3NVIB

Structure of n-terminal truncated nop56/58 bound with l7ae and box c/d rna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOP5/NOP56 related protein
molecule tags Transferase/rna
source organism Pyrococcus furiosus
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
total genus 35
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nviB00
2BO1A 3LWQC 1VQ8F 3RA6A 5DCVA 3CPQA 1GO1A 2KG4A 1YIJF 3OBWA 1GZ0A 5GANK 3CCRF 2OHWA 3JAMM 3JCMM 3V7QA 5GIPC 1K8AH 1YITF 3HAXD 3WXMB 1M90H 3AGKA 2VGMA 3SIUA 4TZZA 3LFOA 2OTLF 1X7PA 1RA4A 3VI6A 3V7EA 3LWOC 5EWRA 2LBWA 1X52A 4C4WC 1K73H 1VQKF 3O85A 3CCSF 3E20B 3G4SF 1W3EX 3CG6A 3I56F 1YI2F 3CCQF 3CD6F 1VQMF 3NK6A 3HJWC 2ALEA 2LBXA 3PAFA 5FLXM 2KTUA 4X3LA 1VQ5F 1H7MA 1N8RH 3CCVF 2FC3A 1VQ6F 3NVIB 3FFMA 3I55F 4LCKA 2OTJF 1Q86H 3LWVC 5FJ4C 3J7AR 2QA4F 1CN7A 5GAPK 2VGNA 3N4YA 3VMFB 1VQNF 3GYQA 3CCMF 1YJNF 1RLGA 5GIOC 2JNBA 1E7KA 1YHQF 3OW2F 3CXCF 3CC2F 3CC4F 3CCUF 1W41A 1M1KH 1K9MH 1NMUB 1Q7YH 1XBIA 4X3MA 1VQ7F 1CK2A 1DT9A 1VQ4F 4BY9D 3J80M 1Q81H 1QVGF 3G71F 1SDSA 3CCLF 1W2BF 3E1YA 1Q82H 2QI2A 1T0KB 3MCAB 1KQSF 1KD1H 3ON1A 3G6EF 1GO0A 3NMUC 2HVYD 3RA5A 1YJ9F 5G4VC 1X7OA 3OBYA 1JJ2F 1W42A 3CC7F 3CCJF 2AIFA 1VQ9F 5GINC 2OZBA 2I6DA 1ZWZA 4BW0B 3NVKE 3CCEF 1KC8H 1VQOF 5IT9M 2CZWA 3CMAF 3CPWF 3J81M 3IR9A 5EO3A 1VQLF 1YJWF 1QVFF 1PXWA 2WALA 3PLAC 1IPAA 3N4ZA 1VQPF 3NK7A 1S72F 3SIVA 3LWPC 5G4UC 3LWRC 5A2QM 2KTVA 1NJIH 2QEXF 4NUTA 1W40A 3CMEF
chains in the Genus database with same CATH superfamily
1FSZA 5KMGB 4X1KB 5LA6B 2BTOA 3OBWA 5CA1A 5JH7B 2OHWA 1W5FA 3JAMM 4I50B 5HY0A 3C9RA 3RYIB 4EB6B 2IG8A 3WXMB 1M90H 4B5CA 2HP0A 5AVMA 1XRGA 3HKEA 1XV2A 2OTLF 3IEQA 3VI6A 5JVDA 4I50A 2LBWA 5IYZA 3O85A 3CG6A 3VYUC 3I56F 2ZF8A 3CCQF 3LMEA 4WBNA 2Z1FA 3VOBA 3D00A 2ALEA 4O2AA 3PAFA 2KTUA 2UYJA 1VHAA 1W5EA 2H8CA 1UI9A 3I55F 3DC2A 4F6RA 1RLUA 4BVSA 1CN7A 4BT2A 3BYQA 3VTIC 2ZOVA 1VQNF 4BT7A 4I55B 1YJNF 1RLGA 2JNBA 3C9UA 2CHTA 3CC4F 4XCQA 3M1XA 4IHJB 3JATB 3FBAA 3FD6A 1XHOA 5JH7A 1DBFA 4R40B 3J80M 2PMPA 4X1YB 1OFUA 4LNUA 3IEWA 2HVYD 2CWJA 4O4JB 5HY1A 5EYPB 1JJ2F 2IAFA 3F6MA 3N2KB 5HY4A 3WJPA 3CCEF 5LP6A 1W55A 3S0HA 2LBTA 4TUYA 2CZWA 4PWTA 3CMAF 3S0YA 3IMPA 1JFFA 1IV2A 3RYCA 4O2BA 4C81A 3WGJA 1QVFF 1PXWA 3CYPB 3N2KA 2WALA 1ONIA 3N4ZA 4C8GA 3DDNA 2CW4A 5KX5A 4G4XA 3SIVA 5C8YB 4ZI7A 1CLIA 5EZYA 5G4UC 3VO8A 4FFBB 3WJQA 5HY2A 1YJ9F 2UZHA 4HNAA 2BO1A 3MDOA 2UYNA 3LYBA 5MN5A 1VQ8F 3V4DA 1QU9A 2HS4A 1YIJF 1GZ0A 2F9ZC 5KX5B 4ZOLB 5C8YA 2UYPA 3MBMA 4BT4A 3MQWA 4FFBA 1SA0A 5FNVB 1YITF 5J2TA 4B46A 5IJ0A 3HAXD 4X1YA 2UYNB 1Z5VA 4I4TB 4LNUB 4YJ3B 4TZZA 4BVRA 5IJ9B 2FGYA 3LFOA 3N2GA 1X7PA 4O4JA 3K12A 4ZOLA 5EYPA 3V7EA 1PF5A 3RYHA 4O4HA 4DXDA 3RE3A 1U40A 5EB1B 3HKCA 1W3EX 4U3JB 2Z1EA 5LOVA 3NK6A 4TUYB 3HJWC 2AMTA 3M84A 5FLXM 2VAPA 3JAWB 4X3LA 1VQ5F 3VIUA 1JY8A 3KJJA 2FC3A 3RYFA 1T0AA 3KE1A 2GZLA 3HKCB 4IIJB 1W5BA 3JARB 3J7AR 2Z01A 3HKDA 5JQGB 4DRXB 2VGNA 4ZI7B 3FD5A 2CHSA 1JN1A 3IKFA 4RHAA 3JALA 2KGWA 3RYFB 3CC2F 3CCUF 4TV9B 1Q7YH 1XBIA 2ZODA 1VQ7F 1CK2A 2Q1YA 2G9IA 3EORA 3I7TA 1Q81H 5J2UB 5CB4A 3G71F 5JCOC 1OAPA 3CCLF 3JALB 5MN6A 3E1YA 3WJRA 4I4TA 1IV4A 3G6EF 5HP7A 2W8BC 2PHNA 4G4ZA 5G4VC 3I3FA 3GHZA 2CSLA 3CC7F 4G4WA 1COMA 4TV8B 2OZBA 2I6DA 1ZWZA 3F0DA 5EIBD 3NVKE 1W57A 5CA0A 1KC8H 5EIBC 4X20B 3WGKA 5B8FA 2RHLA 2HP0B 3J81M 3HKEB 3HTNA 4O4IA 1QD9A 1Z5WA 5BMVA 3UT5B 2Z1TA 3C8LA 3PLAC 1IV3A 3D01A 1VQPF 1ODEA 4C82A 2GVIA 3LWPC 2MQEA 4X20A 3WGLA 4ZHWA 3S03A 1YQNA 3WGMA 2BTQB 3S02A 4G88A 2DT4A 2YXZA 5CA1B 3RA6A 5DCVA 5EZYB 4BVTA 2KG4A 3LDTA 2RHOA 5KMGA 4EB6A 5GANK 3CCRF 3K0TA 4YJ2B 3F0GA 3JCMM 4F6RB 2B33A 3V7QA 5GIPC 5GONA 3QUWA 3AGKA 2VGMA 3TD4A 1YGYA 3WPXA 2HRUA 3P0ZA 4YJ2A 1W59A 5EWRA 3JATA 1X52A 1FNKA 4WBNB 3CCSF 4TV8A 3G4SF 2GLZA 5IYZB 1YI2F 3FPIA 3TD3A 2HRYA 4X1IB 2LBXA 2AIZP 3VOAA 3GTZA 4EI8A 2HX0A 1N8RH 2VAWA 2HP3A 4BT5A 3FFMA 1VQ6F 3R0PA 3Q8HA 4G4YA 1X25A 3RYIA 4KWEA 5GAPK 1VQVA 1RQ2A 3ZOPA 3C9TA 3N4YA 2K1SA 3VMFB 5LP6B 2QTPA 5EB0A 3CCMF 3D54A 5GIOC 1E7KA 1YHQF 1QAHA 1W41A 4G4VA 1K9MH 1M1KH 2RB9A 4RQOA 5HXZA 1NMUB 4O2BB 5LXTB 4O4LA 1TUBA 1DT9A 1SZQA 1VQ4F 3WPWA 2Q1XA 3E22B 4C8EA 4IHJA 4BY9D 1QVGF 2YYEA 4B62A 1SDSA 1W2BF 5ITZB 3ZP7A 1Q82H 2QI2A 1T0KB 3K2XA 4O2AB 2R751 1KD1H 4HNAB 1KQSF 3ON1A 3P10A 5HWEA 3RA5A 5LXTA 1X7OA 3OBYA 4O4LB 3JASB 1TUBB 1W42A 2CVLA 3E22A 4ERHA 3CCJF 2AIFA 1H47A 1VQ9F 1U43A 3M4SA 5ITZA 4BW0B 1SA0B 4C8IA 2H8EA 5J2TB 4I55A 1JFFB 3CPWF 4X1IA 2L26A 2DYYA 1NQ3A 3V3TA 3IR9A 3N2GB 5EAZA 5EO3A 1FFXB 1R1MA 1UFYA 2HQSC 1IPAA 2N48A 3RYHB 3RYCB 1KNKA 3NK7A 3L7QA 1S72F 2OTMA 3TD5A 3LWRC 3ZP4A 1NJIH 2QEXF 5MN4A 1W40A 5LOVB 2HS3A 2ZVZA 3LWQC 1TVKB 3IKEA 1FFXA 5LP6C 2VXYA 3HKBA 3CPQA 3CB2A 4BT3A 1GO1A 5FNVA 1H48A 1FNJA 3ELCA 1K8AH 3HKDB 4E6EA 3B6NA 4DRXA 3F0FA 1J7HA 1RQ7A 1W581 2H6LA 3SIUA 2R6R1 3VYTC 3WGNA 4O4HB 3QHDA 1IV1A 1RA4A 1U3PA 3LWOC 3JASA 4YJ3A 5IJ9A 3OONA 4C4WC 4U3JA 1K73H 1VQKF 1U3LA 3E20B 3K14A 4ZK7A 5CB4B 5J2UA 3CD6F 2Z1UA 1VQMF 2IQQA 2LCAA 3T80A 3U0OA 2BTUA 3KHNA 1H7MA 3CCVF 3P4EA 5JQGA 3NVIB 4LCKA 4NWOB 3KIZA 2OTJF 3JAWA 1Q86H 3LWVC 5FJ4C 3S06A 2QA4F 3ERNA 5IJ0B 2I6RA 4ZHQB 3JAKA 5LYJA 3GYQA 3JARA 2V9YA 2EWCA 2ZAUA 5HXUA 4M8IA 2VAMA 3OW2F 3CXCF 3MCQA 3QTYA 1TVKA 4BVQA 3VYSC 4ZHYB 5BMVB 3HKBB 3UT5A 4X3MA 1VK3A 3JAKB 2P6YA 1JD1A 5HP8A 3CYQA 3JVHA 3MCAB 3F0EA 1GO0A 3NMUC 1GX1A 1Q8RA 3ESJA 5JVDB 1W5AA 2ZVYA 4IIJA 3KJKA 5JCOA 5CA0B 2HS0A 4BT6A 5GINC 1KNJA 2UYKA 5GONB 3HWUA 1VQOF 4O4IB 5IT9M 4EI9A 1VH8A 4TV9A 3C9SA 2RHHA 2RHJA 4B45A 1VQLF 1YJWF 4X1KA 5LA6A 4NQ3A 3ZO8A 3VCZA 4ZHQA 4ZHVA 4EI7A 5A2QM 2KTVA 4U39A 3S0WA 5LYJB 4NUTA 2NMUA 3CMEF
chains in the Genus database with same CATH topology
2BO1A 3LWQC 1VQ8F 3RA6A 5DCVA 3CPQA 4BVTA 1GO1A 2KG4A 1YIJF 3OBWA 1GZ0A 5GANK 2F9ZC 3CCRF 2OHWA 3JAMM 5HY0A 3JCMM 3V7QA 5GIPC 1K8AH 1YITF 3HAXD 3WXMB 1M90H 3AGKA 2VGMA 3SIUA 4TZZA 4BVRA 2FGYA 3LFOA 2OTLF 1X7PA 1RA4A 3VI6A 3V7EA 3LWOC 5EWRA 2LBWA 1X52A 4C4WC 1K73H 1VQKF 3O85A 3CCSF 3E20B 3G4SF 1W3EX 3CG6A 2GLZA 3I56F 1YI2F 3CCQF 3CD6F 1VQMF 3NK6A 3HJWC 3D00A 2ALEA 2LBXA 3PAFA 5FLXM 2KTUA 4X3LA 4EI8A 1VQ5F 1H7MA 1N8RH 3CCVF 2FC3A 1VQ6F 3NVIB 3FFMA 3I55F 4LCKA 2OTJF 1Q86H 3LWVC 5FJ4C 3J7AR 2QA4F 4BVSA 1CN7A 5GAPK 2VGNA 3N4YA 3VMFB 1VQNF 3GYQA 3CCMF 1YJNF 1RLGA 2JNBA 5HXUA 5GIOC 1E7KA 1YHQF 3OW2F 3CXCF 3CC2F 4BVQA 3CC4F 3CCUF 4XCQA 1W41A 1M1KH 1K9MH 5HXZA 1NMUB 1Q7YH 1XBIA 4X3MA 1VQ7F 1CK2A 1DT9A 1VQ4F 4BY9D 3J80M 1Q81H 1QVGF 3G71F 1SDSA 3CCLF 1W2BF 3E1YA 1Q82H 2QI2A 1T0KB 3MCAB 1KQSF 1KD1H 3ON1A 3G6EF 1GO0A 3NMUC 5HWEA 2HVYD 3RA5A 1YJ9F 5HY1A 5G4VC 1X7OA 3OBYA 1JJ2F 1W42A 3CC7F 3CCJF 2AIFA 1VQ9F 5GINC 2OZBA 2I6DA 1ZWZA 5HY4A 4BW0B 3NVKE 3CCEF 1KC8H 1VQOF 5IT9M 2CZWA 3CMAF 3CPWF 4EI9A 3J81M 3V3TA 3IR9A 5EO3A 1VQLF 1YJWF 4NQ3A 1QVFF 1PXWA 2WALA 3PLAC 1IPAA 3N4ZA 1VQPF 3NK7A 1S72F 3SIVA 3LWPC 5G4UC 3LWRC 5A2QM 4EI7A 2KTVA 1NJIH 5HY2A 4NUTA 2QEXF 1W40A 3CMEF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO1 A;  3LWQ C;  1VQ8 F;  3RA6 A;  5DCV A;  3CPQ A;  1GO1 A;  2KG4 A;  1YIJ F;  3OBW A;  1GZ0 A;  5GAN K;  3CCR F;  2OHW A;  3JAM M;  3JCM M;  3V7Q A;  5GIP C;  1K8A H;  1YIT F;  3HAX D;  3WXM B;  1M90 H;  3AGK A;  2VGM A;  3SIU A;  4TZZ A;  3LFO A;  2OTL F;  1X7P A;  1RA4 A;  3VI6 A;  3V7E A;  3LWO C;  5EWR A;  2LBW A;  1X52 A;  4C4W C;  1K73 H;  1VQK F;  3O85 A;  3CCS F;  3E20 B;  3G4S F;  1W3E X;  3CG6 A;  3I56 F;  1YI2 F;  3CCQ F;  3CD6 F;  1VQM F;  3NK6 A;  3HJW C;  2ALE A;  2LBX A;  3PAF A;  5FLX M;  2KTU A;  4X3L A;  1VQ5 F;  1H7M A;  1N8R H;  3CCV F;  2FC3 A;  1VQ6 F;  3NVI B;  3FFM A;  3I55 F;  4LCK A;  2OTJ F;  1Q86 H;  3LWV C;  5FJ4 C;  3J7A R;  2QA4 F;  1CN7 A;  5GAP K;  2VGN A;  3N4Y A;  3VMF B;  1VQN F;  3GYQ A;  3CCM F;  1YJN F;  1RLG A;  5GIO C;  2JNB A;  1E7K A;  1YHQ F;  3OW2 F;  3CXC F;  3CC2 F;  3CC4 F;  3CCU F;  1W41 A;  1M1K H;  1K9M H;  1NMU B;  1Q7Y H;  1XBI A;  4X3M A;  1VQ7 F;  1CK2 A;  1DT9 A;  1VQ4 F;  4BY9 D;  3J80 M;  1Q81 H;  1QVG F;  3G71 F;  1SDS A;  3CCL F;  1W2B F;  3E1Y A;  1Q82 H;  2QI2 A;  1T0K B;  3MCA B;  1KQS F;  1KD1 H;  3ON1 A;  3G6E F;  1GO0 A;  3NMU C;  2HVY D;  3RA5 A;  1YJ9 F;  5G4V C;  1X7O A;  3OBY A;  1JJ2 F;  1W42 A;  3CC7 F;  3CCJ F;  2AIF A;  1VQ9 F;  5GIN C;  2OZB A;  2I6D A;  1ZWZ A;  4BW0 B;  3NVK E;  3CCE F;  1KC8 H;  1VQO F;  5IT9 M;  2CZW A;  3CMA F;  3CPW F;  3J81 M;  3IR9 A;  5EO3 A;  1VQL F;  1YJW F;  1QVF F;  1PXW A;  2WAL A;  3PLA C;  1IPA A;  3N4Z A;  1VQP F;  3NK7 A;  1S72 F;  3SIV A;  3LWP C;  5G4U C;  3LWR C;  5A2Q M;  2KTV A;  1NJI H;  2QEX F;  4NUT A;  1W40 A;  3CME F; 
#chains in the Genus database with same CATH topology
 1FSZ A;  5KMG B;  4X1K B;  5LA6 B;  2BTO A;  3OBW A;  5CA1 A;  5JH7 B;  2OHW A;  1W5F A;  3JAM M;  4I50 B;  5HY0 A;  3C9R A;  3RYI B;  4EB6 B;  2IG8 A;  3WXM B;  1M90 H;  4B5C A;  2HP0 A;  5AVM A;  1XRG A;  3HKE A;  1XV2 A;  2OTL F;  3IEQ A;  3VI6 A;  5JVD A;  4I50 A;  2LBW A;  5IYZ A;  3O85 A;  3CG6 A;  3VYU C;  3I56 F;  2ZF8 A;  3CCQ F;  3LME A;  4WBN A;  2Z1F A;  3VOB A;  3D00 A;  2ALE A;  4O2A A;  3PAF A;  2KTU A;  2UYJ A;  1VHA A;  1W5E A;  2H8C A;  1UI9 A;  3I55 F;  3DC2 A;  4F6R A;  1RLU A;  4BVS A;  1CN7 A;  4BT2 A;  3BYQ A;  3VTI C;  2ZOV A;  1VQN F;  4BT7 A;  4I55 B;  1YJN F;  1RLG A;  2JNB A;  3C9U A;  2CHT A;  3CC4 F;  4XCQ A;  3M1X A;  4IHJ B;  3JAT B;  3FBA A;  3FD6 A;  1XHO A;  5JH7 A;  1DBF A;  4R40 B;  3J80 M;  2PMP A;  4X1Y B;  1OFU A;  4LNU A;  3IEW A;  2HVY D;  2CWJ A;  4O4J B;  5HY1 A;  5EYP B;  1JJ2 F;  2IAF A;  3F6M A;  3N2K B;  5HY4 A;  3WJP A;  3CCE F;  5LP6 A;  1W55 A;  3S0H A;  2LBT A;  4TUY A;  2CZW A;  4PWT A;  3CMA F;  3S0Y A;  3IMP A;  1JFF A;  1IV2 A;  3RYC A;  4O2B A;  4C81 A;  3WGJ A;  1QVF F;  1PXW A;  3CYP B;  3N2K A;  2WAL A;  1ONI A;  3N4Z A;  4C8G A;  3DDN A;  2CW4 A;  5KX5 A;  4G4X A;  3SIV A;  5C8Y B;  4ZI7 A;  1CLI A;  5EZY A;  5G4U C;  3VO8 A;  4FFB B;  3WJQ A;  5HY2 A;  1YJ9 F;  2UZH A;  4HNA A;  2BO1 A;  3MDO A;  2UYN A;  3LYB A;  5MN5 A;  1VQ8 F;  3V4D A;  1QU9 A;  2HS4 A;  1YIJ F;  1GZ0 A;  2F9Z C;  5KX5 B;  4ZOL B;  5C8Y A;  2UYP A;  3MBM A;  4BT4 A;  3MQW A;  4FFB A;  1SA0 A;  5FNV B;  1YIT F;  5J2T A;  4B46 A;  5IJ0 A;  3HAX D;  4X1Y A;  2UYN B;  1Z5V A;  4I4T B;  4LNU B;  4YJ3 B;  4TZZ A;  4BVR A;  5IJ9 B;  2FGY A;  3LFO A;  3N2G A;  1X7P A;  4O4J A;  3K12 A;  4ZOL A;  5EYP A;  3V7E A;  1PF5 A;  3RYH A;  4O4H A;  4DXD A;  3RE3 A;  1U40 A;  5EB1 B;  3HKC A;  1W3E X;  4U3J B;  2Z1E A;  5LOV A;  3NK6 A;  4TUY B;  3HJW C;  2AMT A;  3M84 A;  5FLX M;  2VAP A;  3JAW B;  4X3L A;  1VQ5 F;  3VIU A;  1JY8 A;  3KJJ A;  2FC3 A;  3RYF A;  1T0A A;  3KE1 A;  2GZL A;  3HKC B;  4IIJ B;  1W5B A;  3JAR B;  3J7A R;  2Z01 A;  3HKD A;  5JQG B;  4DRX B;  2VGN A;  4ZI7 B;  3FD5 A;  2CHS A;  1JN1 A;  3IKF A;  4RHA A;  3JAL A;  2KGW A;  3RYF B;  3CC2 F;  3CCU F;  4TV9 B;  1Q7Y H;  1XBI A;  2ZOD A;  1VQ7 F;  1CK2 A;  2Q1Y A;  2G9I A;  3EOR A;  3I7T A;  1Q81 H;  5J2U B;  5CB4 A;  3G71 F;  5JCO C;  1OAP A;  3CCL F;  3JAL B;  5MN6 A;  3E1Y A;  3WJR A;  4I4T A;  1IV4 A;  3G6E F;  5HP7 A;  2W8B C;  2PHN A;  4G4Z A;  5G4V C;  3I3F A;  3GHZ A;  2CSL A;  3CC7 F;  4G4W A;  1COM A;  4TV8 B;  2OZB A;  2I6D A;  1ZWZ A;  3F0D A;  5EIB D;  3NVK E;  1W57 A;  5CA0 A;  1KC8 H;  5EIB C;  4X20 B;  3WGK A;  5B8F A;  2RHL A;  2HP0 B;  3J81 M;  3HKE B;  3HTN A;  4O4I A;  1QD9 A;  1Z5W A;  5BMV A;  3UT5 B;  2Z1T A;  3C8L A;  3PLA C;  1IV3 A;  3D01 A;  1VQP F;  1ODE A;  4C82 A;  2GVI A;  3LWP C;  2MQE A;  4X20 A;  3WGL A;  4ZHW A;  3S03 A;  1YQN A;  3WGM A;  2BTQ B;  3S02 A;  4G88 A;  2DT4 A;  2YXZ A;  5CA1 B;  3RA6 A;  5DCV A;  5EZY B;  4BVT A;  2KG4 A;  3LDT A;  2RHO A;  5KMG A;  4EB6 A;  5GAN K;  3CCR F;  3K0T A;  4YJ2 B;  3F0G A;  3JCM M;  4F6R B;  2B33 A;  3V7Q A;  5GIP C;  5GON A;  3QUW A;  3AGK A;  2VGM A;  3TD4 A;  1YGY A;  3WPX A;  2HRU A;  3P0Z A;  4YJ2 A;  1W59 A;  5EWR A;  3JAT A;  1X52 A;  1FNK A;  4WBN B;  3CCS F;  4TV8 A;  3G4S F;  2GLZ A;  5IYZ B;  1YI2 F;  3FPI A;  3TD3 A;  2HRY A;  4X1I B;  2LBX A;  2AIZ P;  3VOA A;  3GTZ A;  4EI8 A;  2HX0 A;  1N8R H;  2VAW A;  2HP3 A;  4BT5 A;  3FFM A;  1VQ6 F;  3R0P A;  3Q8H A;  4G4Y A;  1X25 A;  3RYI A;  4KWE A;  5GAP K;  1VQV A;  1RQ2 A;  3ZOP A;  3C9T A;  3N4Y A;  2K1S A;  3VMF B;  5LP6 B;  2QTP A;  5EB0 A;  3CCM F;  3D54 A;  5GIO C;  1E7K A;  1YHQ F;  1QAH A;  1W41 A;  4G4V A;  1K9M H;  1M1K H;  2RB9 A;  4RQO A;  5HXZ A;  1NMU B;  4O2B B;  5LXT B;  4O4L A;  1TUB A;  1DT9 A;  1SZQ A;  1VQ4 F;  3WPW A;  2Q1X A;  3E22 B;  4C8E A;  4IHJ A;  4BY9 D;  1QVG F;  2YYE A;  4B62 A;  1SDS A;  1W2B F;  5ITZ B;  3ZP7 A;  1Q82 H;  2QI2 A;  1T0K B;  3K2X A;  4O2A B;  2R75 1;  1KD1 H;  4HNA B;  1KQS F;  3ON1 A;  3P10 A;  5HWE A;  3RA5 A;  5LXT A;  1X7O A;  3OBY A;  4O4L B;  3JAS B;  1TUB B;  1W42 A;  2CVL A;  3E22 A;  4ERH A;  3CCJ F;  2AIF A;  1H47 A;  1VQ9 F;  1U43 A;  3M4S A;  5ITZ A;  4BW0 B;  1SA0 B;  4C8I A;  2H8E A;  5J2T B;  4I55 A;  1JFF B;  3CPW F;  4X1I A;  2L26 A;  2DYY A;  1NQ3 A;  3V3T A;  3IR9 A;  3N2G B;  5EAZ A;  5EO3 A;  1FFX B;  1R1M A;  1UFY A;  2HQS C;  1IPA A;  2N48 A;  3RYH B;  3RYC B;  1KNK A;  3NK7 A;  3L7Q A;  1S72 F;  2OTM A;  3TD5 A;  3LWR C;  3ZP4 A;  1NJI H;  2QEX F;  5MN4 A;  1W40 A;  5LOV B;  2HS3 A;  2ZVZ A;  3LWQ C;  1TVK B;  3IKE A;  1FFX A;  5LP6 C;  2VXY A;  3HKB A;  3CPQ A;  3CB2 A;  4BT3 A;  1GO1 A;  5FNV A;  1H48 A;  1FNJ A;  3ELC A;  1K8A H;  3HKD B;  4E6E A;  3B6N A;  4DRX A;  3F0F A;  1J7H A;  1RQ7 A;  1W58 1;  2H6L A;  3SIU A;  2R6R 1;  3VYT C;  3WGN A;  4O4H B;  3QHD A;  1IV1 A;  1RA4 A;  1U3P A;  3LWO C;  3JAS A;  4YJ3 A;  5IJ9 A;  3OON A;  4C4W C;  4U3J A;  1K73 H;  1VQK F;  1U3L A;  3E20 B;  3K14 A;  4ZK7 A;  5CB4 B;  5J2U A;  3CD6 F;  2Z1U A;  1VQM F;  2IQQ A;  2LCA A;  3T80 A;  3U0O A;  2BTU A;  3KHN A;  1H7M A;  3CCV F;  3P4E A;  5JQG A;  3NVI B;  4LCK A;  4NWO B;  3KIZ A;  2OTJ F;  3JAW A;  1Q86 H;  3LWV C;  5FJ4 C;  3S06 A;  2QA4 F;  3ERN A;  5IJ0 B;  2I6R A;  4ZHQ B;  3JAK A;  5LYJ A;  3GYQ A;  3JAR A;  2V9Y A;  2EWC A;  2ZAU A;  5HXU A;  4M8I A;  2VAM A;  3OW2 F;  3CXC F;  3MCQ A;  3QTY A;  1TVK A;  4BVQ A;  3VYS C;  4ZHY B;  5BMV B;  3HKB B;  3UT5 A;  4X3M A;  1VK3 A;  3JAK B;  2P6Y A;  1JD1 A;  5HP8 A;  3CYQ A;  3JVH A;  3MCA B;  3F0E A;  1GO0 A;  3NMU C;  1GX1 A;  1Q8R A;  3ESJ A;  5JVD B;  1W5A A;  2ZVY A;  4IIJ A;  3KJK A;  5JCO A;  5CA0 B;  2HS0 A;  4BT6 A;  5GIN C;  1KNJ A;  2UYK A;  5GON B;  3HWU A;  1VQO F;  4O4I B;  5IT9 M;  4EI9 A;  1VH8 A;  4TV9 A;  3C9S A;  2RHH A;  2RHJ A;  4B45 A;  1VQL F;  1YJW F;  4X1K A;  5LA6 A;  4NQ3 A;  3ZO8 A;  3VCZ A;  4ZHQ A;  4ZHV A;  4EI7 A;  5A2Q M;  2KTV A;  4U39 A;  3S0W A;  5LYJ B;  4NUT A;  2NMU A;  3CME F; 
#chains in the Genus database with same CATH homology
 2BO1 A;  3LWQ C;  1VQ8 F;  3RA6 A;  5DCV A;  3CPQ A;  4BVT A;  1GO1 A;  2KG4 A;  1YIJ F;  3OBW A;  1GZ0 A;  5GAN K;  2F9Z C;  3CCR F;  2OHW A;  3JAM M;  5HY0 A;  3JCM M;  3V7Q A;  5GIP C;  1K8A H;  1YIT F;  3HAX D;  3WXM B;  1M90 H;  3AGK A;  2VGM A;  3SIU A;  4TZZ A;  4BVR A;  2FGY A;  3LFO A;  2OTL F;  1X7P A;  1RA4 A;  3VI6 A;  3V7E A;  3LWO C;  5EWR A;  2LBW A;  1X52 A;  4C4W C;  1K73 H;  1VQK F;  3O85 A;  3CCS F;  3E20 B;  3G4S F;  1W3E X;  3CG6 A;  2GLZ A;  3I56 F;  1YI2 F;  3CCQ F;  3CD6 F;  1VQM F;  3NK6 A;  3HJW C;  3D00 A;  2ALE A;  2LBX A;  3PAF A;  5FLX M;  2KTU A;  4X3L A;  4EI8 A;  1VQ5 F;  1H7M A;  1N8R H;  3CCV F;  2FC3 A;  1VQ6 F;  3NVI B;  3FFM A;  3I55 F;  4LCK A;  2OTJ F;  1Q86 H;  3LWV C;  5FJ4 C;  3J7A R;  2QA4 F;  4BVS A;  1CN7 A;  5GAP K;  2VGN A;  3N4Y A;  3VMF B;  1VQN F;  3GYQ A;  3CCM F;  1YJN F;  1RLG A;  2JNB A;  5HXU A;  5GIO C;  1E7K A;  1YHQ F;  3OW2 F;  3CXC F;  3CC2 F;  4BVQ A;  3CC4 F;  3CCU F;  4XCQ A;  1W41 A;  1M1K H;  1K9M H;  5HXZ A;  1NMU B;  1Q7Y H;  1XBI A;  4X3M A;  1VQ7 F;  1CK2 A;  1DT9 A;  1VQ4 F;  4BY9 D;  3J80 M;  1Q81 H;  1QVG F;  3G71 F;  1SDS A;  3CCL F;  1W2B F;  3E1Y A;  1Q82 H;  2QI2 A;  1T0K B;  3MCA B;  1KQS F;  1KD1 H;  3ON1 A;  3G6E F;  1GO0 A;  3NMU C;  5HWE A;  2HVY D;  3RA5 A;  1YJ9 F;  5HY1 A;  5G4V C;  1X7O A;  3OBY A;  1JJ2 F;  1W42 A;  3CC7 F;  3CCJ F;  2AIF A;  1VQ9 F;  5GIN C;  2OZB A;  2I6D A;  1ZWZ A;  5HY4 A;  4BW0 B;  3NVK E;  3CCE F;  1KC8 H;  1VQO F;  5IT9 M;  2CZW A;  3CMA F;  3CPW F;  4EI9 A;  3J81 M;  3V3T A;  3IR9 A;  5EO3 A;  1VQL F;  1YJW F;  4NQ3 A;  1QVF F;  1PXW A;  2WAL A;  3PLA C;  1IPA A;  3N4Z A;  1VQP F;  3NK7 A;  1S72 F;  3SIV A;  3LWP C;  5G4U C;  3LWR C;  5A2Q M;  4EI7 A;  2KTV A;  1NJI H;  5HY2 A;  4NUT A;  2QEX F;  1W40 A;  3CME F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...