4WBNB

Crystal structure of tubulin-stathmin-ttl complex solved by native-sad phasing
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 178
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4wbnB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4wbnB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4wbnB01
1JFFA 1SA0B 1FFXB 4HNAA 4I55A 4O4HA 5JCOC 3RB8A 4O2AA 4EI8A 4O2BA 5LP6C 3HKCA 4M8IA 1RQ7A 4LNUA 1FFXA 3JARB 4I55B 2XKAA 4O2AB 3JASA 1OFUA 4FFBA 3HKCB 4ZI7A 5LA6A 4LNUB 3E22A 3JARA 5MN6A 5J2UB 3JASB 2R751 5FNVB 4FFBB 4ZI7B 1FSZA 4X1KA 2RHOA 5LA6B 5IJ9B 3E22B 3RYFB 5J2UA 2RHJA 3WGNA 5FNVA 3JATA 4X1KB 5KX5B 4X1IB 5IJ9A 3WGMA 3RYFA 2Q1YA 3VOBA 4B46A 5LP6B 1W59A 3JATB 5KX5A 4X1IA 4B45A 5M7EA 5KMGB 2BTQA 3C8LA 3ZIDA 5LP6A 5GONB 5ITZA 4YJ2B 5CB4A 5KMGA 2BTQB 4TV9A 5GONA 5ITZB 4YJ2A 5CB4B 3WGJA 3M8KA 4I4TB 3M89A 2VXYA 4TV9B 4U39A 3VOAA 5EIBD 2VAMA 1W5BA 4I4TA 5CA0B 3JAWB 4ZOLA 3N2GB 2R6R1 5CA0A 3RYIA 5MN5A 3JAWA 4ZOLB 4YJ3A 2VAWA 3N2GA 3HKBB 3RYIB 5LXTB 1Z5VA 5CA1B 4YJ3B 4KWEA 3RYCB 4O4JB 3HKBA 3HKEB 3JALB 5JQGA 5LXTA 5IJ0A 2VAPA 5CA1A 1RLUA 5LOVB 4IHJA 1TUBA 4WBNA 2BTOA 3RYCA 4EI9A 4O4JA 3HKEA 3JALA 5JQGB 3VPAA 5IJ0B 4IIJB 3V3TA 4XCQA 5LOVA 4DRXA 4IHJB 1TUBB 4WBNB 4ZHQA 1TVKB 4IIJA 2Q1XA 1W581 5BMVB 3RYHA 4DRXB 1RQ2A 2XKBA 4ZHQB 4E6EA 3N2KB 3JAKB 1TVKA 5JVDB 5JH7B 5EIBC 4U3JA 5BMVA 3RYHB 2RHHA 5EYPA 3N2KA 3JAKA 5JVDA 5JH7A 4U3JB 1Z5WA 5EZYB 3CB2A 5EYPB 5C8YA 5LYJB 1W5EA 5JCOA 3UT5B 5EZYA 5IYZA 1W5AA 2RHLA 5C8YB 4X1YA 5LYJA 2GVIA 3WGLA 3UT5A 3VO8A 5IYZB 3ZBQA 4EI7A 5J2TB 4X1YB 4I50B 4DXDA 3HKDA 4O4LB 4O4IB 4TUYB 4F6RB 5MN4A 3R4VA 3VO9A 4X20A 5J2TA 3WGKA 4I50A 4EB6B 3HKDB 4TV8B 4O4IA 4O4LA 4TUYA 4F6RA 1W5FA 1SA0A 1JFFB 4HNAB 4X20B 4O4HB 4O2BB 4EB6A 4TV8A 3ZBPA
chains in the Genus database with same CATH superfamily
1U0RA 4MPPA 4P7GA 3UFXB 2E18A 2VJQA 1HG1A 3C45A 5IW8A 4C7OB 1KA9H 1LLUA 3MJVA 3AW8A 4GU5A 2B34A 2NQ2C 3GJRA 4JBLA 5DU2A 5ES3A 4LNUA 4ENTA 1EK1A 3BCCH 1SQGA 4WUTA 3WIBA 2PPVA 3S81A 1HX7A 4RA6A 3ZDZB 1CDZA 1IXSB 4PZZA 1P7BA 3GRPA 1UMBB 4XUDA 3SIRA 5TEVA 3ETQA 4FZ5A 3DNFA 2GRUA 2FFQA 2WWGA 1QS0A 4M53A 4B2YA 4DCTA 1FLVA 3L4SO 1JQ3A 2C4KA 5LA6B 3QV1A 1EZZA 1Q84A 5HP7A 4HDSA 3V7WA 4IKPA 1ID8A 2DLDA 3H1IH 3L73H 4N8SA 3IAM6 1FXHA 4MUEA 3TXXA 5DNYB 3EPJA 1C14A 2NO1A 1THGA 2G06A 3HA2A 4K9OA 3UPUA 1FOEB 2P2ZA 2X4GA 2YFYA 3O7MA 5JUWA 2QV0A 2WKQA 4ERXA 5LM3A 2YY6A 1BO6A 1W46A 1TJ4A 4LHXA 5DCUA 1F7VA 1C3LA 1KDOA 2NAFA 1J9EA 2DUJA 3TGLA 4HLQB 4LOJA 3MS4A 1S96A 1BZYA 1VQMV 4KW7A 2FSVA 3ORQA 3VTKA 4OU5A 3WJAA 4DUYB 2C3OA 2G04A 3OWHA 1ZJJA 5SYAA 2PG3A 4BP3A 5IT5A 2G8NA 4LCEA 2Q3HA 5TMPA 3IP8A 4QPKA 3AERB 4LHSA 3RUAA 1P0CA 3U4QA 2A7WA 2GN6A 2J9FA 2YFKA 2QL7A 5EWJB 1URFA 1V8FA 1M1KH 1VMAA 1VP9A 4MK4A 2RH4A 3ZDFA 4A4DA 4FB5A 4I3GA 1BYUA 3SYOA 4NI5A 4EHAA 4QE9A 1P91A 3HE3A 3IMKA 1U0BB 2F43A 4N49A 1E0AA 1KFBB 1UMCB 1YSCA 4Y6GB 5G41A 2ZUSA 2AUNA 2PXAA 3HU2A 4MRMA 4QVGA 4KQEA 4OLBA 2P1RA 2OB2A 4WUVA 5EIFA 3JCZA 3X1YA 4HY3A 2WIBA 3PNQA 3PTZA 4FLWA 4P84A 5D6NA 4RGQA 5ICEA 4P4GA 1XILA 3D3IA 2KTVA 1P1KA 1NTMH 1PT7A 3FJOA 1W6UA 4BEVA 1XA3A 2DWDC 4B6FA 3CVWA 4CKEA 1EGMB 1XF1A 2I2AA 4D4JA 4BVKA 1YI8A 1XQ9A 3KZMA 3KQOA 4P9PA 4BMDA 3NKFA 4EFLA 5FUMA 1E6UA 5BOSB 4X6XA 1H2AS 2ODQA 1ZGZA 4MQ6A 4CLEA 4P32A 1IXZA 2BMJA 4LZOA 2O8CA 2QE6A 1VA4A 2CJWA 1NMQA 2R8YA 4M8NE 4PZYA 3DDSA 2IOFA 2XF8A 2FZ5A 1MVOA 3RYHB 5KTNA 1AE1A 4UMVA 5A1JA 3G1TA 2PA3A 4K9SA 1ZITA 2IF2A 1SBTA 5BWMA 2YS7A 5BWBA 5HE8A 1JVNA 1Y98A 2WTMA 4JEHA 1HW7A 4DQ0A 3AF5A 2DPMA 1FL9A 2CLKB 1MC1A 2E87A 4FMDF 1DUVG 4RTJA 3FB5C 4KE8A 4GPAA 2EULA 1U2GC 2SKDA 1JE1A 1H0RA 4N12A 1XZMA 1UBEA 4RZQA 2IJKA 1MPXA 1UK6A 3WK5A 2BO1A 3KEGA 3F67A 5B3JA 3KKEA 4MGZR 1LPBB 1MMFB 1G66A 2HPAA 2HSDA 2PXXA 4LVNA 5DRYA 1MT0A 4QYIA 5J59A 3U17A 1Z5PA 1IJFA 1X59A 4EF6A 4L87A 1W8DA 3AQIA 3F5FA 1TEZA 4A8PA 4BQPA 3W6UA 3C3AA 3W8NA 3MMXA 2C5LA 1E9RA 3CF2A 4Q03A 5GAJA 4CT0A 3PTLA 3RK4A 4C22A 2BOCC 2AMFA 2R4QA 1MFZA 4RFLA 1E64A 3A04A 3WVNA 1YCDA 1CXZA 3U4HA 4Y1RA 1CUBA 2E85A 4GWGA 4OLFA 2IYEA 4CH4A 1G64A 3FPGA 4Q3KA 4IKEA 1HLPA 5B66Z 1FCJA 1VJGA 3O4FA 4I5GA 1T2EA 2IQ5A 5FF9A 4YVFA 1H4TA 1ZI9A 3RGWS 4JCCA 2WMYA 1W0KG 1E58A 1Z8DA 3MJEA 5C1OA 4YV0A 4RY0A 1U8XX 2BFWA 3HB0A 2RHJA 2JHFA 2ZTHA 1VG8A 3LMEA 1HOXA 4XLTA 5T4HA 4BEWA 3SR2C 4OK3A 3KU1A 2QTZA 1YXBA 4Y6OA 3TLJA 4EG0A 5JECA 2F55A 4LIPD 1VLHA 5LP6B 3LRTA 5DB4A 1PZXA 3NKLA 3SLRA 3ITDA 2Y2UA 1EA7A 4PRZA 1LFDB 1TJNA 4CLOA 4LJ9A 3WE7A 4ZHYB 4GC5A 3WLIA 1P7CA 4YS6A 1XAJA 2GEFA 1MO5A 3VYUB 4BO9A 3B6KA 4HGNA 4OHVA 4TUYF 5KHLB 1UKBA 3OA2A 4IGIA 4GI1A 1KC1A 2JCGA 2QR5A 2B21A 2HHAA 2X9GA 3JW8A 4JDPA 2PUTA 5J40A 4WXHA 3ZZ1A 1GRCA 3U61B 3C7AA 1ZAKA 4Q4LA 1V45E 1PR1A 2JD1A 4HZUA 1NJ1A 4D8VA 3RK0A 1RMYA 5CLLA 1NAHA 3DMRA 3JD3A 4FGJA 1PFYA 2HJWA 3JQAD 1M5RA 5E1AC 1EB9A 4XRRA 3X44A 4MIYA 1DT5A 3VDXA 4JWKA 4EWLA 3SXJA 4KLZA 1YQTA 3T5GA 5LBUA 1A7UA 2IOYA 3A9SA 5IEBA 4B71A 4FYMA 5HGJA 3U44A 1Z37A 1RLTA 4X3MA 1ESMA 4QD3A 4MSUA 2YASA 4QJBA 4F56A 4UU7A 2CUKA 4R41A 4BBZA 3HADA 4QM6A 2M1XA 1NQOA 2VAPA 4QQFA 2AXQA 2XNSA 5TEWA 1G8YA 1K97A 2P22C 1AHHA 2FWIA 1IG3A 4X65B 2I6XA 2VT2A 4M1WA 4XPIA 2NU7A 3IC9A 2YFQA 3GT3A 4LQ4A 6NULA 2B1IA 2PSDA 1FP2A 4BO1A 5HPYB 5LQRA 2X42A 1FZTA 5BP7A 1ORDA 2ILTA 2HA0A 2Z2ZA 5JY1A 1E2EA 1OCOC 2ZE5A 2CHVA 2JHPA 4QFCA 5IRCD 3W9YA 3ZC3A 4FS3A 1CIPA 5DSTA 4ZQBA 1O9HA 2EWMA 1WMSA 4UCFA 3G89A 1VQVA 1ISJA 3GJSA 5AJWA 1T8RA 5FPQA 1RFLA 3FF1A 4ZC1A 4C89A 2CSLA 3E05A 3G68A 2PNFA 1I0HA 3CC8A 3TD5A 5DNAA 1DAFA 3TM4A 5E6RB 4GOKA 2X7RB 4LF7O 3CC4F 1HE2A 2F1KA 2Z5VA 1YULA 2DH5A 3OKAA 1QHNA 5CXUA 1VM6A 1U3VA 3ZHRA 4OF4A 3GAMA 4PX5A 3ZY2A 2ILMA 2G70A 1QTIA 3CSSA 3LT2A 4I1SA 4ZAVA 4ABTA 5J23A 3H4MA 5DCVA 3PC2A 1Q95A 1DTEA 4IMRA 5HKAA 2PGLA 5LKRA 3H97A 4HUTA 3GEBA 3SZ3A 1PEDA 2EP5A 3H8JA 1E5TA 2QIOA 3AR5A 2QGFA 3I2FA 4TUYA 1LX7A 4FOTA 4M8LA 3FZQA 3Q41A 3WXMB 1BTOA 4TLLB 4JXJA 4E0BA 1R0BA 2ESRA 4D6XA 4H1WA 1RWNA 4RVUA 2AOTA 3GXBA 3JPYA 4BP9A 3RVZA 3HCDA 2XT9A 4JEMA 2QX4A 3GAAA 4MA5A 1WX1A 2IUTA 4CL8A 2W22A 1WDWB 2J5XA 2ZWMA 1RJDA 2FW0A 4ZIBA 5K09A 4FLYA 3IEPA 3OI7A 1I94B 4FGUA 3TLBA 1WQ4A 1VL2A 2WRZA 3DDZX 3I2JA 4HLDA 4JBHA 5K6RA 1DPGA 4UDOA 2QYHA 1WUYA 3PK0A 1PL4A 3DLHA 4F6LA 5GANK 3R41A 1T6BY 2VP3A 3LIPA 4I5IA 1RPTA 2LCQA 2QZPA 4RPLA 4YFYA 4R98A 4BX0A 4AY6A 1QF6A 1P1RA 2GM9A 5D87A 1BXGA 2DE0X 1ZOPA 4KV7A 4CLOB 3G4SF 3CHYA 4MTGA 3L1JA 4QDXA 4V1CA 3FHCB 2O05A 1MDFA 7ADHA 4JQYA 1QOPB 3KTAA 4EW6A 1YBFA 3SGIA 1WZCA 2CXQA 1TJYA 1PR6A 1YKGA 3WSWA 4Z7JA 5GONA 1L3CA 3JQFA 2DQKA 3NUQA 4HZUB 5BUSA 4LHYA 2YMPA 4JA0A 1V9PA 1Q7GA 1ZC3A 3BIJA 1KDPA 1NE2A 4W7IA 5TMBA 1YBVA 2QTGA 3D8RA 3U80A 3VZQA 5H68A 1H42A 1VI2A 3M5PA 3LYHA 2AOXA 3IAS1 1D5CA 2VIIA 3ABIA 3UOWA 3SQMA 3NEYA 4BC1A 3NBAA 4DZTA 4KREA 3OX3A 4Q34A 5IWCA 2HNKA 3HGQA 3KVOA 2PKEA 5DM70 1AKNA 3JVHA 3HHEA 4H2DA 4BE7B 4PGMA 3VDMA 4ZOCA 2EJTA 4UM9D 4XA8A 2NUPA 1RM3A 2BP7A 4YCMA 2Q6VA 2QJFA 2Z09A 1BDHA 1GV0A 4S1TA 2I71A 2P6MA 4TYQA 4JNCA 5B53A 4C6RA 1KO8A 3EZYA 3MRXA 1OA0A 3R0QA 3P94A 4RFSB 4BFCA 1YIJV 2ACWA 3CRNA 4LJ6A 5AW8A 4C5BA 2IH5A 3HDQA 1JDVA 1KDVA 1DWQA 4J0KA 3DLTA 5BY2A 1XZ8A 3ZD9A 4R8SA 4YLGA 3M7IA 2JFXA 2P0YA 4ZI7F 1SKAA 3LUTB 3G5MA 3OCWA 3T1QA 4RTOA 4D97A 3HVRA 2DUWA 2HV9A 4URXR 1Q82W 4WCFC 2O8BB 2VUSA 1GV1A 2H54A 3A9TA 4GEKA 4JC8A 4FGZA 4NH4A 2VUIB 3ZHXA 3MXTA 4H6XA 3C3PA 4CT4B 4DJJA 4C06A 1T8TA 3BMXA 3PJFA 1YR2A 3JQ8A 2WJWA 2ZUTA 4A0HA 2VHXA 4UQLA 4W5TA 3UWSA 2L82A 1YJ9V 5C3MA 5K9ZA 1ZH8A 5JOQA 5F7JA 1EM1A 1VRVA 4Q3NA 5E3IA 3V4ZA 2L35A 1Q82H 1RPAA 3IEWA 2GEDA 3VR2D 4AF7A 2D3TA 5IKOA 1WOYA 2HU5A 2B6HA 4LHWA 1UFKA 3E6AA 4YRAA 2QTSA 1GFIA 4YJHA 1THZA 2I2CA 3OEHA 4FMDB 3P30A 2IDZA 2XLCA 4JJIA 5HQJA 3WL5A 3CO0S 4PAMA 4V0SA 1IVNA 2B36A 2QWQB 2A4KA 2ZNJA 1BEUB 2GBCA 1Y5IA 4RM2A 1XZBA 1JQAA 2HF9A 1BVRA 1UKCA 3NG1A 3R3ZA 4WNAA 4PO8A 5E7QA 2QUZA 4AKIA 3R4VA 2ECPA 5HZKA 2OBMA 3RTBA 1OCCB 4IJVA 4YFVA 2P5UA 1AQLA 3FPHA 1Y7PA 4TN1A 1M1UA 3ILHA 3OZEA 2HRUA 3IAYA 4RTRA 4U3FH 1L7DA 3FTFA 4A2CA 1JFFB 1N5OX 2F4NA 3V00A 3VZBA 3ZY3A 5AI0A 4A0SA 3T3NA 2G5PA 3WB2A 4EUEA 4RZXA 2HJVA 1IV1A 1R4MB 1S7CA 2PUVA 2QAJA 3MPOA 5A4DA 3TQRA 5FOQA 2BZSA 2IXBA 4BFYA 4EH1A 1QLHA 1EK6A 1K7EB 1QNLA 1YJCA 2PYZA 4HS9A 4NLLA 5IX8A 1YEWA 2C94A 1XZPA 4ND5A 1CETA 1TQ8A 1QYVA 4L78A 5J4YA 4KR2A 2QE7A 2J5QA 4QELA 2AE2A 5AOVA 1R5OA 2WWIA 2JFGA 2YY7A 1EUYA 1E9DA 2I8AA 4UJ3A 4B7KA 2Q0AA 2OGSA 4RSHA 3PDCA 2QMEA 1WEKA 3BBPA 4ZHWA 4JYZA 2IUUA 3RTEA 3FJ1A 4UHFA 1GUDA 3CVUA 1CUJA 1MCZA 2FPPB 3DZCA 4P36A 4Z4HA 2G7ZA 1L8LA 2GRAA 2EINC 5B6PA 1ULUA 2IHZA 4EG5A 3MRVA 1LFAA 1DQPA 4ANFA 1YGYA 2JCVA 3IO5A 1O5OA 3UB2A 4MUKA 4L9AA 3AYZB 4CIYA 4L16A 1HM5A 2RBKA 1YZYA 3F78A 2ZBDA 3SAJA 1N5DA 3I9MA 4F5WA 2IEBA 4J9YB 1YZ3A 5BRAA 4Q0MA 1NT4A 4JP1A 2QA4F 1XTTA 1K5QA 4QLOA 1TI7A 1EINA 4EFDA 1KH1A 1P75A 2AJCA 1PV2A 3EXG1 3QBDA 2C59A 4RDCA 2P3SA 4TN5A 5FO1A 4LXUA 1W36C 1P84F 1MTZA 2Y48A 1UEIA 3UJDA 2Q6LA 3OR6C 3FAKA 1AQYA 3BG5A 1A4RA 2BP7B 4YALA 1QO0A 2IX9A 2H4XA 2PSHA 3FSRA 3LBYA 3Q6IA 5AHWA 2VDUE 1PJZA 2IWHA 5BRJA 5IXJA 1F5SA 4CMJA 4GKKO 1DC8A 3C3XA 3GFTA 1ZFNA 3GLRA 2GFIA 4HNTA 1U4NA 1SKQA 2J3QA 2UYHA 4LV5B 3LY5A 3OPNA 3TCUA 1JI3A 4D9BA 1Z08A 1OLSB 1DLIA 4GR5A 1NR1A 3I6IA 3CZ4A 5FWXA 2C99A 4LN1A 3BL8A 4A6DA 3KE8A 2W37A 3O90A 4LZWA 1K3UB 2VI5A 1TEXA 2YINC 3OY2A 4V0MA 2ID4A 2XB6A 1M6HA 3ANLA 16PKA 1VQ6F 1O4WA 1ZRMA 2DHQA 2P41A 3K92A 4HEHA 4IHJB 4W7HA 3Q7EA 4X44A 1C7EA 4KOEC 1NN0A 3IMEA 2ZJFA 1Q6YA 4A2WA 4Q9IA 4XBFA 2F4VB 4G4GA 3FYTA 4NH0A 2PZSA 1QGYA 3SHTA 1FSGA 1YB4A 1O0CA 2KG7B 2CZCA 2QMHA 1V5IA 2P62A 5T3UA 1XVLA 2JJYA 3HSSA 1M6VB 1RWVA 5DNEA 3HVUA 1DO2A 4TTRA 3SJUA 2K4MA 4JYCA 2AT1A 2RI1A 3OZBA 2X23A 1Q92A 3CUVA 4D9NA 1E32A 3U4IA 4UTVA 1ISSA 2OP0A 1KYVA 3ABTA 2M6SA 1GG2A 2QG4A 5FLYA 2WIGA 4KUEA 1W19A 1WW3A 1W5EA 5EHNA 2F00A 4LE2A 3GVPA 3JAMN 1RAGA 5JADA 1F60A 1DBSA 4PSKA 5LYJA 2GVIA 1K8AH 1MH1A 4L7VA 3R7DA 2Q4PA 3TLMA 5F77A 2Q4TA 3EXIA 1QUEA 1S4QA 1V3QE 4MS4B 2X9VA 4MQEB 4MWBA 4R2XA 5I9MA 2XUHA 1PV0A 2OBBA 4M99A 5JD6A 3DOJA 3SU8A 4BNWA 4PE5B 3GNTA 4TV8B 4LF4B 5KNCA 1PZFA 4J49A 3U49A 2DAPA 1XQYA 4MUHA 1NC3A 1DSSG 3WTCA 3OZDA 4FYXA 4RCZA 3B60A 3R3YA 3BCSA 3RIYA 3IURA 1SZXA 1PJSA 1SBCA 1INLA 2FKNA 3KLOA 3QUCA 4JT9A 2WJ3A 5DRTA 5EMLA 1P18A 3CLTD 4M0KA 3L84A 2ITCC 3GCDA 1FTNA 3IKJA 2OTLF 3LFUA 3RUFA 4QE7A 3DMFA 3R7NA 4GGPA 4UQPA 4ZCMA 1Z33A 3MTGA 1XNQO 4JK3A 5BVGA 1IE3A 3V4LA 4EI2A 2HHHB 1I4DD 3FGZA 4QQKA 2RH9B 4S0XA 3WMXA 3U10A 2OMKA 3K1YA 4B6QA 2PANA 3E48A 1PJAA 1UT6A 1CRLA 3TH5A 4RAIA 1YJWF 3D6HA 5IJ9A 2CTPA 1W96A 2C2GA 3STUA 4FYJA 1P2UA 3CIOA 5H16A 2I3BA 3FI0A 2I22A 3OEWA 4Z3DA 2FQXA 1KOJA 2VVTA 2L26A 2ZCUA 5DIFA 2MMCA 3K0KA 1TM4E 3LUCA 3TFQA 5B7QA 5CJ2A 5A3VA 1CJMA 1SCQA 5EVJA 5FUYA 1CQXA 4FYWA 1EQAA 4OB7A 4ZVNA 2DVMA 3FZEA 3G59A 1CQIB 3KTFA 4YWHA 2VCHA 1YE3A 3R8XA 4UV9A 3HUTA 1U1CA 1P4GA 4UAVA 2WVGA 2XYVA 4QL3A 4S2UA 2P9TA 2VQSA 3O2NA 3H9EO 3EODA 4Z9BA 4ZJUA 4LZPA 1UCFA 2UZ3A 4NYMR 3LDGA 4ZKDA 1G5QA 3CNNA 1TO1E 4OKIA 2H92A 2ZZKA 3LFOA 2PT6A 1QHXA 2AN5A 3RTDA 2PXCA 2ZULA 4DQDA 1V4VA 2XIQA 3UATA 1REQA 2PJRA 1I36A 4M22A 3WFIA 4NBKA 4GI2A 4YONB 3CGWA 1BSVA 1R3IC 5EBWC 3EGXB 5FKJA 2AZ4A 3G0HA 3VNRA 2D6FA 3AJ9A 2QN1A 1OLSA 1PG5A 3HC7A 4JQCA 3SWWA 1RU3A 3D5QA 3CVVA 2F64A 1KEZA 1KOFA 1RTKA 3OICA 2HXSA 2IHUA 3C5WP 5TRTA 1TCBA 3AUTA 3CJQA 3CCQV 1FYEA 1TPYA 3CBGA 3MTIA 4X8HA 5K0CA 3HFRA 4DIUA 3CYOA 3FJYA 3MMNA 5JS2A 5FWDA 3A2MA 3L7MA 4AG6A 4HXEB 3HR4A 3NHMA 3OQMA 1F38A 2PY5A 4FOSA 3LDDA 1N1DA 5L51A 1W2WB 5AKKA 4HZGA 1U0GA 4IH1A 1WEHA 2YJ3A 2IPXA 3A0RA 2Q0XA 4WN9B 2KX7A 3R6DA 4HQKA 3DBIA 2JAXA 4QDKA 5EQDA 2JAOA 3A1TA 4TKUB 5JWOA 3KPUA 3ZGNA 4OPHA 4MR9B 1DEAA 1J95A 5CA1F 5LYJB 2BWJA 2X4DA 4UAGA 1CZHA 1M0SA 1X8XA 2JIMA 4H1UA 3UBMA 5B64A 2GN8A 2YH2A 5CA0F 1S5JA 1Y1PA 3AEUB 3EZGA 3VXKA 4MS4A 1YASA 1U2TA 3ZZTA 5IBCA 1LQ2A 5C7IO 1Y34E 4H0NA 5JE8A 2XZLA 5TISZ 4UOZA 3HXPA 4W82A 2R00A 2XOXA 4BLOA 3TLKA 1W5TA 3HLYA 4S1NA 3SS7X 1ZAYA 3AL0C 5AHXA 2QRZA 3E1GA 3BF8A 4Y67A 1UIMA 1LPPA 1XDWA 2O8EB 1I08A 4JJAA 1BHJA 2UV8A 1R6KA 4OFXA 4IOKA 1PTJA 1TGYA 1UP7A 3G8BA 4U9IS 2HN9A 2JIQA 3AHHA 1FIUA 4HB2A 2EBHX 1ENZA 1BGXT 1UM9B 3HRIA 3MJFA 1TYZA 4UBMA 4DLPA 1ZK1A 2Z04A 3MIIA 1LVHA 1W1WA 1EDBA 2XTNA 2ZUBA 3EEYA 3H17A 5LP6C 2WP8J 3KBBA 2OXRA 3P9IA 4XFDA 2Z8YA 4ASUG 4H3KB 3OT5A 2H63A 3H5VA 1UMDA 3A1UA 4MWEA 1DC5A 1SB8A 3V2IA 2A8YA 3FOEC 4FE4A 4C6SA 1KMMA 3W4JA 3HCNA 4FBLA 1QJ4A 3HUEA 3ROXA 2F17A 2YJ4A 4UDNA 1BWSA 1A5ZA 2GKGA 2C98A 3BSYA 4IQ0A 2W8ZA 2XB8A 2R8ZA 5HQTA 1K9MH 5EE9A 5MF6A 3GNQA 5ELMA 5U4XA 4DIEA 5FTWA 4B6SA 4DMMA 4ED9A 5UKDA 2GM4A 3B6MA 1I5OA 4KFTA 1DAOA 5EGSA 2VGMA 3A1WA 4YMIA 1GPAA 2I6GA 3SFVA 3SJZA 1GQFA 1CVLA 1ORWA 4NPCA 3U26A 3ZV4A 1P9LA 4C0QC 2Z95A 2AIZP 3VO1A 2V7VA 1BXRB 4BNKA 5CB4A 1SCBA 4DOMA 3PSAA 1GSOA 1MFPA 2Z2JA 5KQSA 1JVMA 2VUHB 1S72F 2UVDA 5BT9A 4KNWA 5EE1A 2R11A 2R9RB 3ABLB 1A9TA 4HR7A 4OYHA 3QNUA 4AY2A 4QJIA 1P49A 3VPHA 4OAOA 5DM4A 3CNBA 3GO4A 2NXEA 3VUEA 3U7JA 4EL5A 4W99A 5EWLB 4NPHA 3RIMA 5KYWA 4Y18A 4EJFA 1TLTA 3RVOA 3JAWB 1NTZH 1XMOO 4BDTA 3VPGA 2ZI5A 2XV1A 3A36A 1DC3A 2AI3A 2WA2A 3UGKA 2QYTA 4QOJA 3EEBA 4ENUA 1EFPB 3B5EA 3GMTA 4JT2A 4DJDC 4KFMA 1E7WA 1JYFA 2H65A 2VYVD 4I8IA 1JG7A 5DLYA 4AYWA 2O59A 1SG9A 2VDVE 4HGRA 1JALA 2VP5A 2H5IA 3DTVB 3HK2A 3JAMM 3OMAB 1CHDA 2C57A 3PKZA 1DKPA 1I3NA 4DUGA 4TYYA 3SBXA 2QLNA 1E3TA 3DBVO 2OFOA 3O83A 3HR7A 3LQRA 4AJJA 5AM5A 3IPRA 2FMHA 2EILB 2CLLB 2IXGA 1WY5A 5K3CA 3STTA 2Z3WA 4YHBA 5E9JA 1HZZC 3L7JA 2QWNB 4E32A 1YCGA 2V4UA 4NAUA 721PA 4BO0A 4WBNB 1G0NA 2E7ZA 2CVOA 1Y1RA 3OQVA 3WIUA 3RRXA 1T36B 4DR4O 2CJXA 2JFUA 1AMOA 4BIOA 1U28A 3KFLA 4AK9A 1TNDA 2VDKB 4EKEA 4TKUA 1NVUQ 2ZPAA 4QBGB 2BOVA 4JXZA 1EEHA 1YK0A 1QQ5A 3MHPA 3GOHA 1OZ0A 3AHEA 5HZGA 4B3FX 2JD0A 3CYQA 1XK6A 3FGPA 2VJMB 2XB4A 3AILA 1UQUA 4NWOB 1TM1E 1NTRA 1OAOC 1UJNA 1X1BA 1ZRNA 1WV1A 4RELA 3TD6A 2PGNA 4TSFG 1AN9A 2J3DA 4GL2A 1I6LA 3LVQE 2A9OA 4NHOA 1Z6TA 2PL3A 1WCXA 2BI4A 2GJAA 2ZJ4A 3OZFA 5FLXA 4H7IA 2I3GA 3NM5A 3EASA 4H4DA 4XX0B 3JQ9A 3I1JA 1BQEA 3O2JA 2ZSBA 2GQ0A 3E7WA 4MGHA 1Z7WA 4AWBA 3V8QA 3QTTA 2WJJA 1WP7A 4ZVRA 3SC3A 3Q2IA 3LBHA 4FXOA 1WAZA 5DTRA 2WTAA 5DTIA 1CY8A 3EAFA 2PVPA 3DAOA 3EQ9A 3KCNA 4TL9A 3RS2A 3T94A 4BJ5A 1M7BA 3KZ1E 4GG1A 4JI4B 1EP1B 3SOPA 2WF5A 3TBHA 4CG2A 5DHSA 1VYUA 1AI5A 4O4IA 4B3MO 1UM9A 4XLLA 3GCZA 4DM7A 1U8EA 1ZDMA 2QTFA 3THXB 1WPBA 2A5FA 2HQBA 5C34B 4I46A 1RHKA 2O2EA 1YGPA 1R2QA 3HYNA 2N1MA 4XCXA 1S4MA 3NFRA 4MJ7A 5LQSA 1O58A 2Y1XA 1HGXA 4F2WA 2IYUA 1NW7A 1YR9A 2MINB 3ANMA 4M83A 1R0LA 3R7SA 3PQ3A 4FFSA 3R3VA 1L7OA 4X8OA 6LDHA 2QENA 2R97A 1P6UA 3OHPA 4N3BA 3QBJA 3CP1A 2QP4A 4S12A 4UXNA 1YFKA 3L8HA 4L76A 3ZWXA 4J4HA 4DB4A 1XGKA 3L79A 3GGGA 1P5ZB 3ROPA 3P0FA 3E9RA 1Q12A 1YJAA 3Q10A 1Y7LA 3T95A 1Z39A 3RS0A 3P2OA 3OSZA 4TQFA 2D4AA 2FNAA 1DAMA 3GFBA 3OZCA 3UPDA 2BGWA 2D2FA 3QIAA 4J0IA 2BN4A 1CX9B 2YWJA 4DLVA 4DGSA 3KQHA 1WBJB 1NZDA 3ILXA 1KJNA 3BH7A 4BVEA 1Q0SA 2EBWA 3KQUA 1IM2A 1EX7A 4OBWA 4E1AA 5LUAA 1JHZA 1YVEI 3HDTA 2DYYA 2H2DA 2ZXEA 5TSDA 4EZBA 2FUG6 3A4MA 3B3AA 4QOSA 5IY5C 3KTOA 2UUCB 5ISMA 2YI8A 2QTRA 1ONOA 4XB1A 4KL1A 3RBZA 3VIUA 2ENUA 2RKBA 2XTZA 2PX3A 4QNRA 4R7ZA 3ZE7A 4C4AA 4FJCC 4DV4B 2A2ZA 4FC7A 4H17A 4OJQA 3ZK7A 4BWVA 8LDHA 3FFBA 2OLJA 2E4XA 1N5KA 1R73A 3GEMA 4B4VA 4KIWA 1WDMA 2VYND 1KXJA 1P9NA 4OHFA 3SMQA 4X89A 4EQ6A 2Q4OA 2NZ2A 2W00A 2EBFX 2OSBA 3R23A 1P2SA 1YUBA 1QFZA 2A5GA 3C3MA 5FOWA 5B5SA 3LQQA 1W30A 1XB2A 2P65A 1JG4A 1RMQA 1GVHA 4OP3A 4QBTA 1BGWA 2QTVA 3MCAA 1O0SA 2F7SA 3DGFC 1KVSA 2VUTA 4QX6A 4WTOA 5EJ9A 4D46A 4PSUA 1X7OA 5D7NA 3C5CA 2IV7A 3FSEA 4CF7A 1Q20A 2V55B 3QKSB 4UTOA 1U7DA 3ZMSA 4I1IA 3IB3A 2J6BA 2FEWB 3Q8HA 3PIDA 1PFVA 4JJ8A 2HKOA 2AFHB 4OQ4A 4PPYA 5L7TA 2ZK7A 3AJRA 1K2VN 2XWJI 1K7CA 1YTLA 3PX7A 2Z6QA 2EU8A 3ZWOA 4GX0A 1BC5A 5F9HA 2I03A 2QYSA 2AHOA 3WGGA 4ZIRA 1N2EA 3S1AA 4F3NA 5CHYA 2WPDA 5B3JC 3CXHF 3FETA 3D8HA 1EPUA 1KMHA 4P3YA 2Y99A 2NO0A 1LF0A 4HL6A 1Z0FA 1XCLA 3FX7A 2EWWA 2CC2A 2WW8A 4GP7A 3ZWBA 4DWVA 1R8YA 3S0WA 2HCRA 1KYOF 3IP7A 4ITUA 4K05A 2NOAA 4P53A 4DMGA 4B3TO 1SKYB 2W6OA 2ZJ2A 1YR7A 5EJ2A 2RJ3A 4E2ZA 1PZMA 4BEJA 2F3SA 3AFOA 3AG1C 2R6ZA 3K4HA 1GDHA 3CCRV 4M38A 3P96A 1VQ9V 1E2UA 1MUUA 3ASUA 3RVJA 4MUYA 4ZQCB 4DC9A 4YUYA 5I8WA 2E5LB 3ND5A 3H6KA 2RGBA 4BO7A 1RXVA 3AVVA 2X0RA 1ZSPA 1WMFA 1C1XA 2Z2XA 5ALSA 1OLUB 4G4ZA 1IN5A 4O4LB 1ZQ1A 3VSEA 4TVKA 3MLBA 3TPZA 3VZSA 5GZ1A 2IXTA 4N3CA 5FOTA 1FEZA 1L8QA 3K5OA 1QRSA 3GDOA 2JK5C 4JKOA 4PC3A 4OHZA 5JJKA 1FNMA 4GPD1 4OUKX 3NAZA 3O26A 3HYSA 1MABG 2GPTA 3X1DA 4BZQA 2EDCA 1W4CA 1T5DX 2Q1UA 1E2KA 1PWHA 1UOPA 5G0UA 4DM4A 4G0XA 1OWNA 3L4BA 3DLCA 2VSQA 4IMIB 4LCBA 3RVLA 3UO2A 3EGCA 3WYAA 3K59A 3GA0A 5B4UA 1YJNV 1H6AA 1SXJC 4MQLA 2LNDA 2IH2A 3M34A 2X77A 3I42A 4LYGA 1PF7E 3WO1A 4FFBA 4DV7B 4D79A 3QKWA 5EFOA 1PEKE 3ZP4A 5IJAA 1BCSA 3ZVMA 2OCCB 3O47A 3MGGA 1ZUHA 3EF0A 5IARA 3C2QA 1JEJA 3U19A 4BHTA 4BOYA 1Y9AA 3TL6A 1XKLA 4YT4A 4F96A 5KX5B 2WDZA 5TVKA 1U63A 4W5RA 2CE7A 4GCZA 5BQOA 3V7NA 4DS3A 2GBLA 2JNBA 4X1IA 1KWKA 1FXVA 4YXFA 3USES 4L28A 1U6JA 4XQGA 2JDIA 1Z6PA 2GXSA 2AOWA 2A78A 3PJGA 2EGGA 4AYTA 1TO6A 2FZ4A 4JLMA 1YZLA 3G02A 1I3MA 1FXUA 1RAEA 3KB2A 4ZZ0A 2OFWA 2R1VA 1K4DC 3PD1A 4IG9A 4LGVA 2LWIA 3ANYB 3U2QA 5KYKA 3CG4A 3M89A 1OGJA 2HA6A 1QYXA 4FWIB 4GVXA 4TWBA 2VPTA 3PLAE 3DBLA 2J67A 2F43B 3ERNA 3WNCA 2WHQA 4NBSA 3CLSC 5EXEA 5A9SA 1A7JA 2PO5A 4MW2A 2ZWIA 1J8FA 3MM4A 1IZ8A 4AS3A 3LECA 3LUHA 5F2NA 4CJXA 3QYFA 2FMFA 3C3WA 4WE3A 4MAAA 1JFVA 1D03A 2Q29A 4JLOA 4X6UA 4INJA 4OMUA 4OP2A 3KAKA 3WK4A 5CDHA 2VS0A 1T0IA 4KEAA 4CKEB 2H4YA 2TMDA 3QWFA 3RVYA 1NXQA 3GLGE 4IV0A 4G26A 3NYQA 3EGIA 4K2HA 4RD4A 3NWOA 3DM5A 4KLRA 4YJKA 2PJDA 4CQMB 3KQMA 1OI2A 3HKEA 1POXA 5EHIA 2Y1CA 4WFQA 3T0GA 3S1AB 3TYXA 1Y1LA 2O2XA 3ZWMA 2FMTA 1JDTA 2CJWB 4U4AA 1MAAA 2W6JA 1SHLA 4A3SA 4EITA 2PQMA 5DJ5A 4YMVA 4R2HA 3DXZA 4Y6PA 2DBVO 2BKLA 3CUYA 4F86A 5CFOA 3PHBE 4DRXB 1FMTA 2V7QG 4KXRA 1N1EA 4MVYA 4PZLA 4HDNB 4KO8A 3PNKA 2WALA 1LXCA 4P93A 5JR3A 4BQFA 3DC2A 4PZAA 4R7CA 2B30A 1UOOA 1V37A 1E9BA 1IUPA 1Q50A 4C7JA 5BORA 2J3MA 5CLIA 3UZUA 4X90A 4FHCA 5ALYA 4B3DA 1QBKC 3HBNA 5KU7A 1N33O 1YITV 2XCRB 4BATA 4IWNA 1VSUA 2F95B 1W85B 2X0IA 1U5BA 4FQ7A 3WP0A 4BNTA 3KUXA 3INGA 4OQMA 3WRVA 1I4EB 3QP9A 5ALXA 1ENVA 3TKAA 2WU1A 5LCXA 3SE0A 5HG0A 1QYCA 5IG2A 4CMCA 1E94E 5DISB 2V59A 3KHUA 4WA7A 4NC9A 3L1IA 4HRYA 2CW4A 4OGGA 1MB2A 1UKYA 1Z9BA 1QWSA 2AQIA 4U9UA 1F12A 2XD4A 4WY2A 1XLUA 3DTYA 2IL1A 1SD1A 1ONPA 3FPBA 2LIPA 1H2RS 5BV2P 4UTNA 3AWIA 4ACBA 1NVAA 4DSUA 1OV4A 3M84A 1OXSC 4H4EA 1X7WB 2NN3C 4H60A 4L5JA 4Y1RB 1XAGA 1D2DA 5BQFA 5AH0A 4E33A 4FBGA 3A1SA 3C8ZA 3BSFA 3IL2A 1YO6A 4EA6A 3NCTA 4F71A 4PIVA 2CDYA 3ACBA 1RNLA 1G8AA 4M8IA 4Z0NA 4CQLA 1WJZA 1CF9A 1MQ9A 1C29B 2Q6IA 3IBSA 3O8OA 1PGOA 3TECE 5L3VA 2ZIOA 2YOHA 3U11A 1PV4A 5AM3A 3WDSA 4JGBA 1O9GA 2FLKA 4MYRA 3MAQA 4PZCA 2PUGA 3VQVA 4L0CA 1RBQA 4R0VA 2R6JA 3NWBA 5KQGA 4D0LB 4FMCF 4Q4CA 4ZDJA 4GUAA 3R7WB 3I5YA 1NBME 5EIOA 3CMEF 1SRYA 4HV4A 3U1VA 2O8DB 2P9JA 4UQOA 3WYGA 3T4XA 5A4AA 2NT3A 1PT8A 3P4YA 1W4RA 3GGDA 3PE6A 1CTQA 1JEQA 2DTXA 2BHNA 3MHSC 2QMZA 1O08A 1TM3E 4I4NA 5KYUA 3PD7A 1Q6HA 3WWYA 2BW0A 4KJZA 1Q1GA 1FMLA 1VBMA 2O1EA 3A6GA 1B8NA 1K6JA 2HMAA 5CHEA 4FZ1A 1JEDA 3WIOA 4A5SA 3COZA 2OYRA 2XDAA 2RONA 4LTNA 2VSXA 1ZWZA 3S2IA 3KQWA 5A9SB 3WKBA 5I5GA 1NRJB 4QLBA 3ENKA 4D0GA 4DAEA 4B3IA 1B16A 1TQDA 3CX4A 2F3PA 5CVUA 2H6EA 5JBIA 3WBKA 2MMGA 1Y6QA 5L7YA 1RYEA 3LBFA 3PR3A 2RGWA 3ZW9A 2IBMA 3PWZA 1K88A 5B55A 1JPUA 2JIZG 2Q5JA 2ZOSA 3I53A 3OTFA 5L95A 2OQRA 5FBZA 1XMXA 1QGED 1V1RB 2GJ9A 3ZNQA 4XPIB 1U8YA 1KKCA 1NM5A 1GKUB 2QAGA 4C7MA 4JI7B 3DCJA 5M29A 3RVSA 1TUBA 1X13A 3AG3C 3BB1A 2ZIUB 3E9EA 1J25A 4FSXA 4JEUA 1X15A 3QJYA 4M46A 4TQUS 5F4BA 1EUDB 2V7TA 4RSMA 4V39A 5HJEA 2GNOA 2EG5A 2FWBA 1TQ2A 3WYBA 1HR0B 1X7YB 3WI7A 4UCTA 4RF5A 4ZU6X 4UARA 5EZSA 3FUVA 4FU0A 2X0JA 1EIZA 5L3BA 1S77D 4ZPXA 4MPTA 1E1QA 1SXJE 4EPRA 1HT0A 5JSKA 3HBMA 3QW4B 2ZZNA 4GUDA 3VQTA 2JLSA 1AU9A 1R9NA 3D36C 2PS3A 2YUIA 3FNFA 4DDWA 1I2ZA 5C5EA 1U0JA 3AJDA 5K2MA 3R74A 2XGJA 3HH8A 2DBZA 3T7EA 3DTUB 5A9RA 1TW3A 2ECKA 3UTDA 3ZKAA 4UVAA 2H2IA 3N3BC 4P2ZA 1JWAB 3UT5B 2JLBA 4LFBB 3AVPA 4JITA 3VMFA 5IYZA 3EZ7A 2BEWB 4Z5XA 3LDEA 1E8DA 3V6LA 2JS3A 2D1SA 5JPDA 1CNEA 5ALHA 4FI3C 2EARA 5FHRA 221PA 1O6CA 4UEOA 4CMKA 3ETEA 2IDJA 2WB4A 1IHDA 1B3RA 4C05A 3ONVA 4LP8A 1AHPA 1J1IA 5L6MB 4RKQA 2WTNA 3W8RA 4DWJA 1SRQA 3HJHA 1A4UA 1ZW6A 1JFRA 3GZJA 1RRMA 4C7VA 2CBXA 4UULA 5I5EA 4DV1B 1XHFA 1E2NA 4WFBV 4IXMA 1VJ0A 3GLFE 4UUJC 2PX6A 4YMLA 5KPJA 3DCIA 2Z1TA 5KNLA 5M7EA 4W5HA 4F4IA 4CH6A 3AG6A 3T4UA 1N2OA 3VR4D 2GN9A 5KOHA 3G80A 1W35A 1QCCA 4M9RA 5I7OA 1AS0A 4E2WA 1FDWA 1H2MA 2QTLA 5FCDA 4C01A 4HZIA 3S5UA 1C2TA 3ZZMA 2YRFA 1JSCA 3UV7A 2XQVA 5LQNA 3HKCB 1AUQA 1DHRA 2E0IA 4DCSA 5CFZA 2P5TB 1ITZA 5TQ0A 2HKIA 1G42A 3I9FA 4DBLE 5JNRA 1E7KA 1KTIA 3W5IA 3X0DA 3AY0A 4NQRA 1RCTE 1C1YA 4MUGA 4CCSA 5LJIA 3IFSA 3ZLJA 4Q3OA 2R0QC 3RYFA 2IEGA 2G36A 4CTJA 1JEQB 1C8VB 1MBZA 3HB9A 3AIKA 3KV3O 1Z5ZA 3M4JA 3WZ2A 5A6VA 1C1HA 1SM4A 2V8BA 1VHTA 3ILVA 2I2DA 3ASNB 2H00A 2F43G 4U02A 1MAVA 5JDCA 4HVAA 1K6MA 5IM4F 4HMQA 1XX6A 1L5GB 5KUTA 3EHBB 3FDJA 4AD8A 2QTNA 1IMOA 3D01A 2FE1A 3ENNA 2J3LA 3MRTA 1RWPA 3I5DA 2ODPA 2PGXA 3PDIA 4LPKA 3QU7A 5ERXA 4GZ6A 1U90A 3URMA 4I9FA 1IURA 3SR3A 4CDRA 1XMIA 2GN2A 3GLVA 3UAXA 5EIBD 1EVYA 1ZIYA 1W5BA 1OU0A 2ZCEA 3NNSA 1U04A 1YQNA 2O2JA 2OVBA 4LOAA 5K6AA 2PAFA 2V7QD 3CCFA 3CV3A 4RF3A 5LMZA 4CLRB 3UHOA 4KFUA 1HRDA 2AWOA 3JVEA 4IYRA 3BD8A 1Z17A 2H8KA 3WOVA 1I1HA 1J8DA 1H22A 4MCHA 4FLZA 1RM1B 1K8XB 2C9OA 3QXXA 1JQ0A 4ZAFA 3KWMA 4DUGD 3DL4A 4KWEA 2A4MA 1JIQA 4G9EA 4PG6A 2Q1WA 3QA3E 1EUDA 1RSOB 4FVMA 3ZGZA 4BVTA 3LNTA 4AJNA 4QATA 2ZIXB 4B82A 1VKHA 5GV7A 5EP1A 3ZYZA 4BQRA 3JALA 2SBTA 1YA6A 3IGAC 4D98A 4NCBA 2JIBA 4X66B 4JUBA 2PMWB 5ABPA 5IZCC 4MYHA 3CWZA 3DEYX 2AZ2A 1FJ2A 2IZOA 3CH4B 4G24A 4L8FA 3ZN2A 1CFZA 1UKVY 3PCRB 4K9QA 1D4FA 4A91A 4ZYLA 3PQDA 5DNCA 1K73W 3HXOA 1JRLA 1XZEA 5A4MS 4JF3A 4B3BA 5G2OA 2YDEA 5AJHA 1YQEA 3DBRA 5T7BA 3ESQA 3FB4A 1XQ1A 4QDJA 3SIVA 4CMEC 1PNOA 1TW2A 4LFAB 4A0RA 2E75B 5D5PA 2JIRA 4I6JA 4NATA 1VQ5F 2Z5FA 3VOUA 4OHCA 3J81k 3C87A 1EU1A 3HP1A 1NVFA 1NT2B 4RTQA 3FPFA 5F2EA 5JD3A 5L4SA 2ZDGA 3DWEX 1K5GA 4PV1B 1ISRA 3E3OA 3PCXA 3FR8A 3MQFA 5B1NA 5EO3A 1XKXA 5DCYA 3K70B 3ZDBA 3E3MA 3BWYA 5HMMA 2DPYA 1JEAA 3EA0A 1J90A 4MEAA 3FE2A 2OYCA 5JYCA 3N59A 2EWVA 1ZGBA 4ZOQI 1B42A 1FKAO 3UB4A 1GTZA 2CXXA 8ABPA 4MKIA 3VBCA 1R4MA 2W6MA 4CG3A 1W0KA 2QDXA 4LDQA 1IQ0A 2RGYA 3VNBA 4RTPA 3DHYA 2H4WA 5K4AA 3V32A 2QA4V 3I9KA 4U9HS 1GZ0A 1ODSA 4A5OA 3CN7A 4HNHA 1GCIA 2H1IA 3LKVA 2V1XA 1IRIA 2FSSA 3CXUA 5DK4A 3AT1A 1OMOA 4MWGA 3WIEA 5EKXA 2ZJ8A 1GK9A 1VCOA 1H3FA 2P6UA 3E1KA 3B3FA 3REFA 3VZDA 2PKRA 1B0AA 2B4QA 3F4LA 4RPIA 1WUIS 2F3QA 4HWGA 4IH4A 1HRKA 1QSGA 3ITKA 4TXNA 4Y1FA 5KHIA 5EWRA 1T5TA 2BIFA 3F6BX 5CDYA 5T6BA 3W5BA 4BKQA 2MW2B 3JZMA 3L1VA 3RYFB 1MN6A 1X8LA 2FPPA 2FSIA 1M2FA 3AR4A 1AKVA 4DJAA 2CCGA 2IDMA 2ZJZA 4ARZB 1T3HA 4Q4DA 1ONNA 1QHEA 2CHGA 1Z6ZA 3HY3A 4JA2A 2F3UA 3I37X 1Z0ZA 4LSZA 4PINA 4PTYA 4YGYA 1TCUA 3UYLA 3ZLTA 2PJZA 5KOYA 1GKFA 5HQ3A 2C8LA 3AHGA 2PYJA 1JNXX 3HMQA 1VQNF 3QZUA 5LQJA 1IQUA 4HB0A 4P30A 4NCKA 4QC2A 3HS3A 4XTCS 1GTJ1 3UCXA 4DFDA 3TLYA 3NBZC 2X13A 2EZOA 3NOOA 1UQTA 4QUAA 1CR4A 3FYSA 3LYAA 2OIEA 1XD2A 1NU8A 2M98A 4X92A 1Z4OA 2YHBA 2J5KA 1ZD4A 1FLNA 3KDSE 2HTEA 4M9CA 4D4IA 1HYQA 1JHMA 2LQTA 1HE1C 4FM0A 3B53X 4K40A 1SR8A 1D6JA 1ECPA 3DDCA 4AJPA 4BCBA 4WKGA 1OYVA 4LUCA 3B8EA 3L04A 2ZSDA 3R6GA 3QKTA 2A0UA 1WUTA 1L7PA 1X70A 2H4JA 3D0OA 3G5AA 2CXNA 4G67A 4B7EA 4YY3B 2ZETA 3NHKA 4D57A 2QLFA 4A2QA 3PDUA 4TVBA 3T0FA 5A7FA 1EGHA 3AONB 3FLBA 1I7LA 2ZJAA 2ZIXA 5E7MA 4TLEA 4ZVVA 3H7IA 3JALB 5LXTA 3HN2A 2FZVA 3IIJA 3IRUA 1ZXLA 3HR8A 4XEHA 4Y2TA 1ZISA 3G0DA 1XHEA 4IHJA 4LWQA 1KEVA 3IVXA 4R5HA 3VZRA 1XXHE 2QD5A 1MGPA 2BF7A 1G4UR 3IEUA 1W5SA 4NR0A 1KC8H 4PRKA 4WXMA 3WMWA 5JWRA 4AZ3A 3SF0A 4YV1A 1WQ3A 3DZHA 2I78A 3RSFA 1F4VA 2PL9A 4GM4A 4AN0A 1R8SA 4JXXA 4K9RA 1K5DA 4DV2B 2R00C 4TV8F 3WJ7A 4ROSA 3OO0A 2ONKA 3GLHA 3U6KA 1XRNA 4MW1A 1AH2A 4G4JA 1WDTA 1ADBA 2IVZA 3DDUA 3CEJA 3N8GA 4W4LA 2CTWA 2CJYA 2GZLA 2R25B 5KUKA 1VL5A 3DL0A 3HI4A 4JLWA 5EPUA 2ERYA 3P1JA 4JFRA 4MH0R 5CYOA 3PXGA 4ZZIA 1EX1A 1TCVA 2OHIA 1JFTA 2AJDA 2V9CA 4JLVA 1VQLV 1DIBA 2WJVA 1VIVA 3Q0EA 2GWHA 3PQCA 2G8LA 1C50A 3B52X 2LO1A 3ADKA 3QMVA 5B1HA 1GTG1 4AN4A 4K9KA 4YJDA 4RPKA 4C6TA 4KQXA 4DG5A 1LS1A 4L6IA 3BPZA 1COMA 3IBYA 2NVUB 4XWGA 4URWR 1QR8A 4RESA 1QVWA 4F21A 4DIOA 1H0HA 1YDEA 4J7AA 1C9MA 4L5BA 2HMUA 3PC6A 3PUKA 3AV3A 2VT6A 1A7AA 4KITB 1YS1X 1BX1A 3EIUA 4JT8A 1IQRA 1SQ6A 1S76D 5CVDA 2GZDA 2BR4A 4RIHA 2POCA 3CVOA 3EQZA 2FOLA 3TI7A 3U81A 3JSXA 3THWB 2WC1A 2IVFA 4IOLA 2OXCA 1JUDA 3M49A 2N75A 1R6UA 5BVGB 4ALLA 3W7TA 1EN6A 4NOKA 4O2AB 3P7MA 1RRVA 3U3XA 1VE6A 4L9SA 7MDHA 3SDSA 3AG5A 1NR7A 4QTZA 3WWOA 1RA4A 2JVIA 3EVGA 1RMTA 2R751 1WWKA 2JHCA 3NP7A 2RHOA 4UXHA 2IFTA 3REGA 4BV2A 1HDIA 4BT6A 2DECA 2QWPB 2VRNA 1U3DA 3DYIA 3TETA 4R83A 621PA 3WBBA 1KK2A 2W6ID 3CCQF 2DFPA 2OZPA 2EF1A 2NNLD 1KRHA 1EFVA 4RUKA 5TPWA 4B46A 1HE3A 4CKYA 1T2VA 1ORHA 2CNNA 5LP1A 9MHTA 1KEPA 3RS5A 2BELA 2JEYA 4I0XA 2ADMA 1JAZA 3IUPA 4JMLA 4BV3A 3WB0A 5AM2A 2ZANA 2QP3A 5LZ8A 1WPXA 5IMBA 4CZZA 3IPCA 1KFKB 4B3TB 1OLXA 2YVLA 4FW9A 4JJ6A 3TRJA 1ISMA 2PMKA 3U4GA 4AYXA 4E3ZA 4QFDA 4YMUA 5LQUA 4AKEA 3SQNA 3ES9A 2IF0A 3CPEA 3HQ4O 1A9PA 3NAGA 4PVDA 3RAPR 4EHNA 1QU3A 1KBZA 1V43A 3GEGA 4RF2A 3SHWA 1SUFA 2ZAYA 3R0VA 1F4LA 2YKGA 4FR2A 2QX7A 1R12A 4JL5A 3BFKA 1ZXBA 3ZDQA 1GYPA 4NKGB 3QLJA 3WYCA 3X1MA 1SVNA 3GV0A 1AP5A 2H52A 4JLJA 4I4TA 5J63A 3WQBA 4D42A 1E1RA 5C18A 4OPAA 1BXKA 1GHTA 2EKZA 3IA2A 4TKMA 3SM9A 1R3JC 1X9HA 3RBXA 1FK8A 1N3LA 3EVCA 1XPUA 5H6RA 2QN3A 3KLPX 4GKJB 1GM7A 4B08A 2FC3A 2EFYA 3KD2A 3FTPA 1E66A 2IYWA 5TGDA 3O5AA 4JGSA 1VRCA 3USCS 5EC2C 2PK3A 3DB2A 4ZVPA 2WLIA 4C20A 4H6WA 4YMWA 1M76A 1GRRA 1M75A 3IE1A 2B92A 4L5IA 4F3YA 4L02A 3W5DA 1YMUA 4RY8A 1SWVA 3FLMA 1QIGA 2VK1A 3FOWA 5C7LO 2AIFA 2R6DA 4PHFA 4QO7A 4IYIA 3G1UA 2NO9A 2Q5IA 3JQ9C 2EJWA 4ND1A 2VYCA 3EUFA 3LDHA 4I8DA 4X8MA 3FWHA 2OWOA 1WMDA 4M7OA 4U7PB 3KCYA 3T7JA 4MW6A 4BMVA 3OP1A 3N2KB 3GR6A 2CDRA 4YAOA 1IM5A 2H07A 4BZZA 2AKEA 3GH3A 1MRNA 1QLJA 1GLGA 1Z5WA 3PRYA 1SVLA 3T5BA 1XZQA 3SYMA 2DY1A 3A3YA 4KIGA 4F12A 2GEVA 2HSJA 3ROMA 3DQQA 4PAQA 4U7TB 1T2FA 3GRFA 1LPSA 2GF9A 3L0IB 4JOQA 5DXJA 5IDVA 1XDBA 3W6NA 1ZRSA 1QDUA 5AWFC 1Z2AA 2KWIA 4KGDA 4ND3A 5IVHA 5HY1A 3H9GA 2WG1A 5DI3A 1J5PA 2FR8C 1SFRA 2BKEA 1RYNA 2NVUA 1ZH4A 1HSOA 3HXKA 3I52A 4MQUA 4ZRNA 3ROTA 2N48A 4RVGA 5KTKA 1L7EA 1ZNZA 3SK0A 3VVLA 1DBPA 4H37A 1GUZA 1UWVA 3PNBA 1ETUA 1OCOB 4AQYO 5ERYA 5HDQA 3S2UA 4Z53A 3LYBA 1DXQA 2YMMA 4YCDA 2IV2X 3TMKA 1JMKC 2F93B 1QIKA 2CMHA 1ZM4A 2W8BB 4BMPB 4EGFA 4LF5O 1A9YA 1GPYA 2I2FA 3ESBA 4ZYZA 4XD2A 2EVWX 2A88A 2UYYA 4MP6A 1SVMA 2GKSA 3TE6A 5JCOC 4UVBA 1PNKA 2PU7A 3L7DA 1EN5A 1SHTX 2K87A 3N8HA 3QF4A 4JI8B 4HLUA 2RI0A 5AXBA 8GPBA 4OYYA 4NWIA 1BQ4A 3TQIA 1QVFU 3GVHA 4G1CA 1BXZA 5TDHA 4CKWA 3KP1A 3ITEA 1XRRA 4OQEA 1UBGA 3DOEA 3TXQA 4GE3A 3SIXA 4J4TA 5REQA 1LV8A 2V7GA 2Y6UA 5DLQC 2X41A 1KL7A 4I0XB 2JFZA 4WI1A 2AG1A 2C9BA 4D82A 3ZCCA 2WFZA 3MPUA 1DG9A 4OCZA 4QYTA 3TTUA 3UBTA 1ECGA 1E0DA 4MITA 1XR3A 2B69A 3L40A 3DMTA 5AW0A 1WNSA 2HK7A 3CURA 4XIYA 2GERA 3FDZB 3QWIA 2YIDA 1TGVA 2V9PA 1HC7A 3FTCA 4V0ME 4PI2A 2PBLA 2B7BA 5BVHB 4RL4A 5COQA 1KNJA 3LHSA 3T7SA 5JSZA 1SOMA 1RJ9B 3HJTA 4FPPA 3LSUA 1QQ7A 2NM0A 1JDSA 5A5EA 1KOGA 2OVFA 2XHZA 3RT7A 2HNBA 1PWYE 2G77B 2Y0CA 4JVNA 4R7TA 4QPZA 5FQOA 1HA3A 2P6NA 3UJ9A 3V7YA 4PGHA 1UXGA 3L7YA 4BBAA 4YRBA 5EJ8A 3NYWA 1FUYB 4B33A 3TDKA 1U8ZA 3ZIAA 5IT9M 3EGVA 1T2UA 2CDBA 5FLEX 3TR0A 1U1EA 2ZYVX 2O07A 3RVBA 3I30X 3D6FA 5MN5A 3OONA 4G0MA 1PWZA 3O7WA 3D8BA 4IT5A 3X2QC 4KK3A 1Q43A 1SUBA 1IHUA 4YA6A 3M4XA 5D7BA 4BP1A 1R0SA 4AAYA 1HT2E 2VSOA 4S1VA 1KH3A 3PDWA 4LOHA 3T3IA 1F2DA 3ZPXA 3LK7A 1E2BA 2BHTA 4EFEA 1FC0A 3HL0A 4C5AA 4LDPA 1G3MA 3IT1A 1SZDA 3DSRA 4DA9A 1GVNB 4WJKB 1UJ2A 2EIXA 1GAXA 4DQXA 1NHGA 1GDDA 4OOEA 4QGFA 4UOEA 2O8FA 3S06A 4I5EA 2UU9O 5IJ0B 2Z1EA 1PL0A 1T36A 2LW7A 2D74A 3BDVA 4XX1A 1LLCA 1JKMA 3IC5A 5FUBA 3OIGA 1AA9A 2IE0A 2I8CA 2R7KA 4JJ4A 1NQUA 1O95C 3RC9A 1KO5A 4U2FA 2EATA 4PPFA 1YZBA 2QM8A 4MLDA 3OJFA 2I6SA 4N5MA 3C8DA 3G1WA 2HR3A 5IWAO 3UMRA 3CMMA 4DV6O 5IU6A 4RENA 4JLPA 1E18A 3H1AA 1KC3A 2BMFA 5EJAA 3AP2A 2QRLA 5GVSA 3E27A 1TXGA 4AZ0B 1IB6A 3DT6A 1SHKA 2PMCA 3ZMVA 2YC2C 3C6MA 3EW9A 3F1KA 4H0CA 1W6RA 5H8WA 4X9XA 1GPKA 2V6MA 3AM3A 5DI3B 5HUHA 3WAGA 2F23A 3O2QB 1SXJA 1O1YA 2QLLA 4ND4A 2TSYB 5CURA 3FAVA 1WB5A 3IUNA 4BN5A 2FYUH 4JYAO 3K09A 1VG9B 1DBQA 1E1NA 1RVDA 4MWOA 3QLTA 4KQMA 3GLUA 4PRYA 3KYCB 3ZJ4A 2ZJ5A 2EBUA 1OJHA 2DQ3A 2IU3A 3A1NA 3IAAA 2G9NA 3EYWA 1VQPV 2PKWA 1TTPB 4ZANA 2LR0A 1ZR2A 3THXA 1W5FA 5SY9A 3VH2A 5HFAA 1Q8RA 1HNWO 5ADVA 2X22A 2VDPB 3ZNNA 4E22A 3Q7QA 3RC1A 4KO2S 4EB6A 3VHXA 3COVA 1ULTA 1PKXA 5EFZA 2VNKA 3Q4HA 4JLSA 2KLBA 2C97A 2NO7A 1MG0A 2QJTA 3LPDA 4J9UE 2H94A 2I7DA 4PC7A 4BGEA 1FFXA 4COOA 2WVHA 3T7DA 1N0JA 2VTKA 5BNTA 1OFHA 1X3LA 3OBIA 2VQ3A 1E3QA 4MPRA 3VBEA 3ORFA 3RADC 1EK0A 1YQ9A 4YLEA 2WSSG 3ZRSA 1EZ1A 2F1HA 2R7NA 3OFVA 2H3EA 4EYEA 3TD9A 3TRIA 2UUBO 3P9YA 1TU0A 4QU0A 1N0NA 2OO5C 1AQ6A 1J21A 3G9UA 5ALTA 1I1OA 1JV2B 1R5BA 2JIZA 4CL2A 3ASVA 3H4TA 4HGYA 2BLLA 3I92A 4YH1A 4L08A 4PYRA 3VPBA 4C0HA 3KOMA 5BVHA 4W5OA 2UZ4A 1T9GS 2HA2A 3OMNB 4HSEA 4I99A 3U0ZA 1WXHA 1I33A 4MRRA 4EB8A 5IULC 1JE0A 1JJ7A 3A7DA 1IUNA 3Q5GA 1PL7A 3VR4A 3WL3A 1RRGA 3J81M 1WP9A 2HJHA 4NXMO 4FLTA 3CZRA 5H2FZ 4RV9A 1XEXB 3TZQA 1K08A 2C84A 4YRMA 1V25A 5ALUA 2GTPA 4V38A 2GYUA 2ZITA 3F2IA 4J1TA 3JY6A 13PKA 1P5HA 3CO5A 1YRWA 3PQ7A 4UEWA 5J5VA 4BFLA 2ZAOA 3NR2A 1SXHA 1GARA 3V8MA 3ZCPA 4J3NA 3PX3A 3OF5A 4AO6A 1JSLA 1KZ1A 4NDZA 3D7RA 3ZHZA 4CMHA 2JNWA 2XR1A 4B79A 5K3DA 2ORWA 3BULA 3E9CA 3TZEA 4MVOA 1WKBA 3K9GA 1V55B 4X1OA 5HF6A 4UB8Z 2O20A 2QSYA 5I9LA 1AUVA 4ZOLB 1VQ9F 4KYTA 2XNKA 4I55F 4XXHA 3QKSA 1T9CA 3ZR4B 1GN9A 1VL0A 1Q22A 4FLXA 4ZO8A 3R7FA 4AF8A 1DKLA 3I12A 4UZEA 3L46A 1YB1A 2C2MA 2SECE 3DC5A 1IY9A 3EIWA 4NABA 4LKOA 3W6OA 5EHXA 1LC0A 3ADOA 1Q7CA 1EFUA 2C1ZA 1RHUA 4C0LA 1T5LA 4F6CA 3QX8A 2JW5A 3WHLA 4P5EA 1X7PA 1RXEA 3C1TA 1UFIA 4C43A 3O85A 3PPVA 1ZM7A 3W05A 4MKXA 4TMTA 5TE9A 4B6OA 3NVIB 3NBFA 5AK3A 4DUYO 4BU1A 2GAFA 3B3GA 4DJ5X 1XTVA 3EDYA 1PYOA 1F8XA 3D6AA 4NU0A 1IUKA 1RQNA 4FCVA 4CKXA 3RPEA 1ZU5A 3V33A 3WP1B 3FWNA 2EW2A 1KMIY 1DJNA 2WB2A 2ETVA 1RKVA 2RH8A 2X5XA 2IYTA 1YZNA 4R9UC 2X8BA 2F8MA 2DPLA 1GL9B 3V2HA 4X95A 1XCPA 2QUKA 5CDUA 1U65A 2DWCA 3VUFA 3NX4A 1A9QA 1D9XA 2G3YA 2O2SA 4G5FA 4RQEA 3KYCA 4KQKA 2CXRA 5IWAB 4J0JA 2Q2OA 4DVGA 2ADQB 1HFKA 3SFTA 3EXHC 4RHCA 1X7GA 1ZLYA 2ANBA 2EQBA 2FRVA 3AFMA 4G5RA 2JLRA 1Q0UA 2OPBA 3L05A 1D1TA 5KC9A 5KNBA 2AEJA 3QKIA 3I56F 3N8KA 1PT5A 3IKLA 3QG1A 2QQEA 3QVVA 4ZP1A 5G3YA 4PDMA 1M34A 9ATCA 3JRXA 4C4OA 4DV4O 2QRQA 1YJ9F 4AZWA 3DT8A 2X8AA 1KFEB 2I2WA 3ZCXA 3U9LA 1FFXB 1VE9A 4J29A 3W9SA 3WGTA 2EZUA 3IUEA 1Z68A 3ZIUA 1GCAA 2GZ1A 2BOBC 2OTCA 3ASNC 3BWMA 4OPMA 1XNJA 1UFVA 3GRVA 3OAAD 1BJKA 4AW9A 2NP7A 3QVNA 3R76A 1R0XA 1G8GA 3R75A 5IT9N 1N57A 3C3YA 1SHJA 4BAYA 4CC5A 1R8QA 5ICFA 1Z6GA 4EY8A 2Q4BA 3LY8A 2HVYD 1OFVA 3KK0A 4CTMA 2F8SA 3FM9A 4IIDA 1PSWA 4CIWA 1K66A 4KJXA 1TFUA 4KPYA 4TTTS 2REXB 4X8AA 3W90A 2XJ9A 4YXWA 2Q3BA 4RMJA 5CCEA 1XD8A 3ND8A 3NHAA 3QTYA 2X5JO 4WJLA 1Y3AA 2OG1A 1LPMA 1LWOA 2QTBA 3LHDA 2CDCA 3I7TA 4FGWA 1ONBA 1N77A 4XGNA 1MJNA 1E2QA 1E2DA 4XYBA 1JN0A 4U2GA 1GFWA 2VNJA 4N3AA 4QYXA 3RGGA 2C77A 5TQJA 3SJ7A 4RV4A 3TOZA 4NYKA 1T4CB 3IUMA 1NC1A 1JA8A 1YIAA 3LKBA 3ZTYA 3MMZA 1FFDA 1J09A 5JD5A 1VXOA 4JI3O 1GR1A 1W52X 2P6OA 3FDIA 4P35A 4D99A 1XMSA 4MVJE 4ZAZA 5A06A 1XF9A 3F6SA 5K3BA 3CCJV 4C8GA 5BNZA 2FDCA 1QUFA 2QQGA 3LVRE 4QTTB 4XFKA 2ZODA 2GF0A 2PVCA 3OVMA 4QRHA 5DCLA 1NVGA 1SVSA 4HTAA 4TROA 3RUEA 1I7QB 1SMKA 5CW1A 4N48A 1S8OA 2CHTA 3N2GA 4WZAA 1FP1D 2N1BA 3AR2A 2QUBA 3LXMA 2WZCA 5GV8A 3WLMA 4A9AA 2XADA 2NZ8A 4FNMA 5AKEA 1XI2A 4E08A 4RD0A 5KNDD 1E1KA 1CF4A 3CUEF 4WBNF 3HKEB 3PYXA 3RCBA 4D9MA 2B4TO 3PQ6A 3F73A 3LFHA 2CGNA 2WG2A 1YTUA 3DC7A 3WU2Z 1NTOA 1PDWA 1MO3A 1X42A 1C7RA 4JI5O 4NXMB 1Y42X 3IP9A 4AHCA 4IDAA 4JJFA 1QGOA 5EXSA 1EG7A 4ZOEA 1RLGA 2MTBA 3TZ6A 4WACA 1P9WA 3RFCA 5LSAA 1N4AA 1UI9A 5DGDA 2QRVB 1P0MA 4E6EA 2W6JD 3OKPA 4KKVA 5CPFA 4B47A 1HDGO 1V54B 3KVRA 1WU7A 5KAFZ 1FFWA 5HIJA 4GM0A 3EJWA 4CMBA 3G0CA 1II8B 3DV9A 4PICA 1I14A 2PYLA 2QKCA 3EWSA 3OZVA 3M1AA 4URZR 1L7MA 3BC1A 3CE9A 1P72A 3SYRA 1QC5A 1SCIA 2CZQA 3TNYA 2XGMA 3KSZO 4JVLA 5F51A 3QH4A 2GLUA 3QEOA 3LUPA 1P81A 5E0OA 3QF7A 4K6OA 1A04A 1ZL2A 1X39A 1U7ZA 5BSKA 3U62A 4D02A 5ARDA 1MKYA 1TF5A 4G84A 1YS6A 2KQUA 2X40A 5CCBA 4DXDA 4H15A 4K88A 4AQYB 1HETA 3L06A 3PDJA 4NX2A 4RVCA 1JF8A 2WTXA 4YASA 3TVTA 3PXDA 3LSTA 5BW6B 3DWGA 4DR5O 4GFDA 4LRXA 3BERA 3M2PA 5FADA 1QNMA 3G6EF 1MX9A 3AGQA 3FCXA 3JZFA 5J2TF 3SVLA 2UXNA 2PUEA 1XTUA 2PWPA 3TG2A 1T8YA 1NSYA 5DASA 3DAFA 5ARBA 2PH1A 2Z83A 1EWYA 1MR3F 3A70A 3ASZA 2FPMA 3DOHA 3SDZA 3STVA 4ZJYA 6PFKA 1LDBA 4PQEA 2A57A 3LSSA 3M4ZA 4JVSB 1K9MW 4LBVA 1PNMA 1P9OA 3GB7C 3PPXA 1O0BA 1M57B 1ZS9A 2I3ZA 3VQYA 2MSLA 1ZESA 4I2NA 4O1HA 1C9DB 1T9DA 3PA8A 3KB8A 1HXHA 2CNKA 1Z2EA 2Q1SA 5J5AA 4CV2A 4YRSA 4OHYA 3L8GA 3CD6V 3MNFA 4H77A 4OLJA 1Y3CE 5JBNA 1X9IA 1GM9A 5IT9A 5FNVA 3UCSC 3CRW1 1L0BA 3KKNA 3MN1A 1BWPA 5KYVA 5K6AC 4XGKA 3RARA 2H57A 2YC4C 2QW8A 4WFKA 2VZ8A 3MW8A 2H0RA 3GXOA 1D5NA 2FB5A 3R3UA 4LEIA 4NPAA 1QIIA 2O5RA 3C48A 5LNK1 2XUFA 3C8MA 4GRAA 1GNTA 4JLAA 1ISFA 3SY8A 5K03A 1Z47A 3GW8A 1L1FA 5TJ9A 2OTLV 4ZCRA 1WMBA 3F5MA 4UBNA 2GCOB 1G2OA 5ITZB 2OD7A 2D06A 3DMDA 1GNRA 3QFCA 3OFND 4IS3A 5D51S 3TMAA 3ZOZA 5FIUA 4WLVA 3L6DA 3EFOB 2C54A 1J7HA 3E70C 3IDZA 4HG2A 1CB0A 3W7VA 1SIUA 5L3ZA 4PLVA 1U5CA 1L5YA 3E15A 4IEIA 5K51A 2EINB 1D2GA 1AJEA 4PM4A 4ZEOA 1D2AA 1M2VB 5HE9A 3QPBA 1V7QA 1XTBA 3BRSA 3LUDA 3MOSA 1YKFA 1V8PA 2OK7A 2I1WA 3WLJA 4YIOA 4TZ6A 2ZSUA 4ZVTA 4B8YA 3SPHA 1V7PC 3B1XA 2OBNA 3HDJA 4Y7CA 4DDMA 3KQLA 1VG1A 3NT4A 4DQKA 3KYBA 4LMPA 5CW2A 1K7FB 4L2IB 4F5EA 1MXHA 3HGTA 1E0KA 2YXYA 3D2CA 2JEZA 4L15A 4EYOA 3E58A 2CHSA 3BA6A 5LD2C 1CEZA 1O89A 3OUUA 2K7FA 2FW8A 2GGSA 1T43A 3E2EA 1SDSA 1SCKA 1V11A 2BI7A 2GZAA 3G0GA 3QVGA 4IVNA 4H08A 2ZE8A 1OCCC 1KVQA 3LBAA 1F48A 5LBQA 1HO3A 3BGOS 5AW7A 2VWQA 2DC1A 1Q81H 1U8AA 2XKBA 3PXCX 4KQWA 5H59A 2PO7A 4FIZA 3CT4A 3PWKA 4RVSA 2CD7A 4NTXA 2PX0A 3P10A 3IBFA 1QGDA 4EGJA 1PHPA 1TMGE 2REBA 2QRMA 3SNHA 3MT9A 2V6FA 3IXQA 4FSDA 4A10A 2GCNA 4O8CA 1FA9A 2O5EA 3JX9A 2NG1A 5EZYA 1KZHA 3UJPA 1QQAA 4GOLD 3UKOA 4LGYA 5B1BB 3OPYI 2RHWA 1DWPA 2C7GA 1EUCA 4FLUA 1DJPA 1S2GA 2AOUA 2P3LA 2ZAIA 1RJEA 4YP1A 3U0OA 3AI2A 1Y33E 2QZJA 3D3NA 4UM9B 2YUTA 2ATXA 2PWAA 1QK3A 2QTMA 3LUAA 3ELDA 4NV0A 4XUEA 4LECA 2P2SA 4II7A 4R1QA 4PBRA 1LVUA 1OD6A 1KDZA 3WQRA 1CRQA 4C78A 4DIMA 3WGIA 2WK1A 4B17A 2FDXA 4V2UA 3GGCA 1BCRA 2RE8A 2YWRA 3T4ZA 5G0VA 3A37A 2YJZA 3KSDO 1V16A 4DR3O 1JY8A 1QGZA 3DXFA 3ET4A 3L0YA 1VLQA 4UXJA 5DHUA 1YNOA 3WTBA 3OE7A 4D9FA 3PSHA 3NIGB 4ESEA 4KMSA 1JEEA 1V9LA 2RFLA 4MUNA 1T8WA 2GDSA 1AKTA 1XVUA 3L6BA 1HE5A 3P9KA 1CVRA 4I55B 3RTCA 2PUCA 2C9YA 1HYHA 1GM5A 1IWPB 3B9RA 4WEOA 1ES9A 2H08A 2F8LA 2ZIAA 1E7YA 2NXNA 3EDCA 5AJZA 2XYRA 3SIUA 1RJFA 2VDWA 4TSRA 5FNVB 4RNDB 4CZ2A 2LDBA 2VHEA 5F5NA 4ETWA 1JSXA 3T5PA 3A14A 5C32A 4LVUA 5F9FA 3BMNB 4ZALA 1FU8A 5I7HA 3RODA 3KSBC 2JFOA 3ZH9B 2Q7HA 2QY9A 3NC4A 4XAQA 2UZ1A 2C5HA 3OUFA 3KNZA 2WLLB 2PIAA 2I34A 5EERA 5GGXA 4ZAGA 4BJ3A 2P9YA 3ELYA 4N7JA 3E1SA 2UXDO 3ZIDA 5A2GA 4OK6A 4MI3A 4XB2A 1XMOB 1DHTA 2HQSA 3F98A 1Q19A 2C58A 3LCCA 3PDIB 3ZWAA 1WQ1R 4IHAA 3DH0A 1DIRA 3P2KA 2H5JA 1WXWA 2YTZA 2VHZA 3C1OA 2WD7A 2X76A 3IBGA 3I2YX 4QJ4A 2XXBA 1HDJA 1G3QA 3M8KA 5EGNA 1ZIPA 3CRVA 5PGMA 2Z5LA 1KI2A 2V3VA 2ZRCA 2ZSEA 3LYUA 5GTHZ 5F1OA 4ZDWA 4B4WA 1ABBA 1JLKA 1Y8CA 4FJ2A 2JFHA 1OUMA 3K53A 4D3SA 1KR2A 3SBEA 4TT8A 3WJRA 3B1JA 4LX0A 4KWHA 3EPKA 2PV0A 3B6ZA 3IQDB 4U7HA 2HFEC 1BRTA 1P2GA 5TQ2B 3RNLA 1Q6UA 3ENWA 1JCHA 2PLAA 3FWKA 5TLSA 1ZGCA 2ZT5A 2OYSA 1LJUA 1P31A 2R3SA 2VLBA 3DGEC 3L7CA 3HV0A 3OW2U 3MEQA 3KJJA 2OCHA 1QHHA 5HHTA 2V7XA 2MDTA 4Q39A 4O4JB 1I5XA 5KNDA 2NTNA 2BZ0A 2LIVA 4IBOA 2LJ2A 1S72V 2AF4C 1QAQA 1ZWLA 2CNBA 5G1NA 4KPFC 4A6PA 4BVLA 4C2TA 3STXA 2W2QA 2EDAA 2UYNA 2JBWA 2VJOA 1RHRA 2DHRA 2RIRA 3I6ZA 2NZWA 3K3PA 2JGJA 3W6PA 1WV0A 5KSPA 2WJGA 4W8GA 5I51A 4PQGA 3EDRA 3GG9A 2RJZA 1BKYA 2IIBA 4ZCSA 3ZHUA 2Q69A 4LYJA 3U3RA 3ZWYA 1SO8A 3W7XA 1CY2A 1V5WA 3TAHA 2Q21A 3ONEA 5SY6A 1HF3A 4ERNA 3M9LA 4HD8A 4XIIA 1VJRA 1FQWA 1NLMA 3AXTA 4TXJA 4ZMSA 2H1LA 4G5HA 2V8OA 1GGKA 3AJ8A 4LNAA 5A4FS 5H1YA 4RY9A 1GKYA 1SKMA 2LUOA 1N0UA 1Q0RA 1HE4A 2PZKA 3OEHG 3SQOA 1XCMA 1ZR4A 4ADSG 2BV3A 4R2WA 2JLAA 1ZD5A 1EUCB 2VPYA 3QW2A 1FNKA 4TXMA 2B3TA 4OO3A 3UMSA 4CWAA 2EJUA 2GS9A 1JHXA 3W9UA 3HJBA 4WZZA 5BWCA 3EZ2A 1WVMA 4FFOA 4JI5B 1AR1B 1WL8A 2WJ4A 3ELUA 5BPFA 1S3SA 1UC4B 1JS1X 1NVBA 5KYGA 3K9LA 5J58A 1T35A 3ADPA 1KK3A 2GBFA 4YXWD 5A3JA 1YF3A 3QU5A 2O4UX 4KQFA 3S5JA 4Q6BA 1TK3A 1GO2A 3CS5A 4RA9B 4QSHA 5LPNA 2H5EA 4NZZA 3ZVRA 1UBKS 3W7AA 5I7SA 1V16B 1XXHA 1P61B 2REQB 4FK8A 4IMJB 4TWZA 1DQYA 1M72A 2HSWA 1XYYA 4GXTA 4JX9A 2ZBPA 3TR5A 2K5UA 1RAAA 2E1PA 1KZ4A 3FMPB 4DCNA 2HRYA 2FETA 1Q44A 2W0MA 2ZEJA 3R09A 4FTWA 4KXNA 5KAIZ 3CR7A 4XLZA 5T41A 2ZXUA 2I1LA 3EFHA 1XELA 3GT7A 3DV2A 5CT8A 4ZODA 5NULA 3PC4A 1KFCB 4NK5A 3KR1A 3LUKA 4YCBA 3R9XB 4MUIA 2YWFA 3QKRB 3NHWA 1UAYA 5KA5A 3L8CA 3VI3B 3ACDA 2RAVA 5CNMA 3AG1B 4TYPA 1WLYA 5DM60 1CS4C 3OKCA 4EP1A 4M7PA 4F9FA 3MJ4A 1HG0A 3G2QA 3AKYA 1EDOA 2ILVA 2MSKA 3FYUB 4WLEA 1J8YF 1IC6A 1CR0A 5DBOA 3E7PA 1X1AA 2IPMA 1WPQA 3G8YA 3KWLA 3N58A 4KHPO 2V5VA 3BOSA 2UZ1B 3QPCA 4Q6WA 3T5TA 3L9DA 3VMMA 3TPCA 1N78A 3FLAA 3JU3A 2XDQB 2H4HA 4LC1A 4X66O 4LC0A 3SZRA 4WY8A 3T99A 4BC0A 1NVPD 3DMPA 3QUQA 4IM7A 2XMQA 1OX5A 1WKCA 1DDIA 4PTLA 3M1XA 1JG1A 1W1IA 3AIIA 1P44A 3R6WA 4L8LA 1JU4A 5I01A 2Y67A 1UJWB 3X2QB 1K4YA 4NNJA 2YWXA 4OX9B 3GFOA 2XECA 4HVCA 3HJAA 4HEQA 4MYDA 1K2WA 3MTEA 4G4XA 4A23A 1U0FA 2CXPA 3L8YA 2HJGA 4JYAB 5GGYA 1WF3A 1WETA 4U8HA 4ER7A 4PLFA 1X3SA 2I4RA 4RS3A 4IRXA 4U0JA 3NV9A 3BFJA 2YZMA 4MVWA 4G8CA 1NXPA 1QB7A 3G9TA 2YZ7A 3EGDA 4GRIA 3KSRA 3DFKA 2EBOA 2J5RA 4WH0A 1DCFA 1DZIA 4L5CA 1AKUA 1SBQA 4UW9A 1PS9A 2WU4A 1VQ4V 3MCTA 2IP1A 3RYIB 4OXQA 4HWPA 1E1QG 2I3DA 1V47A 4LY0A 1JAYA 5AKYA 5J1TB 3EZNA 5HJ2A 4Z4EA 2Q2VA 3VHLB 1H1LA 1SU8A 2IT1A 2JGEA 2J32A 2ODEA 3PVSA 4NS4A 5I48A 1C4KA 4BL5A 1PFUA 3KPWA 3SS8A 4KWTA 3QRWA 3CUUA 4QFMA 4R81A 5AXCA 4H31A 2XVXA 3ESDA 5IK2D 3EF1A 2QN8A 3OOYA 2WM9B 4LYEA 1LC3A 4FMTA 4TPKA 5T3YA 3GLHB 3RUHA 5J4VA 1XQ8A 3S02A 2GHRA 5GPBA 3V1MA 4DAOA 2QF7A 4WN3A 4B3CA 5JI3E 1R37A 2NU9A 2YNMD 5GJVC 2A5LA 1BMFD 3OPQA 5ENZA 1XLTC 4UB6Z 4OM8A 5FYDA 1VPWA 1A76A 2I9PA 4AO8A 1ETHA 4P1ZA 4AZSA 3J80A 1I7PA 5KA6A 3FUTA 2BAGA 4ZCTA 1I1NA 1IL0A 5AIAA 4DSOA 3IDOA 3MINA 5C8YA 4YQFA 2HMWA 1GUYA 3PL5A 3FYIB 1YTFB 2H7CA 5CT5A 3Q3JB 4QJFB 2HK9A 1XCOA 4DEYA 5BW5A 1EVEA 2NYUA 2R84A 5JO0A 3QVLA 1HDZA 4MRSA 4DF3A 3M3HA 4L9RA 2QZ4A 3GLIA 3WYNA 2JIZD 5I7EA 4GW3A 3H04A 4B0PA 3CUWA 3M6AA 2REQA 1GQOA 4J0GA 5FA8A 5GTDA 2P6PA 3NS7A 2FEOA 5LDDC 2ZCJA 1Q83A 1N2CE 2XAAA 3EH2A 4C76A 5JMWA 2IPLA 2GA9A 4E2YA 2N0SA 4PFJA 2D1FA 4K28A 2GSDA 1T0HB 3ASYA 4OQLA 3THWA 1XMQO 1PEAA 4EY4A 4HDRA 5A02A 4BAGA 1YQDA 4FNGA 3VISA 3H1LH 4BR6A 1R15A 5AI6A 3TEJA 4D8XA 3IEMA 2HADA 2XYGA 3RABA 4O2AA 1BNCA 1Y3FE 4KO3S 1C7ZA 2JGFA 1EFRA 1MT3A 3AR8A 5I8ZA 4EVIA 4CIXA 2XB9A 2HPVA 3JD2A 1A71A 1SAYA 2IXFA 3VPDA 1ZP6A 3GEPA 1NVXQ 5DHFA 3IAM1 3LL7A 1CEQA 1PO7A 3VHQA 2UYCA 3MCQA 1JXQA 4ZREA 5TPWB 2NPFA 1M6EX 3SJCA 3VNAA 5CYFA 2VTEA 3CMAV 2BM8A 2OEPA 3GP5A 3NVMB 4JCOA 1N5JA 1IY1A 1L9KA 1ENOA 1Q77A 2QSZA 3CZ5A 3H8SA 1QZZA 4HGOA 4MR8B 3SBDA 1W59A 1I6WA 3MLEA 2NWQA 1WIWA 5CM8B 1N32O 3WL4A 2XNDG 2J7PA 2JS5A 1SC3A 3OT7A 3F8TA 1PCXA 1GZ7A 1OASA 3DE2X 4M60A 4EA8A 4YJ2B 2AR9A 4MVJG 2I4LA 2ORED 3D7NA 4H59A 4AI8A 2HK8A 1UXIA 3I39X 3AEKA 1KJZA 2GYWA 4ZC8A 5TR9A 4ABMA 3BAFA 4J94A 4PR0A 4RDIA 2A1TS 5E4FA 2OXIA 4FLVA 1XRPA 2NVWA 3CX6A 1XTIA 3ED1A 1ZZEA 1OHHD 4WADA 4G25A 5I9TA 5C51B 1IEXA 1GU7A 1YIJF 2CF5A 3RRZA 7GPBA 2UYQA 1TQ6A 3KQKA 4K87A 1EP9A 4N39A 4TXLA 2PI4A 4NBWA 1I2AA 3C6KA 2DSTA 4D44A 5JIBA 3A0HZ 4IVQA 4RH1A 3G2OA 3OTOB 1D4OA 2ZBEA 1PJ3A 2FUKA 1OT5A 3H5LA 4L7QA 1P3JA 4V1CB 1U9ZA 2OLEA 1AKRA 3RFTA 3OUTA 2FDRA 1EP2B 4IIVA 1UXOA 3Q8WA 3HVJA 1TVMA 2QQ0A 4YQEA 3T5CA 1ZA2A 3ZGYA 3NORA 4UNRA 5KVSA 4KQ9A 5D3KA 2N74A 3K0AA 2A0WA 2IY7A 3FUWA 2H6LA