3NVIB

Structure of n-terminal truncated nop56/58 bound with l7ae and box c/d rna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
total genus 35
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nviB00
1W40A 1PXWA 3V7EA 1RA4A 1VQ4F 1CN7A 5G4UC 2KTVA 5GANK 1VQ9F 1Q7YH 1NJIH 2CZWA 2AIFA 3CC7F 3FFMA 4BW0B 3N4ZA 2BO1A 2ALEA 1M90H 3I56F 1YHQF 2OHWA 3CD6F 3CMAF 3WXMB 2QI2A 1YITF 5G4VC 1X7PA 4X3LA 3CCMF 3CCVF 5IT9M 3VI6A 3VMFB 3LWOC 1Q81H 1VQOF 3J80M 3SIUA 2VGNA 1W2BF 3SIVA 3CCQF 5DCVA 3CC4F 1VQMF 5EWRA 3GYQA 3PLAC 3NVIB 3G4SF 3OBYA 1Q86H 2OTLF 1ZWZA 3CXCF 3CPQA 2OTJF 3LWRC 5A2QM 1VQNF 2WALA 1S72F 1DT9A 3V7QA 1K8AH 1H7MA 1E7KA 1IPAA 1RLGA 1QVGF 2I6DA 3I55F 3HJWC 2QEXF 2HVYD 5EO3A 3E20B 1M1KH 1W41A 3J7AR 1KD1H 1VQKF 4NUTA 5FJ4C 3CG6A 1NMUB 3N4YA 1X52A 3LWVC 3JCMM 1CK2A 3LWQC 1KQSF 2VGMA 1W3EX 3OBWA 1SDSA 1JJ2F 3O85A 4C4WC 1YJWF 1N8RH 1QVFF 3J81M 3OW2F 3NK6A 1KC8H 2FC3A 1K9MH 3RA5A 3CCEF 3CCJF 4BY9D 2KTUA 4LCKA 2KG4A 1XBIA 1VQ5F 3G6EF 3LWPC 3ON1A 3CC2F 3NVKE 3RA6A 2LBWA 1VQ8F 5GIPC 5GAPK 1YIJF 1VQ6F 3NK7A 1W42A 2JNBA 3JAMM 1YI2F 3HAXD 3AGKA 3MCAB 2OZBA 2LBXA 3G71F 3LFOA 3CCRF 3CMEF 1K73H 1Q82H 4TZZA 5GIOC 1VQPF 1VQ7F 1VQLF 3NMUC 5GINC 1GZ0A 3CPWF 1X7OA 3PAFA 1GO0A 3E1YA 1YJ9F 3CCSF 4X3MA 2QA4F 3CCUF 1YJNF 1T0KB 1GO1A 3IR9A 5FLXM 3CCLF
chains in the Genus database with same CATH superfamily
4I50A 3JASB 4BT7A 3WPWA 1CN7A 2KTVA 3F0FA 2CZWA 4DRXA 3CC7F 3C9UA 2H8CA 3KJKA 1H47A 3HKBA 3C9TA 2GLZA 2HX0A 1FFXB 1PF5A 3WXMB 1YITF 4I4TB 2V9YA 4IIJA 2Q1XA 3HKCB 3C8LA 3FD5A 1VQOF 5EZYA 3SIUA 4M8IA 4ZHWA 3NVIB 3CXCF 1JN1A 3LWRC 3DC2A 2HQSC 4O4LA 4YJ2A 2WALA 1TVKB 2YXZA 3D00A 3V3TA 1NQ3A 3IMPA 2GZLA 5CB4B 1E7KA 1RLGA 3KJJA 3N2KA 1OAPA 3J7AR 4BVQA 4X1YB 3F6MA 2Z1TA 4NUTA 3IKEA 4IHJB 4B5CA 5ITZA 5HXUA 3JCMM 1CK2A 3JAWA 3E22B 3VYTC 3ERNA 1W3EX 5JQGB 1QU9A 5HY0A 1KNKA 3N2GB 2DYYA 1UI9A 3JVHA 3MDOA 4O4IA 2P6YA 3O85A 4YJ3B 5LOVB 1SZQA 4C4WC 1N8RH 4G4ZA 3RYFA 3JALB 3VIUA 5EYPB 4F6RA 3HKDB 1KC8H 2MQEA 3RE3A 2GVIA 3FD6A 2ZVZA 5IYZA 3RA5A 3U0OA 3CCEF 3CCJF 1XBIA 4EB6B 3MCQA 2VAWA 3M4SA 3CC2F 3TD4A 1FNJA 3F0EA 3JARA 4BT5A 5B8FA 1YIJF 2G9IA 3NK7A 1W42A 3M84A 4X20A 1YI2F 3M1XA 4R40B 4ZK7A 3MCAB 2RHHA 3JATB 5EB0A 3RYIB 3RYCB 2VAMA 3HTNA 4RQOA 4WBNA 1W59A 5LXTA 3CPWF 4PWTA 5LP6B 4U3JA 2QTPA 3R0PA 5JVDA 2RHOA 1ONIA 5FLXM 1CLIA 3S06A 2PHNA 1W40A 5IJ9A 5BMVA 4BVRA 1XV2A 2HP0B 4BT4A 5G4UC 1VQ9F 4B62A 2AIFA 2LCAA 4LNUA 1TUBA 4TV8B 3S02A 5KX5A 2ALEA 3TD5A 4ZI7A 2AIZP 5C8YA 4TV9B 2W8BC 4EI8A 4BVSA 1RLUA 1SA0A 4KWEA 4ZHQB 5G4VC 4NWOB 1W5EA 5HP8A 3RYHB 3P10A 2BTOA 5J2TB 1W2BF 5KMGA 3CCQF 1W55A 1JY8A 4X1IA 3PLAC 3G4SF 2HS3A 1Q86H 2OTLF 3JAKA 2HRUA 5A2QM 4O4JB 1COMA 5LYJB 3ZOPA 1DT9A 1RQ2A 4EI9A 2IG8A 1K8AH 1H7MA 3CYQA 1U43A 1QVGF 2I6DA 3I55F 2QEXF 4RHAA 1M1KH 1W41A 5IJ0A 4G4VA 5CA0B 3K14A 3VO8A 1IV4A 1KD1H 3S0YA 5JH7A 2RHJA 4I4TA 3CG6A 4I55B 3ESJA 3N4YA 1X52A 3GHZA 3HKCA 5CA1B 4IIJB 4NQ3A 3LWQC 4BT2A 5EAZA 1JFFA 1JJ2F 3HWUA 1QAHA 4X1KB 2FGYA 3OW2F 3NK6A 5JCOC 2YYEA 2FC3A 3CYPB 2CHTA 4BY9D 4LCKA 1VHAA 2CW4A 3HKEB 5IT9M 1TVKA 2R6R1 4YJ2B 3WGNA 4O4HB 3LWPC 4DXDA 5CB4A 3D54A 3RA6A 3VYUC 5GIPC 3KHNA 3QUWA 2JNBA 2F9ZC 4X1YA 2UYPA 3N2KB 2I6RA 1FNKA 3G71F 1Z5VA 3LFOA 3CMEF 5MN5A 5EB1B 1FSZA 1VQPF 1VQ7F 5GINC 1GZ0A 3E22A 1VQVA 1X7OA 2IQQA 1JD1A 1DBFA 3E1YA 3ZO8A 3CCSF 5MN6A 4YJ3A 4HNAB 2QA4F 1T0KB 1GO1A 3IR9A 3I56F 3JALA 4TZZA 5EYPA 3CCLF 1ODEA 3V7EA 3HKDA 1VQ4F 4F6RB 5GANK 3UT5B 1NJIH 2Z1UA 1Z5WA 4BW0B 2B33A 3N4ZA 3F0DA 4EB6A 1M90H 3MBMA 3BYQA 1YHQF 3WGMA 2UYNA 3CMAF 2QI2A 3JARB 1X7PA 4X3LA 3CCMF 1Q8RA 4G4WA 4ZOLA 3VI6A 3VMFB 4X20B 3RYIA 3JATA 1Q81H 4B46A 2VAPA 3WGJA 4FFBA 2NMUA 2VGNA 4C8GA 1R1MA 4WBNB 2HS4A 3CC4F 1VQMF 3GYQA 5LA6B 3OBYA 5LP6A 1ZWZA 4C8EA 4U3JB 3V4DA 1VQNF 4BVTA 3KIZA 4O2BA 2PMPA 4O2AA 4TUYA 2HP0A 1IV2A 4ZHVA 5IJ9B 3L7QA 5BMVB 1W5AA 5MN4A 4BT3A 1TUBB 4C81A 5FNVB 4TV9A 2VXYA 2ZOVA 2UYJA 2BTQB 4ZHQA 1SA0B 1XRGA 2VGMA 4XCQA 3OBWA 5GONA 5J2UB 1X25A 5J2TA 5EIBD 3JASA 5KMGB 2CWJA 2R751 2RB9A 4I50B 4X1IB 1IV1A 2RHLA 1K9MH 3S0WA 1YGYA 2KGWA 3JAKB 2BTUA 4DRXB 2KTUA 3VCZA 1VQ5F 3HKBB 1FFXA 2LBWA 3IKFA 1XHOA 2ZVYA 3VYSC 1VQ6F 4ERHA 2CVLA 3DDNA 2L26A 1W581 5CA0A 3WJRA 3K2XA 5IJ0B 2ZAUA 4ZHYB 2LBXA 2OZBA 1U40A 1U3PA 5EZYB 4C82A 3CCRF 5JH7B 3T80A 4I55A 1K73H 3IEWA 5CA1A 2DT4A 3NMUC 4E6EA 2CSLA 3PAFA 1YJ9F 3WJPA 4X3MA 2Z1EA 3C9SA 2HRYA 3VTIC 3CCUF 4X1KA 3NVKE 3GTZA 1JFFB 1VK3A 2K1SA 4O4LB 3ZP4A 1PXWA 1RA4A 3QHDA 1W5FA 1Q7YH 3FFMA 3F0GA 3I3FA 3WPXA 3HKEA 3QTYA 2BO1A 3WGKA 2OTMA 3D01A 2UYKA 4O4HA 2N48A 5HY1A 2H8EA 4IHJA 2OHWA 3CD6F 5HY2A 1J7HA 1T0AA 1H48A 3B6NA 3KE1A 3S03A 3CCVF 3TD3A 3K0TA 3LWOC 5ITZB 5JQGA 3JAWB 3N2GA 1W57A 3J80M 1IV3A 2HP3A 5LOVA 2HS0A 4G4XA 3P4EA 3SIVA 4O4IB 5DCVA 5HY4A 2LBTA 5EWRA 3EORA 3RYFB 4EI7A 1RQ7A 3CPQA 2OTJF 4HNAA 5HWEA 5IYZB 5EIBC 4BT6A 1S72F 3C9RA 4G88A 3Q8HA 3UT5A 3V7QA 1IPAA 3HJWC 1QD9A 1KNJA 2HVYD 1U3LA 5EO3A 3E20B 2IAFA 2AMTA 3RYCA 2ZODA 1VQKF 5HXZA 5FJ4C 1NMUB 2Z1FA 2UYNB 1OFUA 3LWVC 2UZHA 1W5BA 4ZOLB 5LXTB 1KQSF 3S0HA 3FPIA 4B45A 3P0ZA 3IEQA 2Q1YA 3LDTA 5AVMA 4FFBB 3FBAA 5JVDB 3VOBA 1YJWF 1QVFF 3CB2A 3J81M 5LA6A 3WJQA 1VH8A 3MQWA 1GX1A 2EWCA 2ZF8A 4TV8A 3WGLA 4LNUB 2KG4A 3K12A 1UFYA 5KX5B 4O2BB 3G6EF 3ON1A 4O2AB 4TUYB 4ZI7B 3LMEA 5C8YB 1VQ8F 3ELCA 3VOAA 5GAPK 3JAMM 2CHSA 3HAXD 3AGKA 5FNVA 4G4YA 3RYHA 5HP7A 2Z01A 3I7TA 1Q82H 5GIOC 1VQLF 2H6LA 3ZP7A 3OONA 1YQNA 4C8IA 4U39A 3LYBA 5J2UA 1GO0A 4O4JA 5GONB 5JCOA 1YJNF 5LYJA 5LP6C 1SDSA
chains in the Genus database with same CATH topology
1W40A 1PXWA 3V7EA 1RA4A 1VQ4F 4BVRA 1CN7A 5G4UC 2KTVA 5GANK 1VQ9F 1Q7YH 1NJIH 2CZWA 2AIFA 3CC7F 3FFMA 4BW0B 3N4ZA 2BO1A 2ALEA 2GLZA 1M90H 3I56F 1YHQF 5HY1A 2OHWA 3CD6F 5HY2A 3CMAF 3WXMB 2QI2A 4EI8A 1YITF 4BVSA 5G4VC 1X7PA 4X3LA 3CCMF 3CCVF 5IT9M 3VI6A 3VMFB 3LWOC 1Q81H 1VQOF 3J80M 3SIUA 2VGNA 1W2BF 3SIVA 3CCQF 5DCVA 5HY4A 3CC4F 1VQMF 5EWRA 3GYQA 4EI7A 3NVIB 3PLAC 3G4SF 3OBYA 1Q86H 2OTLF 1ZWZA 3CXCF 3CPQA 2OTJF 3LWRC 5A2QM 5HWEA 1VQNF 4BVTA 2WALA 3D00A 1S72F 1DT9A 3V3TA 4EI9A 3V7QA 1K8AH 1H7MA 1E7KA 1IPAA 1RLGA 1QVGF 2I6DA 3I55F 3HJWC 2QEXF 2HVYD 5EO3A 3E20B 1M1KH 1W41A 3J7AR 4BVQA 1KD1H 1VQKF 4NUTA 5HXZA 5FJ4C 3CG6A 1NMUB 3N4YA 1X52A 3LWVC 5HXUA 3JCMM 1CK2A 4NQ3A 3LWQC 1KQSF 2VGMA 1W3EX 3OBWA 4XCQA 1SDSA 5HY0A 1JJ2F 3O85A 4C4WC 1YJWF 1N8RH 1QVFF 2FGYA 3J81M 3OW2F 3NK6A 1KC8H 2FC3A 1K9MH 3RA5A 3CCEF 3CCJF 4BY9D 2KTUA 4LCKA 2KG4A 1XBIA 1VQ5F 3G6EF 3LWPC 3ON1A 3CC2F 3NVKE 3RA6A 2LBWA 1VQ8F 5GIPC 5GAPK 1YIJF 1VQ6F 3NK7A 1W42A 2JNBA 3JAMM 1YI2F 2F9ZC 3HAXD 3AGKA 3MCAB 2OZBA 2LBXA 3G71F 3LFOA 3CCRF 3CMEF 1K73H 1Q82H 4TZZA 5GIOC 1VQPF 1VQ7F 1VQLF 3NMUC 5GINC 1GZ0A 3CPWF 1X7OA 3PAFA 1GO0A 3E1YA 1YJ9F 3CCSF 4X3MA 2QA4F 3CCUF 1YJNF 1T0KB 1GO1A 3IR9A 5FLXM 3CCLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W40 A;  1PXW A;  3V7E A;  1RA4 A;  1VQ4 F;  1CN7 A;  5G4U C;  2KTV A;  5GAN K;  1VQ9 F;  1Q7Y H;  1NJI H;  2CZW A;  2AIF A;  3CC7 F;  3FFM A;  4BW0 B;  3N4Z A;  2BO1 A;  2ALE A;  1M90 H;  3I56 F;  1YHQ F;  2OHW A;  3CD6 F;  3CMA F;  3WXM B;  2QI2 A;  1YIT F;  5G4V C;  1X7P A;  4X3L A;  3CCM F;  3CCV F;  5IT9 M;  3VI6 A;  3VMF B;  3LWO C;  1Q81 H;  1VQO F;  3J80 M;  3SIU A;  2VGN A;  1W2B F;  3SIV A;  3CCQ F;  5DCV A;  3CC4 F;  1VQM F;  5EWR A;  3GYQ A;  3PLA C;  3NVI B;  3G4S F;  3OBY A;  1Q86 H;  2OTL F;  1ZWZ A;  3CXC F;  3CPQ A;  2OTJ F;  3LWR C;  5A2Q M;  1VQN F;  2WAL A;  1S72 F;  1DT9 A;  3V7Q A;  1K8A H;  1H7M A;  1E7K A;  1IPA A;  1RLG A;  1QVG F;  2I6D A;  3I55 F;  3HJW C;  2QEX F;  2HVY D;  5EO3 A;  3E20 B;  1M1K H;  1W41 A;  3J7A R;  1KD1 H;  1VQK F;  4NUT A;  5FJ4 C;  3CG6 A;  1NMU B;  3N4Y A;  1X52 A;  3LWV C;  3JCM M;  1CK2 A;  3LWQ C;  1KQS F;  2VGM A;  1W3E X;  3OBW A;  1SDS A;  1JJ2 F;  3O85 A;  4C4W C;  1YJW F;  1N8R H;  1QVF F;  3J81 M;  3OW2 F;  3NK6 A;  1KC8 H;  2FC3 A;  1K9M H;  3RA5 A;  3CCE F;  3CCJ F;  4BY9 D;  2KTU A;  4LCK A;  2KG4 A;  1XBI A;  1VQ5 F;  3G6E F;  3LWP C;  3ON1 A;  3CC2 F;  3NVK E;  3RA6 A;  2LBW A;  1VQ8 F;  5GIP C;  5GAP K;  1YIJ F;  1VQ6 F;  3NK7 A;  1W42 A;  2JNB A;  3JAM M;  1YI2 F;  3HAX D;  3AGK A;  3MCA B;  2OZB A;  2LBX A;  3G71 F;  3LFO A;  3CCR F;  3CME F;  1K73 H;  1Q82 H;  4TZZ A;  5GIO C;  1VQP F;  1VQ7 F;  1VQL F;  3NMU C;  5GIN C;  1GZ0 A;  3CPW F;  1X7O A;  3PAF A;  1GO0 A;  3E1Y A;  1YJ9 F;  3CCS F;  4X3M A;  2QA4 F;  3CCU F;  1YJN F;  1T0K B;  1GO1 A;  3IR9 A;  5FLX M;  3CCL F; 
#chains in the Genus database with same CATH topology
 4I50 A;  3JAS B;  4BT7 A;  3WPW A;  1CN7 A;  2KTV A;  3F0F A;  2CZW A;  4DRX A;  3CC7 F;  3C9U A;  2H8C A;  3KJK A;  1H47 A;  3HKB A;  3C9T A;  2GLZ A;  2HX0 A;  1FFX B;  1PF5 A;  3WXM B;  1YIT F;  4I4T B;  2V9Y A;  4IIJ A;  2Q1X A;  3HKC B;  3C8L A;  3FD5 A;  1VQO F;  5EZY A;  3SIU A;  4M8I A;  4ZHW A;  3NVI B;  3CXC F;  1JN1 A;  3LWR C;  3DC2 A;  2HQS C;  4O4L A;  4YJ2 A;  2WAL A;  1TVK B;  2YXZ A;  3D00 A;  3V3T A;  1NQ3 A;  3IMP A;  2GZL A;  5CB4 B;  1E7K A;  1RLG A;  3KJJ A;  3N2K A;  1OAP A;  3J7A R;  4BVQ A;  4X1Y B;  3F6M A;  2Z1T A;  4NUT A;  3IKE A;  4IHJ B;  4B5C A;  5ITZ A;  5HXU A;  3JCM M;  1CK2 A;  3JAW A;  3E22 B;  3VYT C;  3ERN A;  1W3E X;  5JQG B;  1QU9 A;  5HY0 A;  1KNK A;  3N2G B;  2DYY A;  1UI9 A;  3JVH A;  3MDO A;  4O4I A;  2P6Y A;  3O85 A;  4YJ3 B;  5LOV B;  1SZQ A;  4C4W C;  1N8R H;  4G4Z A;  3RYF A;  3JAL B;  3VIU A;  5EYP B;  4F6R A;  3HKD B;  1KC8 H;  2MQE A;  3RE3 A;  2GVI A;  3FD6 A;  2ZVZ A;  5IYZ A;  3RA5 A;  3U0O A;  3CCE F;  3CCJ F;  1XBI A;  4EB6 B;  3MCQ A;  2VAW A;  3M4S A;  3CC2 F;  3TD4 A;  1FNJ A;  3F0E A;  3JAR A;  4BT5 A;  5B8F A;  1YIJ F;  2G9I A;  3NK7 A;  1W42 A;  3M84 A;  4X20 A;  1YI2 F;  3M1X A;  4R40 B;  4ZK7 A;  3MCA B;  2RHH A;  3JAT B;  5EB0 A;  3RYI B;  3RYC B;  2VAM A;  3HTN A;  4RQO A;  4WBN A;  1W59 A;  5LXT A;  3CPW F;  4PWT A;  5LP6 B;  4U3J A;  2QTP A;  3R0P A;  5JVD A;  2RHO A;  1ONI A;  5FLX M;  1CLI A;  3S06 A;  2PHN A;  1W40 A;  5IJ9 A;  5BMV A;  4BVR A;  1XV2 A;  2HP0 B;  4BT4 A;  5G4U C;  1VQ9 F;  4B62 A;  2AIF A;  2LCA A;  4LNU A;  1TUB A;  4TV8 B;  3S02 A;  5KX5 A;  2ALE A;  3TD5 A;  4ZI7 A;  2AIZ P;  5C8Y A;  4TV9 B;  2W8B C;  4EI8 A;  4BVS A;  1RLU A;  1SA0 A;  4KWE A;  4ZHQ B;  5G4V C;  4NWO B;  1W5E A;  5HP8 A;  3RYH B;  3P10 A;  2BTO A;  5J2T B;  1W2B F;  5KMG A;  3CCQ F;  1W55 A;  1JY8 A;  4X1I A;  3PLA C;  3G4S F;  2HS3 A;  1Q86 H;  2OTL F;  3JAK A;  2HRU A;  5A2Q M;  4O4J B;  1COM A;  5LYJ B;  3ZOP A;  1DT9 A;  1RQ2 A;  4EI9 A;  2IG8 A;  1K8A H;  1H7M A;  3CYQ A;  1U43 A;  1QVG F;  2I6D A;  3I55 F;  2QEX F;  4RHA A;  1M1K H;  1W41 A;  5IJ0 A;  4G4V A;  5CA0 B;  3K14 A;  3VO8 A;  1IV4 A;  1KD1 H;  3S0Y A;  5JH7 A;  2RHJ A;  4I4T A;  3CG6 A;  4I55 B;  3ESJ A;  3N4Y A;  1X52 A;  3GHZ A;  3HKC A;  5CA1 B;  4IIJ B;  4NQ3 A;  3LWQ C;  4BT2 A;  5EAZ A;  1JFF A;  1JJ2 F;  3HWU A;  1QAH A;  4X1K B;  2FGY A;  3OW2 F;  3NK6 A;  5JCO C;  2YYE A;  2FC3 A;  3CYP B;  2CHT A;  4BY9 D;  4LCK A;  1VHA A;  2CW4 A;  3HKE B;  5IT9 M;  1TVK A;  2R6R 1;  4YJ2 B;  3WGN A;  4O4H B;  3LWP C;  4DXD A;  5CB4 A;  3D54 A;  3RA6 A;  3VYU C;  5GIP C;  3KHN A;  3QUW A;  2JNB A;  2F9Z C;  4X1Y A;  2UYP A;  3N2K B;  2I6R A;  1FNK A;  3G71 F;  1Z5V A;  3LFO A;  3CME F;  5MN5 A;  5EB1 B;  1FSZ A;  1VQP F;  1VQ7 F;  5GIN C;  1GZ0 A;  3E22 A;  1VQV A;  1X7O A;  2IQQ A;  1JD1 A;  1DBF A;  3E1Y A;  3ZO8 A;  3CCS F;  5MN6 A;  4YJ3 A;  4HNA B;  2QA4 F;  1T0K B;  1GO1 A;  3IR9 A;  3I56 F;  3JAL A;  4TZZ A;  5EYP A;  3CCL F;  1ODE A;  3V7E A;  3HKD A;  1VQ4 F;  4F6R B;  5GAN K;  3UT5 B;  1NJI H;  2Z1U A;  1Z5W A;  4BW0 B;  2B33 A;  3N4Z A;  3F0D A;  4EB6 A;  1M90 H;  3MBM A;  3BYQ A;  1YHQ F;  3WGM A;  2UYN A;  3CMA F;  2QI2 A;  3JAR B;  1X7P A;  4X3L A;  3CCM F;  1Q8R A;  4G4W A;  4ZOL A;  3VI6 A;  3VMF B;  4X20 B;  3RYI A;  3JAT A;  1Q81 H;  4B46 A;  2VAP A;  3WGJ A;  4FFB A;  2NMU A;  2VGN A;  4C8G A;  1R1M A;  4WBN B;  2HS4 A;  3CC4 F;  1VQM F;  3GYQ A;  5LA6 B;  3OBY A;  5LP6 A;  1ZWZ A;  4C8E A;  4U3J B;  3V4D A;  1VQN F;  4BVT A;  3KIZ A;  4O2B A;  2PMP A;  4O2A A;  4TUY A;  2HP0 A;  1IV2 A;  4ZHV A;  5IJ9 B;  3L7Q A;  5BMV B;  1W5A A;  5MN4 A;  4BT3 A;  1TUB B;  4C81 A;  5FNV B;  4TV9 A;  2VXY A;  2ZOV A;  2UYJ A;  2BTQ B;  4ZHQ A;  1SA0 B;  1XRG A;  2VGM A;  4XCQ A;  3OBW A;  5GON A;  5J2U B;  1X25 A;  5J2T A;  5EIB D;  3JAS A;  5KMG B;  2CWJ A;  2R75 1;  2RB9 A;  4I50 B;  4X1I B;  1IV1 A;  2RHL A;  1K9M H;  3S0W A;  1YGY A;  2KGW A;  3JAK B;  2BTU A;  4DRX B;  2KTU A;  3VCZ A;  1VQ5 F;  3HKB B;  1FFX A;  2LBW A;  3IKF A;  1XHO A;  2ZVY A;  3VYS C;  1VQ6 F;  4ERH A;  2CVL A;  3DDN A;  2L26 A;  1W58 1;  5CA0 A;  3WJR A;  3K2X A;  5IJ0 B;  2ZAU A;  4ZHY B;  2LBX A;  2OZB A;  1U40 A;  1U3P A;  5EZY B;  4C82 A;  3CCR F;  5JH7 B;  3T80 A;  4I55 A;  1K73 H;  3IEW A;  5CA1 A;  2DT4 A;  3NMU C;  4E6E A;  2CSL A;  3PAF A;  1YJ9 F;  3WJP A;  4X3M A;  2Z1E A;  3C9S A;  2HRY A;  3VTI C;  3CCU F;  4X1K A;  3NVK E;  3GTZ A;  1JFF B;  1VK3 A;  2K1S A;  4O4L B;  3ZP4 A;  1PXW A;  1RA4 A;  3QHD A;  1W5F A;  1Q7Y H;  3FFM A;  3F0G A;  3I3F A;  3WPX A;  3HKE A;  3QTY A;  2BO1 A;  3WGK A;  2OTM A;  3D01 A;  2UYK A;  4O4H A;  2N48 A;  5HY1 A;  2H8E A;  4IHJ A;  2OHW A;  3CD6 F;  5HY2 A;  1J7H A;  1T0A A;  1H48 A;  3B6N A;  3KE1 A;  3S03 A;  3CCV F;  3TD3 A;  3K0T A;  3LWO C;  5ITZ B;  5JQG A;  3JAW B;  3N2G A;  1W57 A;  3J80 M;  1IV3 A;  2HP3 A;  5LOV A;  2HS0 A;  4G4X A;  3P4E A;  3SIV A;  4O4I B;  5DCV A;  5HY4 A;  2LBT A;  5EWR A;  3EOR A;  3RYF B;  4EI7 A;  1RQ7 A;  3CPQ A;  2OTJ F;  4HNA A;  5HWE A;  5IYZ B;  5EIB C;  4BT6 A;  1S72 F;  3C9R A;  4G88 A;  3Q8H A;  3UT5 A;  3V7Q A;  1IPA A;  3HJW C;  1QD9 A;  1KNJ A;  2HVY D;  1U3L A;  5EO3 A;  3E20 B;  2IAF A;  2AMT A;  3RYC A;  2ZOD A;  1VQK F;  5HXZ A;  5FJ4 C;  1NMU B;  2Z1F A;  2UYN B;  1OFU A;  3LWV C;  2UZH A;  1W5B A;  4ZOL B;  5LXT B;  1KQS F;  3S0H A;  3FPI A;  4B45 A;  3P0Z A;  3IEQ A;  2Q1Y A;  3LDT A;  5AVM A;  4FFB B;  3FBA A;  5JVD B;  3VOB A;  1YJW F;  1QVF F;  3CB2 A;  3J81 M;  5LA6 A;  3WJQ A;  1VH8 A;  3MQW A;  1GX1 A;  2EWC A;  2ZF8 A;  4TV8 A;  3WGL A;  4LNU B;  2KG4 A;  3K12 A;  1UFY A;  5KX5 B;  4O2B B;  3G6E F;  3ON1 A;  4O2A B;  4TUY B;  4ZI7 B;  3LME A;  5C8Y B;  1VQ8 F;  3ELC A;  3VOA A;  5GAP K;  3JAM M;  2CHS A;  3HAX D;  3AGK A;  5FNV A;  4G4Y A;  3RYH A;  5HP7 A;  2Z01 A;  3I7T A;  1Q82 H;  5GIO C;  1VQL F;  2H6L A;  3ZP7 A;  3OON A;  1YQN A;  4C8I A;  4U39 A;  3LYB A;  5J2U A;  1GO0 A;  4O4J A;  5GON B;  5JCO A;  1YJN F;  5LYJ A;  5LP6 C;  1SDS A; 
#chains in the Genus database with same CATH homology
 1W40 A;  1PXW A;  3V7E A;  1RA4 A;  1VQ4 F;  4BVR A;  1CN7 A;  5G4U C;  2KTV A;  5GAN K;  1VQ9 F;  1Q7Y H;  1NJI H;  2CZW A;  2AIF A;  3CC7 F;  3FFM A;  4BW0 B;  3N4Z A;  2BO1 A;  2ALE A;  2GLZ A;  1M90 H;  3I56 F;  1YHQ F;  5HY1 A;  2OHW A;  3CD6 F;  5HY2 A;  3CMA F;  3WXM B;  2QI2 A;  4EI8 A;  1YIT F;  4BVS A;  5G4V C;  1X7P A;  4X3L A;  3CCM F;  3CCV F;  5IT9 M;  3VI6 A;  3VMF B;  3LWO C;  1Q81 H;  1VQO F;  3J80 M;  3SIU A;  2VGN A;  1W2B F;  3SIV A;  3CCQ F;  5DCV A;  5HY4 A;  3CC4 F;  1VQM F;  5EWR A;  3GYQ A;  4EI7 A;  3NVI B;  3PLA C;  3G4S F;  3OBY A;  1Q86 H;  2OTL F;  1ZWZ A;  3CXC F;  3CPQ A;  2OTJ F;  3LWR C;  5A2Q M;  5HWE A;  1VQN F;  4BVT A;  2WAL A;  3D00 A;  1S72 F;  1DT9 A;  3V3T A;  4EI9 A;  3V7Q A;  1K8A H;  1H7M A;  1E7K A;  1IPA A;  1RLG A;  1QVG F;  2I6D A;  3I55 F;  3HJW C;  2QEX F;  2HVY D;  5EO3 A;  3E20 B;  1M1K H;  1W41 A;  3J7A R;  4BVQ A;  1KD1 H;  1VQK F;  4NUT A;  5HXZ A;  5FJ4 C;  3CG6 A;  1NMU B;  3N4Y A;  1X52 A;  3LWV C;  5HXU A;  3JCM M;  1CK2 A;  4NQ3 A;  3LWQ C;  1KQS F;  2VGM A;  1W3E X;  3OBW A;  4XCQ A;  1SDS A;  5HY0 A;  1JJ2 F;  3O85 A;  4C4W C;  1YJW F;  1N8R H;  1QVF F;  2FGY A;  3J81 M;  3OW2 F;  3NK6 A;  1KC8 H;  2FC3 A;  1K9M H;  3RA5 A;  3CCE F;  3CCJ F;  4BY9 D;  2KTU A;  4LCK A;  2KG4 A;  1XBI A;  1VQ5 F;  3G6E F;  3LWP C;  3ON1 A;  3CC2 F;  3NVK E;  3RA6 A;  2LBW A;  1VQ8 F;  5GIP C;  5GAP K;  1YIJ F;  1VQ6 F;  3NK7 A;  1W42 A;  2JNB A;  3JAM M;  1YI2 F;  2F9Z C;  3HAX D;  3AGK A;  3MCA B;  2OZB A;  2LBX A;  3G71 F;  3LFO A;  3CCR F;  3CME F;  1K73 H;  1Q82 H;  4TZZ A;  5GIO C;  1VQP F;  1VQ7 F;  1VQL F;  3NMU C;  5GIN C;  1GZ0 A;  3CPW F;  1X7O A;  3PAF A;  1GO0 A;  3E1Y A;  1YJ9 F;  3CCS F;  4X3M A;  2QA4 F;  3CCU F;  1YJN F;  1T0K B;  1GO1 A;  3IR9 A;  5FLX M;  3CCL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...