4WBNB

Crystal structure of tubulin-stathmin-ttl complex solved by native-sad phasing
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 178
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4wbnB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4wbnB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4wbnB01
3UT5A 3E22B 3RYFB 4LNUB 5JVDA 5GONB 4O4HB 1TVKA 5LA6A 1W5FA 3VO9A 4TV9A 4O2AB 3WGMA 4I50A 3HKCB 5EIBD 5LA6B 4X1YA 5JCOC 3UT5B 3JAKA 1OFUA 2VXYA 3CB2A 5JVDB 4O4IA 1TVKB 3JARA 5EZYA 5C8YA 4B45A 4DXDA 4TV9B 4HNAA 5MN6A 3RYCA 4I50B 5JCOA 4YJ2A 5J2UA 1SA0A 2VAWA 3JATA 4X1YB 3JAKB 2XKAA 4YJ3A 4O4IB 5EZYB 3JARB 5C8YB 1RQ7A 4EI8A 4WBNA 4B46A 4TUYA 4HNAB 3RYCB 3HKEA 4O4JA 2BTQA 4YJ2B 5J2UB 3C8LA 1SA0B 3JAWA 3JATB 2GVIA 2RHOA 4I55A 1TUBA 4IIJA 1Z5WA 4YJ3B 3M8KA 1FFXA 2R6R1 4WBNB 2VAPA 4TUYB 5EYPA 3HKEB 4O4JB 2BTQB 3JAWB 5CB4A 4IIJB 3VOAA 1FFXB 3VPAA 4X1IA 3RYHA 5EYPB 1RLUA 5CB4B 3HKBA 1W581 4M8IA 2XKBA 5ITZA 5MN4A 1W59A 1RQ2A 3V3TA 4X1IB 5IJ9A 3RYHB 3JALA 5KX5A 5LXTA 1Z5VA 4DRXB 2RHJA 4IHJA 4KWEA 3N2GA 3HKDA 3HKBB 3WGKA 1W5BA 4ZHQA 4EI7A 4X1KA 4ZOLA 5IJ9B 5LXTB 3JALB 5CA0A 5KX5B 3WGJA 2RHLA 1W5AA 3JASA 4IHJB 3RYIA 3HKDB 4I55B 1TUBB 5LP6A 4ZHQB 2VAMA 5LYJA 1W5EA 3RB8A 2RHHA 4EB6A 3ZIDA 4X1KB 4ZOLB 5CA0B 5JQGA 3VOBA 5J2TA 3JASB 4X20A 3ZBPA 5KMGA 5FNVA 3N2KA 2Q1XA 5LP6B 2R751 4ZI7A 5LYJB 5IJ0A 4EB6B 5IYZA 4U3JA 3WGLA 5JQGB 4I4TA 5J2TB 4X20B 5KMGB 3VO8A 4F6RA 3ZBQA 5FNVB 3R4VA 3N2KB 5ITZB 5JH7A 4ZI7B 5IJ0B 4E6EA 5LP6C 4O4LA 4U3JB 5IYZB 4XCQA 4FFBA 4O2BA 4I4TB 5BMVA 2BTOA 3M89A 5MN5A 3N2GB 5M7EA 4F6RB 5CA1A 5JH7B 4EI9A 4TV8A 5LOVA 1JFFA 4DRXA 4O4LB 4FFBB 4O2BB 4U39A 3E22A 3RYFA 4LNUA 5BMVB 5GONA 4O4HA 3RYIB 5EIBC 2Q1YA 3WGNA 5CA1B 4O2AA 1FSZA 4TV8B 3HKCA 5LOVB 1JFFB
chains in the Genus database with same CATH superfamily
3EGWA 4N5HX 4GI3A 3CS3A 5BVGB 1XQ8A 3T1HB 2GBCA 4PC7A 1A32A 1FIUA 2EJBA 4DW8A 3R24A 2DKFA 2OCBA 1NVBA 3K5OA 4TQGA 4JT8A 1L8QA 3QF7A 1TM4E 2IPNA 2WDPA 4FFNA 3R74A 2KQXA 3O7WA 4TTSA 4IWXA 4W6QA 3HR4A 3PHIA 4EGJA 4Q12A 1RJDA 4FT2A 4X6UA 4DDTA 1KE2A 4GKKO 3OLCX 1JEAA 4US0R 1M8GA 1F8UA 2FV8A 4X1KA 2OZVA 4Y98A 4AS2A 3DV2A 3ND9A 5JH7F 3IPAA 3AR5A 1L5ZA 3HNOA 1IPHA 3WJ2A 3IPLA 4O8ZA 4H4CA 4C2TA 4U8HA 1Q7EA 4F2DA 1TFRA 1D8AA 3S44A 2OGZA 3ZEDA 2WNSA 2OQVA 4U00A 3QY0A 4S1OA 2FZWA 1TCVA 1V4NA 5AI5A 1W76A 2FR1A 4E5DA 1XQYA 2W0FC 2I2CA 2PZSA 3H5RA 4C43A 3FCCA 2QRMA 4LBZA 3N4YA 2QM4A 3JQ7B 1IQRA 4B40A 4AN0A 2I4LA 1SXIA 4UQOA 1NW3A 1QC5B 2XQVA 1EEHA 3CZMA 3GJ6A 1JNXX 1IMJA 3WL3A 3W5AA 2Q8VA 4W1RA 1MQSA 3CR7A 2QA5A 3AUFA 1P1CA 2GLXA 4ZTBA 2GZ1A 3OF2A 3HU5A 2V58A 1IY2A 2OAP1 4KUMA 2I4NA 3AF4A 3RGGA 3Q4HB 4O5OA 1QP7A 2B5OA 4JQOA 2ZUFA 1DAMA 1UR5A 4MQ6A 2EULA 1GO2A 1FMCA 2Q2QA 3ZHZA 1XPJA 5ELXA 4ZQFA 1ISFA 2X0EA 3HXMA 4YASA 3P30A 1MABA 1JQEA 1QIHA 3T7SA 3D3WB 3V32A 2WB2A 1JIJA 3MAJA 1Y66A 1R3DA 1B6QA 3RABA 1Y1SA 3H4IA 4Q34A 4M7PA 3THYB 3OAAG 4DUYO 1G21A 4KOAA 2CNKA 2W6JA 3ZUGA 3JYQA 2HJSA 3WNDA 2R96A 3PJFA 2Y92A 5C80A 1A82A 4M9SA 2P2GA 5FH9A 3DYVA 4X97A 4PFQA 3GZNA 3BEDA 2FXIA 2XCUA 4I8IA 2Z1FA 4OKIA 2DPYA 2X2OA 1ZA2A 1GHTA 1X15A 1EI9A 1YI8A 1VZ2A 3R20A 3PC6A 3WA7A 3LNMB 2PM8A 3UGJA 3DDNA 3KJIA 3ZVNA 1NXXA 1QK4A 4CGYA 3IDOA 1EGMB 4QBIA 4YP0A 1O6GA 3SIVA 4B7ZA 1DG3A 1KFKB 3HLTA 5AVWA 3DUFB 1M0EA 5B1OA 4J0KA 4WLNA 1SQGA 3B6MA 2Y1WA 5C3MA 1Q8RA 4IZOA 2D1SA 3RYFB 5J1TB 2HJ9A 1YFKA 1TD1A 4CKBA 2MHCA 3TR5A 1XDBA 3DBHA 3RYCA 2CV1A 3HO1A 4WFHA 4KWHA 3E03A 3UB4A 5IT9M 1D2MA 1W36C 1G3UA 3BA9A 2Y66A 3C3KA 5JCJA 2YYYA 1FNMA 2HHAA 5I51A 3O92A 2HXYA 3CRRA 3GARA 4J91A 2QN3A 1YIJV 3CCMF 1QTNA 2WEKA 4AJ4A 3M9WA 1D4ZA 1QP8A 1K0FA 2HRBA 1UQRA 2PKWA 4S1NA 1UK7A 5D87A 1LY1A 4AS3A 2PSDA 4N54A 4K35A 5BR4A 1KSJA 3KYCA 4BNFA 2WTUA 3SOPA 5HNKA 3FHOA 3HC7A 2HT6A 3I01A 3FY4A 2V1UA 3H19A 3N0RA 1UMKA 1FSGA 4JL8A 3KUXA 4TTRA 1PWXA 2AL7A 4J75A 1LJ8A 4TYNA 1JDBB 4KN9S 4X92A 1IJFA 4MA0A 5AM4A 1DIBA 1U02A 2PZGA 3BF8A 4ZI2A 1PTKA 1S2MA 4V0ME 4ZEOA 4NH4A 3CUEF 1Z5NA 5B7QA 4EYQA 5EKXA 2CHVA 1EBFA 1FUIA 2V0CA 4CV0A 1E60A 4R68A 3F6YA 2ASEA 1DF5A 5H9CA 3A11A 4IDDA 3PCTA 4TT3A 1TGOA 2VP0A 3C8ZA 3IAAA 4LDJA 3EWSA 4Q7QA 1N2BA 1AIPA 1TT5B 1JDSA 2IXGA 4PRZA 1ZIDA 1WB9A 2YUIA 1L5MA 3MCAA 5CYPA 4AJ1A 1JWLA 4WXRA 2O2SA 2G63A 3AB8A 5EXDA 3REFA 1PQ4A 5DM60 2JHGA 5BW5A 5FWXB 5ADUS 4CZ2A 4EABA 5GPBA 3Q12A 4LWSB 2A06H 4YRQA 5H9WA 4EDFA 1G8YA 1R2QA 1WLEA 2RIPA 1YDFA 3GRYA 2QN2A 2C4WA 2REXB 4PZCA 4OQMA 3EIEA 4DTIA 2W90A 2XHEA 2DFTA 2I3DA 3LRPA 5P21A 4I46A 3IA7A 4MSUA 4RM3A 2ANBA 4M1SA 1SUAA 2FN8A 4W4TA 1FEZA 3B9RA 4BMZA 5A4MS 4FDLA 5KOHB 3ZHXA 5A4AA 2TMYA 3K6SB 4DVGA 4DM7A 3HCFA 1G8GA 3KRTA 2GT1A 3AKYA 5CVEA 3T3DA 3FB4A 2R6FA 4G8BA 2JAPA 2HIGA 4TRNA 5K7SA 4HRXA 4TSKA 2CNDA 4PHCA 1M73E 5LGTA 4M22A 4FZ5A 2VNHA 2NTJA 4DR1B 4IL5A 5MHTA 5FQOA 3APOA 4XGNA 1I0IA 3AM5A 1IXYA 3H17A 5IAOA 2WAYA 3HV2A 5IVHA 2OD9A 3K03A 3OZVA 2VBCA 4DPLA 1EUCB 1U6JA 5H81A 1C80A 2QVBA 5FUQA 2JS3A 4J80A 4KXMA 3AJAA 5IWAO 4JBWA 4XYGA 3LWPC 4FIZA 4BYMA 5FPRA 4GZ5A 5IDYA 4PRLA 2GETA 2YY7A 2NQ2C 1YA4A 4NRDA 3MXOA 1BT8A 4ZZ0A 4YPFA 1NZDA 2Q4BA 4RETA 2I2BA 1SEVA 4B3SB 1BA3A 2ISSD 4M8IA 1VKJA 1IHUA 3OQJA 5DHFA 5DWVA 3RYHB 2W8BC 2PX8A 2JIRA 1P80A 5JXJA 2CF6A 1U8XX 1MHPA 1TCBA 3SSNA 1FS6A 2FPUA 2H8KA 5GJBA 1DC4A 5IJAA 3D4LA 1Z0SA 4KZKA 2R6AA 4KYVA 2OHFA 2G40A 4EDHA 1JHAA 3LNTA 2OYSA 1XZQA 2H1CA 1UZAA 5EG5A 3H1FA 1NW5A 3V4VB 2YUAA 3UK6A 5DKFA 3G5LA 3ZEAA 1VPWA 1W6UA 3QYJA 4FWBA 2WKPA 2Z5LA 1P4RA 2GAAA 4JF3A 3OZGA 1XNRO 5AI8A 2ZGVA 3F5DA 1BS1A 2BHSA 3RK0A 4YP6A 3T80A 5DTEA 1KQGA 2A9PA 2O5VA 3C3JA 3P2KA 5KNBD 4E46A 2Y0PA 3KYIB 4FHFA 2H92A 1A9OA 4QIHA 1T4MA 4LISA 1JEQA 3TOSA 4DA0A 5A9TA 2V5VA 1JILA 4HLUC 4PNZA 2WWFA 3LLVA 5HKKA 2VNKA 2B7BA 1OX4B 2ZRBA 4YV7A 5I4BA 3ZD7A 1NUPA 1E0DA 3LA6A 1UXJA 5EJIA 4AJLA 3DG9A 4ZV4A 3DDCA 3FZYA 2CAZC 4XX0A 3RD5A 1DC5A 2DJ5A 2AIRA 3HYLA 4Z1OA 3HUFA 2YXYA 1MR3F 1MEJA 2X6RA 3F2VA 4Q5IA 1A2BA 3DV0B 4EYOA 3R6GA 2VJKA 4KBGA 3DNFA 3QWBA 2GB4A 5DM0A 4DIFA 4EGSA 1K98A 1MOSA 2LDBA 2IYTA 2CH7B 1H8HA 1W36B 4B45A 4J7AA 4UMDA 1T0HB 2W6JG 2BTEA 2PRSA 3UTCA 5FLEX 3BCCH 5KU7A 4DJTA 1XZFA 2YFKA 3QITA 1N6KA 3KZCA 1WB5A 2R44A 4B2LA 1ZM3A 1DC6A 5CDFE 3GEHA 2VJDA 1SUIA 1APBA 4QOFA 2PH5A 2ZKLA 2IYNA 2E4AA 4L9RA 1DADA 3QO8A 4S24A 1JECA 1A9TA 2P4EA 4E2XA 4QLBA 3RV4A 2BH2A 3GPBA 3BFXA 2H8PC 5KO2A 4QRDA 4OAPA 4LQ4A 3V48A 1QD9A 3QGMA 3NOVA 4AZ0A 5F51A 4XWOA 3EZNA 4KQGA 2W6CX 4EL5A 4ARBA 2QVXX 1PTJC 1R10A 5K6AA 4A27A 4QG3A 4B8YA 3AU9A 2NO6A 1L7DA 3CKLA 4Y2RA 1E4YA 5GQSA 4W5QA 1CUWA 1A04A 1WV1A 4WGGA 3BRWD 3W3AH 2FWRA 5KSZA 1XO1A 3PFKA 3HVUA 4PAGA 2VSYA 4I8XA 2D6FA 1X3LA 3HHPA 2Q29A 3QIVA 1F0PA 4H4DA 1B15A 3NFRA 3LOPA 1IOVA 2WKRA 2WYHA 1W47A 3OCCA 1VG0B 3EXHA 4MW0A 4ZQCB 1OIVA 3IEIA 3ZW9A 3KQNA 1GPMA 5B2ZA 3CZRA 3MEQA 1UT8A 1KI6A 3ST7A 4OXKA 1YQQA 5K8JB 5CX4A 1Y4SA 1MNAA 4QGSA 2RHLA 1Z33A 4R1TA 1IBMB 3A58B 1K3UB 2WHXA 4Y2YA 3IQXA 1FRFS 4KWCA 2HRQA 4UVHA 3ACBA 4D3SA 3W2IA 4B3GA 2FUEA 5AVXA 4WXYB 1UT6A 1CX9B 4HQKA 1JB9A 4FNMA 3DE2X 1SUCA 5B1HA 3OPNA 4BX9A 3P3NA 2E82A 3HGTA 3VH4A 4IIEA 1YCFA 3T34A 2XUIA 3K0SA 2JGKA 3PDHA 3DEIA 4XB1A 2BFDA 1I14A 2HD4A 2PY5A 4BMOB 1N1MA 2E1PA 4UE6A 2RCVA 5EZYB 4NOJA 4ENSA 4PYRA 2PZBA 1VOTA 2INGX 3B1YA 3VX4A 2NZJA 1QQAA 1TCCA 4GSYA 1CPYA 2CJPA 2Z9DA 2J6HA 3DT8A 2P0AA 4Q03A 4DK0A 1YFJA 5J63A 1P3Y1 4DQLA 4Z9BA 1W5SA 2HFJA 3PNBA 4CIWA 4OQEA 4H33A 5J4KA 1Q1EA 4NTYA 3ERNA 3NIBA 3FAZA 1XMIA 1AY0A 2O7RA 4GCZA 4GNKA 4RCVA 3URMA 2GZ3A 1DZIA 2GI4A 4J7KA 4MTCA 1RXSA 2OCGA 3AY7A 2WHYA 2O3JA 1O9BA 4IQ0A 2JLAA 4UDNA 3SJCA 1Z4KA 1S01A 4MRSA 3UKMA 5EI5A 1SCNE 3M6LA 5DBOA 1FNDA 3K8OE 4XYEA 4IIGA 2QZZA 4DLVA 1ZWLA 2H1OA 2AJLI 4YCSA 3IXLA 4YR7A 1DOZA 3UHOA 5EIHA 4TKLA 2X5NA 1WJZA 1H0HA 2ZUUA 2OCKA 4BRUA 5KJCA 1TTPB 4XZ3A 3ZU4A 4EHKA 3FJ1A 3QFSA 3MMSA 2G6TA 1GLNA 3GQBB 5CB4B 3IUPA 4RAQA 2WMNB 4FEAA 4FM0A 3S06A 5K2OA 2VCEA 3GH1A 4G28B 1VQMF 2Z3WA 4BO4A 3UB3A 3C7TA 3O74A 5BT9A 4WKBA 1JG6A 4F04A 4GR9A 3QHAA 3GPIA 5KYVA 3P52A 4YH1A 1Q90D 3D5QA 3L6CA 3OFKA 3CO5A 4UMVA 1ZW6A 2O8DA 4M53A 3DUWA 2JGNA 5CA1B 4C76A 2H59A 3ZNOA 3E4CA 5BR7A 5BN1A 4KR2A 3IV9A 5ADHA 1JHZA 2UZ3A 2OHXA 3K73O 3R6TA 3QPUA 3M8AA 5TARA 4KREA 1BCRB 2I1WA 4DR4B 3EOAI 4Y1RB 2Q7HA 3VR1A 2EIMC 4CV1A 4RTKA 1XDCA 1UBLS 1EUQA 2JK1A 2C04A 1N2IA 3ZJYA 3WYAA 5I7UA 1UJ4A 1LK0A 2M32A 4EMSA 3ZTWA 1AK2A 1RJFA 3GMSA 1N34O 1E18A 1X7GA 1RI2A 2JAWA 4KI0A 8ADHA 4I4NA 2XV1A 1E64A 2IY9A 3A3KA 4X3PA 1EKXA 4MYRA 1H2BA 3TAHA 1K6IA 2BI7A 4K6GA 4A23A 2WZCA 2UYKA 1L5WA 1FPMA 2Y9MB 4HDSA 3ZXXA 1IXRC 1F4LA 2QN9A 4DLBA 3F1KA 2GVNA 2CJYA 2HV8A 3SS8A 5JNRA 4YB8A 4RPJA 4BBJA 3U4IA 4FSDA 3DE0X 4TN1A 3PI7A 4KDRA 2ILMA 1YZHA 2H1RA 2CCKA 4QUGA 4J7ZA 2YS6A 2OZKA 2X4LA 2ILTA 2VUIB 2WD7B 3BXZA 5DECA 3DEKA 3CYFA 1U1FA 2YJ3A 2BI4A 2AXNA 4DN6A 2BW0A 4EPVA 4IVRA 1YNSA 1W55A 5DPMA 4BKPA 2ZDQA 4MKGA 4LY3A 2JFZA 3SR4A 4RCYA 1E7KA 2J0EA 1QXSA 5IYDO 3K94A 1LWNA 3TBKA 5FNVF 3C70A 1G38A 2PUBA 4AG3A 1ULAA 2V7VA 4PGFA 4TRRA 4BGUA 2QRJA 1QGED 1WCIA 3SKYA 1AZLA 2ZS9A 3I5UA 4DANA 4R9SA 1U94A 2Z1MA 3QRWA 3DYIA 3PXUA 2VHQA 5F52A 3GFTA 3L1HA 2WTAA 3AOGA 1CQIB 3R7AA 5JAIA 3K0EA 3DEAA 5JO9A 4YRNA 1T5EA 3LZ6A 4KLRA 3AZPA 5B7PA 1Q6HA 3BFKA 2E18A 4MRVA 1LLFA 4BMSA 1P1HA 4LJAA 2FW8A 1QS0A 2HKIA 5AD1A 2XZPA 3HCBA 4AUEA 1BZKA 2XMBA 1X4TA 3PC8A 4IH4A 4I9WA 2XUPA 2XLCA 1G5PA 2N74A 1JEDA 3WRYC 4P32A 4UTXA 4GF5A 2OHVA 3F5SA 3TBHA 4OIMA 3BCHA 1BO6A 1PG2A 1BGVA 3ZCVA 4LV8B 1TUGA 2IODA 2QLJA 3ZRVA 4QTZA 2RC6A 3QLVA 3ZGLA 3AETA 3EH1A 5L4LA 2FK7A 3U7HB 1XEWX 4U9HS 4UJ5A 4MW2A 3VYSC 1XXHA 1F17A 1OC4A 4ISCA 4D0SA 4BEBA 1B06A 4KR3A 1WJGA 3WFVA 5U4XA 5AUPB 4IDGA 1GL6A 5CU7A 4C4RA 4FDAA 4TXJA 3GH3A 3P2EA 1SC9A 3MAGA 4HS9A 1MNQA 3SBDA 4X24A 1CJTC 2MK3A 5I01A 3H3JA 1VF5B 3LDUA 2W4IA 5EJ8A 3QE9Y 3K6KA 1CJSA 3ITNA 3N74A 4J4BA 4N0MA 3LDGA 5I9IA 4AMVA 5DHQA 4CL0A 1YUBA 2PS0A 2QP9X 4U9IS 4EA7A 2UYNA 1DP4A 1K8AW 3RRMA 3DNMA 4FHGA 3D3QA 4II7A 1OH6A 2F3SA 3A9TA 3UOGA 1L4FA 5JSUA 4FFKA 1OLUB 5JANA 1Y6JA 3B77A 4II2A 4KLNA 3HPQA 4NBWA 1ANKA 5T5QA 4DSAA 3OIGA 2AQ8A 3BMNB 1E3IA 3R7WB 2YIBA 4GU5A 1J0AA 3VGPA 3NYRA 4B81A 3GLFB 4JYBA 4PX5A 4KXUA 3JTEA 1F38A 4LJKA 3P0FA 1VSBA 1XCBA 2PI5A 1N2JA 4MP6A 4GO1A 1AG9A 1FLAA 3ZWNA 4D9MA 2O3TA 4RD6A 2OGSA 4MVOA 4E5SA 2QL9A 4XKJA 1IZYA 3TW0A 3HXKA 3LYAA 2KGWA 2HQ1A 3U0VA 5FT9A 1FLDA 4ND1A 2J0QA 4K9DA 4TT8A 2C5SA 1KQOA 3L7OA 4PI0A 4DV2B 4JSYA 5FNVA 4WZAB 3G0OA 1K8XB 2PUFA 1B8PA 1IV1A 3FD6A 3ROZA 3P94A 1Q81H 4OVKA 2GHTA 4B6JA 1KVRA 3PWKA 1U5BB 2VTBB 2COEA 1AV7A 3L7BA 2DW4A 3CYPB 4I6EA 1GZ3A 1XKTA 1D07A 4BNKA 1H2NA 3R8XA 2F64A 2EZ4A 2XHZA 2FPIB 5ALEA 1UJBA 3UOAB 5FAXA 2WV9A 1JQBA 1TF5A 2WLHA 2EIMB 3NBKA 1ZM4A 1YS9A 3OOHA 1W36D 4MTGA 1GNVA 1V8ZA 3ONVA 3JQ6A 2JCXA 3UJ7A 4D43A 3KWMA 3O91A 2PWAA 2ZCVA 2ATCA 1FTYA 1Z56C 4Q3OA 2XOEA 1ZSYA 3OZRA 2XXBA 1DAPA 1SK9A 5AM3A 4RX1A 3G6EV 4C1BA 2HMVA 1Q20A 4H37A 4Y2QA 1QO0A 3ZS8C 4PICA 4J2OA 2R7NA 2GEKA 1TTTA 3CO0S 4Q9HA 3V80A 2WWWA 1U3FA 1GV1A 4W1PA 3NH9A 4RY8A 1WCYA 4MX8A 3KUKA 3O1IC 2HO5A 1S2GA 3ZLVA 3MT8A 4L5BA 2DYSB 2Z0AA 1UQTA 4BU0A 4PDLA 3OCVA 3GWZA 4LV6A 1CJBA 2HMTA 4W63A 1GNQA 1XVUA 3GK3A 2BFFB 3SQWA 4FK8A 3PX3A 1MO4A 1V9CA 5LHHA 1B6RA 5AESA 4X64B 3RADC 3OT1B 4JBLA 5JWHA 1M10A 1ZJ5A 3IKJA 3EEQA 4JAUA 3K1JA 3VO2A 5HUJA 7ADHA 1SS3A 3TE7A 2CHEA 1XZDA 2H2WA 1X1EA 3NFYA 1T2FA 1AHPA 4Y30A 2BBSA 5LNK6 2CDNA 1BE1A 1U3DA 5ALUA 1IVSA 2XX3A 2AQKA 1E1YA 1R6UA 1HE5A 3TDMA 3QEOA 1AGXA 4BV9A 1T8PA 1VQNV 3Q6NA 3TL6A 2HFKA 1BE8A 1USWA 1RWNA 4G27B 1OSNA 3DLPX 5HUQA 1QMGA 4JASB 3ZMSA 4P2BA 1V8DA 4CT0A 4B71A 2A35A 3M5WA 2C7PA 3VTIC 3ZLJA 5G4LA 5AICA 3WLKX 3OLXA 2Z30A 1DLIA 3P3PA 1GQYA 2PRKA 3WXMA 4X44A 2XMDA 2ZYHA 3LUKA 2CUZA 2EBHX 1A9XA 1T9GR 5TRTA 1DX4A 1FXWF 1JDNA 4LFBO 1U9CA 2XHBA 2HVYD 2R9IA 1FDIA 4IIHA 1N7GA 2H7CA 3GGPA 1GR1A 2OQ2A 1YRQA 3UK2A 4UCVA 3DMYA 2Z8YM 3MT0A 5DGIA 3OTFA 4C21A 5A3RA 1OFTA 3BN3A 4RA6B 4TQDA 4O59O 3ER9A 3C1OA 4G8JA 2NSJA 1G7RA 2XUKA 2WA3A 3AEIA 2P3QA 1HY3A 2Q6LA 3U62A 2AR7A 8AT1A 1IQ0A 2OO7A 3JVDA 3AGQA 3TK1A 4ADSG 1UWLA 1B23P 4BCBA 4ZCRA 2F55A 3G0BA 2Z95A 3ZGYA 5B4VA 5C8YF 5A7HA 2A33A 1SG9A 4QDUA 4HQLA 3VYSB 2JFGA 3TEMA 3O31A 1IY9A 3EB9A 3PEFA 3BWDD 4ZV7A 4LVNA 1CUXA 1WW8A 3KYDA 4D9JA 1Y7IA 2GEJA 4LX8A 1Q3TA 3ZV6A 1P72A 4Q0MA 2XZOA 2UUAO 2NT3A 4TZTA 3OCJA 4M49A 1PIWA 2C7GA 1WB6A 3JAWB 5DI9A 3RVRA 4EH1A 2PANA 4DABA 4F2HA 4IZHA 1PR1A 2GXQA 3JQCA 5BSTA 4DW1A 3NGMA 4Z99A 3K0KA 2HWXA 3VTZA 1GG9A 4CEIA 1YVPA 1VQPV 3FMOB 4HH1A 1E1RA 3NR2A 4XLZA 3FPBA 2GK4A 4GR5A 2PXCA 4KR9A 2AGAA 3SHFA 1J1ZA 4BRSA 3NU1A 4EOGA 2ZIGA 2AMYA 4J1NA 5HX7A 1GU7A 2ORVA 5JCPA 3RWMB 3GHHA 2PR7A 2FF7A 1UT5A 2JRLA 4D9HA 2LQTA 2CBZA 1QE5A 1DXOA 2I6GA 3WMXA 3T7CA 2GGSA 3IOCA 1RXEA 3QY9A 4QECA 2C5FA 4ZPXA 3BBPA 3DZ8A 3L7QA 1NS1A 1KVQA 1O87A 2O05A 2X77A 3J7AU 4WERA 4IF6A 1C0LA 4LE2A 4CMHA 4JVSB 4OH7A 2WJWA 4LYFA 3H84A 4FE3A 3F3KA 1FMFA 4ND8B 4RXTA 1A9RA 2QLBA 4LF8B 1N36O 4N3GA 2VJMB 3E89A 2FSUA 3F4BA 5FWYB 2GPWA 2ZWMA 3P71T 3WYEA 1C8LA 1S72V 3TXQA 1XRJA 4KIUA 3HFJA 1G6Q1 1D0VA 2ZATA 3LW7A 1P44A 5A7GA 1ISIA 1W4AA 7REQB 1WD5A 2G82A 4KPGA 2I67A 4XQGA 2H0RA 3N8KA 3EZFA 2WA1A 4OQNA 3CZPA 4K05A 1KYTA 1QRTA 3AHHA 3LH5A 1FXWA 1LUVA 3DVRX 2XKAA 1VIMA 4HR7A 2ZAOA 4E3ZA 4KFUA 1BMFD 3ZQ4A 3L8ZA 5CBGA 1CY2A 4KW7A 1Y8AA 3RC9A 2Q0XA 1UADA 3UJAA 3EVNA 4XDJA 1P3JA 2JASA 5E6UA 4V1CB 5MN4A 2OV4A 1OZFA 2FFQA 2OC4A 4EEXA 1JEJA 4CM7A 4MVMA 5I3ZA 1A8QA 1MO6A 3M6WA 5TJ9A 3KHUA 5AJHA 3M4XA 1I94B 4Q3AA 5KHAA 4IG9A 1DB3A 3OVMA 3O8OB 3RS9A 3E61A 3F4LA 1XZAA 3DCNA 1GNTA 4NMMA 2ZZKA 2OO3A 1GKYA 2VHCA 1SIOA 2BE3A 4U3FH 3WLFA 4QODA 1J2JA 3K6RA 3JQFC 3EYWA 1DAGA 2OCIA 5DB4A 3DXXA 5HZGA 1EVQA 2VNIA 1I6WA 4E4EA 3I73A 4NQRA 4IFEA 4WASA 3U9SA 4RVNA 4D0RA 1RWXA 1VIVA 1RYEA 5CFZA 5EP3A 3B6ZA 1EIZA 2P40A 3U1VA 4AYTA 1HDOA 2W2TA 2KB1A 2BR4A 4ZVSA 3OU2A 4YRCA 4EG4A 1RP7A 5HG0A 1KI1A 3QLTA 3O8NA 1WEKA 2HIHA 4DR5O 4A82A 1PGQA 2AI1A 4RABA 2X5XA 5JAPA 2ZNIA 1CD5A 4AKEA 3B1ZA 1ZXBA 3FPKA 3A8TA 2DHDA 1EUDB 1X1AA 3L07A 4PZ9A 1PLKA 4D9BA 2C2BA 1DCFA 3RVLA 4TWBA 1TD9A 4CMBA 3OA2A 2JJ8A 2XRZA 1G21E 4BQQA 4BEJA 4CPDA 4AUKA 2YXLA 2FMKA 1TU0A 2CFTA 1MO5A 1X13A 2Y2UA 1B2LA 2WJPA 4TXHA 2YJNA 4OFWA 2BMVA 4QQ8A 2CXPA 3VR2D 4YHHO 1FSSA 3PHJA 1SXQA 4MQMA 1KKUA 1SKVA 3NLLA 4HZ3A 3BFRA 3HXQA 5CAEB 5GVRA 1CERA 3D81A 1NC3A 2R68A 3TCXB 4JQSA 5KWSA 2D4HA 2XUFA 2FUKA 1E9EA 3VU0A 5TVGA 4DPKA 1NHGA 1PS8A 3PPIA 2BF7A 4L15A 3D4NA 4B3CA 4NBSA 4A2QA 1GVNB 4UVDA 5HBRA 1ENVA 3B8NA 4PY2A 4DV5O 2CJXA 4RKEA 1ST3A 1EN4A 1RPRA 3ZNNA 4LZPA 3AESB 4RZIA 1J90A 1YK1A 5HSGA 3B1VA 4B4OA 1R0WA 5I9TA 2IU3A 4RAOA 2H9IA 1VYHA 4MUFA 4N7MA 1XG5A 3F6RA 3W9SA 1I5XA 1U81A 1EJ2A 1ZRHA 3K0CC 2ZR2A 2HV9A 3AG5A 3F46A 3HCOA 1GCAA 5C7IO 4V0OA 4ZP1A 1IFXA 2O8EB 1JMVA 2ZT6A 3K71B 1J06A 1H4SA 4IDFA 3HPRA 3DFMA 4NTZA 3OJEA 3RJ9A 3B2QA 1Z9BA 2H1FA 4JI8B 1JX9A 2XECA 3X2EA 4U0KA 3P2OA 2OTJV 2J0VA 1JR6A 4DV6O 1SC4A 4PDMA 4GKBA 4L9SA 3LOUA 4MA4A 3EOZA 3B52X 2ZI3A 4UV8A 4PG4A 4E03A 3A1EA 2OZBA 4XSGA 3FTFA 5I5GA 2EL9A 3H0CA 2JB9A 1HM5A 3L8FA 3DMGA 2ZE7A 1HV8A 3F73A 3SFTA 2PUWA 4UHCA 3OZCA 2J4DA 2H1HA 4IYIA 2CUTA 1C3OB 1L5LA 4K2AA 5C5CA 1M5UA 1O7JA 4N9WA 1J70A 1I08A 1CK4A 4I1YA 4L72A 4GDFA 5KEIA 4WN9B 3D0OA 4WV3A 1THTA 2QX6A 1OROA 1RD4A 1JD1A 2FPRA 1VE5A 5SZHB 1J8MF 3O94A 5BWLA 5D3QA 4JB8A 1NVEA 1XEAA 3OESA 1UODA 2UZHA 4RZXA 3JATB 1QDEA 3IAS1 2X1HA 3VU9B 1DJPA 2J9ZB 2HHHO 1U04A 2Y2VA 1JF8A 1IEWA 3PUHA 3L77A 1DMSA 2MINA 1FDOA 2NZVG 3AHJA 2FWJA 5COAA 5HOQA 3NBFA 1ADJA 2C2HA 4M8KA 2F4VB 4FM1A 1PNTA 1FTNA 1EWRA 2Q6OA 4PLZA 1AZSC 2V7EA 3ENKA 1ISPA 3MN1A 4XJTA 3OCUA 4UBOA 3QKTA 4ZK7A 1U2ZA 1T8YA 3GHYA 3C7CB 4JC8A 2XB4A 5DYIA 3GW8A 4BFCA 4I4TB 3BD9A 4QQRA 1EP2B 3KLOA 2K1EA 1HZZA 7YASA 1P45A 4BB5A 3E05A 2O2HA 3VVCA 4PRKA 1P5ZB 1AC5A 1C7EA 3UJ6A 5ALKA 1Y5MA 2ACEA 1J1IA 4MTLA 2N1BA 5H82A 3T38A 1P81A 1NJFA 2YN4A 3E8GA 1FXVA 4JL5A 4LDNA 1KDOA 4NBKA 2AQHA 3JWGA 4B2YA 4RS4A 2BMJA 4R51A 3SQDA 2AMVA 3VYTB 1X42A 3EDCA 4PZZA 4IDCA 2D2FA 5E1AC 2I99A 1QHEA 1RAEA 3C24A 2PMDA 4IQ8A 3K5HA 4L5CA 3FIUA 3V6LA 4OB7A 4HC4A 2O1SA 3NJRA 3QNUA 3NASA 5F2VO 1JLKA 2UZ1B 3ROTA 4UEWA 4IUYA 4URXR 2QHXA 5LZ5A 2VHVA 1QSGA 4YN3A 2PWPA 2CLEB 3CLSC 3EIXA 1PT5A 3ZGZA 2A1IA 1S8NA 5C37A 1A4IA 3FZGA 1RSZA 2C78A 2CUGA 1KJJA 4C03A 3MELA 5C7YA 1QIIA 5LB4A 1ZMOA 3Q7RA 1AGPA 4JR0A 3E8HA 4HNSA 1PK9A 1WB8A 4TS1A 1TMGE 2GTIA 3H1LH 3VKHA 3ND7A 3L05A 3AERA 3RARA 5I8PA 2L2QA 4FFVA 4A0QA 2BOCC 3B7GA 4ZZIA 4LZJA 3ILSA 3FNRA 3WJQA 1KI2A 1Y3IA 3UICA 13PKA 3L46A 1W1UA 3HB9A 4MUJA 4R1OA 1XUQA 1P7WA 4JU8A 3RVZA 2CHQA 4HN4B 2MSLA 3DXYA 4D26A 3FSJX 2C4NA 2ZRPA 1RIIA 3A3NA 3EVTA 2BTUA 1G18A 4F4HA 1IZZA 3HDTA 1Z37A 4XDHA 5DGTA 4GLFA 1J20A 1G7TA 5CT5A 2CVOA 3DLIA 1PFWA 1MH9A 4DIMA 2J3HA 1BQ0A 3T1YB 3RJMA 4G37A 3GCXA 4DDKA 1SIWA 2FMFA 5FTJA 3TGUH 3CZ9A 2FB5A 5JDIC 4AZTA 2IXAA 3CUYA 4CEHA 3DOFA 2GXUA 3HUUA 4FMPA 1VQ6V 1GM5A 4O5AA 5EXSA 3BRQA 4M8LA 1O6BA 1P91A 1WMSA 4QYMA 2VWJA 3ZXYA 1ZP6A 4YRMA 2I6SA 4GLXA 3IYLW 3PEYA 1QYWA 5DN9A 5A05A 2CXNA 2G9ZA 1ISJA 2XBLA 5EJEA 4NF2A 5BSFA 4I55B 4EMBA 1T0KB 2IKQA 1IHDA 4LOHA 1C5KA 2RGUA 4N3AA 4FN4A 3FPIA 5DGHA 2LW7A 3DHNA 3SJBA 4QVKA 4JSTA 4X20B 2OMEA 2YQ4A 1ZNQO 4IH1A 4ZOEA 2P79A 5HP4A 4MV0A 3S0WA 3UH0A 4C0BA 4J11A 1M9NA 2J0SA 4C7MA 5BNTA 1BE3H 4DCOA 5LMNO 4NE7A 1GR0A 1MAWA 1Y5RA 3AJ8A 2YVLA 2JGMA 1K06A 3B48A 4EGFA 4OLBA 1VFPA 2BAGA 4J6FA 2VXOA 1QJ4A 2I76A 2PRYA 4EJFA 2NMUA 2E55A 3SC4A 2X4IA 4O2LA 1KK0A 1CFZA 2H4YA 4MWTA 3HP4A 2ZRQA 1XNGA 4JJ4A 1E3JA 2YTZA 1GT6A 3P9PA 1NXSA 3WQBA 1HNZB 3DCYA 4AF6A 3OKFA 2PH3A 1LPPA 1UJ5A 1KMIY 3DOCA 4R4JA 4WOPA 3A1UA 3AFIA 4OUDB 2QROA 5L7WA 3VJKA 1RRCA 4MI3A 1E79D 4GNRA 3CPJB 3KB6A 3KOWA 2Q62A 5DU2A 4DGSA 2HCJB 2OORC 2OHIA 1QE3A 2P91A 2QJOA 2EWWA 2Q0SA 5C5IA 3FW1A 1YI2F 3BEHA 3FWNA 2C3OA 3R5JA 5K3EA 3NUZA 5JJIA 5JJKA 4YAEA 4N40A 2X76A 1NR5A 4J3FA 4MUNA 4MUIA 1RJGA 1H6AA 2WDZA 4MS2A 1PJRA 3SZGA 1GA6A 1V7PC 2Y1GA 4LYEA 5A2QA 2F9FA 2W93A 1G9XA 1WOMA 4E94A 3HMKA 1PT6A 3FVQA 1XL4A 4I1UA 4N9QA 3G79A 5AH0A 3AGPA 4LCEA 2D3OW 3CW9A 4Z3KA 2QDXA 3KTDA 4NPCA 3O4HA 2CDYA 2V7QD 1EEXB 3VGJA 5CCXA 3RODA 1AP6A 3LLSA 1L4HA 3CHXA 3QUTA 3E70C 3WIEA 2PSFA 3BHIA 4EA8A 1H69A 4YCJA 3WIBA 3ID6C 1YBFA 5DM1A 4ZYWA 4AZ3A 4KQXA 3DBRA 4U3JA 1X1BA 4S2UA 3WI7A 4MYTA 2C59A 3MCZA 1NTMH 1GEEA 2ODAA 5I45A 1PGOA 1DHTA 3N8NA 1ZFNA 3C5CA 2IOHA 2IF2A 3SBOA 4BVFA 4XB2A 1EK1A 1PW5A 2Z3VA 3EAQA 3E5NA 4TZZA 5FO1A 5CT6A 3N87A 1H3NA 3IEUA 3A0BZ 4EJ2A 3B53X 1N9ZA 3O47A 1W34A 4D4HA 4JLWA 3C8LA 2C2GA 2ODWA 3MCTA 4BRWA 1OAOA 1QIKA 4AJHA 2XTAA 3EIUA 2ZXUA 2Q0OC 2Q8PA 1SXJE 4UFNA 5FO0A 2DFDA 1GZ6A 4PLYA 5CEFA 1GKIA 5EK0A 5H6QA 4RPHA 2IUFA 3RU3A 5MGNA 5J4HA 3QW2A 1JIXA 5GW7A 1RXYA 4G4YA 1N8SA 1MOPA 5FFFA 1K3EA 3G2NA 3RUFA 1K5DA 3PVCA 4LN1A 2VQFB 1FDRA 4AJIA 4PXAA 4ZHSA 4ENUA 1GUZA 1J0DA 4BO7A 3EHBB 3PL1A 5EJ7A 1Q92A 3W5IA 4UM9D 3NCHA 3B3GA 3B12A 4RA9B 2ZM6O 1X1QA 3UATA 4GZRB 3SMQA 1UBFA 3UT5B 2IHTA 2W48A 5DJ5A 4BO9A 2H6EA 3Q8XB 2MSEB 4L4RA 4PO3X 3RTGA 4C8IA 1R64A 3SC6A 1IEXA 1LA2A 5JD4A 2IBTA 3GIWA 4NAUA 1L5NA 4KO8A 2POCA 2QRKA 1HWYA 1KEVA 1GH6A 4QFCA 4BX2A 4XASA 4U2KA 3U3KA 5DK6A 2IYFA 2I2FA 4YECA 2ZQYA 1MV8A 2D5AA 3OP4A 4X41A 2VUUA 4QSHA 2E5LO 1DEKA 3LL4A 1E2IA 3G9XA 3WLEA 4D02A 2KMLA 5BSKA 1JX6A 1VYTA 3IEXA 3X44A 1UZLA 4U2CA 4R1UA 4PRYA 3CRQA 3MUOA 1BG6A 2VGMA 4EG6A 3E0QA 5KNBA 4AP5A 4EYSA 4X62B 3HJTA 5H1YA 3L0CA 4CCYB 2F1IA 1JPUA 4IINA 4B3MO 3HUDA 4NDAA 2XUOA 2Z4SA 4Z49A 2WNIA 2R87A 1SUPA 2IK8A 5FLYA 3R41A 3L8CA 3GGSA 3R76A 3CRMA 2Q7DA 4O4JA 3FWKA 1EDEA 3VU1A 3R5SA 2CVPA 1AMOA 1V8PA 4LWPA 1J9EA 1VF6C 1JBKA 4W5JA 5F9MA 4R6ZA 1WO8A 2JFWA 1NURA 2OKCA 1AHHA 1ODIA 3HBMA 2IIQA 1PFGA 2BGRA 4EPWA 3BX1A 2WU8A 1C30A 1E1LA 3VKVA 2QLFA 5ALYA 3QEAZ 3L40A 3HJUA 2Q1XA 1LRLA 3KZNA 3SR0A 2PMKA 3PPXA 1E6EA 2N3ZA 2MSDB 4MLPA 4D81A 1Y3HA 1OYVA 2YDXA 4LDZA 4XTCS 1JXOA 4CW7A 3G9TA 4FBGA 4XIYA 2QP4A 2DPMA 3GJ5A 4YAWA 3TPFA 5G4KA 2OOKA 2E48A 2G06A 4FYHA 1P7PA 1NQTA 4XR4A 2WJZB 3KQVA 2P22C 1Z0AA 4QU8A 2CGOA 5DT9A 3CXUA 3G2MA 3UEOA 1M74A 3HCCA 3SPXA 4BNXA 3HVIA 4PIPA 1Y8RB 1TA8A 5TEWA 2Z9CA 2AOUB 1ORRA 3VI4B 1LRJA 4B3TO 5ES4B 3NKLA 4R6XA 3D8SA 1XRMA 5JCZA 1SKYE 2IOQA 2JA1A 1KNQA 4GPAA 5SY4A 4JI4B 9LDTA 3LC7O 3BRWA 5I6DA 4G9EA 2PYJA 3T3HA 3RU9A 3CCVF 1SG0A 4D9IA 3E8XA 1B43A 2OHJA 3IO5A 3HN7A 1JSRA 3CZAA 2UYHA 4JR2A 1OH7A 4Y0NA 2QEQA 1N33B 2V0NA 4EJ6A 4NCXA 1GFIA 2ZROA 4DA7A 4UBIA 3TEJA 1KJYA 4PQFA 2Q69A 1LWOA 3WGUA 5BY1A 5BVGA 5CDYA 3FVWA 3L43A 1AVTA 1V3UA 4UREA 2QZ4A 3ES9A 3UJ3X 1IOZA 2IJGX 3LNNA 4A10A 1EK6A 1GGMA 2JS7A 3VHQA 2H16A 1GQQA 4AROA 1B0ZA 2B2NA 2PJZA 4WY8A 2EGGA 2B30A 1WDWB 1HZJA 3HRKA 3VI3B 1LUWA 1U8CB 4TMYA 4CIVA 1F2DA 2XAJA 3A7EA 5HOEA 4GC5A 4JYMA 2R5NA 4BGIA 3KTOA 5C8DA 4G4JA 2ATIA 1Z4PX 4RW0A 3H9JA 2XIJA 5TQ2B 1PVVA 5TF4A 1VQ9F 1E79G 1U7WA 2DQYA 2H4ZA 3P2JA 4P82A 3KR0A 3IBFA 3FPGA 1U0BB 3QX9A 2VTEA 3GUVA 1JHVA 1U8TA 4ZOQI 3CCSF 3OF5A 5HMMA 4KXQA 3LV8A 1YHQV 1VCOA 4KSYA 1AD2A 6AT1A 4HWRA 4XQ0A 4PDRA 3F6MA 2UXCO 4JOCA 4OJTA 3GXOA 4QBHA 4Y2GA 1U3CA 4V24A 1C7IA 1OWOA 1XXHE 2HOQA 1PR4A 1Q43A 4YLGA 5BUCA 2ZRFA 4INJA 2VRZA 4QM6A 2AG6A 3JQ7A 2CB9A 1FP2A 4H1VA 3LO5A 3QW4B 1QC5A 4QYTA 1N2EA 1KHHA 1N2SA 1N0HA 3IT3A 2H08A 4B7AA 5B12A 4BYGA 1Q14A 2V59A 1US6A 1XPRA 2VLIA 5EC8A 1RI4A 4C20A 1CUHA 6LDHA 4F8YA 1GGEA 2RK6A 2WYIA 3DB2A 5TDHA 2GR9A 2EZOA 2X4DA 3EXFB 3OHPA 2EQ5A 4OPAA 3C6QA 2DFPA 3IT1A 3Q4HA 4RTJA 3RSSA 3MWGA 4JA0A 1BXGB 2PLWA 1NM5C 1NQ3A 3U80A 5ALTA 5AP9A 4WRRA 1T6BY 3JVHA 2JI7A 4K6MA 3KZKA 3O0DA 4N0PA 4HX5A 4D41A 3D3WA 2QRNA 2MCFA 3FPAA 2I1LA 4EUSA 3OIFA 3AK2A 2JZCA 3QFCA 3T9AA 2I3BA 3THYA 1G4YB 1E9CA 4E4YA 2B0JA 4RHXA 4OQQA 3N59A 2XTMA 1SOMA 4GPEA 2IH1C 3KUDA 3MD0A 1M2KA 3K35A 3IHWA 2Q3CA 1FVFA 2HX1A 3MK31 1GZ5A 1M72A 1OKKD 3WXBA 3IQEA 4J16C 3DAHA 2PZMA 1CETA 2VPPA 4ZOAA 2JIBA 1KKDA 4F86A 4JI5O 2R48A 1KVUA 1WHSB 3CRNA 1LPOA 5A5DA 1UH5A 3F0TA 3RSGA 3DMTA 2W43A 5DV9A 3ZY5A 4MYDA 1AURA 1PEYA 4C01A 3FMGA 4G67A 5K2MA 3PGJA 3HXOA 2X6TA 2FZEA 2QXUA 1XEQA 4Q7LA 4YAUA 3WRXC 1KZ4A 1ZH8A 5BV7A 4BRZA 3DUFA 3G0CA 3GO4A 3KKLA 1YQDA 4U4AA 3OWHA 3D6UA 1NRXA 3NWBA 4TQFA 4OPMA 1VI6A 1TYEB 3RYFA 4IRMA 4A3SA 3U09A 2QI2A 3K70B 4WEQA 4QATA 4C9BA 2JG3A 3E7XA 4JEIA 2DHEA 2BDTA 2HO4A 4XDLA 1S5PA 3IQWA 1GD1O 1Y6GA 4G4IA 1L5RA 4XVHA 4CF4A 4PTLA 4X91A 4HAIA 1JFLA 3CVOA 4E2WA 2QVCA 4M38A 4CZZA 1Z0JA 4KR7A 5E9JA 3WOHA 2EQAA 2WAAA 1Y1PA 1NJ8A 1CDZA 1NYQA 4Q4HB 3OQMA 1QLWA 3GUCA 4GE0A 5CIQA 3OY7A 2ZRLA 4WADA 4F8EA 5JPDA 1HMYA 3RYIA 4KQ6A 3E9EA 3KQTA 4D98A 1TZMA 5L3EA 1HOTA 4CG2A 4H17A 3O8QB 1A2OA 5BSUA 1B1CA 5BWCA 1ULHA 3NDPA 1IIBA 1ADYA 3C7AA 4AUMA 3WLPA 3DSRA 4JLSA 1DO2A 2J07A 2QN8A 1NL3A 4K2HA 3HK2A 2DYSC 3MC1A 1CQXA 2DQZA 4QOHA 3OLWA 2Q46A 2FCRA 4WINA 5EQTA 2JIDA 3UFXB 3ETCA 4DNPA 5SY6A 1ZD8A 3O2SB 1G3MA 1GYQA 4EY3A 3TOXA 2NYVA 1HYBA 1RYNA 1EESA 1UMBB 3QH4A 1FTSA 3O3OB 4E5NA 1FF9A 3ZBUA 4EITA 4DNQA 3ETLA 1P19A 2PZ8A 3ZIAA 1XOIA 2Q3DA 3GFBA 4Z2AA 3ZIAD 5JS6A 421PA 4MCAA 3N05A 5GP1A 2B1GA 1SU7A 3FUVA 3SDLA 2ZRKA 3FHTA 4UOEA 1TT5A 4FM9A 2VA8A 4EY4A 3E8FA 2AKAB 1VTKA 2ID7A 3JQ8B 1VBFA 4KJZA 4X66O 3EZ9A 5IKOA 5J2TB 4NULA 1WVIA 3R9KA 5FBQB 2KBFA 3PR2B 1NVKA 1YHZA 1EGQA 3NANA 2Q3BA 1F48A 1SOUA 1A1VA 1U99A 5FWXA 4I4IA 2NZ8A 5FBKA 3WLOA 2QB5A 2FSVC 3LY9A 3RHFA 1UZNA 4LWSA 1NE7A 1E5QA 4OBBA 3EEYA 2XMSA 3KIZA 3MTJA 4JX8A 1QIJA 4IS2A 3NHAA 1M6VB 3MJCA 1D7OA 3NYIA 2XAGA 3VBBA 4G4VA 5ALJA 3CX4A 3OJ0A 2M1XA 4HVCA 1W87A 1GDTA 4YQYA 4KO3S 1CRQA 4I7ZB 1YZNA 4QLAA 1EWKA 1RCTE 3ZV3A 2P30A 5GINC 2H4FA 5KOHA 2VRBA 3ZY6A 1N0VC 3HLKA 3K6SA 1NKSA 3NORA 1IV2A 1D04A 2LP4Y 4C14A 2MSCB 3EXAA 1TEXA 3TH5A 3JAMN 2B21A 4MMYB 3W7TA 1WVMA 2I1VB 4CS3A 5F2NA 2BONA 4C6SA 2CLHB 1V8BA 1CUVA 1T0BA 1W48A 3G67A 1EUCA 3CCEF 2Y77A 5CBFA 3N2ZB 4WFKA 3AF0A 4FFWA 1ZMRA 1NVDA 3CLSD 1KNJA 1GKUB 4L3VA 1WXXA 2Z4TA 3KZXA 1WE2A 1A50B 4TWRA 1U7ZA 3MRSA 4PG8A 1CR6A 1X14A 1M3SA 1CIJA 5AHRA 4BNDB 2Q1TA 4G4GA 3PSHA 5FLXM 4PPGA 1OCRC 3RYHA 3MLEA 2J9GA 5FX2A 4U2BA 1R4AA 4UDYX 4LZOA 3PXXA 2W9XA 1XE3A 1QFSA 1T1JA 4YVFA 3AHCA 3VR0A 4D0GA 1UXOA 1VHAA 4XJSA 4IOKA 1QAHA 4M0LA 4DPMA 3SGIA 5IDJA 5I7WA 2AS0A 4F60A 2WP0A 3PLAC 4QRHA 2DBVO 4CF3A 1DTEA 4AIIA 4NU5A 1GDHA 4YO7A 2Z01A 3SIPA 4YT8A 5ALGA 1TC1A 3IELA 3KKYA 3HVHA 4FHCA 1EP1B 3U37A 4X9QA 2WJJA 1U7XA 2P7IA 5FB3A 3CMMA 4S12A 4TMTA 2WU3A 5EZYF 5CVDA 4DB2A 3DEYX 4URZR 4MWSA 2XMGA 2XSZD 4RZUA 1KS9A 4RELA 2F48A 2WFAA 1EWTA 2J32A 4GLLA 1IOLA 1EFKA 3SJQC 4CKWB 1U7HA 1DHRA 3DBOB 3UMBA 4KQWA 1J99A 1YMUA 3MTAA 2YASA 3A4MA 4DMFA 1GTL1 1AJNA 4NWOB 2OQIA 2G9IA 2IYOA 3KPVA 4PBSA 4EB6B 5B2FA 1BMDA 4LF7O 3BTUA 2P2NA 1S9HA 3GG9A 2NU8B 1JAYA 4RJTA 4K9LA 5K8LA 1SKUA 3DV0A 1RRMA 3TCNA 2X9LA 3C8MA 2XZTA 2CXTA 5J5CA 4CMKA 3L18A 4LSMA 1E2PA 2AE1A 5ER9A 1ZRNA 4KITB 3NEJA 3S0JA 2K4MA 3C14C 2FGJA 1NN5A 5EWMB 2WUWE 2G28A 4OK3A 2Z5GA 4DA4A 2WV7A 4RESA 2D59A 3EFOB 2KWIA 3WNZA 2V8OA 4PZDA 1ZA1A 2AXPA 1Q6ZA 2ZWIA 5ERYA 4E2ZA 5KQPA 2X8AA 2ZM5A 1UJNA 2OK7A 2AEMA 5LIPA 3UJHA 4Q1AA 1Q1BA 1BROA 2RAPA 2AOTB 4Q19A 3CIFA 1Y74B 3WJ7A 3CRW1 4E31A 5KHKA 2AZ2A 2DRIA 2CL0X 2ZBRA 3ELBA 2A6PA 1TMKA 5D7BA 4BQNA 5BRNA 1IB6A 3PPVA 1ZK0A 1UEXC 4L7QA 3FAKA 1T1IA 2HKOA 1ZESA 5DGDA 2PAAA 3PGLA 1I1NA 1M90H 2QOEA 3FRHA 1H94A 1BSVA 1T4BA 3NWEA 2GNPA 5KDLA 3S0HA 2A67A 3TN7A 3UIEA 3JD2A 4LBVA 5H9VA 1VI5A 2NO5A 1RHJA 1E4VA 1SVUA 2BKAA 4JLJA 1P39A 2EJUA 4CKXA 1VLZA 4JR1A 4AMGA 5C52B 3ENWA 1TAUA 3NTLA 4F4DA 2FRVA 4FEYA 2D2CB 4XX1A 4FYKA 3IMCA 4UBMA 1G3IA 3P10A 5AG2A 4OGGA 3LFHA 2JLBA 2FMTA 3IP8A 2X1VA 4MVYA 3P96A 2IHUA 4LDRA 3D6AA 3MOGA 4NX2A 2AK3A 4M0CA 5DX1A 5B1SA 5JNWA 1ZWZA 4ETIA 4Q9JA 4A2WA 2CEAA 4X90A 4CM1A 4ZVQA 2IYRA 1CSEE 3I2HA 1GG2A 4I7EA 4G97A 4RPIA 4J0CA 3CMEV 1KP3A 4HLDA 2YS8A 3PQCA 5C32A 5AK6A 1YQUA 1CY7A 2QMYA 4LOLA 3IX7A 3OJOA 3Q2OA 1M2FA 1HFJA 1XRRA 3C3XA 2DQ0A 3A0UA 1MRNA 2DT5A 4CHGA 4YLEA 3D7SA 3IDQA 3IXQA 3R3ZA 3G0IA 1ZIOA 3G2OA 5EZYA 3OX3A 3LKVA 2VAWA 4YRGA 2YCLA 3STTA 2Y93A 2ZLBA 1U8FO 6NULA 4BFWA 3PLRA 4X7PA 5AW7A 1GN6A 4M89A 1ZOOA 1RPAA 1IEQA 1SU6A 4L85A 1Q0LA 4XA8A 1GTJ1 1FBTA 1GTMA 4AJOA 2YWJA 3LX6A 2FUCA 3E81A 3ZIAG 2PXXA 1NAIA 1RWQA 4DR7B 2E76B 1GNLA 4UMFA 2ORYA 4BATA 4G01B 3QEKA 1PSWA 1KBZA 1E8MA 3RQSA 5H68A 1L0LH 4N03A 4Y9DA 1ZK3A 2EF1A 1VBNA 5AHXA 2WAMA 5TC4A 1K92A 1XSEA 1YJBA 1ORQC 2VHEA 2BYTA 3RUDA 3V5NA 1ZVMA 1SXGA 4WAUA 2IYEA 2H63A 4HP8A 4IJ6A 4TV8B 4EB8A 3I2IA 4AIRA 4ZKEA 1SVLA 4OA5A 5C3UA 5JI2E 4M1YA 3ZI0A 1YZGA 4UPDA 3VQVA 3N7TA 2Q41A 1E0KA 2LBXA 2A0LA 4MA5A 4CCWA 4G5OA 1OCRB 1A9QA 3I6ZA 1K9MH 1GQRA 3RDPA 3CPWU 2JVJA 2W8BA 3CBQA 2YWBA 3R9WA 2JKVA 4C7VA 3GQBA 5CB4A 3EAFA 2LKCA 2NNUA 2IF0A 1ESZA 1CQZA 3LKBA 4Q1DA 4KVGA 1S8AA 1GNPA 2PVCA 2RGDA 1KK2A 4I0XB 4QDKA 3QG1A 3V8NA 4FWIB 5K3DA 2IYQA 1BX0A 3LGXA 3K79A 1OWPA 1I1HA 4BP3A 5DNEA 1WSWA 4PVDA 3SFZA 2GESA 4YFVA 2M2IA 3RIXA 5TPWB 3MMNA 1HDCA 2JDIA 4M0DA 3WV4A 4LS3A 2JDID 3JYLA 2B82A 5CA1A 4QE7A 1GWNA 4NG4A 4O4LB 4JP8A 4OO3A 1XRNA 4JH0A 2QYHA 4P2GA 2NZWA 3JZDA 5M29A 3CNLA 1P7ZA 2WIBA 2CMGA 3EPPA 5HQTA 1TM5E 4YV0A 1FFEA 4UCFA 3OT4A 4N5LA 4EI8A 1BCRA 1QPGA 2B8EA 4HLUA 1JU3A 1KFCB 4Y1RA 1E0AA 1VKZA 1QK3A 4NS4A 3BA8A 2I7XA 1YFLA 3G6KA 5LP1A 4HZGA 3TTTA 1X25A 3NVKI 1N5IA 1BHO1 1N2CB 1Z13A 4F84A 4Q39A 2PS1A 3LY8A 2GBIA 3UAZA 5JMWA 5TISZ 3F5QA 3ZLUA 3K16A 2R6GA 3CPWF 2ZULA 1TUEA 1T6XA 3ZEIA 2IEYA 2O1WA 1FDUA 4GGOA 4MAMA 3SNKA 2A0KA 1YKSA 1Q83A 4H1UA 1KAEA 2HDWA 4LRXA 5GIPC 5JJCA 3SXJA 1BMFA 3OEED 1G2PA 4DDWA 1G8AA 2Y1DA 3OMAB 3R3XA 1YJCA 2JD0A 2GM9A 5ARBA 1TU3A 4MR8B 3C5WP 3OCWA 4PCUA 2C8VA 3ZX4A 5DYNA 3VYTC 4AKHA 1IM5A 4XJVA 4R9RA 3THXB 2FZVA 2WD7A 3LF1A 1IPAA 2PWYA 1H1TA 4RL4A 5LU9A 2Z2IA 1WCV1 4Y1GA 1SAYA 4Z2WA 3I92A 1EN5A 3DT9A 1R6NA 4BLTA 3AJRA 2OZEA 3UGKA 3MGCA 3T7RA 1O57A 2CD7A 3VCZA 1CN7A 3TMYA 2D13A 1PTJA 2FCAA 1ZJJA 4NI5A 2IYSA 3LCJA 1JFTA 4E1VA 1ZZGA 3NB0A 1Y9JA 3RE3A 5DW3A 4C0HA 4MS4A 1KP2A 3ECSA 2VSNA 1B8OA 3RHZA 2YMLA 3OECA 1BVUA 4OXQA 2PSSA 2QENA 1QGUB 5JZMA 3DE5X 1M2GA 4DRXB 4FLWA 3ASYA 3TRKA 5EJ4A 1EMDA 1BD3A 3Q3EA 3QPBA 2BF4A 2IE8A 3D2LA 3L5KA 2CXRA 1CQIA 3F3SA 1UDRA 2HC9A 1FXSA 3CSDA 3T7AA 3W2HA 4RY9A 1VPVA 3ZCRA 1XEWY 1I3MA 4ICGA 1J22A 4GBMA 2PSJA 2XITA 2EKBA 2FPSA 2C2XA 3V8VA 3A14A 4AF7A 3IIEA 2ZUVA 4HNQA 4WOKA 1L4BA 3HM2A 5ALZA 2JGEA 1NLMA 1W2GA 1ZRMA 3CHYA 5CA0B 5IEBA 3QJGA 3T4PA 2BFAA 1GARA 5HIAA 3ZWDA 4EO4A 2YYEA 3LDTA 5I9BA 3VR2A 2I4TA 3NW9A 4DARA 1S3SA 3W6NA 3B5EA 1YDEA 5IAEA 1W0KD 2WALA 3G4SV 5ICMA 3LX5A 3H2HA 1IBRA 1R1DA 5DM2A 2IUUA 3QXGA 1V8OA 3OTOB 4OXRA 4BO2A 1E3LA 4G0WA 5KINB 4JI2B 2F1OA 4ON9A 1GXSB 2HCRA 4FMBB 5E7QA 2QJFA 3E15A 4DLAA 1Z8HA 3GRUA 4NXMO 3ZHSA 1Z0DA 2F3TA 8OHMA 4GGMX 3RUHA 4ZHVA 1K5GA 4LF6B 3HO8A 1N6IA 1COZA 1L7QA 4PGMA 4XFJA 4OLHA 2OFOA 3LQKA 3OU6A 3S28A 1E96A 1OVGA 2IXTA 3DP9A 3U3XA 1ROPA 1OLUA 2LUOA 2OFWA 4AJKA 5IJZA 3EF1A 4KQHA 4JTAB 2JCGA 5ESRA 4JKYA 3K8QA 3EUWA 3B2NA 1SQ5A 3BMNA 2P9BA 3I1JA 3R23A 5AI4A 2FWPA 2XDWA 1Y6XA 4TL8A 4L5YA 3GLFA 4MZDA 3PQ6A 3Q2IA 5CH8A 1EGVB 1T4DA 2P4QA 3EIOA 4QUKA 5AVKA 4FCTA 4MR7B 2AG8A 1F2UB 1CS0B 3JRNA 1PI3A 4QGAA 5DX8A 2I78A 3TIIA 3VQYA 4G0UA 4PYNA 2CJFA 4XJXA 2PMFA 1YJNV 4WZAA 3DW3X 3FKQA 1S3GA 3RRNA 1QH9A 4LECA 3RJ5A 1Q1GA 3WRXA 3D8UA 4RJKA 5G0WA 4Z0TA 1IN8A 5FPKA 3PF9A 4KE6A 1U5BA 4EI9A 2VTBA 1UKZA 2FMHA 4JU9A 3DLTA 1LK5A 1DDGA 3ZMUA 4JJZA 1OFVA 1A7UA 3I30X 2X7RB 2EIHA 4QYIB 3QOXA 2VDJA 2GKOA 4JITA 4C22A 2FPIA 3LA8A 3HB4X 4UTZA 1WD7A 1MGOA 1USVA 5AVUA 4F9FA 2CXSA 4ZN6A 1XD2B 3ESAA 3RKSA 3F6EX 1HQCA 1QYIA 2VP2A 3AUKA 1ESDA 3TLGB 2C42A 1G2IA 1JKJB 5KYXB 5FTLA 4CL2A 4NMHA 3U61B 4EY7A 3T7JA 2ITDC 2VTVA 4M8NE 4R84A 4CC6A 4Z0PA 5DNVA 3DGFC 3U3MA 3ZVKA 4INOA 3PWZA 4BEVA 2VQEB 3EC2A 4CH5A 2RGWA 1K2WA 2GVDC 5DRTA 1P0MA 2R1VB 2G76A 3H4TA 4BE4A 4JXKA 3KT0A 3QEBZ 3MTDA 2UUCO 3BQNB 1TF7A 3LBIA 2M9MA 1ODSA 1CUAA 1N8RH 1Y1LA 3B4SA 2WC1A 2JDIG 2GN4A 3LI2A 3V7WA 3O1HB 4AULA 4J6EA 3U10A 4ZYTA 3S29A 1ODEA 4D82A 3LSUA 2C9CA 3MGBA 4WMLA 4C81A 5KC8A 4MIOA 3E4DA 3AHFA 3FUXA 1KMHB 4Q9LA 3JARB 4E2FA 4AURA 3QBVA 4YCAA 5KTNA 3OT1A 4TM8A 5ED4A 4ZU3A 4M7WA 3M4YA 1SBQA 4Y2UA 5CLGA 4PX2A 4QUHA 1NF8A 1YB4A 2I7DA 2P3OA 2WJVA 1YL7A 1I7PA 3A1DA 1T9DA 3DEFA 1PD0A 2YJGA 1DAOA 2J9FB 3H5VA 4PLGA 1T9AA 1DKPA 1PL8A 3B9PA 3JQRA 1A0OA 2K2WA 1I0LA 3HP1A 3X1DA 1L4EA 4PGHA 5BYJA 5AIBA 1EBUA 3IAXA 4PHGA 1CUSA 1S7CA 3A6DA 2PTHA 3LTNC 3G17A 2ZR3A 3Q1LA 3PEUA 3SU8A 2C9DA 3EEOA 1X9GA 3TGLA 4JASA 2GCPA 2EFDB 1CKEA 1UJ2A 4N1AA 2F67A 3U2QA 3CZ5A 1RSOB 1BMFG 4I6GA 2PBRA 1MH1A 1DBQA 2VWKA 2FSVA 4H0NA 4GIBA 2FNAA 5KVAA 4HNAB 1NZ6A 2VZ8A 1T26A 2ZKIA 1NMUB 2WG2A 2G07A 4AMUA 3IE2A 1V96A 3KFLA 1QRSA 2PT6A 3UC9A 5ISMA 3AMVA 4RA6A 1WA8B 1TJNA 4O8CA 4DDVA 3WRYA 2F7SA 1G4AE 2EATA 3Q7QA 4KPUB 1ADGA 1SZXA 1QZXA 3S0YA 4ZZ1A 1A7KA 5LQNA 1CR4A 3ETGA 2UXDO 2NTYC 4JL6A 3TE6A 2Z0MA 3IE0A 1ZHOA 4V1CI 1XTUA 1C0KA 1MORA 1FFSA 4P83A 4UUMA 3TCUA 2IHVA 1AN0A 2EOAA 1K27A 3V1KA 3DKRA 1NFQA 1BAPA 1IEVA 2JI4A 3JWJA 1AUVA 4M9RA 3N7UA 2H1IA 3HB5X 4RLFA 3KYBA 2NTNA 4P33A 3MBOA 2YFHA 1O9HA 4J2TA 4RJLA 2DHQA 2IZ7A 3OE1A 3SIRA 1YS1X 4YUAA 2PUGA 1CJKC 3UCSC 2HREA 5HDQA 2YY5A 1U31A 3EA4A 1R16A 4UXHA 3DE3X 2IA5A 2D1RA 3PNVA 3U1TA 3JAWA 3J7AR 3G2IA 4Z7JA 1NJGA 4HWPA 1NLZA 4KYIB 2GN2A 3HFRA 4G5HA 3ZP4A 3RRBA 3TTUA 3IUNA 1Y0BA 1CRWG 1E9AA 4CLDA 1M33A 2LCQA 1V9SA 4EI7A 4AFNA 4IHJB 4BBPA 3WGGA 1Y42X 1SU8A 3WSWA 1RACA 5KKNB 5IH3A 4JNKA 4WEOA 5A4FS 1DTWB 5IC6A 5LYJB 1PJ2A 1U9YA 2DR3A 1JMKC 4CR6A 2RQ6A 2YIMA 2QMEA 3OURA 2WSBA 1HDZA 2OT3B 2MIIA 1YJ5A 3AKEA 3D31A 2YVKA 2QIPA 5HRAA 2WQ7A 3WGNA 4UB8Z 5B3JC 1ZSVA 1ZUIA 2D2VA 2HBZA 1W0KG 2VTDA 2RHBA 1IY8A 1Q5PA 3A9UA 1LF0A 2OCCC 4JI0O 2W6PA 3P20A 4A1FA 2FP4A 4GKJB 1E79A 4GYYA 8LDHA 3MTBA 5BWMA 3I28A 1KXZA 4P7JA 3OJFA 1QF9A 3GBSA 1ABBA 3V33A 4JV5O 3M3HA 1C2TA 1F6WA 1DDOA 3Q8HA 5K0FA 2A4KA 2AJCA 3OIYA 2VDWB 2Q5EA 1CRPA 2I6UA 3NCTA 4ND8A 4K28A 3NTVA 3R65A 3F0FA 3TJTA 4V2IA 2VJMA 1R9NA 4MB6A 6CHYA 4LC9A 1RXCA 5FWYA 3ICCA 4A6XA 3UQ8A 5JO0A 2H1SA 1ZGCA 3MWYW 3B51X 5CCEA 5KKCA 5CN0A 5LQJA 3WDMA 3UPTA 4F9GA 1D4AA 1JJFA 4QFBA 4BNYA 7REQA 1QKIA 3PHGA 1V5WA 2ZRCA 1CDOA 2UU9B 3AVTA 4NL4H 1Z16A 4O4JF 2NLOA 4UM7A 1GLGA 4EHBA 2V7QA 2NUPB 4JGBA 2FYTA 2EZUA 3GJRA 4K0RA 4Q47A 1U97A 5FEMA 4V1CA 4IOLA 5I8WA 1FFDA 1XMXA 3GY0A 2AW9A 2PQ6A 1ZCBA 3LL7A 1CUZA 1NUUA 4G3XA 3ZS8A 2H5IA 4OF4A 1H1LB 3K1ZA 1BCSB 1MX9A 3S2SA 3HWUA 3ZIUA 4KX3A 3O8OA 2KG7B 1Z2GA 2MT9A 3W79A 3F97A 4BT5A 1N3YA 3IOMA 2GPSA 3TNLA 4Q82A 4FCCA 3ZKWB 3C3AA 4EHIA 1WULS 4YR9A 4JOSA 4WOCA 2R6ZA 3ZDBA 3BWXA 4L27A 4POOA 3U13A 3E22B 2GF9A 4RADA 4NENB 3Q7TA 4YIOA 3GC6A 5KYYB 1SVSA 2P6NA 3KTFA 4BKRA 1VPEA 2ZPAA 1JPXA 4KI7A 4WOJA 3KL4A 1R3KC 4G85A 2OXTA 1SVIA 3E82A 2UVQA 4KAFA 3UM9A 4GMXA 2FJPA 4M37A 3U0BA 1RPJA 2XYGA 4GL2A 5IVIA 1T2DA 4LZAA 1SUBA 3DZJA 3UCXA 2XKBA 2L6LA 1UK9A 2BJHA 3C3CA 4FS8A 4C4ZA 1LSSA 1YIJF 1QDUA 1S76D 1Z5UA 4RQOA 4BNLA 2GJSA 2ZSFA 4LFCB 1EUDA 4QGGA 2YC0A 1A76A 4HGNA 3D5TA 3A1TA 2Q5IA 3DC6A 3DDZX 1MC5A 2BBOA 2H94A 1PF7E 4XYBA 1CP3A 1FXUA 2BZ1A 1QHTA 4K88A 4BV8A 5CBPB 1M5RA 3IAUA 1P5JA 1ZICA 1N25A 4DCUA 3WK7A 4DADA 1V7ZA 4MRNA 7GPBA 3AWIA 3AR7A 2VDRB 4G0PA 1TA0A 5IDVA 5EBWC 3DKKA 2FRDC 2X2FA 3MWLA 3IGFA 2ZRIA 3FYTA 4IF4A 3WYGA 4PNEA 5CAEA 3RRFA 3EN0A 3ECAA 1OUMA 5EBLC 5BR8O 1QQ6A 3CF0A 1JHDA 3N2YA 2OO5C 1BC5A 2ZOVA 3VQTA 1YI0A 4D3FA 4YC7A 4XUGB 2O1EA 1OBCA 1JAXA 4M1MA 4OHRA 5LQDA 4OATA 1DJQA 1E6LA 1TB4A 3ZW7A 3LWVC 3AESA 1WXDA 4JJ6A 3W9BA 4MCIA 4BFTA 4E2LA 4X6LA 3A31A 3IL2A 5HZMA 2VZLA 2OVBA 4BAZA 3K70C 4LXXA 4BQFA 3HBFA 1V2HE 2G9RA 5HMLA 3LM8A 4HKTA 1HDRA 1VE9A 4XW2A 4CC5A 1SKAA 4M60A 3BQMB 1V7QA 4LJ4A 1P0IA 3CM0A 1O58A 1W93A 3PQFA 4FX2A 2X2PA 2O8EA 2WNHA 4UUJC 4ID3A 4G65A 4R3NA 2JD1A 4K87A 2GSDA 1RRFA 2AEJA 3IOEA 1R37A 1US8B 1D6MA 4XIIA 4XAQA 4DY4A 4IYHA 3JVEA 4ZO7A 3AM1A 4NS1A 2HSZA 4R40B 3I42A 3D3NA 1P4GA 4BVSA 3AL3A 4RVSA 5CM2Z 2RHRA 4H7PA 5AM2A 1JKMA 3L6DA 1IV3A 2VPIA 3I64A 3EHEA 3PD1A 1OLOA 2X8JB 3H4VA 1W57A 1ID1A 4FR0A 2FN3A 5FA8A 1TUBB 4QZVA 1W5EA 2ZWVA 5FTMA 1CJUC 1JS1X 2X0KA 4JDUA 4YUWA 1C3OA 4NKGB 2QR2A 1CXZB 1LC3A 2I5PO 1E7RA 3PRYA 4UEOA 2G83A 2AC2A 3KSMA 4FTWA 4WN9A 5MFPA 3OICA 2XYHA 2QLLA 2OCCB 5C18A 2P35A 1JH9A 3PR3A 1SHTX 5CPFA 2GERA 2HYDA 3BJMA 5KCZA 2DB3A 4U2DA 3CWZA 3JATA 4HAMA 4UM5A 4GDMA 4D8VA 5KUMA 3VU9A 1V45E 4IIVA 4PQRA 2BCEA 5LQUA 3UG6A 4UCXA 1UJCA 2ZAMA 3M6IA 2IW1A 5JUWA 4E2YA 3ZBTA 1GJRA 3K4HA 5AJXA 4K8RB 2AN5A 4JB2A 3H99A 4WK2B 4GOMD 5LZ2A 4C82A 3FROA 4ZARA 3L0ZA 3VNVA 5F5NA 5IJ9B 2L17A 1KDPA 3N4ZA 3CCJV 3U4DA 1DQYA 2IDMA 2WM3A 1T3HA 5IFKA 4NNOA 4O3FA 3K2BA 1GCIA 2L0XA 4RO0A 4I4TA 3THRA 5CM9C 2BHTA 3NVIB 3MTGA 4UUQA 3OI7A 4B6OA 2CK3D 2PJDA 3KIPA 1V4BA 4BIOA 1N32O 3HWRA 5AXDA 2C7OA 3GVPA 3A05A 3C2QA 3ZWCA 4DMGA 1QGAA 4Y2VA 2JARA 5DCLA 4QJFB 3E9RA 3PA6A 2VEOA 1PJZA 3GP5A 1AI5A 1N6OA 4HV4A 1NVWQ 1YZ3A 1P62B 4MTXA 1M54A 1D9XA 2A1TR 1F1BA 5B66Z 4PQYA 3LWDA 3H3XA 1LDGA 3CW8X 3WNQA 3ABOB 4YCDA 4C3ZA 4D3ZA 2V4ZA 1E89A 4IDHA 2C3YA 2QRPA 2HP3A 3THWB 1N7IA 4HY3A 2VVTA 2R65A 1SQBH 2CZCA 1N6PA 3SJAC 2UZ1A 5CFRA 1CB7A 4WDQA 3B36A 1FPOA 3TZEA 3IMKA 2EBOA 2YZNA 4LX0A 2P2LA 1ZH4A 3FOWA 3BCSA 4IDAA 4ZT6A 3FLEA 4ES6A 3VIUA 3JQFA 2NSHA 1S4MA 2FPOA 2RKWA 1I3KA 1G8FA 2PO5A 3N0XA 4Q7EA 1YJXA 1QVWA 3LPNA 4LFAB 1DL5A 4HZUB 1DT9A 2X23A 3KT6A 2HTEA 3CBGA 2G17A 1QYVA 4C1NA 3CLRC 3ND8A 2V7QG 1KAHA 4BN4A 3W3AD 3WYFA 4CWAA 2XAAA 4H7IA 3ZUPA 1P49A 4M6WB 2WMDA 2Z8XA 1A97A 4EUKA 4HATA 1RXUA 4QGHA 1E6WA 1R0YA 1REQB 1T9GS 4HYYA 3P9XA 3C1UA 5L51A 3JZMA 4C4WC 4LXIA 2WRZA 5FWDA 3M82A 3CYQA 1RZRD 3A1NA 2XVAA 3CE2A 3EVGA 2PGDA 5LN1A 4YRBA 2H2AA 3WFIA 2JGIA 2YWEA 4PX9A 3VZDA 4AY4A 5ARDA 4COKA 4M1TA 1UBGA 4EG5A 5I7SA 1RWKA 4K6CA 1K8ZB 3ITKA 3FFXA 1D2HA 1OKKA 3S3WA 3BERA 2R4UA 2IPAB 1ORWA 5E38A 1MOZA 5KJFA 2VO1A 4MVJM 5E3IA 3I56V 1NVGA 3STUA 4GOKA 4YXWD 2FXVA 1S9DA 2QZSA 3CB2A 1R8SA 2HUPA 4OEHA 2LVBA 5EJMA 2VF4X 3T0GA 4F5ZA 1RC0A 1YULA 4LOAA 1ATIA 2P06A 2PKQP 2EJTA 4JLAA 3BMCB 2OBXA 3FYCA 1JLMA 1QIEA 1E5TA 4DQ0A 3M7MX 5SICE 2GFHA 4AQYB 3WGQA 4R1NA 3UMCA 2MOKA 3UKDA 4F91B 2YC2C 4D1YA 2ZG6A 3ELDA 3P97A 1E2HA 4RLSA 3PC2A 1RM4A 3EUAA 2WU4A 3PPYA 2O1XA 5AJWA 4X20A 4KWTA 1J8YF 3B6KA 2Q0HA 3BIWA 4F38A 3PQ4A 4I9FA 4BVJA 4LW8A 3R9IA 3KHSA 2QTVB 2WWIA 4CBCA 2GA8A 3ICEA 4CJXA 3K0CA 1L1QA 4E08A 1HE8B 2X2EA 5FADA 1IY1A 2HWYA 5DM4A 3TD9A 3TR6A 4B3BA 3E18A 4C7KA 4UVBA 2ODEA 2HPZA 1VL6A 1DOHA 1KH2A 3K2IA 1F2TB 1YMVA 2PFKA 1FQOA 3V34A 2WICA 4FIPC 4OUDA 3WGOA 3ONWA 3E1GA 2BKVA 3NKFA 1PDOA 5IARA 1JDTA 2ZRDA 3G71V 1DT3A 3FX2A 3GRAA 5F1OA 3BK2A 1T0AA 2PLRA 4ETWA 1TOAA 4NIMA 2AMFA 2AZXA 2ZE8A 2OD2A 4DLNA 1J6UA 2FZGA 3CNEA 1KUQA 3MJHA 1E1MA 3ZJ5A 3AJDA 3W78A 4F7DA 1ECCA 2D5LA 1L4YA 3OPYB 4WPGA 1QOZA 4EKWA 2XYRA 1IUOA 4B4WA 1PDWA 1ULZA 5A3VA 4L8VA 3VKWA 2RNBA 1ZEJA 2E21A 1GPWB 3EVBA 3CRCA 1M2HA 4D4IA 2POQX 4DW0A 1CJVC 3OQIB 2AN3A 1UXIA 4A15A 4KH1A 3KQLA 4F6LA 5K20A 4B31A 1PNOA 3BSSA 3T7EA 1KMMA 3H4MA 1ATZA 2QXTA 3ZQKA 5CLIA 4JLNA 4XVRA 3BH0A 2DQKA 3TUJC 1E3SA 3OUZA 1AOXA 4CF7A 3IAFA 1EP3B 4TWIA 2Y4NA 2FSPA 1NXVA 2Y05A 2N46A 3K96A 1HETA 4L2IB 1OTHA 3MW8A 2A88A 4FZJA 2XD4A 2E6UX 2QVZX 1AF7A 2BI8A 2DUUA 2EP5A 5CFQA 1O77A 5CCBA 3PGMA 1ZITA 3U48A 3DONA 3IJPA 1LX6A 3QXSA 1G41A 4BVRA 1VP7A 3U3ZA 3ESQA 3WQHA 1ZOLA 3AR4A 2V9ZA 2E4ZA 1FQKA 1OBVA 2QR3A 4YJDA 2EHJA 2WF8A 4H15A 3OGCC 4CL3A 4P2ZA 2FE4A 1DC8A 2PGLA 4P3XA 4BIZA 2GM3A 1GGHA 5A4DA 1R0CA 3LDAA 1KZGB 4LC1A 1ZLYA 2A1UB 2PN1A 2GZ2A 4WLEA 3UXHA 2GSMB 5MDHA 5BQFA 4UTNA 3V1TC 5B1YA 2FA9A 2IPLA 5GV8A 1F4PA 1SG6A 5G4UC 4MAAA 3GA7A 4KN8A 2WTMA 2O8BB 3NIWA 4D5EA 4WD3A 1HRKA 3QE2A 3IEQA 1KEWA 2IEDA 1C14A 4RA9A 3QNWA 3LT0A 1BVYF 2OB1A 2F43B 2GHIA 1L4KA 4UD2A 5IZCC 3UT5A 2I2XB 1UCFA 2FMXA 3AXSA 2X9NA 1HNWB 2JAHA 5DFAA 3ZH9B 1OI2A 2JFHA 3IPXA 4BAUA 5L3QB 1G4UR 3CC4V 1EX6A 4NXNB 5HY4A 3HB0A 1KAMA 3AP2A 1EFCA 1ORIA 5FV7A 3CQ9A 5BV2P 2P9ZA 5K99A 5FTKA 5HILA 1VLMA 4TTVA 4NCBA 3F7OA 4HAOA 3PWSA 1RQGA 3UAWA 4QJ5A 3DZKA 4CG1A 3CMAV 3N2IA 4QGBA 2W2KB 4JENA 1Q86H 1TPYA 1SJ9A 3TTWA 2AX4A 3DMFA 2OKGA 4IXWA 5B30A 3LDEA 2XUAA 3AHGA 3GGCA 1ODCA 3EGVA 5ULLA 2OWOA 2DN9A 4DYVA 1QE0A 3VPCA 1X19A 3ZY3A 4CCYA 3BORA 5E7JA 1YE5A 5LWHA 3UMSA 1IZ0A 1JU9A 5IZ4A 5JDIA 2XSZA 1E5DA 1DS6A 3JU3A 4MNTA 2QYSA 3NHBA 8ABPA 4XLTA 1BJTA 4ZU6X 2IPXA 4IQGA 2FN4A 4O3MA 2QKSA 1OX4A 1CZKA 1HE4A 1SD5A 2AD1A 3WNVA 1H0RA 1KBOA 1VE1A 1RHRA 1AQUA 1YZKA 4E09A 1S0VA 4B8WA 4LNHA 2Q3LA 4UVGA 1E6MA 3A9RA 4MHSA 3ZLTA 4CNBA 2HU5A 1T13A 2CKMA 1C4WA 2QN1A 1NF9A 2G25A 4KG7A 2BEUB 2GEVA 4QPJC 3GRPA 4KNYA 3Q9UA 2X0FA 3AWDA 2JGFA 3EZYA 4WKOA 2CH7A 1WBDA 4C08A 4OI2A 3QU9A 2OYCA 3OM1A 2P4VA 3LSSA 4GP6A 2FFRA 4OQPA 3Q10A 4DQUA 2DWQA 4RTSA 1SRYA 4YXWG 2YJ5A 4J2HA 4F46A 4EA6A 4AX4A 3O8CA 1VQ4V 3ANXA 2WMYA 2O2XA 3WLHA 1P6UA 5CB4F 5TMDA 4EWLA 1BDJA 4K9NA 4K3UA 2P9JA 1Y8RA 2X0JA 2AOUA 3LYUA 4OI0A 2DLCX 1TZKA 1XD9A 2J7PD 3CR3C 4NYMQ 4BTEA 1J49A 2OORA 1NBMD 2ZTLA 4LCUC 3BD8A 3VQXA 4LJ7A 5CMUA 2FSIA 4JP2A 1TZCA 3LNCA 3G49A 1VK3A 5AW2A 3Q3CA 3K06A 2WIFA 2WWVD 5KJEA 4DMRA 3NWJA 3UZUA 3ELWA 1RWVA 2DM6A 2V1DA 5CA1F 3T5BA 2WLNA 3PTZA 3G7NA 1T9CA 3DMDA 1YQWA 5JSHA 2PT5A 4W9MC 2Z5VA 1JPVA 3ASOC 4TTPA 5KQSA 3RAEC 3PC7A 4BNNA 1KO4A 5B53A 2OUIA 3HR0A 1NVFA 5F1YA 5A06A 2FPWA 2L82A 1P1FA 1FYJA 1DI0A 2YFQA 3I5DA 2RGXA 1VJCA 5K0CA 5KTKA 4MB2A 3KSRA 4PZUA 4UHFA 1CE8B 5J2UB 4FFLA 4OA8A 4L6IA 1NTZH 1QG4A 1P1BA 1YTLA 3IHLA 3L0IB 4YIKA 4KGXA 2QRLA 5E4YA 2Z3ZA 3KHTA 4BKUA 4L95C 1X8JA 5KU1A 5B1NA 3P9ZA 5F76A 3GVHA 4RQTA 2ZSAA 3SXPA 2ETNA 4RMJA 3G1WA 3UMVA 4WBSA 3B78A 3BHMA 1WY7A 1XQ6A 3CGWA 2YKGA 1IN6A 4R6WA 1Z6QA 3OM8A 3KV1A 1NU1H 1ZUNB 1WPQA 5E95A 3FLMA 4DBVO 1BS9A 3D3EA 3KAPA 4ZXFA 5DVZA 1XVVA 4CDGA 4GEKA 4J1SA 4TKVB 3OCYA 2I8CA 2ITCC 4CF6A 3LHFA 3RVMA 4TYMA 2Z83A 1VJGA 1P9WA 3DDUA 1T6NA 2CY0A 4J0IA 4M9QA 3GRZA 1V7CA 1TPZA 3TETA 2DWDC 3Q0EA 4HHEA 5ALPA 1HLGA 4IDPA 1XDUA 3HZOA 2ZZMA 4LJ6A 1V48A 2V3WA 2XZDA 3HS3A 3EQ2A 4GW3A 3RJTA 4DYDA 2GN1A 3OE4A 3GZ4A 4FNOA 3MSXA 3DVQX 1GGNA 3EXFA 4XM1A 1OV4A 3ZZ0A 1Z2PX 4LRYA 4B0OA 1PP4A 3OPYI 1BXGA 3URKA 2IL1A 5K4AA 5IBQA 4Y8VA 3G6EF 3B7WA 4I1IA 1VB5A 3GCGA 1EM6A 4EL0A 2BDEA 3ZK7A 1QV9A 3N2NA 5DNWA 3IAM6 2DPHA 5J2TF 1WXIA 4L4YA 3K9CA 3S4YA 1UKEA 3PNPA 3Q15C 4F21A 3TNJA 4RHUA 3SICE 3SEFA 4LF4O 2PJUA 2EL7A 1RQLA 2BOVA 5DDIP 1C3XA 2ADMA 4Z9FA 5GZ3A 4FMTA 1L5YA 5HJ7A 4AN4A 2NXCA 1CB0A 1XJWA 2YWCA 4DLPA 4Q16A 1Z5PA 3LWNA 4EYEA 3E9QA 3MB5A 1H2KA 3DTTA 3MJSA 1YRWA 1WHSA 3FVVA 2R7AA 3KDSE 2WOJA 2O2IA 2C4KA 2GX6A 4DXAA 3PC3A 1U0RA 2ZYSA 1JIIA 1RQ2A 2HLPA 2W6NA 1YRYE 1U9IC 4I9GA 4PU0A 3E5RA 4PZLA 1ZH6A