4WBNB

Crystal structure of tubulin-stathmin-ttl complex solved by native-sad phasing
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 178
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4wbnB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4wbnB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4wbnB01
3HKEB 3RYFB 4YJ2A 3JAWB 5CA1A 3RB8A 2VAWA 3JATA 4EI9A 3RYCB 2VAMA 1W5FA 2RHJA 4O2BB 5IYZB 2RHLA 5JCOA 5LA6A 1JFFA 2R6R1 3VO9A 5EIBD 4ZHQA 5JQGA 4O4IB 1OFUA 3VPAA 4LNUB 5JH7B 3N2KB 3VO8A 1FFXB 5LYJA 4I4TB 5ITZA 4TV9A 4O2AA 4F6RB 5J2UB 3HKBB 5JCOC 4IHJB 1W581 5LOVB 2BTQB 2R751 3C8LA 3JASA 4X1IB 5IJ0A 4ZOLA 1Z5VA 4TV8B 3JARA 4XCQA 3WGNA 1TVKA 3ZBPA 3M89A 5CB4B 5KMGB 5LP6A 4X1YA 3HKDA 1TUBA 4TUYA 3ZBQA 2RHHA 5IJ9B 3HKCA 3RYIB 4U3JA 5MN4A 4ZI7B 5LXTA 3R4VA 4YJ2B 1W5BA 5CA1B 1W59A 1SA0A 3JATB 4X1KA 4DRXA 1W5EA 4HNAA 5LP6C 4WBNA 4X20A 4B45A 2XKBA 5M7EA 5BMVA 2XKAA 2Q1XA 3CB2A 5LA6B 1JFFB 3E22A 5GONA 3UT5A 4ZHQB 5FNVA 5JQGB 1W5AA 4EB6A 4DXDA 3N2GA 5EZYA 5LYJB 5ITZB 5KX5A 4TV9B 4I50A 4O4JA 4FFBA 4O2AB 3WGKA 3JALA 4YJ3A 5C8YA 5CA0A 3V3TA 4I55A 3JASB 3JAKA 4EI8A 5IJ0B 4ZOLB 1FSZA 5EYPA 2BTOA 3JARB 2Q1YA 4IIJA 1TVKB 4KWEA 4U39A 1RQ2A 5JVDA 3RYHA 3HKEA 3RYFA 5LP6B 4X1YB 4M8IA 3HKDB 1TUBB 4TUYB 3RYCA 1Z5WA 3HKCB 5EIBC 4U3JB 2GVIA 5MN6A 4O4LA 5LXTB 1RLUA 4IIJB 4O2BA 5IYZA 1SA0B 4X1KB 4DRXB 4O4IA 4HNAB 1RQ7A 4WBNB 4B46A 4X20B 4LNUA 5JH7A 4EI7A 3N2KA 4O4LB 1FFXA 5BMVB 3ZIDA 4I4TA 3E22B 5GONB 3UT5B 5FNVB 4O4HA 3WGMA 3WGJA 4EB6B 4F6RA 5J2UA 3HKBA 3VOAA 4IHJA 3N2GB 5LOVA 2BTQA 5EZYB 5J2TA 4X1IA 5KX5B 4I50B 4O4JB 4FFBB 2RHOA 4TV8A 3JALB 4YJ3B 3WGLA 5C8YB 5CA0B 4O4HB 2VAPA 3JAWA 4I55B 5CB4A 5KMGA 3JAKB 5J2TB 5MN5A 4E6EA 2VXYA 5EYPB 5IJ9A 3RYIA 3VOBA 4ZI7A 3M8KA 5JVDB 3RYHB
chains in the Genus database with same CATH superfamily
3R6WA 5IAKA 3LT0A 4IY1A 4EVQA 3SDZA 2F1IA 3ZZNA 2V7PA 4BPRA 1FDIA 5JQGA 3G9ZA 1MF7A 1A5SB 2OMEA 1XJ5A 1SXIA 3DXFA 4ZDIA 1VEWA 2XWPA 3T7AA 2L19A 5E6RA 4AKHA 4R2KA 4JHLA 3U1BA 3QVJA 1RRCA 3NBQA 4OAPA 4MW0A 1K2WA 1NQWA 3B3JA 5DN9A 5GZ6A 4QQ8A 1UBTS 3SHOA 1DCFA 1H47A 1E0SA 2XCOA 4LRYA 2VWKA 4O4JF 4M46A 2OILA 4MI9A 4U1RA 5C93A 1GNTA 1DQZA 1GT6A 3EWIA 4BCBA 4X8HA 4FIDA 3Q6IA 3SE7A 4KPYA 5IDXA 3HJUA 1N0JA 3NW9A 3LBNA 1C0PA 1NR5A 2Y4OA 3CC4V 4CEHB 3DHWC 3N0VA 3GRRA 2QV7A 3LA8A 4DEXA 1FJXA 3D36A 3RTGA 2REXB 4IPTA 2QWQB 1VQMF 4NU8X 3FZEA 5KTKA 2ES4A 4MUHA 5CMUA 1T35A 3T4DA 1T13A 1UBUS 1Q50A 2GFQA 1PG0A 4G28B 3PL1A 1CB7A 3NV7A 3GEIA 2ZXUA 4FC7A 4IF4A 4QELA 3P9IA 3FI9A 3UCXA 1NI5A 5JCOA 2EWWA 1YE3A 4L28A 4QUDA 3P4EA 3L1IA 3OD1A 1R4MB 3L1KA 3IEWA 1EZ1A 3QYAA 3HACA 4Q1EA 3N8HA 1YQEA 3L82B 1QDEA 3LWVC 3BCHA 3B85A 1F48A 2ADPA 3P94A 4H31A 4MKRA 4NPHA 2WUEA 4D96A 4DJDC 1R1DA 4O1HA 5DHTA 4FR0A 3QVXA 3LPLA 5A04A 1JR3E 1FPQA 5CA0A 4IR7A 3S29A 1L7NA 1GQQA 4JMPA 2BH9A 4DMUB 3AEQB 5B37A 5EXSA 5ALIA 5CIWA 1N7IA 1RYHA 1F51A 4RQTA 3O7WA 4P92A 3CCUV 2VKQA 1WO8A 1AP6A 2G71A 2GZRA 3CLVA 1N5MA 4UM9B 1Q3EA 3CJQA 5J9FA 3D2LA 1DAKA 4C2TA 1X94A 1R9NA 2XA1A 2YICA 3G13A 3I72A 1KVQA 1VARA 4K9LA 1WUTA 3ZW9A 1H2WA 2F90A 2J59A 3DEYX 4GMGA 4B40A 3FUVA 3S02A 2HLNA 1U9IC 2QTGA 3LO8A 3OQNA 3MIIA 1W46A 2P4EA 5EUQB 5KNDA 5HKLA 2Y1CA 4B31A 3H7IA 2PO5A 4EAAA 1V39A 2HF9A 3NASA 4KAJA 4RSRA 1VCMA 3TETA 1SQPH 2QQFA 3AEXA 3KV1A 2QAJA 2CN1A 2Q6VA 3DMGA 1PF7E 4UZEA 1EZJA 3ND9A 2YVQA 1CUGA 1FUIA 3TOSA 1ZK2A 1QU3A 4UOZA 2IDMA 3PDWA 3QVMA 5BQPA 4KQGA 4J0HA 3B1VA 5D6NA 4GYJA 4EEQA 2ZB7A 2WNIA 1K5GA 1EG7A 1XRGA 3L4JA 1H5UA 4BNDA 3O83A 5AW5A 2IYFA 1CY0A 1W87A 4AUNA 3F96A 3CCCA 4QAQA 1Z0JA 1EA7A 1QLHA 4C87A 5BR8B 1IULA 4MGKR 4KO8A 3EE6A 4EUNA 1BMFA 4Z1MD 3V8QA 4FLEA 4DV1O 4MUKA 1T3LA 4OQZA 1GGFA 1H69A 3CVWA 2HMTA 2OVBA 1WR8A 1XAIA 4K9OA 3GZNB 4COOA 2I1WA 4TT3A 4MUXA 1USIA 2JGFA 2VDQB 4P80A 3RHTA 2UV8A 5IXSA 4G27B 4RESA 4HZUA 1NF3A 3IMCA 1G20B 1ZKDA 2FRXA 1T0AA 4JIMA 5E4YA 4Q24A 1D2EA 2AEEA 1G1AA 4RO0A 3P0RA 2ZIZA 3S7ZA 3F73A 1GARA 4AYWA 5KUTA 2JLZA 4M8KA 3OFND 3W9BA 2YDEA 4DDTA 5EJAA 3THSA 2EFDB 4C0HA 1F8YA 3LUTB 1FTQA 4PC1A 2RH9B 1IATA 3W8FA 1GPMA 2E85A 1KJ9A 3V3KA 3EEFA 2NLOA 1K4KA 1OWNA 2P4HX 4R0MA 1YB6A 4MPPA 3R3VA 4BV2A 4LZJA 3EWAA 4RVUA 2O20A 1KKUA 4LTDA 4W6ZA 2UU9O 2ZDQA 3ZCUA 3CMMA 4MWDA 4X7RA 2FXIA 1NXXA 3KHUA 3DDCA 3NX4A 1T0IA 3F5SA 2JLUA 2FETA 2H8GA 4A8JC 3PJRA 1NOJA 2IHYA 3ILXA 3VMFB 4QDZA 5JS1A 5FCDA 2YXZA 1QTRA 3C8DA 1GPUA 5UKDA 3OLZA 1HEUA 2IPNA 1Z62A 1GTJ1 2HH9A 1YSCA 1NPTO 2C00A 1T8PA 3SIRA 3H5VA 3JSNA 3ZHYA 4DLSA 4BCCA 3QKSB 4BU1A 4J2HA 3P52A 1A95A 4CIVA 4BP9A 4TXLA 4P81A 5B1BC 2XYGA 1J23A 2J6HA 3CLSC 2P9ZA 5TS2A 5JIBA 3O4HA 4CKZA 4KFRA 3STVA 4A4DA 1L1RA 2E37A 5BV0A 5HTOA 2QVCA 2K1SA 4JTDB 3SIUA 2RGYA 3AVWA 1JEQA 3OLCX 2B98A 4XYGA 1U7XA 4EKIA 5L3FA 1LR1A 2HLDA 5DM60 4ARZA 4DQ0A 5CJPA 3CZCA 4HCJA 1IBLO 3C6ZA 2PJZA 3F5MA 3LCMA 2LDXA 5G1OA 4UVIA 3X1JA 1YGPA 1R0YA 4BNFA 3OQIA 4E4TA 4M53A 3RVLA 2BM1A 5BXQC 5DH9A 2II6A 3OJFA 2YYYA 3HCAA 4KBGA 2OTJV 3PPVA 4EG0A 2VPYA 1RYDA 3ANNA 4WD3A 2YBEA 1YDHA 3ZNPA 3SYRA 3SMVA 3KELA 2QGNA 4RKEA 2VXCA 3AKDA 2EIHA 4C3UA 1IXKA 1R0CA 4ALNA 4TTVA 1EFVA 3AHCA 2RSLA 1VQ7V 3A6LA 2GJSA 2FYTA 1BIFA 1P0PA 1JL3A 4GR4A 3PFCA 2HSWA 3RT7A 4MWSA 3KAQA 5AVYA 3GQBB 2Y66A 1BWSA 1W36C 4RTPA 4LN1A 3FCYA 4DIKA 1YH3A 3ZU2A 4B75A 1MXHA 4ZCLA 2OXIA 4HNRA 2GZ3A 2Q21A 4UNNA 2DYSB 1U8CB 1ZVQA 1I0LA 2LE0A 5CVDA 2Y1LA 3W1VA 3DLBA 4HF7A 4FNGA 3TQOA 4YJGB 1CP2A 1UR5A 2P0EA 5CNMA 3C9TA 1YZQA 2CDNA 2IUSA 1T5EA 3TSZA 3NTXA 1RRFA 4KUHA 2VZLA 5B1NA 3SDSA 4KCGA 1PL6A 1G3IA 2X0FA 5BNZA 1P2VA 4UBKA 3DE5X 3LGXA 3TRJA 4HB0A 1BGWA 3I9V6 4DPMA 5EE1A 4HTFB 4TV8A 3FVTA 2Y92A 1MRNA 4UBMA 1WCV1 3QVNA 2IHKA 5MDHA 1E79A 4Z9FA 1U2PA 4M7RA 3U5ZB 3KT0A 4ZZ3A 3H3JA 2YXPX 3R7LA 4ALIA 1YKFA 4K6KA 2AR7A 2GUZB 3QIVA 1P81A 2PAAA 1F60A 2OESA 2WUGA 1JHAA 2IYPA 3NH9A 1W2GA 2QTOA 3SPIA 4QSMA 2XVXA 1BU8A 2QI9F 4UB8Z 3HL0A 4F7DA 1ZSPA 1V48A 3W8EA 1R73A 2IW1A 2CLMB 1X92A 4KLAA 2IHZA 1QB7A 4R8SA 1YJCA 4J16C 3OZDA 2Y1GA 5GZ1A 3FB5C 4J07A 1ZSYA 1U2DA 1QZXA 4ZODA 3ZRSA 1OSNA 3KFLA 2P7IA 3S0HA 5KQPA 3LHDA 1VQ6V 4BO0A 5GQSA 2B0CA 1Z4PX 1XQ9A 1J0CA 4WHMA 5DHAA 5KPDA 2AXQA 4HXGA 3TQIA 4WW0A 4EO4A 4M9SA 1PV0A 2ZIUB 4MPJA 5FI0B 3L4BA 1C5KA 1SD1A 3B78A 4CKBA 2P27A 3GBSA 3J7AR 4MIYA 3QMPA 1MB0A 1ZICA 5CT6A 3QX9A 2FSGA 3WZ2A 4KR9A 2V4UA 3R40A 3LWPC 3ZZMA 3PYLA 1PEAA 1P3JA 3OEED 3EMDA 2GYVA 3QUAA 2Z2YA 4N8EA 1X7HA 2R79A 4HDNA 1MIOA 4PAOA 4CUKA 4LVCA 2VJQA 1Y67A 2Q1XA 1FS6A 3NOOA 4BLUA 4DR4O 1Y8RB 2X9VA 5CFQA 1JG4A 3U7IA 4AJNA 3U9TA 3C3XA 2N05A 1W4LA 2QSYA 4YAEA 3THXA 3FR8A 3ZY2A 3ZQ4A 4BLWA 1Y6ZA 4Z5XA 3W5HA 1ECFA 1JR3A 1RM1C 3GN2A 1Z2PX 3QKTA 3QE2A 3ES9A 3CNEA 2XTAA 3HYTA 3C1UA 1NVVQ 4UUMA 5K7SA 5AQ1A 1YTFD 2V4DA 4PYLA 4II3A 2DBQA 2R9IA 1XC7A 3UJHA 5C1DA 1UBOS 4G86A 4L73A 4EQ6B 3C1OA 4RVHA 2PA0A 1L4MA 4IFBA 4X66O 1HE3A 1M2WA 3VU9B 1O4WA 1QF7A 2BE3A 2PUTA 3AUYA 2MHCA 3X1XA 1E2UA 4E5VA 5JCJA 4S05A 4WXHA 4M0PA 1NT2A 3BMCB 4RKRA 2ODWA 4QVGA 2F8LA 5JLAA 5AKJA 5JZBA 2P2YA 3G2HA 2VR1A 1PT9A 4BVAA 2B7LA 4RIEA 2VP6A 2XASA 5FUMA 5E8JA 1FNDA 1FFCA 1TZMA 4P0QB 4KGZA 5IY5C 4R81A 3U4AA 2C59A 5F7OA 2PUEA 4H3KB 3FDIA 2IS6A 1L7PA 2ECOA 5LMUB 4AMZA 3T3GA 2Z6VA 5DM2A 3TXQA 1YZLA 1F4VA 4CT4B 4M1YA 1Q6UA 2M6RA 1A50B 3Q3EA 1VHAA 4L9AA 4DZTA 2C5HA 4XGIA 5CBPA 4BMVA 5DM70 2GEUA 1VQ1A 4KV9A 1M54A 4L0DA 4TXMA 4AJ2A 4DCVA 1XELA 4AY6A 2F93B 2ODPA 1A76A 1FXHA 4ZVMA 4KL8S 4U63A 1PGNA 4I4TB 5B7GA 3TOVA 4RWEA 1F4LA 3OPYA 4XYLA 1RSOA 1ZH6A 4KXQA 5CPFA 2GMWA 1XTSA 3KQVA 4WFKA 5E6UA 2C8LA 1SA0A 2H7VA 3MTGA 3AIOA 4CFSA 2HGZA 1UEJA 3AESA 2QE7A 3GDGA 1A32A 4HAIA 2XQJA 3W5AA 5DM6V 3NR2A 2XAHA 3E8FA 2FSPA 2Q1YA 3QTYA 3SVTA 4ZPXA 1NMQA 4GXQA 4E07A 2JIZG 1CUSA 1A77A 3ET5A 4BW5A 4DCOA 3U44A 3JPWA 3R0QA 3FPBA 1YR8A 3SBDA 1W34A 3BCCH 3H1KH 3FXAA 1QBKC 3WLRA 3DBHB 2G1UA 2VK8A 5HG0A 1XLTC 1YL6A 2GZSA 3G0OA 2OXCA 3IUBA 1RQGA 1E9AA 2C5EA 4NU6A 4NENB 3F78A 4J0FA 1UJCA 3T06B 3DZFA 4JBLA 2V54A 3P3NA 2A0KA 4WH0A 4NXMO 2CC2A 3DO5A 4D4IA 1T1GA 4DUPA 4BE7B 3DTVA 3PDIB 4CTOA 5HR5A 4FPXA 3MEQA 1GG9A 1EQAA 4LWSB 1FXKA 3TZCA 3TL3A 5C4GB 1K7EB 2X6BA 5K2OA 3W7TA 1UEXC 1B8NA 3BFXA 4ZDJA 5FUQA 3OJOA 3TRHA 4DUGD 3SJBA 2QTZA 2CHEA 5FTKA 1CSEE 4DA9A 1GRRA 2DHDA 1WUJS 2VDWA 1B3QA 1UMDA 1NN0A 3MCVA 3DAYA 2F48A 1YZKA 4RJJA 3QFFA 1VQ9V 3TCNA 5B3KA 3UH0A 3FSGD 2V4ZA 4W5RA 3FCOA 1QYWA 1QRAA 2PD3A 4OQFA 4U7PB 5BRNA 2HJDA 5D7BA 1T9CA 4ZAYA 5FV7A 3L4SO 1VKHA 4MTGA 4XW2A 3PE6A 4P58A 1QXSA 3MS4A 2IZZA 3BJIC 2EGUA 3KXIA 2XMBA 5IZ4A 5IX8A 3CD6V 5FTJA 4A6XA 2EDAA 2CAZC 4QTYA 1E5XA 1ISFA 1FP4A 1N5RA 3EZ6A 5GIOC 3TB6A 2C3PA 2VRCD 3K4HA 4CMGA 5EJ7A 1K4YA 2C8KA 1VSVA 1N0NA 5TQJA 2C1ZA 3B6ZA 1U0OC 4ROSA 3WJ2A 2ZYAA 2WD9A 2F1JA 2FZWA 2CD9A 1S7CA 3WLHA 2EQBA 4C3ZA 1PQYA 1SCJA 3V00A 2MQEA 4XDHA 3FGOA 3HK2A 3L8MA 1NL3A 4D7TA 2R7AA 4JOBA 1GZ3A 5CXUA 1WETA 1JQ3A 1H4QA 2ZE6A 1F6DA 1YFJA 3N2KB 1RRGA 2QSUA 3F6PA 3PQ4A 1QD9A 1JDPA 4KJXA 2WLIB 1GCIA 3PUXA 2CTWA 4Z2YA 4IYHA 1TVMA 2AMVA 3K1JA 3NG1A 2AIZP 2Q2OA 4LG1A 5THKA 5JXJA 4LXGA 1RHKA 1UADA 3QFCA 1WMFA 5HYVA 4NICA 3K1ZA 3IKLA 4C3OB 4KW7A 1IY0A 3AX6A 2I4TA 3WYNA 2E4VA 1TADA 2LD4A 1M1YE 2DHCA 3FJYA 2Y68A 3HR7A 5TPWB 4YLEA 1R4NB 3G79A 2BRUA 3T1VA 4FKZA 3NPAA 3C2QA 2BR5A 1SURA 4IRMA 2L0XA 4A9AA 4R9SA 4AJKA 1Z7BA 5AOAA 2FLWA 4RQBA 2QRMA 1N2SA 3VZRA 1VQ5F 1M6HA 4ZI5A 1PFKA 2BBSA 3X2QB 3IHWA 4XWYA 2OFFA 4BB6A 1JA8A 3M3DA 4JJ7A 4A5SA 2ZW9A 5ILGA 1SOWA 4B4OA 2R72A 4RV9A 2ETVA 3NEAA 4KDEA 2Q9AA 4PEVA 4REQB 1ZKMA 4PBTA 5CMLA 1E6EA 2VJMB 1QFJA 4L8FA 1JMVA 1YHQV 5F33A 3GRKA 4Q93A 1TM2A 5BMVF 3MINA 4LYAA 1IOVA 3I2YX 2NVWA 1F5NA 1RXCA 2QXTA 5H4HA 5I7VA 2GK4A 4BIOA 3LY5A 1XD8A 3X2FA 3TTUA 1HDIA 5CJ2A 1JWLA 3DE1X 4CDMA 3RYCA 2QX4A 4F5EA 4QHYA 1F9AA 2CLFB 3OTGA 4LRXA 5M29A 4C4XA 3U1TA 3D3JA 2P3QA 1EIWA 4R05A 4MR9A 2O1EA 3ZK8A 3FH0A 4L3OA 4QPNA 3OFKA 3CW8X 3ZE0B 2ET6A 4D7SA 1Q43A 3D0QA 2GJ9A 4B8ZA 1NVWQ 3ESJA 2GN6A 1I4OA 4RVFA 3ZV5A 4QBHA 4ZQIA 3I73A 4DSOA 3ZS8A 1V1MA 1G3UA 3P4YA 3FYIB 4N0MA 1Y9ZA 5EZ5A 4AWBA 2JASA 2WFLB 2XODA 1JJ2U 2H8EA 3RM3A 4NQ3A 2F1OA 3H4TA 1V16B 1Q90D 4W8HA 3T3IA 2PS1A 3NUZA 1QOZA 1S9HA 1R0XA 4HFMA 4N8DA 4AKSA 3K6SA 1P1RA 3MQFA 1EFKA 1SKUA 4JIGA 3JSAA 1HNNA 3HJTA 3H75A 3ER9A 3UMMA 1O6BA 3P19A 4FEAA 2C7PA 4EO7A 3F6YA 1QHIA 4PSDA 4FFPA 3VZCA 1IXYA 1ZUHA 4BGDA 1DOHA 2P9TA 1K5SA 5JROA 5EZYB 3M81A 3ECAA 5FWAA 3DLAA 3I2IA 1H2FA 3CJTA 3TD6A 5DT2A 1R15A 2VLBA 1XGKA 5IH3A 3MSXA 2QZPA 5K8VA 2J9YB 5HIAA 3B12A 4X62O 2IY7A 1YTUA 4Q1DA 4DM4A 3SS7X 3ZY3A 1E5VA 2R1ZA 4QUBA 3IQEA 4E11A 5TGTA 4MS4B 4UAVA 1JPXA 3PA6A 4KXMA 3IUJA 1N7HA 2A3RA 2ZJ8A 3RRYA 2SECE 1JHMA 5I7OA 2DBVO 2B30A 3VHQA 1NVMB 3GG9A 4IYJA 2H57A 4INZA 4AUEA 2PKEA 3DA8A 3OD4A 2IXFA 3T1HO 1QH0A 3E1GA 4BB5A 1KO5A 4AZ3B 1E1CB 1FPMA 2OORA 1IJFA 3S8MA 5IS2A 2UYOA 5A03A 1WDMA 4L8JA 1EDOA 3Q7RA 3BN3A 2M6KA 5JXIA 3G5UA 4KE8A 4LDQA 2GERA 3S1AA 3OOWA 2IYVA 3OZSA 5F21A 4B7EA 3Q8MA 1U90A 2WP0A 3TIFA 1SUBA 4IILA 2OKGA 3DEIA 1CWUA 3N58A 1V5FA 1EGMB 1H9BA 2PG3A 3F8TA 3CRQA 1BA2A 1BQEA 4LJSA 2JI7A 5FPRA 2OV8A 3CF4G 2IKSA 2VNJA 4DXWA 1M9NA 4G4ZA 1XQ8A 2VH2A 3CCJF 4U0KA 1XILA 3T7TA 3EASA 3ZUPA 4X44A 4IGIA 1U9YA 1Q0RA 1TQ4A 4K8RB 5LB2A 1P62B 3M33A 3DLCA 2Y69C 2Q3MA 2QU7A 4MOWA 1M75A 2YXEA 5L7WA 2SKCA 2FPKA 4Q9JA 5DRTA 3CNNA 1EVKA 1EKXA 3L0SA 2LO1A 2PGDA 4C88A 1GNQA 2X0LA 3AETB 3B9BA 3UVEA 4Z1MA 2QVLA 5AHXA 3RAPR 2HBQA 3CXUA 5C2JB 1GM8A 3AK3A 2C7VA 1YV9A 3ZZ1A 4MAAA 2HQRA 1UKEA 1U8TA 1YR7A 1Z5WA 3KQWA 3ZWPA 2W6OA 4GGMX 2VP5A 1VZ3A 4U02A 4K87A 4R2XA 3A8TA 2WUDA 4C7XA 3DQPA 2ZR7A 1DKRA 4P83A 4F6CA 3DXRA 1RDFA 4PZYA 3O0DA 4NK5A 2O07A 1PI3A 4HC4A 5JS2A 5JYBA 2AMYA 2ZYWX 1VRCA 4KX3A 4ETIA 1DELA 3UCFA 3CZRA 3GA7A 3OFNA 2OM2A 3GLUA 5AICA 4FOSA 3SSOA 2WALA 1CCWA 1RE1A 4X6UA 2R8ZA 3LQFA 3EVZA 1MHTA 1VRVA 2DPHA 4H15A 4NEGA 4KVZA 4PYQA 2HJVA 3UYKA 3V42A 4WSOA 1FJGO 3S2EA 2PH7A 4ZHQB 4M0LA 4EFEA 1QAMA 2MCFA 4JI7B 1UJWB 4ZO8A 1SXJD 1SZDA 3DAHA 2FA9A 2GRUA 3WXMB 1EM8B 4ZAVA 1JQJC 1VP9A 3KLMX 1R3LC 4EB3A 3TZBA 3PNQA 4URZR 1NBMD 3TE7A 3NJ8A 2A5JA 3DZBA 1TM4E 4Q4HB 4UMFA 4F96A 1DWPA 2X8LA 3TRFA 5LYYA 2V3VA 3MWEB 3NBUA 2XJ9A 1EMDA 4IZ6A 2A5DA 4MVUA 2R1TA 4D3YA 5I7RA 2BHLA 1TJ5A 3IUSA 3KR1A 1EUYA 1MPXA 1BX1A 1P1HA 4TKUB 1NTKH 4YXWG 2WI8A 4O2RA 3ABRB 5CBHA 3WGIA 4RACA 4Q9HA 5JY6A 1JHPA 2CLDX 2ZP1A 4QPPA 1T4GA 5B3JC 3BK1A 1G6Q1 3HV2A 1GGKA 3FOBA 4BX0A 2QRKA 2VQ6A 3FN4A 4OKSA 3ZWMA 5TE9A 2HF7A 4OFBA 1KE2A 3CU5A 3M5CA 3WMRA 3RNLA 2C99A 3A28A 3TCUA 5A2QA 4BFUA 2WJ4A 1ZSNA 1PZEA 1EFUA 3VNUA 2FK8A 1DLJA 1PVOA 1M5UA 2IGTA 4WBNB 1UIRA 3CKYA 5BY1A 2H7CA 4WNYA 4AAYA 4CU5A 3MRSA 5IVHA 3GCXA 5DLDA 1BU5A 5D3MB 3AR4A 4UU0A 1XRLA 3IOYA 4DYVA 4JXZA 1TT7A 1E8NA 5A9TA 3R7FA 2Y1XA 1FFTB 2IXAA 2A2ZA 1ML4A 4M86A 4UQOA 5CK5A 2JC3A 5CHYA 3C3SA 1ZH0A 1CY1A 1LC0A 3OTQA 3T5GA 2VTBB 1QJCA 2W6MA 5E2IA 1Z47A 2XNKA 3VC3A 1U2TA 2PGOA 3F90A 2LGQA 1K9MH 1IMOA 5FNVF 2NP7A 2PLFA 4JUAA 1L6IA 1JB9A 5JJ5A 3EB9A 4Y6OA 1Y8QB 2ZDHA 1I2AA 4KB5A 3GFPA 3UG6A 3RSCA 1U7WA 5B2ZA 5E0OA 1I32A 1F1BA 2J9GA 3UWKA 2IHTA 1AA6A 1NLUA 1BOOA 2PBLA 3G3EA 3PXXA 2ZROA 4IV8A 3KXKA 2WBLC 1M1YA 5JSFA 1TKBA 3K5LA 2OCGA 1WCIB 2X2PA 1SHKA 4RBNA 1JE1A 5BR4A 5AOBA 1JG3A 3ZTYA 3OZRA 4BJ3A 3OCJA 4A8HA 4WN3A 1TQHA 4XUDA 4F12A 1DAEA 3N5CA 2X5XA 1GXSB 1P84F 1DXQA 2PNJA 2NNUA 2B4RO 3GJ3A 4DHWA 2UYPA 1S2IA 2DWEC 2A6PA 1G2IA 4XYBA 1F51E 2V8BA 2GBOA 3DOEA 3TEMA 1BDBA 2ZOSA 4PA6A 1JFLA 4YBRA 3TLZA 2AN4A 1W9HA 1K9VF 4G67A 3C97A 1P5FA 3ZMUA 5SV2A 4CLRA 3RSSA 2C7QA 1XMVA 3F7OA 3QBDA 1MH1A 1V43A 3ZRXA 3D6TB 4HX9A 4C2UA 4IXWA 4XFKA 2IJIA 4IIDA 1P61B 4E2ZA 5DHSA 2HXYA 3WLEA 4RW0A 2XUOA 2G4LA 4MGYR 4UBLA 4ZCIA 4EW3A 1V3TA 4HLUC 2F64A 3AWDA 4TLLB 1XWFA 3GEMA 2YC0A 5LD2C 3SZ3A 5EERA 3U1VA 3QF7A 3ILYA 5A71A 5E79Z 1XCBA 4CKCA 4Z9XA 3H1LH 2MYPA 2NW6A 1KMNA 1FSGA 4ZGWA 2ZRIA 1TUBA 2A14A 3SU8A 3D6VA 1BOFA 2ZUSA 5KKAA 4IDDA 4OU5A 1T3SA 1LZKA 4XSHA 1ULAA 4OK6A 4CGZA 1Q21A 2FZEA 3H9EO 3PYXA 3LTEA 1KMQA 4EI8A 4BQRA 1XOIA 3FUWA 5AUNB 1NKVA 4DBVO 4Z4EA 5K0CA 3JVUA 3HVKA 3AHDA 4LI3X 2CB9A 2QS9A 3TRKA 4KWHA 5KBYA 1G9SA 3FCXA 1MB9A 4BN4A 3DHEA 4ALMA 2XNDA 3D02A 2ZSBA 2B1RA 3U11A 3RFTA 1KR5A 4FYVA 5EE9A 2HUPA 1IBCA 5D1NA 1TF2A 1YQTA 4MUGA 3E8SA 4Z4HA 1KYXA 1SKYB 2BFBA 1ZJ4A 4FJ0A 3GP5A 2OIGA 4CM8B 1RQPA 1U8ZA 2Y0CA 4AI8A 2X15A 1N8RW 3A6ZA 1ZR4A 3K5OA 4NP6A 4BE4A 3ONDA 2F2TA 4EPVA 5J23A 3GEEA 2A9VA 1FLDA 3DXYA 2YJ4A 1KJWA 2C2BA 3UO8B 2Q46A 3L84A 4B5LA 3QITA 1O1YA 1C0EA 4O0MA 3KQNA 1RE0A 1GRNA 1IXBA 2WLKA 3PDCA 2CDRA 4YIKA 1JKJA 5SYAA 3SX4A 2X0NA 2YWCA 3CIOA 5LQUA 2DFPA 1PBNA 3Q8XB 4HDMA 3RE3A 4YCLA 3SY8A 1MVNA 5EB1B 2WE8A 3UO3A 1E5DA 3SXPA 4QGSA 2LFSA 2ZTVA 1N0UA 3L6CA 5MGNA 2ZJ2A 4X65B 5HFNA 3WQHA 4WOPA 3M3HA 2GPTA 4B6GA 3FYUB 3ORQA 1ZYUA 4CR6A 4UU7A 2WIAA 1LBTA 2BFAA 2I3DA 5D3QA 2EBFX 1XHXA 2OTCA 4PD4F 3K0HA 2HP8A 3RRZA 3OEHA 2EGHA 2F3RA 4BO7A 1YDFA 4P34A 2ROQA 4N7MA 2F95B 4KQ2A 3I04A 4IS2A 1PSWA 4LA4A 5DLQC 4JI5B 1PJQA 4BZQA 3LPAA 3FFBA 3T3NA 3AYXB 4MVJE 1XTTA 1NM5A 4LHSA 3EG9A 3BTSA 2X22A 5AM3A 4PRZA 3TB4A 1CEYA 3EZXA 5KX5B 4DQKA 1ZVVA 4F38A 1NTMH 3IODA 1W25A 3P2YA 4I8XA 3C1AA 1SQ5A 3DCYA 2Q0OC 3S2ZA 4R7CA 1U28A 1A96A 1I2DA 1C7EA 1VQLV 4IHKA 3EC1A 1HA3A 1TYBE 3ZDDA 1FX0A 4G9EA 4EW1A 1JHZA 5KINB 4KQIA 2DR2A 5BSGA 2DWUA 2A94A 1SF9A 2RHWA 4MKXA 1KVUA 1KK1A 4JEIA 2G67A 2DULA 4YPVA 2PZBA 3KALA 3QEAZ 3IE2A 1M8KA 2WMOB 2NU6B 5TC4A 4JYMA 3NBZC 3JZIA 3E86A 2NZVG 2G0NA 1GZUA 4Y0NA 2ZINA 1GT91 2FFJA 3SJAC 4OL9A 2PL3A 4HGRA 1V35A 3GD5A 4P7FA 2CDAA 1SXJE 2RAVA 1V3VA 1KDPA 4JI3O 3RSFA 3KO8A 3PPWA 3ON5A 5B3SB 4O8CA 3WQQA 5JWPA 1NBME 3B1JA 4IDPA 1S72F 3HP1A 3APQA 3K3PA 2G06A 4RJLA 1IHUA 5H7XA 5KSOA 3DEFA 1RI4A 4L78A 3ZWYA 4R3UC 2HA6A 4B1FA 3C4QA 2ZCJA 3G6EF 1R64A 2RB5A 4HWPA 3REQB 4XGRA 2MMGA 2WA2A 4HFRA 4PW0A 4F4IA 5CFOA 4MUAA 4G1FA 2Q7HA 1N4AA 5KWEA 2XTMA 4WK0B 4E30A 4D5GA 5AIAA 3AEUA 2O8CA 2J08A 3FF4A 1W30A 5EP3A 1KI3A 4N1AA 1AV7A 2VQFB 3JW8A 2ESRA 4TMKA 4R9UC 4M9RA 3UF0A 2A84A 3J80M 3P4XA 4Q7KA 1M66A 2EATA 5CK4A 2I2CA 4YC7A 4P7BA 3ZIDA 2Q5JA 4IGFA 4UBOA 4YJHB 3EIWA 4IDHA 4HNHA 4AF6A 4NYMQ 2W71A 1O6FA 1FSSA 5IT9M 5JSZB 1UINA 2F55A 5CA3A 4KXVA 2XB2A 3BWVA 4OQMA 5G4KA 3M8KA 4B08A 1QAHA 4GNKA 3NTOA 1ZINA 3N8GA 3RB8A 3ZBHA 2VRCA 4B7AA 3EOAI 1MGPA 4EGSA 3VSCA 3PE4A 5A6SB 4CC6A 1BQ3A 1AUOA 4BECA 1F6BA 4NZ9A 2B61A 1C4XA 1RIFA 1QCDA 3VNAA 3V8PA 1JDUA 4I14A 1COWD 1D2RA 4X94A 2YN0A 4YRFA 2OV3A 3QJYA 3OHPA 2O7RA 4TPKA 1DG1G 5E7IA 4K8OA 4NJEA 4RH3A 1PR0A 2H06A 5EINA 4D9FA 2QD5A 1Z4QA 4NCXA 3KJNA 2Q50A 1SU6A 3I3OA 1WV0A 1KU9A 2R66A 4BO4A 3GVCA 4AJPA 2CHUA 1PKXA 3MT8A 2AR9A 3D7LA 4IL5A 4K6GA 4TXJA 1GPYA 3ZXXA 3EZNA 1HFWA 3JXEA 3OFJA 5BWOA 4DFDA 2IHNA 2R84A 3LPCA 1DG9A 3LUAA 1GN2A 2I9KA 3W7VA 1CPYA 3M6LA 3D00A 1CQPA 1FJHA 4YQEA 2IHUA 4JYCA 1ABFA 2FG7C 2MYTA 3I12A 4MEJA 3EWNA 5EZSA 1SHLA 4I5GA 2GN0A 2J0SA 4A92A 3TLJA 5GIPC 4IG9A 3QRWA 3VKUA 2PYIA 4P0PB 4PG6A 4DY6A 5B3AA 1ZD3A 4KMRA 2BJWA 1LRJA 4TRJA 1XZDA 3AOGA 5LHIA 2HMYB 5DHQA 3SKVA 1S5PA 1I1HA 3PQFA 1NGSA 3CEIA 4B81A 4NYKA 3BGSA 1CR2A 3E8BA 1PZGA 3BULA 5EPOA 3H11B 2ETNA 1VSTA 4P5PA 5DV9A 4XOUA 3O8BA 3VYTC 4ZOLB 5DTRA 3K5HA 4CG0A 4LFAO 3L8YA 1MO3A 4OHUA 1NMYA 4X54A 3E84A 2FN4A 1XD9A 2GYYA 1Y8ZA 4J8PA 4B3IA 3AUXA 3EY4A 1OGIA 4DQLA 1MJGM 2FQWA 4BKRA 3H0CA 4CIWA 3GRPA 4KITB 3UXYA 3ZLTA 4N65A 1URFA 1OGYA 1H2YA 1XKXA 4J0EA 2HJSA 3LVFO 3FWYA 2ZRQA 4KXWA 3NHKA 4D9GA 3CCQV 4XM0A 1VL1A 4ZIRB 4BVJA 4QFCA 4YI5A 1N57A 2WIDA 4NJMB 4ARUA 5JHGB 1JKIA 1XV5A 2TSYB 3H1TA 3OAAG 1KMMA 3ZD9A 1P4HA 4E7OA 3QLTA 1ZWZA 1QHHA 2V9ZA 4WFGA 4ZDKA 4RCVA 1B1AA 4OXQA 3T3HA 2HIGA 1DJMA 4S1PA 3BRCA 1P2DA 2RHTA 3M2TA 3GW8A 2BPOA 1Z22A 4MQ6A 1VQOF 2RGGA 1ZL8A 1H4TA 4IZHA 3K1YA 4C29A 5BW5A 3B8NA 2BLLA 2HU8A 1YULA 3GPLA 1H42A 2J9RA 3ZWWA 1SRQA 4BVBA 1O03A 3IDZA 4Y6SA 4GI7A 4RSGA 2C2MA 3OOEA 1HE2A 4M37A 2JA2A 3F47A 2F17A 4LF7B 1EUZA 2P6JA 3KD3A 2GCEA 1QONA 2PLRA 4RA9A 4IDEA 2R44A 4YMLA 1HL7A 2CW4A 5CB4B 1IWBB 1XJCA 5EBMC 1MC1A 3NALA 5CEEA 4ND8A 4HEA1 1YA4A 4LOHA 2ZB2A 1OYOA 4IICA 4P38A 4JBWA 3ONFA 3O95A 4EHJA 3QI7A 3NWJA 4B44A 5F4BA 4RVSA 5SZHB 4E3WA 2DTEA 1XNQB 3L02A 1CF9A 5CDUA 3HSKA 5J2UF 3CINA 2WAYA 1U8FO 4MYCA 4F6RA 1GG2A 2V58A 1M2FA 1KZ4A 2CXNA 2DPGA 1CEZA 5HM8A 2FYUH 1R4ZA 1U0TA 4MRMA 5FQOA 2MU1A 5F78A 3X3HA 1DZIA 4NI5A 4CPDA 5SY4A 2LGWA 3RR2A 2O3SA 4JOSA 1Q1AA 3T1YB 1YK1A 5EC2C 1W0JD 4HRXA 3TLGB 4DV2B 3C9RA 1TW2A 3O47A 3SIXA 2H4FA 1BCCH 3NNNA 2X4GA 1J0EA 2LBTA 5CVJA 3PV0A 2AFHB 2JGJA 2FDXA 4LYEA 4L85A 1QG0A 2XKBA 4G36A 1PNRA 1A72A 3ZZ0A 3UT6A 5HDBB 2QBYB 3RADC 1ZCJA 2CH7B 1P2TA 2VH5R 3X1MA 1QR2A 1YS9A 3DAFA 3IUEA 5FADA 2JH8A 3SOPA 4S35A 3KCYA 1WOYA 4OYLA 4MVJA 4JX9A 1Z4OA 3IMEA 4F93B 5KPJA 4H6WA 4EMTA 2GCPA 1OMOA 4Z4GA 2QRVA 1GUAA 2HHLA 1MFZA 3DZCA 4F9EA 4GAEA 5H5NA 3LY9A 4LK2A 5EWRA 1JJ2F 1DHRA 2D1SA 5TMDA 1U2GA 5ALRA 1QH1B 5C4MA 5COQA 3SC4A 2W42A 2D1QA 2E9SA 3TGWA 1IZ0A 4LX8A 1X2EA 2H4WA 2Z1UA 5LL6P 2O5RA 5I8PA 3EEOA 2IU4A 4AO6A 2X7HA 1Q74A 3GXOA 3BA9A 3A6HA 3CG0A 4FCCA 5E95A 1PJZA 4D0NA 4P4SB 1HE8B 3P9CA 4DR1O 4LF4B 4HHEA 3GT7A 3GJTA 5E7MA 2WSSG 3K5PA 2HVYD 4EWLA 4TVBA 2REOA 3GFVA 4LNUA 2ZJYA 4B62A 1IJKA 1F1JA 5IEBA 1EJ2A 2PGIA 3DGEA 3UUFA 1EGQA 5IEJA 2K4MA 2NGRA 2KTUA 4DKJA 1NVGA 3T3EA 2ZPAA 1SXJA 4YN3A 5LQCA 2WVGA 2WWTA 4NEQA 2HX1A 1L0LH 1NNUA 2L6LA 2M6YA 4GX5A 3DAOA 1NBMA 2EL7A 2JGDA 3ROKA 4RZUA 3GLFB 2FPGB 4P31A 3LRPA 4C5AA 3RRMA 1XMJA 1ECBA 5EKDA 1KFKB 2C77A 4KXUA 1W0KD 3W5CA 1NLZA 1YIJF 3T9DA 1QYDA 2HDHA 5LA6B 3UJPA 1P9LA 3VBEA 5HMMA 2H92A 1NC3A 2OHXA 5EP1A 2O54A 5EFOA 1VI2A 5MGBA 4LF9O 4PV7A 4BMSA 1CLUA 4K5QA 4EAQA 3LLVA 3PPIA 5KYWA 1F0NA 4CH6A 2QVBA 1P1KA 2VJYA 1J95A 5I9SA 3GVMA 5DYYA 1K92A 1QM5A 4F4JA 1NDUA 2Q27A 3LX8A 4D3DA 1QVZA 2FDRA 3V33A 2I62A 5KDLA 1MAHA 3KNZA 3TIIA 2EJ7A 1D2GA 1MABA 4PI0A 4TTTS 5L3SA 4JQZA 2R1VA 2XCUA 2PLAA 1JR6A 2PIDA 4IX9A 4XVRA 4BZXA 3EEIA 4Z2AA 2UZAA 5L3QA 3HKBB 1HNZO 4JSTA 1R1BA 4KNYA 4DS3A 4TRNA 2DSNA 4YDRA 1AQJA 4MQMA 2YN2A 4QPDA 3DEJA 4LHXA 1V9CA 5FFFA 2E5WA 4Y2PA 2IZOA 4Q4AB 3HR4A 2JHFA 2LUOA 2NYRA 4P84A 4DLRA 5JXHA 2Q7OE 4FM1A 1H8EG 1JXMA 3UAOA 4PJ0Z 2WY2D 3HB4X 2WLTA 5FNZA 4KSBA 4K35A 2GBLA 4RE5A 4M89A 4CLOB 4AMYA 4C1NA 4WRRA 3FG9A 4KWTA 3GLSA 3DB1A 5GJWC 1XZJA 2DPMA 4NBTA 5EMNA 1VG9B 3KX2A 2ZDIC 3C43A 2R9AA 4I50B 4RGBA 3Q11A 3UTDA 1X7XB 5JNTA 1MVOA 4L75A 1WU8A 5HE8A 1TC2A 5KIAA 2FX5A 7GPBA 3SWWA 4ZOQI 4WBXC 4Q7MB 1AF7A 2DVMA 1I5YA 2VTVA 3PHHA 2YMPA 2PQ0A 1MV8A 3L4BC 5CVCA 4IDQA 2YWGA 1K7YA 5K45A 3FMGA 4ZI7B 1QDLB 2YYEA 4CG3A 4YAKA 2ZI4A 1NRXA 3K32A 1P19A 3BL6A 5BN5B 1P9RA 2FJ0A 3BA1A 2VHXA 4YX9A 2OUIA 5J1TB 4ZIBA 4PTZA 4IOMA 4C43A 4TQUS 4MSWC 4OI2A 4BN0A 3HBJA 3MWDA 1JHQA 2P79A 3V7NA 2PSFA 2XUKA 1DTWB 4X3CA 3WX0A 2IP2A 1UDRA 2IOQA 1R6NA 4ZN6A 4AWAA 1DAIA 1DADA 2BFMA 2L2QA 4UXNA 5AVOA 3IQFA 3P96A 4M1SA 1HR0O 3AY3A 4EHNA 1QBZA 4BO2A 1AMNA 5B4VA 3IXMA 2XVMA 2BBTA 3ML0A 3CG6A 3VDXA 2A1TS 4PGHA 4LF6O 3K3WA 2V4MA 1Z0AA 3GNTA 2KJQA 5T4BA 5HK9A 5B6JA 3QTTA 1U7ZA 5K3SA 2IV7A 3WL3A 1V2HE 4EMUA 1ZNZA 4BV3A 3G71F 4MV3A 4DMLA 4LY9A 1R88A 4B34A 3CB2A 5LGNA 5KVSA 3C5VA 5F9FA 4Q6WA 3H1HH 4DCPA 5F5LA 4G0MA 2UVQA 4PHFA 5LBIA 5K0BA 3UO2A 3PX2A 2ALJA 2PZJA 4JBXA 5FYQA 5G02A 3GLRA 2B83A 5F2KA 3TAUA 3WK7A 3KAJA 2XRZA 1J21A 4ZQBA 3EPLA 3QUCA 3OX4A 1K3UB 4S1OA 1NSTA 2Y1KA 5A06A 1OBOA 1D1PA 4TTIA 1V41E 2EEPA 2Z8YA 3ZHQA 2XDWA 5A7HA 3M34A 1DF4A 1EVLA 1G4UR 1OVMA 4JP1A 4M3NA 2FL4A 3PX7A 5HF8A 1O87A 1JR9A 5BN1A 3GFOA 3ZHVA 3OPXA 1XVUA 1YBVA 1PNMA 2WILA 3C3PA 1G41A 3EXHC 4ZMRA 4JITA 2FWBA 5BQ5A 3BREA 1E0AA 2DTXA 5A0TA 4PA9A 1FMCA 4WNAA 1P75A 3Q4HB 5LQKA 3T1NA 3W6UA 1XZ8A 5T3YA 2ACVA 5KC9A 2R68A 1MA3A 2PSDA 3KC2A 2SNIE 1GOTA 3EGWA 1N32O 3LVRE 3K5WA 2WD8A 3F46A 2IJKA 5HJ7A 4GYKA 4CMIB 1G5QA 3O8NA 3D3WB 5KNBH 1N6RA 2GAOA 4JI6O 2KG7A 3IKJA 5DOZA 1J49A 3BFJA 1SC6A 3VJLA 1H0SA 1OYYA 5NLLA 4KDCA 3T7IA 1ORDA 1RYZA 4YB8A 1P8JA 4JC0A 3WXBA 2CFRA 1E2PA 2ZI6A 2GCNA 1EE2A 1F2UA 1U0BB 2B92A 4PIVA 1UDCA 5FL7D 1YAJA 4M0FA 1YBAA 2G1KA 3HUTA 2WP8J 2QLBA 2BEWB 2O06A 2KHZA 2GHYA 4BKQA 5AVKA 4IQ0A 4QGGA 5JH7B 3DFMA 4JX8A 1IIBA 1ZQ9A 2B4QA 1QFSA 3AFIA 3OZUA 4NV1A 3F5FA 4D80A 3W04A 2QB5A 2PMBA 1QWOA 1ZWKA 4BNHA 2TMKA 5FIUA 1YQUA 5CA1B 4YDHB 2DT8A 3PNLA 3NT4A 3TUJC 4TZZA 1IXZA 5GJCA 4BWFB 2V74B 3IS3A 1U98A 1JEYA 1XEAA 1H8HA 5F51A 2BSXA 3BK2A 3JQBA 4ZVRA 4E4EA 2B8NA 2WHPB 5DI3A 3GJSA 4FMCF 3DTNA 1W41A 4RMIA 2DLDA 4XXHA 3QMWA 1QV9A 1D2HA 3G2KA 1TCCA 1XDBA 2B6HA 5IKPA 3TXXA 1RRKA 3ZY4A 1K97A 2Z4RA 3AF1A 2GXUA 4RF5A 1O96B 2IYNA 3U7HB 3S0YA 3IAM1 4TZ0A 5LYJF 1HETA 3TIXB 4IF6A 1DT5A 3B3FA 2Z5VA 4H33A 4DWJA 3B13B 4B84A 2RI0A 3HBFA 3GRCA 3VRHA 3UGJA 1L4NA 5D86A 1HFEL 1CY8A 1V11B 3GBVA 3JVHA 1J7JA 3K1AA 4UE3S 1XMQB 1F2DA 3CPJB 3JPYA 5TQ2B 1ODLA 4RZ3A 2M32A 4RD0A 2DF8A 2NUAA 2OYCA 4R1UA 2W6JD 1PWXA 2JATA 3LCUA 2LKDA 4TYWA 1JU4A 3DEKA 5AI5A 1OTYA 1D6MA 3V4OA 3NVKI 4J7JA 1XKQA 1QCEA 4ZICA 3RJMA 4Y1RA 3I1JA 5JAMA 4CF5A 1KY2A 2QM4A 1EE1A 2XXBA 5IAGA 4RDIA 2GK6A 5KYGA 1GQ2A 2BTQA 3LQQA 5GOZA 4RIHA 1V0JA 1BCSA 1ESDA 4G3XA 1R2QA 3BSWA 3UXHA 3BC1A 3DFZA 3Q88A 3BD6A 1JHDA 4S04A 5TMEA 4URYR 3BD7A 1QVWA 2I2AA 3GROA 5E4JA 3RU2A 4OLHA 1UJ4A 3DT8A 1DGQA 1E1LA 4U8GA 1X7YB 2IU0A 1LI5A 5EXDA 2AW5A 3K8OE 4RK5A 1V6CA 2PD4A 3TTYA 3DVAA 4D6PA 3GAMA 3UQYS 3V97A 1J8YF 3R23A 5CYFA 2WLNA 1MO4A 3BHNA 4D3ZA 5BQ3A 1VTKA 2IHBA 2IEZA 3ZC3A 5IT4A 5LQJA 4D2IA 3ZWNA 1PEKE 5JZ9A 3RT9A 3W05A 2RGDA 2O8BA 3IP1A 2BZSA 4D8UA 3AR6A 1G1MA 4GC9A 1XNJA 4IO0A 1GKYA 2PF4E 3J7TA 1MLDA 2E87A 2OPBA 4JI1O 3JQGB 3WE7A 2H3OA 5FLXM 5GV8A 4KGVA 5DHUA 4J7ZA 4IDCA 2C5SA 4MW9A 4O25A 1JSLA 3RYFB 4YQZA 1RSZA 4EI9A 3TJMA 2Q9BA 1DX9A 3CWQA 2B1GA 4FMDB 5DO9A 3I9FA 5E7QA 3OQPA 2WTMA 4CFYA 2A0LA 4UQPA 4LGCA 1KORA 3HKDA 4W8OA 2O3UA 1HY3A 5DULA 1DAHA 5FWXB 3IOCA 4CTKA 1I7NA 4EKYA 2IXDA 1U5BB 4NZPA 3UV7A 5ADUS 3QJ5A 3WL6A 1A1VA 4UQLA 4HNGA 1GKIA 1P73A 1BS9A 1SCNE 2C9MA 2YJGA 2V3CC 2AJTA 4NCHA 2QMZA 1DEAA 1RU3A 4OGQB 4E13A 2E4AA 1ZS9A 1L6RA 4KVFA 1QU2A 1U11A 4L4YA 1NR7A 2IXGA 1OFTA 2AKEA 2KQUA 4MKIA 2ZWAA 3SBOA 2GN4A 2B3TA 4MJ3A 3QWBA 1WG8A 2OCKA 3PHBE 4N7BA 4YIPA 3KU4A 4TGLA 2C04A 2FE4A 1H66A 3FTCA 1T9HA 1H6CA 4DIFA 2AYYA 3Q9LA 3HUDA 1AURA 1L9KA 1YQXA 4LC9A 3AGQA 1JEDA 3V7WA 3UM7A 3K59A 1JSZA 2ZJFA 2QVGA 1K73H 1WZ2A 3PFHA 4BQIA 1RAHA 5FD8A 3DF9A 4ZK7A 5ILOA 2CFTA 4BW9A 5IYZF 4FX2A 4A6DA 1SD5A 2WU1A 2WDZA 1VQPV 3UMJA 2NUBA 4DLWA 5IC5A 2AC7A 2MSEB 1Z0IA 2A59A 4MMZB 2ONJA 1K27A 2CWDA 5AKLA 1TLFA 2PL9A 1FVXA 2G4VA 3WWYA 3AIIA 3QBVA 3O0TA 3UW1A 4AU1A 3WRVA 3S70A 2YVLA 4QDJA 4PR3A 5IRCD 1JI0A 3RJZA 4LZPA 1CJSA 5FUVA 3NTQA 4F92B 3PXCX 4FYPA 2VCHA 4UM9D 1KNQA 2B1QA 2EJUA 5DW3A 4BVHA 4RLHA 2F3UA 1TJ4A 1QH9A 4P2ZA 3MTAA 4AUKA 2WU0A 1KP2A 3RUEA 5F5XA 3L04A 4MSUA 3CV3A 3VBBA 1O97C 3ZDAA 4MUNA 3MHSC 3UK7A 3F7VC 1MJ5A 2BELA 3RAFC 2CJYA 4BNUA 4Q3CA 3KOWA 4EY6A 3SIPA 1UMBA 3EDOA 3ZCXA 1DK1A 3ADPA 2B9VA 3DT9A 4K6FA 4YH1A 3ZE8A 1IDN1 3LDFA 2IYWA 5KVAA 1NTRA 1RBZA 3K9SA 2Y76A 5KTOA 3EIQA 5HS6A 3KYDB 2Q3HA 3O2NA 2RHJA 4J3FA 3ABLC 4Z2WA 2CXRA 2OCCC 3TPFA 5LUAA 5CXXA 1G5IA 2JIMA 3J7AC 1IN4A 4HG2A 5IXJA 1PZFA 2CCKA 4A2CA 1NUPA 3U5TA 3GU3A 4R1NA 4QGPA 4G0WA 2QUZA 3K58A 1W85A 5CH5A 3LQKA 1JQ5A 2ATXA 1DU4A 1E1RG 5C8YF 1R3IC 4Q18A 4GYYA 2Z3WA 1Y5IA 2OWDA 1DWOA 1UBRS 3WAGA 2D74A 1PZMA 3GRYA 4BT7A 1KO8A 4BMPB 2B4KA 1A0OA 4IMJB 4PG8A 1ONBA 3HB5X 3VYRB 3KKEA 3KPVA 4BO8A 4JK3A 5LSAA 2G0AA 1N75A 2C96A 4N7JA 3OF3A 1N2ZA 2H51A 4CC5A 3ZMZA 4E6EA 5E0KB 2Q3DA 3WP1B 2EFEB 1RXIA 5BVGB 2ISSD 2CLKB 5EMMA 4HZ3A 2QIOA 1T4CA 3LBYA 4W1RA 1TYZA 3IAEA 1D5CA 3HR0A 4KO2S 2QWPB 4TV9A 1J00A 5E6SA 3I32A 4O0LA 4XLZA 4G2KA 3W2HA 1Q92A 1RA4A 4A5OA 2X1MA 2ZZKA 1I4LD 4RHFA 4BEBA 1L7VC 1O3YA 1SOAA 1PQPA 5KAFZ 5I01A 4Y6PA 5AESA 5DNEA 1H9CA 3OPQA 3Q7EA 1VHQA 3C3BA 2P0AA 3T7JA 3UXEA 2FFRA 3K5MA 2P22C 1WM1A 3WA7A 1W0JA 4H3SA 2OGTA 4IS3A 1AY0A 4KR6A 5IANA 1K08A 5IKEA 4DUZB 1XPRA 1XTIA 1HDEA 4RUKA 3ZKAA 1EFRG 1D04A 1KJJA 3IO5A 2DG2A 1BXRA 3F6RA 2CHFA 3WK9A 3NH6A 2GEJA 1N0HA 1PWZA 3GC6A 3F98A 2BJVA 5I5GA 2BBWA 1P7BA 1FBTA 3PNPA 1TGOA 4RMJA 3EEQA 2VF4X 3T3MB 2P3SA 6LDHA 3FB6C 4OH1A 5HOQA 2IG8A 1QGUB 1LVUA 5HCUA 4B4KA 1I13A 3V2IA 2JIPA 3V8BA 5C8DA 3B3GA 2D4AA 4Q5IA 1N2GA 4Y9RA 2E82A 2OR3A 3DGFC 1OUMA 2EEZA 4JR2A 1PS8A 5GW7A 1X14A 4NATA 4WESA 1KMHB 4BPBA 2I1VB 5KTSA 1B43A 1E5QA 1DBQA 4RTKA 4INJA 5EKUA 2ZVYA 3AHIA 4WCFC 3JQFC 4B6FA 4O4HA 4M55A 1UBMS 1AQIA 2MK3A 3AU9A 1DRKA 1ECGA 2VS0A 3CPEA 2A7WA 1NUTA 1LV8A 5C1IA 5EHXA 2EBWA 4FW9A 4ZQCB 1XRRA 1VQNV 3VPSA 2XH8A 2GXQA 5ADHA 1LK0A 2OZVA 5BT9A 2WWXA 3ZD7A 3GAAA 3ISJA 1EK5A 4P33A 3EODA 3FCEA 2ARHA 5HY1A 1CRPA 2KS6A 4Y30A 4OHKA 2PE5A 3TFWA 4Y7DA 1ADGA 4U3JA 3T1QA 1M5RA 1QP0A 2FZLA 2UUCO 4HNAA 5EGSA 4CWAA 2ZR9A 4EYKA 1IUOA 2VZ8A 1UXOA 1QHTA 2GZHA 4EDFA 3P0IA 4ZFNA 3R4CA 1FFGA 2O48X 1YRBA 2Q4RA 4ZO4A 2I34A 4LBYA 4YUXA 2PLNA 3A2KA 1HYEA 2NLJC 4DKXA 4PIMA 5KYYB 3LYBA 4ILEA 1GZHB 1HW7A 1RFGE 4KQ6A 3BGDA 4WOBA 1W2WB 4P4TA 1Z26A 1RM0A 2VL7A 1Z5GA 3NIDB 1QQ7A 1XZLA 4NFLA 4WXYB 1AT1A 3NIGB 2ZTLA 3K4PA 3OWHA 1M8PA 3PD1A 2W22A 1TZ2A 3OZXA 3DDSA 1QG6A 3CMAF 1XN4A 3DOFA 1Q16A 1ZJZA 1B0UA 5KNBD 1HDJA 4NV3A 2CVOA 5E3HA 1MO2A 4HAOA 2EHJA 4LW8A 2HA2A 1KY5A 2VDLB 4MEBA 4E14A 5LGTA 3ESXA 3F5DA 4NY1A 3RVRA 4AY2A 1R66A 4MVSA 1EE9A 3SF8A 3PKZA 3ME5A 3ZN2A 2P77A 3GCDA 2R4UA 1RWKA 2FMTA 1MC5A 1T91A 4LH7A 2Q2NA 2UVDA 5B66Z 4EHBA 5JJNB 2YXLA 4EKWA 4TRRA 2O3RA 1K7XB 3FYHA 3ENVA 1GZ6A 1SG0A 4WWHA 1M2NA 2H2FA 1ZN7A 3GGGA 4B6SA 3TINA 2MWMA 1M67A 3IT2A 1FF9A 5EJ9A 2X1VA 4B32A 4JLWA 2DQZA 4A7PA 5DEIA 3FYDA 5D84A 4J3JA 2QENA 1WVMA 2XB9A 2ZJAA 1GFZA 2ATIA 4DABA 2QJWA 5ERYA 4PSAA 3AHHA 4BNNA 2C2KA 3THRA 4HPWA 4JGGA 1Y6QA 1B15A 4EYEA 2Z9DA 4EJSC 4POAA 1UAAA 4XIFA 1J97A 4F1KA 2ZREA 2ZR3A 5LXTA 3OEEA 3VR3D 5K0SA 1N34O 4LJ8A 1EXMA 3RWBA 3OWXA 4FM2A 3UK2A 3U3MA 3HCWA 2EJRA 2CNOA 3V6LA 3W78A 1KQFA 3W77A 1Z5NA 4PE5B 1N2BA 1MX1A 1AE1A 3AXTA 1SIOA 2ZB4A 5HTKA 4XDJA 2A1UA 3TQFA 4JI4B 4RLQA 2QT9A 4DC9A 3MJ4A 1CQJB 2NADA 3GIWA 2I22A 1OHHG 1H9AA 2OTMA 4RTQA 4HDRB 4RV4A 3WZLA 3AF4A 2ZSJA 3RDPA 4AL4A 2DKOA 3REFA 1VLQA 5F12A 1ISRA 3ZHUA 5H80A 2B82A 3R74A 1RLGA 4L8GA 1CUWA 1X9HA 3RWOA 5CB8A 1K8YB 5LC1A 3ESQA 1GPKA 4B09A 5FO1A 3C5HA 2B35A 3ZI4A 4TQ9A 3K70B 3CCMV 4D1YA 5JFTA 3PFIA 2RG1A 3CM0A 2ONYA 3MZ0A 4EHIA 3HUUA 4XB6B 1FTSA 2I7TA 3ROGA 4V0SA 4FLXA 3GFQA 3F74A 4F2DA 2B37A 2VJPA 4GUAA 1DPFA 1CE8A 4XR9A 4NS4A 3W5UA 3Q7IA 2PU7A 1O6GA 1KD1H 1AGRA 3E22B 2CKMA 5BV7A 5CDFE 4EFNA 3JWEA 5DM1A 1E2NA 2L17A 2QWXA 3AJ9A 1PXWA 2C9OA 3UBMA 1Q0HA 2PBZA 5IYDO 2GYWA 1XDCA 2H2IA 1ZD2P 1Q12A 3ZN1A 2O19A 2UDPA 1I36A 3TBFA 1PGJA 1NLYA 3ZTTA 2EFGA 2D7CA 1TXGA 3T54A 1CZHA 1M6NA 1NWCA 3CF2A 3ZXYA 3LBHA 3NVDA 4KQFA 4J7XA 1FIUA 1SUDA 1ZUWA 3UKDA 3NBMA 1DWUA 5LMNO 2B5WA 3LM8A 5EIEA 1F06A 4EFMA 4DA4A 2HU2A 4B7CA 4TVOA 2JHAA 4IOJA 4RH1A 3FMOB 5DT9A 4DLAA 1QNMA 1Q7GA 2W2QA 4RPGA 1P0MA 2R8OA 1TUEA 1QZUA 2WU4A 2YXDA 4RK7A 3D2BA 3CYFA 2BOCC 1YBFA 2FEWB 2RH4A 3DPUA 1Z5ZA 3VYWA 4BB9A 5C80A 3VDNB 4I9QA 1OF1A 5AOVA 4R83A 5JMWA 1HL3A 3FDZA 1XMOO 4CM3A 2C20A 1ZM7A 2BM0A 5TIIA 1OXTA 3HFGA 1RMTA 2ZR0A 1MOQA 4K7JA 4GVXA 2WB4A 3FNIA 3H8WA 3SBXA 3INGA 2EQ5A 3L9DA 1ZITA 4KAXA 4K0KO 2NO4A 1NKTA 4M1WA 3CE9A 4LIPD 3H13A 4PR0A 3RG2A 5JI2E 4D0LB 1JQEA 2OA0A 3FB4A 1C9MA 1QF6A 5FL7A 4QRIA 1U28C 2VK2A 5CEFA 5JV5A 1O9HA 1X0XA 4D8TA 1ZMXA 4EQZA 1YRHA 1XO1A 3K71B 1SAYA 3G85A 3QNWA 3CC2V 3W5DA 1RHRA 2H7XA 4IIJA 1FQKA 1CBUA 4G4WA 2XR1A 3ABZA 2HS3A 4RY0A 4FEYA 1QQTA 3IGFA 4UHFA 2VGMA 4BVRA 4K40A 3BD9A 3NVMB 3DC6A 5KO2A 1RM4A 1Q81W 4DUGA 2Q6AA 2NZYA 1K89A 4IYIA 4Y1EA 1EP2B 3V9AA 2FUKA 3Q3IA 1GSIA 4KPUA 3CCEF 1FUYB 1RPAA 1FQOA 3KIPA 2QLFA 1NG9A 4BEWA 1OASA 2UXDB 3FSGA 1X1QA 2IITA 3CRRA 4O02B 3WIVA 2QLJA 3GUUA 4TWZA 5K4GA 2K87A 3J80N 2GHIA 3DL4A 3QFTA 4RHAA 1MOPA 4FHFA 4Q7QA 3C7TA 3DKPA 4QEZA 5FAKA 2XYPA 4E5KA 3NBAA 5IT9N 4GX2A 3ZE1B 2W83A 3FPEA 2PZFA 1FFDA 4NYJQ 3C8MA 3OE7G 4G09A 3BQMB 1N3BA 2O0MA 1NJ8A 5KHIA 4KBFA 4ACBA 3G0BA 4WDQA 3QNUA 2V7BA 4KR7A 1Y0BA 1ZDMA 2GTSA 2FF5A 4TTQA 1G6OA 3WGUA 3OW2U 3FOWA 3NWEA 1OPXA 3HDJA 2VA9A 2D62A 3TDMA 5FR1A 2R6GA 4UM5A 3W3ZB 4XWTA 1J4AA 4YJ2A 1PHRA 3AOEC 5JHHB 5LWHA 2W6JA 3WMEA 4A15A 3HYNA 1QMPA 3E7FA 3HVIA 1SKAA 5I7HA 1QRSA 2XDQB 3UYLA 2DUMA 1K88A 4CTJA 4QJFB 4GECA 1PL7A 1EZVH 1Z7EA 1UDWA 1Z4LA 1OXSC 4RL6A 4IJMA 4KXNA 4LE2A 1EWQA 4HBNA 1P49A 1DUIA 4OB7A 3NWPA 2OSVA 1L0BA 2GFIA 1MJNA 2YY5A 2BT4A 1JJOA 2JLRA 4N6NA 2FMLA 3GEBA 5YASA 1NZFA 3L0IB 4D8WA 2GGSA 1V1RA 3GLGB 2UUBO 3V55A 1OWPA 3GV0A 2XZDA 4R2JA 2CV0A 4HDAA 1XU4A 3OMAB 4IQ4A 3D36C 2ZM6B 3GFRA 4FFKA 3EH1A 1GZ0A 3URMA 4QOEA 2VP4A 3AI1A 4KRXA 4IKPA 4UV9A 4ZVUA 1TDJA 3MW8A 1GADO 5KJFA 2FFQA 3F3SA 1LW7A 2EIKB 4BT4A 4RZXA 1O0BA 2IEBA 5CNJA 4L51A 1XAHA 3NKFA 1IBRA 3O94A 4YJKA 4GPAA 2BP7A 4PWYA 2OD2A 2JFOA 3T5BA 1USUA 2A3NA 4JLDA 5FXMA 3LHSA 2ZSUA 5JCOC 3V1MA 1I7SB 4QBKA 1JCHA 4B6OA 4NCBA 5B1EA 1J5EB 4UHBA 1E0JA 3QBJA 4JNCA 1MZEA 2HQBA 1FYVA 1TC1A 3VC7A 4PSVA 3H1EA 4PIPA 3A9VA 4MZXA 3T0FA 1H0KA 1T2FA 3WO0A 3KQHA 1OJHA 3RIEA 1H48A 2R8EA 5ITVA 1I9CA 4PLPA 2JCGA 3AEKB 5A4MS 2X13A 2XJ4A 4GGPA 4C0WA 4EZIA 2GBFA 1WAZA 1QS0A 2UAGA 3I37X 4BO3A 3DDZX 2QKSA 1M5TA 2NN3C 1G8KA 4WVFA 2HR1A 3BHPA 4QO8A 5DXJA 3U7QA 4NG4A 3FYTA 4UREA 3OTIA 1W1UA 3F2IA 2O5CA 3HN2A 4AQYO 4N9WA 1GPNA 1C30A 2JFPA 4X1IA 2DOSA 3CLTD 5B4TA 3OQBA 3ZOZA 2IEYA 2FR8A 3JYPA 2AN5A 5ALJA 5CLJA 1UL1X 5DOVA 1QFYA 2Y4UA 3IP9A 3S2YA 1KYOF 1YDEA 1KDVA 2FLKA 1I3OA 2Y9MB 4F5DA 2AW3A 4D4JA 1CHDA 3BD8A 1ISMA 1LK7A 4DV3O 5A9SA 1WCWA 3G9QA 3ELBA 3PHCA 1MEOA 1PW5A 3DLHA 5DCUA 3CCSF 1NJFA 3OJCA 4ZKDA 3HH8A 2CJWB 3HC7A 1SUIA 4BVGA 3WKDA 4EFLA 5TJ9A 5BWNA 1DIGA 5C8VA 3WAJA 2QTVB 4D0SA 4OUDA 2FR1A 3IR6A 2H5IA 1U43A 2VWPA 1DAGA 1Z0KA 2ERCA 3DBLA 1ZGCA 5ERGB 1FFYA 4LCBA 1Z07A 1WNFA 2JKYA 3G9UA 5IWAB 1BGYH 2QW1A 4ZZIA 4OPHA 9MHTA 2GF9A 2E21A 1BFKA 1EJ6A 2FUNB 5LHGA 1FDRA 2HZ7A 5KOIA 4DZRA 3PR2B 4C7OA 3KWJA 4R7ZA 3AF2A 3F5WC 3HP4A 4IEIA 3UQ8A 2YS8A 4UVAA 2J48A 4LF5B 5IJXA 1C2YA 4GYWA 3VYSC 4K28A 3RS9A 3A3YA 3ZGOA 3W5VA 2PWYA 3PF9A 1L8LA 2GBIA 2WV9A 3MVEA 1SVWA 4PN3A 2YIVX 1SCDA 2QUIA 3BILA 3RFCA 3TEFA 4I6JA 3A3OA 3MJHA 3FBTA 4KAFA 4GS5A 4L4XA 4QFBA 4V3CA 2HMSA 5IDWA 1NS1A 1U6IA 2PL5A 4IIHA 3D4LA 1FYFA 3A2LA 5MFPA 1KRHA 5KLVH 1R1MA 3FRJA 4NZNA 1OU4A 5I9LA 4UOEA 3WRWA 5ITWA 3RFRA 4DZZA 5JS8A 4U7GA 1ENZA 5K3FB 5BN3A 5HFAA 1EI9A 4NBNA 1I2ZA 4DR7B 1YZVA 3LX4A 2YVUA 2OYSA 4BFLA 4D0RA 1TM3E 4G1VA 5CDFA 1MN6A 3F6CA 3PXEA 3DDNA 3PBKA 3VO9A 4MTLA 3M1XA 5FUYA 1GRVA 3OTOB 4A0FA 4QE7A 4W7SA 2GD6A 2LCIA 4DCMA 3K05A 1BVHA 3UB2A 2X5OA 1UDAA 4MV5A 1VH8A 3PJEA 1HSZA 2QM7A 1PJRA 1F0PA 3CLRD 1M83A 3OTHA 1YBMA 3THOA 2DXIA 1EP3B 2D2CB 1Q0SA 2QP3A 3JALA 2ZAYA 2ORWA 5BUZA 3KR2A 3TDNA 4RAOA 2ZIOA 4G41A 3G88A 1A04A 4ZAFA 2PWAA 2XD4A 5IT9A 1YI8A 3I58A 2UVPA 5BSEA 3PUWA 5FUXA 3T35A 4UTOA 1L4GA 3SGIA 3DZ8A 2VGNA 2FSHA 3WL5A 5IC6A 4KSYA 3VTZA 4TOIA 2JBAB 4UUBA 2Z83A 1Y6GA 3JQDA 3Q3GE 3THYA 1UUFA 3GFSA 3OGCC 4FYHA 2G28A 5GM1A 1CUBA 1OLXB 2RK4A 5JFOA 5T4EA 5IT0A 4MDHA 1N2EA 2G4CA 4PO3X 1ND5A 3JWPA 2AVDA 8ABPA 2FF7A 2GKSA 4FOTA 3ZGYA 4E2YA 5JASA 4H0CA 3WGQA 3MAJA 1RKQA 3MHPA 2QXYA 4C8GA 1ZIPA 4WE3A 3LP6A 1SC5B 1ZRSA 5B55A 5T64A 1SKBA 4ZCPA 4QO7A 3K0TA 1W8IA 1XQVA 5T57A 5ESXA 3CS3A 3K5IA 3GTZA 1B3RA 1ODCA 1KOJA 4O2BA 1M7BA 2HPZA 3CMEF 1GGEA 2XWSA 1ACLA 3FLMA 4MQUA 2Q4DA 3Q7SA 4M76B 2G5PA 4RTNA 3LBIA 3OZ7A 3D3IA 3KJFA 4R4JA 1TT5A 5F2VO 5JVDB 4MWCA 2NWQA 4J4HA 621PA 1IN8A 1DAOA 1JFFA 3O4JA 1BHSA 3N86A 4ZXFA 3VTIC 3CEAA 3OZVA 1OLOA 2YRXA 2QWOB 2R7LA 3ML1A 2ADOA 4OIFA 3G67A 4YROA 4E3ZA 2PCLA 3DMDA 1GGJA 5TT1A 4ZZ0A 4JYPA 3TXYA 5B5SA 1NUQA 2Q0XA 4X64O 3LLUA 1JVBA 4CCYB 1BEEA 3RPEA 5M7EA 4P32A 4DCNA 4PZDA 4MS3B 4O29A 3CCRV 2J6CA 3CA8A 1EUCB 2CE4A 3LW8A 3OLQA 2Q6TA 3L0OA 2PK3A 3G5TA 1SBQA 1MJGA 4V0LA 2GA9A 3E3LA 4L5YA 3ENQA 1OH8A 4B7ZA 4N03A 4YCDA 2YFYA 1H7MA 1T4DA 1V37A 3W6NA 3STXA 2VDMB 3D8SA 1SVOA 2C0PA 5GINC 2AA3A 4UOQA 1P91A 2GTIA 4PYMA 3ICXA 3LMKA 3HKEB 3W7AA 4FFMA 1LQUA 2W11A 4LEIA 4NOLA 5H6RA 2I91A 4PDVA 1M6EX 3ZR4B 5ER6A 1LF0A 3GOQA 3VSAA 3N05A 4YMGA 1VMAA 5L4SA 4YCJA 1ZX1A 1IDSA 3KRTA 1FNSA 1XQWA 1LLDA 1LDMA 1BNCA 1W4ZA 2HQ1A 3IURA 3GJ4A 3EUEA 3E9ZA 1N36B 1DBSA 2FK7A 3J81k 1U2DC 1W47A 4RXMA 1E2GA 4IMPA 1G8SA 5I9BA 3A4TA 3QTLA 3O26A 4EELA 4Z4FA 5DDIP 1WHTB 4XPIB 3GJZA 3QOWA 4RF4A 4AURA 1FB5A 1CUUA 2EWMA 1KFBB 3K4QA 5KKNB 2WWIA 1ZX3A 4ZU1X 3R09A 3K9LA 4IXNA 3OHMA 2GEBA 4CZZA 1R8SA 5MFZA 3L0ZA 1N33O 3ODGA 3GJ6A 1WHSB 3CWBH 4IW3B 5AUOB 4XQ9A 4Z8YA 4QD3A 2EAUA 2I1QA 1DAFA 2NYVA 1SBTA 4O4IB 2WF6A 3SPHA 2IHVA 4Q16A 3QI2A 2A88A 1JMYA 2POCA 2QN2A 1V8BA 3S1LA 5K1ZA 2WWWA 1Z6GA 4KREA 1VIYA 5JAPA 4WIAA 3PG5A 2Z4SA 4XLLA 4IUYA 1VMEA 4F6LA 1R0WA 3CC7V 1ZCFA 1L4HA 1Z0UA 2V6MA 4J1QA 3MMNA 2YHIA 1OFUX 4Q9IA 4OP3A 3QKUA 1KOGA 1Z39A 1P74A 2CTRA 4OPAA 3EPHA 4KWEA 5FWYA 1KZ7B 1PIWA 5KNBA 2XAQA 1HO3A 5BQXA 1D4ZA 4HTFA 3LE8A 3MGKA 3L9WA 4IHJA 2BISA 2ATKC 2NP6A 2XRYA 1HE1C 1HNWO 2HJRA 5GM2A 1E1MA 1KTIA 2I03A 1T8SA 4B2PA 4PFQA 2A9QA 1HEYA 2GUZA 2A7XA 4LDZA 2HT1A 5EIBD 2PX2A 3OWOA 3B8MA 4BBJA 4MP8A 1K8AW 3W5SA 3FVVA 4FT2A 4UCWA 1FA9A 2PZLA 4HUTA 2FXVA 4R0NA 2CLSA 2EILB 3BHJA 3E23A 2ZB8A 1UJ5A 4H7EA 2GBGA 2VJCA 4I0XB 2XGMA 5IHPA 3LLCA 2XMZA 2VSQA 1SZJG 2C57A 2REQB 4OHOA 2Q7EA 3R24A 1HDRA 2AMFA 3GR6A 1QPZA 3H4MA 3RC1A 1SHUX 1Y4ZA 1N6IA 1ODKA 3MHHC 2B8TA 1GL3A 2H6EA 5DYWA 4IHAA 1IVYA 2YWJA 1ZR2A 2NAPA 1G7CA 3DKRA 1HDYA 3DP9A 2ITDC 4J43A 5LMCA 5L9AA 3SZOA 4HVTA 3IKMB 1ZMTA 3QLUA 3IQDB 5D8DA 1EP1B 1G291 3VR3A 3ONEA 5CVUA 3RVZA 4GL4A 3SICE 4DLNA 4QJ4A 3BMQB 1UXKA 1UPUA 1VB3A 3ZU3A 1Q83A 3CNLA 4S0ZA 1E9CA 1I94O 4H7KA 2F00A 3QY9A 3GJ0A 3M4NA 3PK0A 1Y33E 3SQMA 1LVGA 3OOSA 4ENWA 2RGUA 2VCEA 3MIZA 3L6EA 3IB6A 2JGIA 1W88A 4IV5A 2QAGB 4Q19A 4H0FA 3ZVMA 2WIKA 3MAAC 3CRVA 4LHYA 2Z98A 2VDNB 2QPTA 2QI2A 5DNUA 2J3HA 3NHWA 4WXEA 5JUWA 3HVRA 4RPJA 4TWRA 2AOVA 2NMUA 2VPPA 1OVGA 1OCOB 3AFMA 5JG7A 1J22A 3KVNA 1UWCA 4MARA 3ZKWA 4GX1A 4PRYA 2X5NA 1NBAA 1P3Y1 2X1LA 3DH0A 1OXVA 3SYPA 1I3KA 2I3GA 4II2A 2UZIR 3GJRA 2DT5A 4B3TO 1FXWF 4Z0HO 2UZ0A 3HNPA 1QIJA 3VU9A 4OL0A 3OTFA 2A79B 3G2MA 4UXJA 3GD7A 4RHTA 1YJ9V 4MXDA 2OBFA 4G0VA 2XE4A 3M89A 1GG5A 4LI0A 5LP6A 3PT5A 4MPTA 3G5MA 3LCRA 4AQ7A 3UK0A 1QHNA 4PPYA 3W7WA 2FWJA 5EIAA 1UM9A 3LZDA 3V48A 4RY8A 1QPGA 3L7DA 3FRIA 4DL9A 1E58A 1XPJA 5CN0A 4FWTA 4L5JA 5IFLA 3A6EA 1IQ0A 5JYEA 5PNTA 5IABA 3ZE2B 2H8CA 4OX9B 1FXKC 3CPQA 2CVPA 3N7UA 4RUEA 2EZTA 1NJIH 2IDJA 3QENA 3IESA 5G4LA 3SJBC 2I55A 1DV2A 4M21A 3KPWA 2W0SA 3OA0A 1F7UA 1P7VA 3PQDA 1M7GA 3EIFA 3L71H 3V1TC 1Y76B 4MK4A 2YI8A 1I80A 2AXEA 2OFXA 1IEWA 2X8JA 1WSWA 5BW4A 2PXAA 2IZ0A 1GNVA 1NPYA 2O2ZA 1NI4A 3LT1A 3SFZA 3GIDA 2W0FC 2CVFA 3GI1A 2D2VA 1NJ2A 5H81A 4R40B 4UASA 1RQLA 2Z0AA 3RVSA 2J4CA 4CHGA 4RK1A 3I9V1 3H0EA 1K5HA 4FOPA 4DUYB 3A10A 1THZA 1YZGA 3NAMA 1IPAA 3F7TA 4C06A 2P5UA 5BR8O 3KXDA 1MEEA 3BMNA 3H9JA 4ZYWA 1D9XA 2PHNA 3B3AA 3BE8A 4J0IA 1OREA 2A1IA 4K9QA 2WT8A 3DBHA 1CETA 4HXEB 3WGMA 4WLUA 1GU7A 2PGNA 5AP9A 3L75H 1BDJA 3SHTA 4UEOA 1XVTA 5AD1A 4ZGBA 2EL9A 2WMNB 1JAZA 2G6TA 1TA4A 4RM2A 4B3CA 1HSOA 3CX8A 1G3MA 3I6QA 4NENA 4FEEA 2P6RA 5B5EZ 3WADA 1ICEA 4KIWA 1QTIA 3VUEA 3HM9A 3V6MA 1B4DA 1LXCA 2A7QA 4AO8A 5DWQA 3GLTA 1DMSA 2ZLBA 1LPPA 2C3MA 4UZFA 2PT9A 3P5BA 2FLVA 1M8JA 2IZ5A 5FLXN 1LUAA 4OCZA 3IEQA 4LWSA 1E4EA 2J9FA 4NR1A 3NP9A 3FKJA 2YV1A 4COKA 4FFBA 1S8FA 4OHPA 2H1OA 1WCYA 1MT0A 3R9XA 1U94A 1ZEMA 4TTPA 3EFOB 3UJ7A 2ACKA 3WOHA 1GAJA 1N4CA 5DBGA 4MW7A 4BNKA 4I1IA 2N0SA 1FMFA 1A4RA 1ZNWA 1A4IA 2MINB 3RODA 2BRUC 1G5HA 4BMXA 4RHXA 4CTNA 4G8JA 1MMFB 2EX4A 1YZ3A 2WD7A 1KEWA 1U7UA 3U0ZA 3VZDA 4EJ2A 3OIYA 4GBGA 5AM1A 1VBNA 3R5HA 1XRMA 4FFRA 5DEDA 1FFBA 3E9MA 2H63A 3HJRA 4Q4JA 1Q0ZA 1K68A 1K8ZB 1ADYA 3PYMA 3THWB 2FN3A 1B1CA 2A92A 2KBEA 3PIRA 4Q66C 2W6ID 3RO7A 1T6XA 3WK5A 4H3VA 5ALOA 1IURA 4FFSA 1JLLA 1I33A 1TM7E 2NZWA 1SJ9A 1MO5A 1A8HA 1FK8A 1R37A 2ZS7A 3EXFB 2N48A 4BN5A 1COWA 4ZEMA 1IB0A 4OSEA 3A0RB 3JQ8A 2IM9A 5AVJA 4YPFA 3CKKA 3PGMA 4IDFA 5A5EA 4F3TA 3N0WA 1XQYA 4YDQA 2V6BA 1RC0A 2FOLA 4QWMA 2GTHA 1ODTC 3H87A 2VXYA 1CZKA 4M4SA 3CZQA 1WKCA 1BHJA 5CITA 5KHAA 1USVA 2PUJA 3N6XA 2IBMA 4JTAB 4R3NA 3UZUA 4F3RA 5E3JA 3VPAA 2YN4A 4R8RA 5AI6A 3H1GA 2FWAA 1Y5RA 2JGKA 3Q1KA 4E5PA 3E15A 3OOYA 3BF8A 4RD3A 2QAIA 4LFBO 1E7WA 2ZITA 3TRIA 1YMUA 3ZS8C 4ZHWA 3FWZA 4NCNA 2VT6A 2Y93A 1OFHA 2FSSA 3G6BA 3ZNNA 2WE7A 4LBZA 1DEKA 2ZWIA 3O8RA 3PPXA 3TQCA 4HB4A 5DBHX 1MC8A 3RLFA 4CVNA 4EIWA 4H77A 4AULA 5TPWA 1UJNA 4MVZA 4LDPA 2EZUA 5EJFA 1YJQA 4PC6A 1MZVA 1YU9A 3C5WP 5IJAA 2AT1A 3AC0A 2YMLA 3FNRA 3JYLA 3RS5A 2ZBPA 1IONA 1JQLB 5BMOA 4O4LB 2CNWD 2FPUA 1NVAA 5DNYB 4EX6A 1VSQA 2P0YA 5JBNA 4Q12A 2O1WA 3EW9A 2XGOA 4AP5A 4HDCA 4O4JB 1WMEA 3VJKA 1L4YA 3WGLA 2W8BB 4FNAA 3HO6A 3B6JA 3MF4A 2ZJBA 3S1SA 3SJQC 2NXCA 2JHPA 5TF0A 2X42A 3UJCA 3GMTA 3WBBA 2IH1C 5FHQA 1VIVA 4AO7A 1XD2B 2ZUWA 1XF1A 3OZWA 2X8AA 3W4KA 4LOIA 4UPEA 2WF5A 2D6FA 5CT4A 2VHJA 3KTAB 3JD2A 1NSFA 3UMCA 4DV4B 1AUXA 2GH1A 5KTYA 1QR8A 2R6JA 4YUWA 2PBFA 4BAYA 2OCHA 1KNJA 3T7SA 1PZNA 1BHQ1 2GM9A 1XMSA 2AN1A 3FVRA 2V1XA 2M6LA 3GYBA 1I4WA 2J9XB 1Y8AA 5HKKD 2NVOA 5IPFA 1L4BA 1UF9A 4QU5A 4JYAB 4U7DA 1OI3A 3OQMA 3TE6A 2IC5A 2F43G 3P32A 2OORC 3OW2F 4MYSA 2NO0A 3IA2A 3BWXA 3G1TA 5DTIA 1GG8A 1PDVA 2BGLA 2W4IA 3COYA 4M83A 5TVGA 3GJYA 2O2JA 2HP0B 4NBVA 2QX6A 2CB0A 2P6MA 3JAKB 3IXQA 1IVNA 4OXKA 1RABA 1LRKA 1C1DB 1DAMA 1JUDA 5E1BA 4KR2A 2I6TA 3CCBA 3DDHA 5IUNC 1HYGA 3S3TA 2O3JA 2FUCA 2NPFA 3IO3A 2DQ4A 4O2AA 3USES 1X1TA 1IL0A 4OOFA 1ZGZA 1KTVA 3CTMA 1WMDA 3AY7A 3EGOA 1A5AB 4BV9A 1Y1QA 5FH9A 2RARA 1CTQA 4QYTA 4G5RA 3H9CA 4GH5A 1BRMA 4MV6A 1V9SA 4A8TA 3KL2A 4IL6Z 4ZCRA 3U56A 3O2SB 1KEEB 1VGQA 2ANCA 2C2HA 4G5QA 4RPLA 3HHPA 5D01A 5EWMA 1X1AA 2WM8A 4L8LA 1EAMA 1XNGA 3R3SA 4CLXA 2SICE 1QV7A 1V4NA 3DB2A 2Z5FA 3ZTWA 5KCMA 5FTNA 3FMIA 2H1HA 3FD5A 2AG6A 2H2DA 4PO1A 4DGQA 1U1IA 4L2IB 3QHDA 1BE1A 1GEEA 3E8GA 2I0FA 2YQZA 3H8JA 2QMUA 4CXMA 3BXZA 1QE3A 3E2PA 3ASOB 4N47A 4M1EA 4BNXA 3OR6C 5I4KA 3UFXA 3E1KA 1REQB 3UHJA 2IU6A 3KJXA 3RWRD 2WVAA 2V97A 2ZBFA 2G80A 2N3ZA 1FSPA 1ESCA 1QR9A 2ATEA 3MBMA 3AFOA 1D5WA 1C8KA 1R8JA 4NBSA 4E31A 4PDMA 5FLXA 5BVHA 2X9NA 3L6BA 4MW5A 1HKUA 5KYVA 3JCMM 1TK9A 2OCPA 2WFMA 2ZXFA 4Z7NB 1EWKA 3QVGA 2H52A 4MB6A 3IV7A 2H5EA 5FPHA 4HNSA 5EOVA 4I1SA 3M1IA 1N2XA 1PVDA 4UVGA 3IPAA 1UZNA 2ZWOA 2Q8VA 3D6MA 2C84A 1LFDB 3FD9A 5H70A 2O2IA 4ZVQA 3AJAA 3X1DA 2ECQA 5EXXA 2CJPA 1KC8H 1KQGA 3DNFA 2BEVA 1X7PA 3MWFA 4L57A 5J4KA 2YDXA 3B53X 4D25A 4ADSG 4D43A 3UHPA 2O7VA 5LMUO 4KIUA 1EVIA 2VBGA 2ZRHA 2NPOA 1Q86H 3C9UA 4BAGA 4MUFA 1Q7YH 4HX2A 4P9OA 3OO0A 2VPZA