 4AG5A 3ELYA 4ZGWA 3GLGE 1J8DA 1UDBA 1PWHA 4B5LA 2CE2X 2FPXA 4UDYX 4C14A 4N1AA 1IJEA 3M6MD 5CRIA 3K0CC 1P6QA 3LQ2A 2Z3ZA 1II0A 2I34A 2Q5LA 4PPQA 4F3NA 5JS7A 4QJBA 4DMCA 2BZSA 3AQ4A 1GP2A 4V2UA 2BCEA 2AUMA 2ZKLA 4D9CA 3W5VA 1NIJA 2JA2A 4HDKB 1MMFB 2Z08A 5JCPA 3DXFA 5CN0A 2WTAA 3EZGA 2DHDA 1UK9A 3T06B 4EY5A 3T0GA 2V0NA 3KTAB 3A70A 3MMZA 1RHKA 4HBZA 2GA9A 3SM9A 4F2GA 3OQ6A 1U1CA 3H5WA 1GCOA 2XHEA 4MUFA 3FUCA 3HPQA 3CRMA 4QVGA 4PG7A 5CH8A 4LRUA 2I03A 2V98A 4QUEA 2JNWA 3CPQA 1P33A 3B2QA 3CCEV 4ZHQF 1UOEA 4R5HA 4ZHQA 2WJGA 3T7EA 3ZWBA 3IR7A 1CQWA 1RPAA 4PWZA 1MA0A 3A9SA 3AVUA 1XGKA 4EZBA 1F4PA 5LD2C 2PQMA 1UJ2A 4LXGA 3Q7EA 3TTXA 3ZJTA 4NAVA 4QODA 1T1EA 1XZNA 5EXDA 1X92A 4TYMA 2VH2A 3CLUD 4JOSA 3BJRA 3L1VA 4EPXA 2ETNA 4DPLA 1IEQA 3DGFC 1VP7A 4GR4A 3RHFA 3EVGA 2BKLA 2YXPX 1JJFA 1E9SA 4UD2A 2HU5A 1AZSC 3MLBA 2JH8A 3A6DA 1XOUA 1X9GA 2XXAA 3N0VA 4UFNA 2LCIA 3EDOA 2OQVA 4JYAB 1AQ6A 4AKEA 2FZ5A 4WLEA 2VXBA 3DTVA 5KNBA 3LP5A 1DAMA 3PS9A 4JHLA 1XVLA 1RWWA 1SUPA 4RHCA 1EHCA 5JRJA 5C8DA 2BJVA 1COMA 4HFRA 4KFTA 4HZUB 4CL2A 4HSGA 3SHFA 4DR4B 3B7PA 1HRDA 1ZIXA 4W1RA 1GKLA 2J3MA 4FFRA 5JNTA 5ED0A 2W8BC 1ZI6A 4V2IA 4V0MA 4DW1A 2GN2A 3NBZC 4AYXA 1KI9A 5EGNA 1B3RA 1E3LA 1NSFA 2QVGA 5GV8A 3U3KA 1KJYA 1KFJB 3WA7A 3PZRA 4LKRA 3VR5H 2CHQA 2HOQA 4QLOA 3LIPA 1TIKA 2X0NA 4IOJA 4YECA 1QPZA 2FR1A 4ND6A 1WULS 3UO8B 1R5JA 4Q3LA 3STLC 5K01A 1UPGA 2XAHA 1IFXA 1M1YB 2YWXA 4JLSA 4WACA 1EJ2A 3ILXA 3M2PA 3FF4A 4CM7A 2ZBGA 4F2WA 4I9NA 3TFOA 6ADHA 3R9KA 4BNXA 3LDAA 4ND5A 2HEGA 4CMCA 1P39A 2C8JA 1RPOA 2QG9A 3BMNB 1R6BX 5JMTA 1NQ5A 1T35A 3W6NA 2WVHA 3EVBA 1XTUA 3T7AA 3W6UA 2DFVA 4P84A 5IF3A 5ES3A 1XZ8A 4UQPA 1OLSB 3T99A 3PE4A 5JO0A 2XOKG 3LVRE 3K0GA 4UCVA 3GHYA 1DJQA 4UFPA 5K3CA 3SEQA 4KI0A 2GESA 1U94A 3GFBA 5CJJA 4WUVA 3WXMB 1SESA 5D51S 4DCNA 4MIYA 1D07A 4YRLA 5DDIP 1JAXA 2DTDA 2HD4A 2AUNA 2PCJA 2VK4A 4OAPA 1RI3A 3I56V 2ZG6A 2C97A 3CLHA 3ETLA 4HHEA 4LE0A 3OFND 1BXRB 4BAYA 3GN2A 3QPBA 4PXAA 1TF5A 1B00A 3E9QA 4UPVA 3GMTA 3HACA 3RABA 3RTEA 4CODB 4U2CA 2PBLA 2VPTA 1RRVA 1SQ0A 2BFWA 2FPIA 3HB3B 3MERA 1V55B 4LQLA 1VHTA 1G20B 1XEXB 2ZSBA 4CH4A 4FGJA 4MVOA 1CDOA 3ZBTA 5LA6F 2Y0BA 5LA6A 2GZ2A 4HNRA 1H6CA 4P54A 2P67A 5DW0A 4HWRA 4I9QA 4NENA 4YV7A 1OZ0A 4QX6A 1UC8A 3AYXB 3VR6D 5EPUA 5C7IO 1LXCA 4FZ1A 2Z5GA 1BX1A 4YAKA 2GM9A 4MR8B 4L50A 1QDLB 5EXXA 5I7EA 1GTVA 3RS9A 1NASA 4UM8B 2R4QA 3LCJA 4U5QA 2O7VA 2UU9O 3IDZA 3O82A 4BNVA 3J80A 4FGLA 1GGHA 1B14A 3NMUC 4PICA 1UBKS 1PWZA 4FCWA 4JCCA 2XE4A 3OMXA 2FR0A 4GVPA 1WN7A 5EJFA 1YAJA 2YIVX 2ZBRA 3ENVA 1H5UA 1T3LA 3TN7A 2NVUB 1MTOA 2YXHA 3GBSA 4RD0A 2O06A 4DPMA 4DFDA 2OT5A 1QLHA 1U0HC 4POOA 2C4HA 1L8AA 3UZUA 4H6PA 3T4EA 1CIPA 2JFNA 1Y6GA 4CMJA 3LLSA 2NWQA 2YINC 1APBA 3W6PA 5A05A 3AJDA 3VPXA 3IA7A 3N2KA 2V7BA 2EW1A 2NZYA 2IZOA 5KOHA 1WB8A 1EGVB 2ZFUA 3CX5F 1S1CA 4C4XA 1D8TA 2EIHA 2AG6A 4MV6A 2FWNA 3FHOA 3AKDA 4JVNA 4BNNA 5CYFA 2EW2A 3W5IA 1P9WA 1FBTA 1FSPA 2Y0CA 2R97A 5ECGC 4L73A 1T9HA 1N9GA 1S4MA 1ZJJA 2DKFA 2V45A 1U8UA 3NORA 2C2OA 5LHIA 5FB3A 3C3WA 1YR2A 3EUEA 4HL6A 3WRVA 3S28A 2VYQA 4L0QA 2X19A 1JFFB 1Q1EA 1N2HA 2VT6A 4N5HX 4OVKA 3LF2A 4X64B 4XX0B 3WAGA 4YP5A 4XE5A 4LBWA 1AR4A 2PZFA 5D2CA 1FFCA 4KIGA 1YS6A 3IELA 4J16A 4GGPA 2QVCA 2KGWA 3RGGA 1IXBA 1R6UA 2DLCX 2UUBO 1U2SA 5BNIA 4Q1AA 1FMLA 3H9VA 1WY7A 1VYVA 5C8ZA 2I2XB 1JPUA 1YHNA 5L7TA 2UYOA 2QRPA 5DGHA 1P9RA 4L8WB 1P5HA 4PO1A 4XSVA 3A7EA 2P9JA 3STYA 2RAUA 1W2BU 4K8XA 2P2DA 4CMKA 2FB9A 1X14A 4E1BA 3ACBA 4BNYA 3VHXA 3GFSA 2OAP1 3QH4A 4LF9B 3GELA 4ZT2A 1SIUA 5CYGA 3K70C 4LAFA 5I9SA 3T7TA 2Q21A 2VP2A 3OZTA 4M60A 5DHFA 4DCVA 3MFYA 4TV8F 4Y2SA 4J7AA 4TV8A 4AZ3A 3R09A 4Y6RA 3RHSA 2FZEA 2IY7A 1PD1A 5DLQC 3T95A 3UH0A 4E2ZA 2RNBA 2I8AA 2XYGA 1ZW1A 4R0VA 4EUSA 3OPNA 1VG9B 2JZOA 4GKVA 1BE0A 4C07A 1Q1BA 4GXNA 3SZRA 5CDGA 5TJHA 4OHBA 4RH1A 1IATA 1LBIA 2NAFA 1DRUA 5FUWA 1G1XB 3KYJB 3HO8A 2DHEA 3B6NA 1HGXA 1ZM7A 1G7SA 4LNUA 1N92A 4Z3DA 3CLRC 3E3OA 3K1YA 3WIDA 5I51A 2PR7A 4GM0A 3U4AA 5HEKA 2FQYA 4XB1A 1C3VA 1I01A 621PA 4WGFA 4YEDA 3KLNA 4RMHA 4AXBA 4N5IX 3ANTA 3JALA 3BGOS 1SXJE 4OPMA 5M7EA 4YRNA 1JR2A 1T0UA 5AKGA 3MIZA 1MQ9A 3P4EA 3D3EA 4NDAA 3UWPA 2XRYA 1NTRA 4LDRA 1KDVA 4CIAA 3O74A 3O1LA 3KPWA 1GZ4A 4I4IA 2K87A 1G7RA 4I50F 4GLXA 4I50A 3BXXA 1KDYA 1XVTA 2VHJA 1FMFA 3REFA 4CS2A 3DL7A 5LP1A 4UJ5A 2ZULA 4BFTA 2FZGA 1M1NB 5E6SB 1XRNA 5LQCA 1RC0A 2PF4E 1NJ8A 4XYMA 4LJ8A 2EHDA 4GMKA 4GPTA 3CCBA 1JFSA 1SXHA 2GBPA 2C92A 4QOFA 4NEQA 1S8OA 3RIXA 4GOJA 4C7KA 3I4CA 4RHAA 1GR0A 4MR7B 3R7DA 3OE4A 1LDGA 3AUUA 4G3XA 1UBMS 3RSHA 2R6CA 3U7JA 1WDWB 3KL2A 1G38A 3CEPB 4DOMA 3HU2A 2JCSA 4WFKA 2E0IA 5TT1A 3KJQA 1Z5PA 3B8HA 4Y1FA 3T9EA 3VSCA 4E4RA 1ZKMA 3RJZA 2GCIA 3AGQA 3W8DA 3WAJA 5HW0A 2G17A 1BT8A 1Y5IA 2Q8VA 1HDXA 5BT8A 1Y74B 2WWGA 4B5CA 3NDRA 2FAXA 2UVDA 3GRUA 4J6EA 4N9WA 4P35A 3GXOA 3SKYA 5FBZA 4RV4A 3BSYA 4Y2RA 2JD2A 1S3FA 3GIDA 1RAGA 3NS7A 2X6QA 1GFWA 4Y1EA 2ZSAA 3NHMA 3HCOA 4LXQA 4P4TA 1SCKA 3C6XA 3K59A 1MW9X 2NO1A 3KKLA 1XRLA 1V4VA 1BWPA 3GZNA 3EYWA 2JGIA 4KXWA 4PHZA 2GD2A 4N47A 2IDKA 3HJAA 3S03A 2GSDA 1JS1X 4RS3A 3ASOB 1JLLA 2B4YA 1C81A 3G02A 5CIQA 2PKEA 1Z7GA 1VQ5F 1N8KA 3CHXA 3DEKA 5IWAB 4I3HA 3RVSA 4MUAA 3BBPA 1IV1A 1NJIH 1ICEA 2GN8A 3LWNA 1FZTA 4CMAA 2WNHA 5CH5A 4GUNA 3F0FA 3M4NA 4UMFA 5ITWA 4PA6A 2C9CA 4TN1A 5FBHA 3UK2A 1YZYA 3FPCA 4J3FA 1A2BA 1V35A 4LK3A 3UAOA 2GSWA 4LYDA 2BI8A 3WGUA 3I12A 1KAHA 1RD4A 4C5AA 4P3KA 1M1KH 1M1ZA 4X71A 1MV5A 3PUKA 2CCGA 3OCJA 4OL9A 3QKSA 1C1XB 4MGIR 1JJ2U 3VJRA 1ST3A 1LK7A 3O8LA 3RRMA 2IHKA 1OFVA 1M0WA 2HSWA 5JCJD 4AKIA 3IFSA 2EKBA 5CGQB 4AJOA 4MWCA 1FDSA 3HYCA 4D0RA 3O4RA 5EE5B 5J1SB 5JMOA 2C20A 1NYRA 2NZVG 5DK6A 1PEKE 1ND6A 1T3SA 1XYVA 4TZTA 3UK7A 1OFUX 4BVSA 4X62O 5GMOA 5LN1A 1YQDA 3HMKA 3TLGA 3K0DA 4GKJB 1CF2O 4EI8A 2POQX 4RF2A 4PQGA 3GWZA 1SD5A 2IXBA 5CPFA 3ESXA 5L3EA 1UXJA 1J23A 1KMQA 3ZQ6A 4MRPA 2GUZA 2D3TA 2G71A 4PLCA 1NRWA 2O4UX 1XZMA 1JV2B 4WOJA 2NZJA 5IYZB 1JTEA 3JWIA 3OZDA 3G8AA 2PMWB 3J81A 3VNUA 2FZVA 2Q9LA 1MG0A 2VQSA 5BQPA 3SPHA 3VQYA 3PFGA 4PE5B 2BCGY 3DHEA 1CNFA 1XNQB 3E4CA 3R6WA 4KQFA 1W47A 2GYUA 3RS5A 4Q7EA 3COVA 1JKXA 4NX2A 1NC1A 2RG7A 4URUR 5GM1A 3O8DA 4DTCA 4M36A 1XKLA 3VKGA 4HT3B 1MR3F 1M54A 4YGXB 1G19A 4AQYB 1HSOA 1LSSA 1CZUA 1N0WA 5K8CA 2FUKA 3MOIA 2R1UA 2Z2ZA 4XJVA 3MS4A 3K0SA 1US8A 1GNLA 2PUEA 3VR5D 2DT4A 1UZLA 5EVJA 1X7XA 2GTPA 1C1YA 4MEAA 3JZFA 4XGRA 3VH1A 3L71H 5EJ6A 2DUUA 3CUUA 1Z2PX 5K0ZA 2JLQA 4F96A 3ZHVA 1DBWA 3FYSA 1CS0A 4X0EA 4S3MA 2VATA 2PYJA 3LLMA 5F51A 3QHAA 3VKVA 4GM1A 1DEXA 2H3EA 2PZGA 5E8RA 4ZGGA 3P9NA 3ONEA 1Y76A 5IK2A 2M9MA 4OXQA 4FIDA 3T4ZA 1YDXA 2ZIXB 3OP1A 1TYEB 1OFGA 5HXUA 3EHEA 2VA8A 3EGIA 4IQ0A 2YXZA 3KTDA 4B3FX 3QWBA 2AVDA 3LT5A 4RQUA 4DJFC 3OZCA 2R9RB 1NPDA 2VO1A 2R5FA 2BHTA 3N0TA 1DZ3A 3W7UA 3HM9A 2IDJA 4GOND 2RJ3A 2C2ZA 4G1EB 1IL0A 1P2DA 5T41A 3ESYA 3MSCA 3D6TB 5HS6A 1IZ3A 3H3XA 3FRIA 1YFJA 3U4QA 3RRYA 3GPDG 1JHUA 2C3YA 1ESZA 2E76B 4HXFB 4Q03A 2FWIA 3AR3A 1U9YA 5C8VA 3K12A 1VJ1A 5I7WA 4L0DA 1J2JA 2OM6A 4LDPA 2FG6C 2FPPA 3UICA 3VR5A 2DCMA 2Y4UA 4JI4B 4WBNB 1THTA 1CUVA 3K0KA 5ALNA 2IL1A 4OYLA 4L08A 5COBA 2H5LA 4FYJA 4LA4A 5F21A 5G53C 4YV2A 4G4XA 1LUAA 4G4SP 4PQRA 4M0CA 3B78A 3RBVA 1PZXA 4PX3A 3F7MA 2VNAA 3PENA 1TTTA 1M34E 2REXB 1SXIA 1J0CA 2YSUB 3I6QA 3RGWS 1NFRA 1TYBE 3IUYA 2P5SA 3CE9A 5CU7A 1UM9A 4D5GA 3Q87B 4W1SA 5FPHA 1KQFA 3MA0A 4JB0A 4EYSA 4PZDA 2D4HA 2Q4TA 4BVLA 4FQ5A 4CMGA 4LSZA 4JROA 3UW1A 4EY7A 3AINA 1AJPA 4DR4O 4U9HS 2NYVA 3FB1A 2BMEA 3DZCA 3U4CA 4F84A 5LXTB 3ABSB 4ZVLA 3E3MA 3QVGB 1JECA 1F4VA 4R2IA 4XR9A 1N3LA 4C7XA 5FAKA 4M7OA 3FCAA 3RIGA 1NC3A 5GAPK 4BT6A 3OMAB 2BCCH 1DJNA 4NEHB 3GRPA 3CC7V 3J80M 1Q3HA 3DT9A 1DGQA 2ERXA 4BFLA 2XE8A 4MUBA 1V71A 3ZIDA 1Q91A 1GN3A 2VTEA 1KD1W 1AGPA 3AKEA 4P2GA 3F5WC 2H2GA 3ESJA 1WCIA 3PNYA 1OH5A 2VAMA 4BXOA 4B4DA 2J33A 2RMKA 1Z0KA 1FS4A 4IJ5A 5ALIA 4NWOB 1VMDA 3E8MA 2JJ2G 4MW3A 1JBKA 2BMFA 4D9IA 4M4SA 3AEUB 4OIFA 1OV9A 1C2YA 4MYHA 3HDYA 3M1IA 3OX4A 1W5EA 1LI4A 1RRPA 5BMOA 2QQ0A 1ZM2A 4MVXA 4Z7QB 4W99A 3O2NA 3M1AA 3PEUA 4OP3A 4MRMB 1DDIA 2QYSA 2ZSHA 3UATA 1K2VN 2GB4A 3M33A 1GVNB 2VH1A 4H3VA 1AI6A 3HWSA 3PIDA 3DSRA 1N3IA 3GA5A 2A2ZA 3DZHA 4DKJA 3SQWA 2DSNA 3JSLA 1SZQA 5ALHA 1BMDA 4P3XA 3LOUA 4JJ4A 4Q1VA 3G2MA 2I6DA 2HGZA 2D5AA 4NTYA 5B3SC 4M9RA 2Y4NA 4YT8A 1KORA 4EPWA 1FFXA 4W82A 3CH6A 1MH9A 2VQ3A 4NESA 3NHWA 5CA0F 2OAQ1 5CA0A 3S0WA 2P0YA 1FNDA 3OE7D 1FKAO 5JEEA 1ZGHA 4K3AA 5BW5A 4ARUA 5DISB 2BEWB 1IBMB 1BW9B 5LBTA 3FDFA 3H2HA 4ZN6A 3FX2A 3IAFA 2J0UB 4KIWA 2O3RA 1T2UA 3LPMA 3T4XA 2UYNB 3G2OA 3KEMA 3MK31 2CLFB 1U3VA 3OLQA 4PJ0Z 2FP4B 4O5OA 1RC1A 4IJMA 5AUNB 4TX1A 1ZCBA 4MQUA 3ONDA 5KU7A 3AVWA 1EWRA 2GNAA 2YDYA 3R74A 3QLVC 1OXVA 2UYJA 3PX7A 1I7SB 4R1PA 4ZOAA 1S89A 3GLFB 4N7MA 2PE5A 5TMEA 5ITVA 3S0JA 1W35A 1U4SA 4J8PA 3CR7A 3PSAA 1T2CA 5JC8A 1N4CA 3P9KA 4F2DA 5KYGA 3V1MA 3ZUGA 3A37A 5GPBA 2JBAB 1G3MA 1SCNE 2OENG 5GV7A 5AJTA 3KKZA 3K9LA 1MEOA 1DCFA 2O2CA 5LQSA 3THSA 4EBFA 1QO7A 2GEJA 5EC2C 1CK4A 1DKOA 3F3SA 2HCRA 1SC3A 1ZJ4A 1JYEA 3A9UA 1ETUA 3BREA 4UPEA 4JJ8A 3AT1A 5JASA 3K9SA 2P69A 5IT9N 1JFLA 4RM2A 5I7SA 2XEDA 1K73H 4ZJUA 2JIZG 4AF8A 4G01B 2VHVA 4RM3A 4DQDA 1ZOPA 1AQUA 3DB1A 2ZRDA 5A3VA 3ESZA 1PZMA 1Z37A 1OXBB 5BY2A 2AFIA 4FKZA 2C2KA 1RFLA 4OA5A 1R3LC 5K8LA 2FJUA 2O8CB 4HVAA 4DB4A 2EIJC 5ES4B 3WLPA 2A1TS 1FPOA 3ETEA 4FYVA 3TIXB 1JY8A 1GT6A 2BISA 2AD5A 3CF4G 2CXHA 3F46A 4X64O 1JJBA 2D7DA 1GPYA 5JDIA 1IBCA 1XMVA 2YV2A 1MO2A 2XMBA 5K3BA 1L7QA 2I2DA 3QX9A 4PLVA 2BSXA 4KMOA 3OZVA 4Q3BA 3UCSC 4GRDA 2VPWA 4DZZA 1G41A 2VQ6A 4YRDA 1QFMA 3TZHA 4GIBA 1FBNA 3ZYCA 2ZBVA 4LSGA 2BKUA 2RHJA 5B7GA 4CT5A 2M1XA 1GSOA 3JWEA 4BT4A 4KN5A 2OCYC 4OBBA 3SSMA 3NLLA 2H29A 1R3IC 2I6SA 2IOYA 3MG9A 1QGUA 4L16A 3JV7A 1M90W 3OH8A 1XNRB 1GARA 3K0AA 2X7RB 2D5LA 4BZXA 2R66A 3AJRA 3L43A 5F5LA 1UINA 4OI0A 4LF9O 5FLKA 2B20A 3K20A 4FXOA 1SUWA 5JJLA 5FOVA 3NEJA 1S4QA 5C5IA 2C00A 1XVUA 1TEHA 3CCUV 5THQA 2UU9B 5TNXA 3F4LA 4GLOA 5FV7A 5U9CA 4X89A 3B82A 1D8AA 3FLEA 2IEBA 5FOXA 4Z9BA 2RHTA 4TKVB 4C5BA 3RFFA 4UDOA 3UHPA 3L8GA 2WQ7A 2AKEA 4B7EA 1YBFA 3CG0A 4BO2A 4UASA 4B6QA 5DN9A 2P5TB 1FRZA 2VJBA 3GRFA 4FQ8A 1JL3A 1VE9A 2HU2A 1JILA 5B2FA 4ZOEA 2NZWA 2F00A 1VI6A 1U02A 3RBXA 3HCEA 3FB6C 5ED4A 2Q1WA 2C31A 4ZCPA 4DIUA 4WY5A 1KBHA 1A9XA 3TW8B 1GCAA 3STXA 3LT0A 5HKKD 3CM0A 4MV0A 4CE6A 5C3MA 2VAWA 1KEEB 4U4AA 1M8JA 4JJEA 1B0AA 5AM4A 3JSAA 4QVKA 4QUIA 1EI9A 1QKKA 3S3XA 3OWOA 3OZRA 4JI0O 1UDCA 1VKZA 3K4PA 1SUSA 2Z4TA 3OY2A 2LBWA 1NFQA 2VYVA 3N05A 4FK8A 2N1BA 4FX2A 2FRXA 4WE3A 3D43A 5C1IA 2QTCA 1PLKA 1AQJA 3F2IA 1H6BA 5KYUA 2WJIA 3NV7A 1MVOA 1QE5A 1XL4A 3RK4A 1CB7A 2IS4A 3U7GA 3OZSA 4ZIRB 3RVJA 1BSVA 3ABKB 1KIMA 2HMUA 4I5IA 1Q57A 1VLQA 5DGXA 1ZZEA 5KHOC 5IBCA 1B8OA 3KVNA 1QK4A 2PLFA 1M3SA 3JRWA 5CT6A 1DUIA 1USUA 1GITA 1IG3A 1W41A 4Q4JA 2DQYA 5FUBA 1Y80A 2XNCA 4GXRA 4V3BA 3IR5A 4OD0A 1DP4A 1NN3A 2WIGA 4L5YA 4Z1OA 1LJUA 1T25A 3OU6A 3F9IA 1SQ5A 1SUBA 2ES4A 2BFFA 4RD2A 1HEYA 5EHIA 3VO1A 5KYXB 1D2MA 4DLUA 4NI5A 1DC3A 2W2LA 2Y77A 2JGDA 1S2LA 3DJYA 1YBMA 4L07A 2ET6A 4WI1A 5GJWC 1SQ6A 1E2DA 2BTUA 1EN6A 2F1KA 3U40A 2WWRA 1F8XA 3QFFA 3VR6H 4K88A 2WIDA 1EWYA 1P4JA 2FWAA 4PYQA 4XRRA 4BO5A 3THXA 3E3NA 2FRDA 3U13A 2EKQA 4K3UA 2ZI7A 4Y7DA 1OYYA 4NPHA 3MJRA 4H60A 4CUJA 2EWWA 2AOWA 3I9V1 4Y9UA 3VQXA 2G5GX 3DMNA 5EJ2A 2OBMA 3TEFA 1RM5A 3K08A 2NOAA 1JQ5A 2RK3A 4ZT5A 2NUAB 1W6RA 2PIDA 1D7AA 1BJTA 2ZJ8A 2NTNA 5FV4A 1KYVA 2V5AA 1PG2A 4U02A 2HCFA 2AJTA 3OTWA 2ZZMA 1Q0ZA 3KZXA 1V96A 3LJKA 4S12A 3ZRSA 2HA7A 2ZP1A 4YQZA 1OBHA 4RXMA 3ANLA 2V8OA 3FFMA 5GZ3A 2WHXA 1L7PA 3IS3A 3PXXA 4P58A 5ETJA 2AG0A 3KJJA 3IXQA 3GBPA 2ZIFA 2BFDA 4UCXA 2IAFA 4CVNA 4LCUC 4ZVRA 3ZDFA 2YC0A 4ISBA 3A0BZ 2EFEB 3BCCH 2QMEA 2NP6A 2O52A 3VSBA 3PNMA 3A8TA 3ADPA 1HFWA 3F67A 4FLFA 1JJAA 3HFJA 1XMSA 4IDFA 2XB4A 3O1JC 3W9SA 1DKPA 4GR9A 1IIBA 1QOQB 1R4NA 4RTPA 2FWMX 4QVIA 4IXNA 5F33A 1NQAO 4NBNA 4IDBA 2AYYA 4CDRA 5H82A 1HA3A 2PVCA 4GKJO 1OGIA 1S8FA 4LRXA 5CITA 4UCWA 2HWKA 1L6IA 4HDMA 2RGAA 2AFHB 4PZYA 4PO8A 1H47A 1ZI9A 2X8JB 2BZ0A 5J2UF 2YJZA 5J2UA 4BLSA 2PH1A 3ZLTA 2WF7A 5JIBA 2P2LA 3OPYI 5CFZA 2R6GA 3IUJA 4FW8A 3NBFA 1SCJA 3WGZA 1OIWA 1JR6A 4MTGA 1L0LH 1IWBB 1D1QA 4ARZB 3AP2A 4DE5A 3T15A 1NU8A 1PL8A 1JH9A 4QGBA 1PK9A 4A8PA 4L87A 3OZIA 1CG6A 1W7AA 1T4DA 3KZCA 2KI5A 3KJKA 2EX3A 4BWYA 2CW4A 4C0KA 4KWIA 1G4AE 4PZPA 4M86A 4AQYO 3QNWA 3DYIA 1UPUA 1YXBA 3NWJA 1L5HB 1JXQA 5K3FB 2REQA 1YCDA 4M1YA 1PR5A 3BXOA 2FC3A 3JQ8A 1M2OB 3M70A 4CL8A 2Q3JA 5AESA 1MA3A 2XA9A 1VQ4V 5GTDA 3V8QA 2PK3A 4UUAA 2G82A 2QK4A 4J0IA 3F3YA 2PHZA 2OVFA 4G5YA 2JDIG 4C87A 3OEED 4L15A 2G8NA 2HLDG 3UF0A 2Q7OE 3F1KA 1JXOA 3K5MA 1VFNA 1I32A 2Q4DA 2VTDA 4M9XA 1RAAA 2HXGA 4M6WA 3IR9A 4BT2A 3K4HA 2X8LA 5CNIA 5BOSB 4B87A 1DAIA 1IY2A 5C1BA 3ENQA 3IODA 4IO0A 2Q2QA 2E4YA 1H8HA 4CNBA 1GTG1 2W98A 2C29D 3FSJX 5BNWA 3EXG2 1U3WA 4BWAA 1MXFA 4QU8A 1N9KA 4LPSA 2HMYB 1SKYE 1VZ2A 2HA6A 5T8KA 3DLCA 2UUAO 5GZ1A 2O5RA 3SNKA 1ZLZA 4XVRA 4LKOA 4BYGA 3OONA 5A5FA 2HT1A 4G28B 2LPMA 3LA6A 3DWFA 5CXXA 3FBAA 4C30A 3A06A 3OUZA 3TPZA 3G8CA 3WMRA 4OGLA 1KQOA 2H11A 4X62B 3A4TA 3HRKA 3E9CA 2H9YA 1IUKA 2YV5A 1YBHA 4B3TO 1UT8A 1L4BA 3WFIA 3TYXA 2L82A 1WB4A 3P5SA 4CIVA 3UYKA 3JATB 2F8SA 1HOXA 5K09A 2W4MA 1C9JA 3LVQE 3EXHB 2G63A 5IUKC 1M83A 4G4GA 4IH9A 4BN4A 5A4MS 3L6CA 1O94C 1W25A 1U7HA 4IKEA 2VPZA 1UBCA 5BSWA 3IV7A 1GO2A 3M9WA 5DM6V 1LF5A 1CXZB 4N3GA 4E14A 2FGJA 2QD4A 3A1EA 3NTVA 3NAZA 1E92A 5EJEA 2HMWA 1BHAA 1BX3A 3B2EA 4DGSA 5ALEA 4C81A 3HBFA 5AP9A 4MARA 3PGA1 1VI5A 1ISSA 1P7WA 3H9CA 2AVNA 4IQGA 3DEZA 4RA9B 4F3YA 2IEAA 2WK1A 3QXSA 1YR7A 1L5GB 5P8WA 3REOA 4DQLA 1CZLA 3EZFA 3OFJA 4HG2A 4HMPA 2OXFA 2DF8A 3GVMA 3OURA 2QBYA 1VL0A 1C30B 2Z1FA 1G16A 1Q7TA 1OTHA 3ET4A 2YJGA 5C52B 5C3UA 4KH1A 3T1VA 2ZT6A 1KVSA 3FYUA 4X1YA 3AXSA 1G55A 4QHSA 2G70A 1U28C 3QEAZ 1U4NA 5K3DA 3ON5A 4EEKA 2V4UA 1KI1A 2ATVA 4IIVA 4E5NA 3NHKA 4JUIA 4LGCA 3NYIA 4N0EA 4AJLA 3FSEA 1I24A 2IEDA 2HX1A 3USZA 2CL0X 2AJCA 1FQKA 3EPKA 4QDZA 3KUKA 2GS9A 1DUVG 1HZJA 4YCAA 4GLJA 4DMLA 1OAOA 1RJGA 1BJRE 2ZYGA 3AEQA 3Q10A 2IA5A 1S7CA 1SQGA 4G1CA 1IX9A 3S2EA 3B8EA 1FXKA 3UV3A 2QP9X 2FTKA 3VSAA 4LF8O 3OM9A 3V7EA 4CM9D 2A9HA 4MTLA 1E6UA 4XWKA 1K7FB 2PXXA 1VEWA 1JHAA 2O05A 4B82A 1BDBA 1FOEB 2EF0A 4NK4A 4MDYA 5E9AA 1KVTA 2VF8A 3PGLA 1SC5B 2RHRA 2FL4A 2J45A 3HCBA 1RAEA 4JGGA 1IUOA 3IT1A 5KWJA 4BRWA 4DV2O 1A69A 2ONKA 4NL4H 2QL7A 1PVOA 5IBRA 5EUBA 4OHXA 1VC2A 4Q3NA 1DDOA 1CHNA 3OIGA 1YZVA 4JH0A 3FFAA 3LFOA 4LDQA 4Q7KA 4QAJA 4UB6Z 4MGHA 3ZD8A 3GJSA 3SYCA 3DXZA 3S8YA 2XAQA 3F7YC 3QVUA 1QVAA 4Y9TA 4F6RB 2R85A 1PL7A 3R0QA 1XMJA 3GRAA 4HGRA 1KC1A 2Y69C 2UVQA 2WR8A 2LBXA 4ER5A 3O90A 5EZYB 5ALOA 3PDJA 2ENWA 2TMKA 4MTOA 4E3ZA 1JLSA 5ALPA 5HE8A 1Z0ZA 5FRDA 3BS4A 1PT7A 4KKXB 3ZU6A 1J7JA 1GZ0A 1IBMO 1ZJWA 3COJA 1GFZA 4CLOA 3RSQA 1NNUA 1WCV1 4G0ZA 2P5UA 4TTAA 5A04A 1DWUA 5K0LA 5CVCA 3RVOA 3AUAA 1E2LA 5LQAA 4BQSA 4AG3A 3OQMA 1QAMA 3I5XA 3DE4X 3QY9A 2HLPA 3DBVO 1OIXA 1JQAA 3TLAA 2IV3A 1WPGA 4X9XA 3TCXB 5KA5A 3ZU3A 3ABLC 1Y8QA 3KXIA 2P1ZA 2I2FA 3LFUA 2A33A 1WXFA 3K06A 1H4SA 1I33A 4OHPA 4QE9A 1N5OX 1SY7A 3TBHA 2IUUA 1QB7A 2AFVA 3RG8A 3W7AA 2FETA 2CWDA 4FMBB 3PRYA 3SPCA 3AR5A 5GY7A 3ZW8A 4TLLB 5EKSA 3K9WA 3KYBA 4JLWA 3QLUC 1BGYH 2V7TA 4RHXA 1Y82A 2ZYDA 4G41A 2JFYA 1P8JA 2AQKA 4L74A 2IS1A 2IYFA 1Z34A 1EXDA 1NNI1 1A4RA 4I5EA 4TTRA 3PI7A 4HAYA 4G88A 5G4LA 4JB3A 3SYLA 1U0FA 4CV1A 4K9NA 3KJZA 5PGMA 4R1SA 3DP9A 3DOFA 2ZJ0A 3HXPA 4HMQA 2R25B 1Q3EA 3IEKA 4FM0A 1Y7LA 2X1LA 4AJ1A 5AYVA 1S01A 4LTMA 3CN7A 1XT6A 5E79Z 1PUXA 5GGYA 3DC2A 4FBGA 2I65A 5DBEX 2A3QA 1J07A 4F5DA 1G6KA 4UEQA 2A88A 1ZH8A 3KQLA 1NNSA 1X7ZB 1QHFA 3DM5A 4EB3A 4RXUA 4LVOA 2WSBA 1T2DA 3OLXA 2B5OA 3UAYA 4HYYA 2F3QA 4JVSB 3DD5A 2G72A 3IMEA 3OOSA 4J9ZB 3SMVA 3M8AA 5JADA 3DF9A 3ZDRA 4OJYA 3K53A 3R3HA 1ZIYA 1GO0A 3JXEA 2XRFA 1JDNA 3SGLA 3ROTA 3W5AA 1DU4A 4C76A 2Z8XA 3MAJA 4IJWA 2IUTA 1XNRO 1Y8AA 1KS2A 2QG6A 1J5PA 2HKIA 1NJGA 3LCMA 4LQDA 3QFHA 4L6CA 2BMWA 2OZLB 1U7TA 1YAHA 4E32A 1VPEA 2QZJA 2QQGA 2GPYA 2IQ5A 1KEWA 1YIJV 1MPTA 1BGWA 1O96A 3BL5A 1JLKA 4II2A 5EIBC 2Z43A 5CDUA 4FHZA 1LVHA 4W63A 5KTOA 3FVQA 1E79D 2QB5A 3THWB 4P4UA 1WZUA 2QLMA 3F7OA 4N5NA 1F48A 2BRUA 3HVUA 3J7AR 1FNMA 4HDRA 4U7DA 3TMYA 3Q98A 1JXAA 3AVPA 1RJ9A 1U2QA 2WMOB 3IBCA 1PXWA 1VGRA 3CRCA 4G0YA 1UAGA 1JEOA 1KY2A 2A35A 3JWJA 4JUDX 4KGXA 4MCJA 4G0XA 1E6KA 4MS1A 2GBIA 4M38A 4HWGA 3SXUA 4XLLA 2GZMA 1JU3A 1J5EB 3OFNA 4O0LA 4WXHA 3P97A 1H1LA 1GPJA 3DHVA 1H9BA 2XNSA 3G9QA 4Z4HA 3BGIA 2NXJA 1T0KB 5IULC 3UXMA 5F1KA 3LVFO 3I4FA 4BX9A 1QORA 1ZOIA 1EFLA 3BTUA 2M7WA 4W9NA 4ZVMA 2Z6UA 2WSSG 2JGAA 2ZAMA 1M6HA 1Z5VA 4XM1A 3PJDA 1FFSA 3SU8A 2JZCA 4Z51A 3KTFA 3R3UA 1P1KA 4DYLA 5JAMA 3LGAA 2Y9PB 1QTNA 4HK4A 3MXOA 3VR6A 1TDJA 1AY0A 2ZPTX 3TLEA 3L6EA 3OTGA 3QPDA 1MO6A 1M2HA 5IKEA 3Q7RA 3L0PA 3GZTB 1IG0A 5IKXA 4ENSA 2XMDA 5G1OA 2YDXA 3BFXA 2IJJA 1B0PA 2HUPA 3JZMA 1MXHA 4EY3A 2WWXA 1M6YA 5IN5A 3UG6A 1GLGA 1AS2A 4N5DA 3MWEA 2PD3A 2DWPA 4K9PA 5JROA 5T57A 4MSWC 1W2GA 1KERA 1TPZA 3UANA 3WLSA 1XNHA 5FJ4C 4R4JA 3K0BA 3I2YX 5CLHA 4DB2A 3G2IA 4ZTZB 1NUPA 2WLSA 3DYBA 3WDMA 3SHOA 1JIXA 1E1KA 3OBBA 1PQ4A 1TO1E 2XUJA 4N9QA 3VDXA 1ZMTA 2JCBA 4DJDC 4L8VA 3AF6A 4RPCA 3PQEA 2WFLA 3TF5A 4MQFA 5KUTA 3KWJA 4UCTA 3P3NA 4RKQA 2HCTA 3TOCA 4M76B 1TAQA 1JG6A 3M34A 4TMKA 3D6MA 2JRIA 2YDEA 3OA2A 3K1TA 4DSTA 4JC5A 1KQNA 3ILYA 2AX4A 3B5IA 3KBOA 1OCOC 2XKBA 1L5NA 1JQLB 4HUJA 4ZAZA 2ODEA 1VYTA 1H2YA 4XQ0A 4B7KA 4RFSA 5G1NA 2FW6A 2XMGA 2WSIA 4RJJA 1N6LA 4WJKB 2BGKA 4QU9A 2PWBA 5IKPA 4J7XA 3FDZA 1U5BB 2E74B 4BKOA 2ZRJA 5IMBA 3HP1A 4FGKA 4ARVA 1P72A 2DWDC 1QGZA 3CMAF 4HEHA 1NOIA 2CBZA 3V8BA 3S2UA 2MJLA 3WY9A 4HVCA 5DI9A 1VE6A 2RB5A 1ZEMA 5F12A 1A7UA 2PGDA 4RDHA 5MHTA 4F72A 4MHTA 5L4LA 5B1SA 4OPAA 1DV2A 4EFMA 1KNJA 2AFIE 4N7BA 3JAWA 2CHEA 4YRIA 1TKAA 4JL5A 5JY1A 1IZYA 4JI0B 1QQ6A 3TLYA 3DV9A 1ABBA 2RB4A 4R81A 1KYIA 2GM5A 2IYLD 5F7JA 4AF6A 1CJBA 4KK3A 2NUTA 3MIIA 4QPPA 4PNEA 2UYKA 4US1R 4EHKA 4A5UB 4MEBA 4Y0NA 4FMPA 4HTFB 4B79A 3P0IA 1GPWB 5GJVC 4JWTA 2KB1A 1QHSA 1XZPA 1OH7A 1SBIA 1YQ9A 4XVQA 4A6PA 3VH2A 1NLMA 4N76A 2IJGX 3NVKE 2MSCB 1SKBA 5C37A 3HC7A 2QM0A 3V4VB 2GF9A 1OREA 5IVPA 3C90A 1U6JA 4WESA 4P0QB 1DEKA 2YS7A 1IM2A 1QNFA 3N8NA 1PEYA 3L1JA 5HY1A 4CMBA 3NHBA 2JH9A 2YXBA 3H9JA 3MDSA 5LDHA 1JVBA 1CBUA 1NP3A 3CSSA 1I6KA 3ZWMA 3A3KA 4ZV7A 1GUYA 5H2FZ 2YVUA 1CDDA 2LW1A 4ERNA 2GF2A 1QZ3A 4ZGBA 1SRRA 1QGAA 4QOEA 3EPLA 1EE9A 2VF5X 2YS8A 4Y9RA 2IW3A 3X2QB 2OZPA 3DWIA 4B4UA 3PRKE 1V8BA 4CR6A 2RI6A 4OHKA 1RWVA 2PN1A 3QPAA 4XWWA 5DX0A 5KNLA 3OZFA 5DWDA 5K6AA 3RE3A 3CJQA 2ZXWC 3VU0A 3EZXA 5DM2A 4EF5A 1G8JA 2FSIA 8ABPA 4NV0A 2IUSA 1XK6A 3PDUA 4QBHA 4B6JA 1S3SA 3HMQA 4GS5A 5ICGA 2G7MC 1G63A 4XDJA 3FOZA 5JRZA 4OB8A 2QY9A 5CUQA 5FWXB 3R3VA 3TTVA 3C3PA 2IJKA 4Q1FA 4AMYA 1SVSA 4S05A 2XUGA 2R4TA 5HZHA 3MOGA 4ND2A 2GDZA 1T3TA 4IHKA 1DOHA 4WFFA 4Y6OA 2ZSUA 4LFCB 5GONB 4EITA 1F2TB 5B6PA 1DINA 1L3IA 1BOOA 4YAWA 4HGNA 4FNGA 1VCMA 1H65A 4KVAA 3PGKA 3EWAA 1GSIA 4UBMA 4X8MA 2H7YA 3A1FA 2XHBA 4KYVA 1FYDA 4LJKA 4JTDB 1TD1A 3VVCA 3N07A 2M6YA 4D26A 4WNCA 4GQAA 3D6JA 2I9KA 4U7OA 3GP3A 2JIDA 3LQ1A 1YUBA 2WQ6A 4WOCA 4BBJA 4I1PA 5TARA 4P4SA 4BQFA 2Z4RA 1V7PC 3HQ4O 3NIDB 5DNWA 4LFAB 3RREA 2Y05A 5ALQA 5A6SB 5E2BA 4H7KA 2PT7A 1X1SA 4K05A 4URXR 3TZEA 1KMCA 3NHFA 1KAEA 4PONA 4F4IA 2YFKA 3HCNA 3GLVA 3A1DA 5F4ZA 4EJ2A 3ICPA 4DV7O 4UBNA 4JI3O 1VLHA 5ALVA 4HUQA 3NAMA 5DFAA 2R44A 4MYTA 3PIIA 1FFEA 2BM1A 2ZODA 2OK7A 3IILA 4HGZA 1JDPA 1UBHS 1NG9A 4K6MA 1SD2A 5KVVA 4QG3A 2VDWB 3EEOA 3E22A 1I13A 4QE7A 4P2BA 3UJHA 3ZTWA 4KI7A 4D0LB 1MZPA 1PPJH 1GG2A 2WOOA 1NQTA 1QV6A 4NQ3A 1SR8A 2F48A 4BEVA 3GEEA 1MHTA 1Q6HA 2Y1WA 3QE4A 1QLEB 4IFEA 5AOCA 3QKRA 1UQRA 4HLUC 4OHMA 2Z0AA 4HRVA 5EEGA 2ZVJA 3MHHC 1GNTA 2XAFA 4OQYA 4QTYA 4BNWA 2QE7D 3AG3B 2SHKA 4DDTA 4X85A 3CC4V 2PMCA 3FVRA 4FN4A 4FLTA 2XODA 3TOXA 4EM6A 4NEGA 3RVNA 1K9MW 1WB7A 4GI3A 1H42A 1YMQA 3S81A 2OC9A 1HKUA 1U8AA 4XAQA 4DLYA 1ODKA 3GMIA 4MUNA 5ERXA 4CKXA 4LUCA 3MRXA 4DRXB 1ZX3A 4CEJB 5LQKA 4ZD6A 4JP1A 5JCJA 3STWA 2I4RA 1Z2CA 5IABA 1JWBB 5FQNA 5NLLA 1P1BA 1GCIA 4HN2A 3OM8A 3AY0A 1M2EA 2H5IA 1BS3A 1E9VA 1VL2A 3OQNA 2G1AA 4G4IA 3VQWA 1DBIA 3VOSA 4XVHA 2JGEA 4ARSA 2X6AA 2L17A 3CNEA 3P2IA 4U6SA 3RLFA 1ZWIC 3D4IA 5BN4A 1YI1A 2PX2A 1LDYA 2N1MA 4BW0B 4JENA 2XVYA 3ZKWA 4C04A 3OG9A 1Z33A 1A5BB 2EG5A 4FWTA 2E4XA 1GUBA 2JFXA 1D4OA 4MKFA 1A88A 3U17A 2RC5A 4YXWD 4UATA 1FE8A 5HOQA 3A0RB 3E2IA 2D2CB 3ZMSA 4X88A 2JLAA 4RIFA 1AZLA 1J39A 5CB4B 2UUAB 3D3KA 4QA9A 3PR1A 3FM9A 3DOUA 4G26A 4P31A 4QPZA 3ZMVA 4UAGA 3N6RA 2V6IA 2NSLA 3WRYC 2P2SA 3BFRA 4KU4A 3UCXA 3DHYA 2RGDA 4TWRA 4IGAA 2J4CA 4JV5O 3CSDA 1RYBA 2IV2X 5AK6A 4LYAA 3NC0C 1PNMA 4YRBA 3FVTA 3MPOA 1W5TA 3P9ZA 4MVMA 2ZXUA 2HCJB 5JE8A 1DKNA 1XZBA 4ZVTA 4K8ZA 4G9GA 1G2OA 2H2WA 1QLNA 5ENVA 4ASUG 1ESNA 4YO7A 3OLYA 2G04A 2GK4A 5JJNB 3ZIUA 3NUQA 4PLGA 2G9UA 1SXJC 3OX1A 3B53X 5K0GA 2WKWA 4B3TB 4CTMA 3ZWDA 8GPBA 4FWBA 3L7NA 1A2OA 3BFKA 4D4JA 4I36A 2CY0A 3K0FB 3LPLA 5K0CA 4C7MA 2ZE6A 3CCMF 1ZN9A 2QUKA 3W8NA 3E8FA 2Q8NA 4O3FA 3LDGA 2C77A 3LSUA 3D3JA 1GMGA 5EZ5A 1P31A 3FLBA 4B17A 1X38A 5K05A 1Q81W 4IF6A 2YMMA 4X63A 5DNCA 1YUMA 1D2GA 4AUMA 3ER6A 2VYND 2HAEA 2B7BA 1Q86W 1JSLA 3H1JH 1DJMA 2GCNA 1BVHA 5KB3A 3R7WB 1TNDA 3KT3A 1JEQA 1OFTA 5A4FS 5IDVA 2Q69A 3OFKA 4MWEA 4X44A 4I1OA 1MVLA 2GSMB 2P2NA 3PNOA 5H68A 1ZL8A 1CUFA 1DEOA 2Y3IA 1AROP 4INPA 3BSWA 5JHHB 2CUKA 4CDNA 2Q99A 2W2XA 5AOBA 1EQ2A 3V55A 1QIIA 2G4CA 1JEJA 4JL6A 1NI4A 3K16A 4JI8B 1B1CA 5FT9A 3O7MA 3M6FA 2C1XA 1XR3A 1MLDA 5GJCA 1XAHA 2INGX 4ME6A 2QM3A 3FIUA 4L3WA 4OY3A 2QLLA 4WDQA 1J00A 1ZGAA 4GAEA 2FQ1A 3THYB 2C42A 2CYAA 2ILMA 1IXRC 1EGHA 4CLRB 2V1XA 5ALMA 3KYCB 4RTMA 3KO8A 1F2UA 1QQBA 1AZWA 3NFYA 3OBIA 4RULA 5EEHA 1K06A 4DK1A 2ZPAA 4ZZIA 1VIBA 1SURA 5BV7A 4HS4A 3EG9B 1PM9A 1K8AW 3WMFA 2EERA 2PL9A 4F9GA 4ABMA 4I1RA 4X54A 4LF8B 5EBWC 3WAKA 1MJNA 2EZ8A 4J1QA 4KFMA 1CNEA 4BMPB 4FI3C 1J21A 4FLUA 2I6RA 4RTKA 4XVUA 5EIFA 3IIEA 1G6OA 1U43A 4P98A 1LDNA 1T8YA 3CO5A 2ATXA 3C97A 3WGMA 4W9MC 2Z98A 3B5JA 3QXHA 3V33A 4EX6A 2IHUA 5GM2A 4DV2B 3HAXD 2VLIA 1JE1A 3UUFA 4CUKA 1X8KA 3TJRA 4ZVOA 1AB3A 1EBBA 4CQMD 4BE4A 1NQVA 2EINB 2QNIA 4JYPA 3AW8A 3CWQA 4H7DA 5DLEA 2Z6QA 1ZSYA 2A59A 3C7DB 4AMGA 2HP8A 2A14A 3KT8A 4GMXA 1JU4A 1U2DA 3G2HA 3N2YA 4LMRA 1WY5A 5ALKA 5EJMA 3IKTA 1ZINA 1NVPB 1W88B 3CF0A 4KQKA 2HB6A 2VHZA 2CH7A 1CUJA 3WQHA 5DVZA 1C7QA 4DL9A 1KSFX 5J59A 1QO9A 1UF9A 4URZR 3T4DA 3BCUA 2FYUH 2QUBA 1FRFS 3B2EE 2QV0A 3V2UA 3PQ6A 3EY4A 2YY6A 4BV8A 1HM5A 2XE6A 2BYTA 3ZP7A 1T4CA 2QTNA 3G6EV 1KDRA 3WLMA 1FMJA 4MHOA 3L7IA 3F9RA 3ZXSA 3G2QA 4RDIA 5EY5B 5F64A 1KJ8A 3CR8A 2JGLA 1N5IA 4FZRA 3QTCA 4JBNA 4JP8A 2ZI4A 3OIYA 1OTYA 4YT5A 3WYAA 3L02A 1E4OA 3FTFA 1MABB 1HPLA 2WM8A 5FYQA 3V32A 4EJSC 3M5WA 2OKGA 5AW2A 3C6BA 3RU2A 4BX8A 3UFBA 1SZJG 4CZZA 1TI7A 3FUXA 4X1KB 4O4LB 2WYWA 1OPRA 2RGNA 5ALFA 3VAAA 1JLHA 1OWNA 4OUDB 4KQ2A 2ZVPX 3FGZA 1B2RA 1J5EO 4LNHA 4NE7A 5J4HA 2UVPA 1YKSA 1WIWA 3ESBA 5CT8A 4NCXA 4E1VA 3CRAA 4RELA 3FCYA 2FK7A 3W5SA 3T5TA 4DMHA 4Q20A 4L2IA 3OE7A 1M2GA 1JDUA 4AT1A 4EW1A 1LD3A 3GCDA 1JQKA 3I9OA 2C2WA 3NK6A 4KJZA 5E7MA 2Q6VA 4IIUA 2EGUA 4IOLA 5HTKA 4HDAA 2GBGA 3H18A 3CISA 2JCXA 1PX0A 3LFTA 1SQFA 3H6GA 4UNRA 3L0SA 5LP6B 3PQ3A 4WCFA 5HS4A 4KFCA 3ZWYA 1YR3A 2OWEA 4TWJA 2J48A 3NIWA 2ZIOA 5F7ZA 3D0QA 3EMDA 4NPAA 4BVJA 2CK3G 1WHSA 5CMLA 1E7SA 2AB0A 2ZR3A 3VDMA 1C3OB 3I55F 1ZCAA 4G4SO 4NBVA 1KC8H 3VSEA 1VQLF 3Q7SA 3VJMA 4ANFA 4LRQA 3BULA 4Q9HA 3S1SA 4R7GA 2QRQA 1E1QG 1DSSG 4FN5A 1AKUA 2AIZP 4I7ZB 1EE2A 2JLCA 1F2DA 3QG5A 4F1WA 1V4NA 2C9ZA 1EVJA 5EXSA 4ZHSA 2P8JA 2XR1A 1PNQA 3OAAG 3ENKA 2QUHA 2X9LA 1BXGA 3CN9A 4TXNA 3G80A 2XT6A 1J70A 4EOGA 2IY8A 3W1EA 1YQEA 5HJ2A 3IUMA 1QIJA 2P40A 4TTSA 2EV9A 4PDMA 3RD5A 4L76A 4Q01A 3F97A 4FLMA 3K2IA 3L0IB 4YRQA 3LHFA 1EFVB 4IIFA 2XBLA 2OT3B 3VBEA 1Q83A 2BKVA 2ZDIA 3R20A 2QVXX 1T3HA 1RM0A 1P6UA 1NF2A 3BHMA 3ENWA 5LM3A 1OZHA 4V0ME 2J3QA 2GAJA 3K6JA 3OOYA 2QLFA 2PXCA 4DLZA 1Y1RA 2Q3CA 3KU4A 1CE8B 1JDVA 1SHUX 3VYWA 4IVRA 2ZJAA 2ACEA 1NLYA 3VISA 2DM6A 2QUJA 3PP8A 2PLRA 1T1RA 3G2NA 3DUFA 1P4SA 3ZH2A 4LJ5A 4LEIA 5DE3A 4D74A 4HWSA 4KSBA 2X1HA 3C85A 1F38A 4CH5A 5AW8A 3WBKA 1FVXA 2C7VA 2VSXA 1M66A 2IXAA 2XQVA 4F7DA 3G2JA 4EW3A 2ZJ6A 1GM8A 1G3RA 3TEMA 5L3ZA 4KXQA 3CCSF 3QOFA 5LNK1 5DI3A 4PHGA 1S77D 2GJAA 2O3UA 2QTRA 1WW8A 3Q1LA 1O5TA 3U44B 1DCMA 3COPA 1L7OA 3RFUA 4RJKA 4ZQGA 2OO5A 2BO1A 1XLUA 3HLKA 4DCCA 3QEOA 3V8VA 2HL6A 5JO9A 5SZHB 2BEKA 1H85A 4TWIA 2Q3BA 3UCFA 2A9VA 3IT0A 5AHKA 3STUA 1KQGA 1ZNZA 5BVHB 3DDUA 5HP7A 2R9IA 4DWOA 1XDWA 4YJ2F 3HI6A 2VP9A 4YJ2A 1H94A 2ZWPA 2RBGA 3I2GA 3VX3A 4LV5B 3GVHA 1KZ9A 5B57C 3C3AA 4EI9A 1XHEA 2Y48A 3JAKB 1ENVA 2V55B 3QPWA 3TMAA 1C41A 1X1AA 4G5SA 2PJRA 1DKRA 2GWHA 2X6BA 2X77A 4FM9A 5F23A 3GF4A 4FHDA 1WZNA 3KQYA 3QYAA 5CAEB 4YP0A 3NATA 1EFHA 2LO1A 1WJGA 5KQLA 1X8JA 2C5LA 2W2KB 3H7IA 3OQHA 3TQCA 2EEZA 1H5NA 3URMA 3MGAA 2OA0A 5HKKA 1H69A 5TV2A 2C83A 2W00A 1Z7EA 3J81M 1WA8A 1SIWA 1XTQA 1U63A 2X9NA 3MB5A 2LWIA 1B16A 1KA9H 4BQQA 3ZY6A 2QGNA 3EPHA 1JEYA 1F8YA 4JTCB 1SULA 4EHAA 1TYCA 3T4UA 4B75A 5HMMA 3JCMM 1L7NA 3S55A 4EG3A 1PR9A 4EHLA 1EB9A 2BFMA 5G0UA 1PCXA 1N75A 2HS3A 4LS3A 5E9JA 3G7NA 4L4RA 2YWGA 4M21A 2OV6A 3WWCA 1KDOA 2E49A 3FMOB 4HZUA 1GD1O 1LDMA 5JC1A 2MSKA 1ISRA 1AR1B 4XB2A 2PGGA 5L3QB 4ZT3A 4LFCO 4ZQIA 5JSFA 3X2EA 3FNEA 4PTYA 3JVDA 3LSYA 2OORA 1P2VA 4L27A 4D79A 2M2IA 3IJRA 2IPLA 5HUJA 1MB4A 5M3BA 2WHPA 5LQUA 2EEPA 4F4DA 2J8ZA 1E89A 2A9JA 4Z8YA 2PG3A 4LXUA 1YDHA 3FOEC 1JRLA 3CYQA 3H1BA 1D1PA 2XOEA 2GPNA 2CSLA 2WF5A 4LFAO 2CLMB 1YDMA 2PTHA 1J1IA 1T5DX 1DCTA 4RORA 3RB8A 2CJWB 5BYBA 2WZCA 5L95A 1AV6A 4PGHA 4ZQEA 5T4FA 5FBLB 4S04A 2PO5A 2Z5FA 3OCZA 1T13A 2QRHA 1OLSA 1KZ6A 2AQ8A 5G41A 3EH2A 4B45A 2IYVA 5B55A 3IP9A 2B1QA 2BUBA 4I46A 4FMDB 1T5IA 4O1IA 2CMHA 5FQOA 1KVUA 4UOQA 1YB7A 2QAGA 4ZZ1A 2Q1UA 2XMSA 3H19A 3LF1A 5H8WA 3ZHYA 4K26A 4LXXA 4NU8X 4PA7A 5FNVB 1XOIA 1FSZA 3OJXA 2DVMA 1UDRA 3WNBA 3SJ7A 3WFVA 3I3FA 2ID7A 2CKDA 5TVKA 1II8B 4PW0A 2XKJE 4R2JA 4D3XA 2I33A 3HYNA 3IIJA 1DO2A 1RM1C 3ZNOA 4NB5A 4B31A 4CJXA 5TLSA 1ACLA 1P0FA 2N0SA 1HLDA 4D82A 3QJ5A 2FYTA 3CCLF 4M1KA 4DDVA 2BFAA 4IG9A 1CRQA 1Z5UA 1W30A 4A91A 2WB4A 3FD6A 2HQBA 2H1FA 4L51A 2CSUA 2QRLA 1YDEA 5JZVA 1VDZA 1I4DD 1IHPA 1L8XA 1IM5A 3SZLA 2VXYA 1EFRD 4X3MA 4IL6Z 4RAQA 1RABA 1ZJZA 3QU5A 4JJAA 1GL3A 1V8DA 3GARA 1QC5A 5E38A 6CHYA 2QHXA 1B23P 3KQUA 3K4QA 3UN1A 1VCIA 3B1XA 3PXAA 2WSLA 1U0JA 2YJTD 1SXPA 3CPEA 3AG4C 2K2WA 5E9QA 4I4CA 4MVQA 3AOGA 4PAMA 3OSZA 1YJWV 1ONNA 4PG8A 2Q0HA 4KAAA 3KQKA 5LIPA 3TZKA 2CMKA 2HSZA 1NBWB 3HJWC 2VYCA 1W6UA 2QI2A 4GZ5A 4R1MA 3IULA 5IPFA 4QYSA 4R3UC 3PCXA 3SZUA 1AZTA 1TL7C 3W04A 1XDGA 3FPFA 3IALA 4A4DA 3WYCA 4Q3AA 2QUIA 4R2KA 2O8DB 1RQ2A 2FW8A 5TEWA 3KD2A 3SVZA 3QA3E 5J3JA 1KBZA 6Q21A 1W36B 3BXGA 3L1UA 1CJSA 4U63A 4B3DA 1K2WA 1A9QA 3BH0A 2WKRA 3KYDB 2HWWA 5KAIZ 1CC1S 5LDGA 4ENWA 2IEZA 3B3JA 4KFRA 5A7FA 4DV7B 1YHYA 3PFWO 4JI3B 2PO7A 5A1TA 4HDNA 4KXLA 3UMBA 2FCRA 3C6ZA 3OZWA 4FEGA 1T9BA 3TZCA 3EFFK 1VIYA 4IEFB 3DM9B 4WINA 2AZ0A 2VJMA 5H9WA 3IMFA 4LPKA 1VHWA 3C1AA 3AF1A 3BHJA 1NS1A 3BRSA 1GL9B 5KVQA 4DCGA 2XTAA 1U2PA 4WZAA 2XVXA 2P6JA 3OEEA 1D0IA 1Q0SA 3ZZTA 2A5LA 5DNYB 1LKZA 2O8EB 1ORIA 3IBSA 3IDSA 3KL4A 1FD9A 4WFGA 3TJTA 3DAOA 1J9EA 1W1WA 1G5FA 5IJXA 1P7VA 4IFIA 1MU0A 3E70C 1G21B 4AURA 5JARA 3T4PA 1TCAA 5TC4A 4R7TA 5F1OA 4QDOA 3UMMA 2IEGA 1H0SA 1UR5A 1O97D 3KM0A 2DYSB 3WKDA 1VPWA 2WD7A 2C03A 2IQQA 4AG6A 2FMXA 1GUDA 4D3YA 1E8DA 5LMZA 5AKZA 4C6TA 2XNDD 3AFOA 1GYPA 2Q5HA 3D1JA 4MUGA 3NWOA 4YUYA 1DFIA 3EGDB 3OE1A 3Q2IA 4KH0A 3B13B 2KS6A 1S96A 4P0PB 4JI8O 1EXWA 1H2BA 3TNLA 2D1SA 3SJQC 2A79B 4JR0A 5FORA 5FOWA 3GAAA 4FYPA 2PLNA 2X76A 3GL9A 1KWGA 2J5RA 1YL6A 3FROA 1T8RA 2ZANA 1KO8A 4R54A 5BYJA 3V8PA 5KOJA 2V7GA 4CR8A 4B6PA 3GJ8A 1H8EG 4EMSA 4NU6A 2H6LA 4TOIA 5E7IA 1WXIA 5C32A 4JD5A 4KUGA 4B43A 1JKIA 3Q7PA 4BYMA 3QJYA 3F7VC 4B2IA 5CCXA 4MOWA 3BWDD 1JYSA 3LSTA 3EWIA 4YI3A 5H3LA 2WYIA 2EKPA 3UAXA 4E5KA 3GGPA 3ROQA 2GAIA 3NJRA 5H02A 3HGQA 4Y2XA 4JIMA 1Z6ZA 3DVAB 4CCSA 2XX3A 1LI7A 4Z3KA 3B1YA 3CE6A 3IPCA 4KL8S 2YKGA 3KQNA 2P9BA 3NC4A 2PPVA 3B6KA 2KG7B 4JV5B 1TRHA 3LWDA 3L79A 1RRCA 3H7AA 4R71A 1AH2A 1EGMB 2PX5A 4PC2A 3V2GA 1QK3A 2OHIA 2FSPA 2XF2A 5E6SA 2AKYA 4EDFA 1E1RD 3RWBA 4G89A 5CA3A 5CFRA 4ES6A 3ZNQA 2GEFA 1F60A 2FUG1 2XSZD 4OJMX 2OCBA 2Q6LA 1UXOA 3ICXA 2HV8A 3HCWA 1JDJA 1ZCJA 4U3JA 3ESCA 3I1IA 1VQNV 5JZ9A 2QW8A 1LLCA 5JY6A 4JJIA 4CF6A 2EJUA 3Q7TA 4XASA 2JLWA 1U98A 3GB7C 4QTZA 4Q21A 2PM8A 4IGKA 1OC2A 4EF4A 1AKVA 3RA5A 3Q5EA 1LJLA 1Z0DA 1XB2A 3IO3A 4Z86A 4F06A 1M33A 4UD6A 1PU2A 1KO1A 4NS4A 5K8IA 5MF6A 2JH3A 4J16C 4CM9A 2C5FA 1BEUB 2NXNA 5I3ZA 4YJGA 5FPQA 3IURA 1WCXA 5D86A 1Y74A 2BFCB 4KC0A 3SKXA 3TDKA 4CV0A 2G40A 6REQA 2IU6A 5GAJA 2JVKA 1X3SA 4AULA 5BN1A 1VLJA 4TZ6A 4ZA2A 5JISA 3CR3C 2NO4A 5HDQA 5G3ZA 4FBMA 4DLTA 1W5FA 3N5CA 4OLFA 1ECLA 2OTLF 2UXDO 1NDHA 2N74A 1Z75A 1W96A 3LX6A 1ORQC 4AKSA 1QIEA 4JLBA 4ZOQI 3VJKA 2ZVDA 4HR7A 3P2KA 1PZNA 4DIBA 2Q6AA 2VJAA 1EZVH 2I4NA 2HC9A 3I58A 3K32A 4O1HA 1SK9A 1UH5A 4HYQA 4AY2A 3ZI0A 2QX6A 4FPXA 1M72A 5IW8A 3SIRA 2WA4A 2J9FA 3OQ1A 1C0EA 2AS0A 1IQPA 3ETCA 1EK6A 1BEZA 3TRFA 3LWPC 3D4PA 4IOKA 4OF4A 4H1VA 2RJOA 4R1TA 4RQFA 4I1YA 1JE0A 3STVA 2JB9A 5K4AA 4D4GA 4RHTA 1W87A 1RI4A 1XXHA 5EE3A 1DPFA 4RYDA 4BFSA 3BPSA 3OW2F 1R3UA 1N8NA 3KLMX 2DRIA 4ALMA 1R66A 4EH1A 4MROA 3HJNA 2UZHA 4JNCA 4DV4B 3ER9A 3DBRB 3GLKA 1C1XA 2PJZA 2H6EA 3TE6A 2Z2YA 3IKMB 3USES 4QSMA 3BGSA 4BIOA 1R27A 1YJ8A 3P0FA 2JGKA 4OQXA 1WW3A 2XE7A 1ZRMA 1YB5A 3SEAA 1OT5A 4AAYA 2UYGA 1FIUA 4TYPA 2ODAA 1Z4MA 4QNNA 1TZCA 3F7TA 3I5MA 4ZO4A 3GFVA 3PQ7A 1JBQA 1TCVA 1RT9A 3V9AA 4EHJA 2IH2A 1M56C 3HBJA 2O0HA 2JZNA 1NKDA 3SC3A 3UT6A 4YAUA 3PT9A 5IJ9B 1XTSA 5FPTA 3TINA 1NOKA 1YVDA 1TEXA 5AW4A 5ITZA 2WYHA 2NP7A 1GZUA 5MN5A 1B42A 3KE9A 2R8ZA 3GLQA 4BGDA 4RWZA 3SC2A 4A0RA 3FWPA 1CR2A 1R8SA 4XIGS 5JAUA 1TEZA 4EG4A 2D0PB 3UT5A 4GC9A 2C5AA 3D2BA 2Y1LA 4MKRA 5IXSA 3KQPA 3DMTA 3ZDXB 2O2XA 1XN1A 3DMYA 2EWMA 3OO1A 4GNRA 5CNKA 4C2UA 1XRGA 1TVKB 4IIJF 4WLFA 1VIAA 3HXOA 1NNEA 1ZC4A 4IIJA 3REQB 1KI4A 1RZUA 2Y1KA 2XPCA 3IHWA 2ASEA 4HXYA 4W7IA 2IYPA 2EBWA 1OXXK 5ALZA 1J9GA 3ZD6A 3H1EA 1IQ0A 3BWCA 5L3CA 3DR5A 4DM4A 1LBEA 3DLBA 1AUVA 3CYFA 5DEIA 1XBLA 1DE0A 2HTFA 2QM7A 3GLUA 3RC9A 1BXKA 5JCOA 5L53A 5E3IA 4HEA1 1Z68A 4XIIA 1HUQA 3UT0A 4QATA 2Z6VA 3L8YA 5EXTA 1E1YA 5CX1B 1ABFA 4A6EA 2E75B 1Z74A 3NTLA 5JS1A 4FT2A 1CVIA 3LWQC 4X41A 2WTMA 1BDIA 3TJMA 4D8VA 5J43A 3AVXA 1OCCC 4HTAA 4EG8A 2QQFA 2HREA 4D9HA 4XDYA 4CRWB 3K03A 1FRQA 1T1GA 1HXHA 4UOEA 1Y6QA 3NCTA 2Z8ZA 4O02B 5HFNA 4EB6A 1OLUB 4D0SA 3H8VA 4EGCB 4EG0A 2QRZA 3B9PA 4NBWA 2O57A 1TQDA 3JVIA 1L7VC 1V54C 4R3NA 5C34B 2C4KA 1SMKA 4JK3A 2R60A 3BILA 1PKEA 2VSQA 4BFYA 4KE7A 2Q6TA 3KB2A 1E79A 4MLZA 3PUWA 1P8AA 4MP8A 3MUNA 3L0CA 2HDWA 4GYYA 1MBZA 2WILA 1QRSA 3BMQA 4G4YA 4IDDA 5MFPA 4Q24A 4LN1A 3ZHQA 2HNAA 3WC4A 1Z88A 3RIEA 4H2DA 3LQYA 4J4HA 3ZI7A 2DQKA 4HGYA 1JAHA 4TLEA 4IZHA 2V7WA 3ANNA 2PMKA 2F43G 1FSGA 2D5BA 3AU8A 2O3JA 1G8AA 1P6XA 2BSQA 1PZHA 3FG9A 2WLLA 1BWQA 1XX6A 2XDYA 4MPDA 4YMSA 3W8RA 1PIWA 2B8WA 1R3JC 2WJHA 1BC5A 4DSAA 5EHQA 4DBVO 1QGYA 1W0KD 1JHZA 5AM0A 2Z9CA 3TQRA 1YXMA 4O8CA 1IEWA 1T1JA 1RWQA 1A95A 3JAMN 3BWXA 1LZKA 2V6JA 1L5LA 2VOJA 1GM7A 4R83A 2QNRA 3ETHA 3HDQA 2PJDA 4C3VA 2YRXA 3V46A 2D5IA 1XTZA 4QDKA 5L6MB 4E5UA 4W5NA 1AP5A 3W2TA 2E4ZA 5KAPA 4UMEA 4P9NA 1MEJA 4DT1A 2W2VA 2PUFA 1WU8A 5KCMA 3EDCA 4RNCA 2YWBA 1N4AA 4E4EA 3R0XA 1TVCA 2IIBA 3C6KA 4EVRA 3TTSA 1HYBA 5C80A 3HB7A 3QVGA 4A0GA 4EKDA 3B9BA 5DM0A 4OJTA 3D5QA 3PLNA 3T1HO 3IA2A 2FN8A 2FQQA 3VPCA 3MUEA 3UJAA 1TA8A 1GLVA 1J25A 4WT7A 5DBHX 3SJBA 3AU9A 1F0KA 3LUFA 1FU4A 3EXIB 1XEQA 5A06A 4G0OA 3GUCA 5JJJB 2I6TA 1YB1A 2JK5C 1OAKA 1XNJA 2DWOA 3HKDB 1UJ6A 5TT0A 2A0FA 1A4UA 5BN3A 1ADBA 4RHUA 4L57A 2DLNA 2WLKA 3FCEA 2W83A 3AEUA 3L8MA 3WK6A 3OC0A 1L8DA 3TIFA 4M9CA 1FPQA 5JAQA 5LDDC 3KVRA 4LRWA 2B37A 2Y93A 1B7GO 5C1DA 4FOLA 4FB4A 3L72H 3CW2A 3EPRA 4Q18A 2XZOA 3C3YA 3MC1A 2JLRA 2H4HA 3JASB 4EKEA 4EUHA 2R48A 4JT8A 2VS0A 2XWPA 5F7XA 1SNYA 1FNNA 1AK2A 2NNWB 5A9RA 3VAZA 2HJHA 2HWUA 3ZD9A 2KW5A 1IOLA 3P9YA 4ZMBA 1Z6TA 1SF9A 2YHAA 4V0QA 3TL2A 4KZKA