3NVIB

Structure of n-terminal truncated nop56/58 bound with l7ae and box c/d rna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
molecule keywords NOP5/NOP56 related protein
total genus 35
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nviB00
2KG4A 3PAFA 1VQ9F 3CCQF 1CK2A 5IT9M 3LWRC 1YJWF 1IPAA 3CCLF 3V7EA 5G4VC 3HAXD 5GIPC 3CCJF 3SIVA 1Q86H 1VQ8F 3CG6A 2QEXF 1YITF 1K9MH 1YJ9F 2VGMA 3CCUF 3CMEF 2AIFA 1VQ7F 2KTUA 1KD1H 3NK7A 2VGNA 1Q82H 5DCVA 4TZZA 3ON1A 1K8AH 1N8RH 3LWVC 3JCMM 3LWQC 3G6EF 3AGKA 3CPWF 2BO1A 3OBYA 1YI2F 4BW0B 3G71F 2OZBA 1QVFF 1RA4A 3MCAB 3CMAF 3WXMB 2OTJF 1Q7YH 1M1KH 1VQNF 3OBWA 4X3LA 1W42A 3J81M 5GANK 3E1YA 3J7AR 3V7QA 1JJ2F 3NVIB 2OHWA 2LBWA 5EO3A 1GO1A 3CC7F 3CD6F 3NMUC 3N4ZA 5A2QM 1YJNF 1XBIA 2HVYD 1W3EX 3I56F 3CC2F 1NJIH 1W2BF 1VQ6F 3CCMF 1Q81H 1VQMF 1T0KB 1VQLF 1ZWZA 3I55F 3CC4F 3JAMM 1RLGA 2FC3A 5FLXM 5G4UC 2QA4F 1NMUB 3LFOA 3HJWC 1W41A 2CZWA 3CPQA 1SDSA 1S72F 1K73H 1QVGF 3NK6A 5EWRA 2WALA 1KC8H 3IR9A 2I6DA 1VQ4F 5GAPK 3GYQA 3RA5A 3VI6A 4NUTA 1GO0A 1DT9A 3RA6A 3CXCF 4LCKA 3J80M 4X3MA 3LWPC 4C4WC 3G4SF 1KQSF 2OTLF 1VQOF 2QI2A 3VMFB 1GZ0A 5GIOC 3CCEF 1YIJF 2KTVA 2LBXA 1E7KA 1X7PA 3NVKE 1H7MA 3N4YA 1X52A 1X7OA 3LWOC 3CCSF 3FFMA 1CN7A 1M90H 3OW2F 2ALEA 5FJ4C 3CCRF 3SIUA 3O85A 1YHQF 5GINC 1W40A 4BY9D 3PLAC 2JNBA 1PXWA 3E20B 1VQPF 3CCVF 1VQKF 1VQ5F
chains in the Genus database with same CATH superfamily
2UYNA 2Z1FA 1CK2A 3CYPB 5CA1A 1RLUA 2Z1TA 3WGMA 5IYZA 3LWRC 1YJWF 3CCLF 5IT9M 3S02A 3HAXD 1ONIA 4X20B 3D00A 5GIPC 4YJ2B 3CCJF 5J2UA 1VQ8F 3CG6A 4XCQA 2F9ZC 1T0AA 4X1YB 2VGMA 1XHOA 3CMEF 4O4HA 4BT4A 4ERHA 2Q1XA 1JFFA 3RYCB 1QU9A 5JH7A 3VCZA 3E22A 5DCVA 3S06A 3K12A 3ON1A 4ZI7A 1RQ2A 2RB9A 1W55A 2BTQB 4U39A 3G6EF 1YI2F 3C9UA 3OBYA 5HXZA 2OZBA 1DBFA 1QVFF 1Q7YH 1M1KH 3ZO8A 3U0OA 1VQNF 5GANK 3D54A 3E1YA 3JALA 1JJ2F 2OHWA 1W59A 5MN5A 3JASB 3IEQA 4ZOLB 2VAWA 4WBNA 4ZHQA 1YJNF 4RHAA 2H6LA 1W3EX 1VH8A 2ZAUA 1COMA 2ZVZA 3CC2F 1VQ6F 2V9YA 4HNAB 4B62A 1ZWZA 4B5CA 3EORA 2LCAA 3VTIC 3F0DA 1RLGA 2FC3A 2W8BC 4G4WA 4PWTA 2QA4F 3UT5B 4R40B 3VOAA 1NMUB 3P0ZA 3LMEA 3HJWC 3RYFA 3CPQA 1SDSA 2CW4A 3HKEB 3S0HA 3NK6A 5EWRA 5EZYA 3R0PA 2I6DA 1VQ4F 5GAPK 1VHAA 3KHNA 3I7TA 3VI6A 1CLIA 1GO0A 3LYBA 3JAKB 4ZHWA 3J80M 5KX5B 3LWPC 4C4WC 1VQOF 3VMFB 5EIBD 3TD3A 5CB4A 2CWJA 1OFUA 5GIOC 3TD5A 1W581 2I6RA 1H7MA 1W5EA 1X52A 1X7OA 2PMPA 3ZP4A 4C82A 4G4XA 4HNAA 4TV9A 2ZVYA 3JARA 5FJ4C 3SIUA 4O4LB 3O85A 1YHQF 3WJQA 3JAWB 4TUYA 1W40A 4WBNB 3QUWA 1U43A 2JNBA 5JVDA 3N2KA 3CCVF 1VQKF 3PAFA 3M4SA 2RHJA 3VIUA 3WGKA 5GONB 3HKBA 4O4LA 3BYQA 2OTMA 3SIVA 3FBAA 1Q86H 5B8FA 2N48A 2QEXF 4ZHYB 2ZODA 3ZP7A 1YJ9F 1VQ7F 2RHOA 4ZI7B 2HP3A 3E22B 5HY2A 3ESJA 4RQOA 3I3FA 1TUBB 3RYCA 1Q82H 5CB4B 2HQSC 3FD6A 4O4JB 3LWVC 3KJKA 3JCMM 2CSLA 3V3TA 1IV4A 3AGKA 2BO1A 3JAKA 3G71F 4FFBA 5LOVA 1OAPA 1VQVA 3IEWA 3CMAF 1U40A 3WXMB 1W5FA 3HKEA 5CA1B 3J81M 5CA0B 3J7AR 2VXYA 2CVLA 2R751 1FFXB 5KMGA 2R6R1 2G9IA 1TVKA 1GO1A 3CD6F 1JD1A 1FNKA 3HWUA 3N4ZA 2L26A 3C9TA 3N2GA 1U3LA 3VO8A 3F0EA 4DXDA 2UYKA 2CHSA 1H47A 2YXZA 4U3JB 1Q8RA 2DT4A 2ZF8A 5EB0A 3CCMF 1VQMF 2BTOA 4ZOLA 2EWCA 2IQQA 1Z5WA 3GTZA 4BT5A 3S0WA 5JQGA 1JY8A 1W41A 1S72F 1R1MA 1KC8H 4DRXB 4YJ3A 3IR9A 3WGLA 3GYQA 2RHLA 2UYPA 4EB6A 3CXCF 1W57A 4F6RB 4X3MA 5EB1B 4EI7A 5HY1A 5JQGB 3MCQA 2OTLF 2QI2A 3VOBA 4BT7A 2AMTA 1YGYA 3CB2A 5J2TB 1QAHA 1W5AA 1M90H 5JCOC 4NWOB 2ALEA 2GLZA 5LYJA 2HX0A 3IKEA 3TD4A 3CCRF 3JATA 4X20A 1W5BA 5GINC 3PLAC 1NQ3A 2VAMA 3N2GB 4M8IA 4ZHVA 5LA6B 5LP6B 1PF5A 2QTPA 1PXWA 1VQPF 4C8EA 1TVKB 1J7HA 2UYNB 3QHDA 3GHZA 5CA0A 5HP8A 3L7QA 5LA6A 5G4VC 2AIZP 3KJJA 1SZQA 3Q8HA 4BVRA 3VYTC 3IMPA 2HS0A 5LYJB 1YITF 2RHHA 3DDNA 5J2TA 5ITZA 3QTYA 5EYPA 4BT2A 3HKDB 4O4JA 4O4IB 3DC2A 1KD1H 3NK7A 2HS3A 2BTUA 5IJ0A 2Z01A 1K8AH 4I4TA 5MN6A 4O2BB 1N8RH 4LNUB 4F6RA 3WJRA 4EB6B 1FSZA 4IHJB 5C8YB 2LBTA 3HKBB 1RA4A 3JVHA 5GONA 4YJ3B 1VK3A 1XRGA 3HKCB 3MCAB 3FPIA 2OTJF 3OBWA 4X3LA 1W42A 3V7QA 4I55A 5HWEA 5EO3A 2HRUA 4O2AA 5JCOA 3CC7F 1UFYA 1QD9A 3IKFA 2Q1YA 4EI8A 4TV8B 5FNVA 3C8LA 2UYJA 1XBIA 4G4VA 2HVYD 2HP0B 1KNKA 4X1KB 4C81A 3F6MA 4X1IA 3JARB 1NJIH 3F0FA 4TV9B 2DYYA 3HTNA 5EAZA 5HP7A 1Q81H 3K2XA 5AVMA 3JAMM 2Z1UA 4KWEA 4ZK7A 2CHTA 3KE1A 3ERNA 5EIBC 3WJPA 3M84A 4B46A 4BT3A 5KX5A 2CZWA 2H8CA 2MQEA 3ELCA 3VYUC 2P6YA 2IG8A 5LOVB 4FFBB 3RYHB 1DT9A 3RA6A 1ODEA 3CYQA 1JN1A 4LCKA 3RYFB 3G4SF 1KQSF 3UT5A 1GZ0A 3CCEF 2KTVA 2LBXA 1TUBA 1X7PA 2HRYA 1E7KA 4EI9A 3S03A 5LP6C 3CCSF 3C9RA 1U3PA 4X1IB 2Z1EA 3T80A 1YQNA 5BMVA 3ZOPA 2HS4A 1KNJA 4NQ3A 3C9SA 3D01A 2YYEA 5LXTB 1IV1A 4B45A 2VAPA 3E20B 2K1SA 1GX1A 3N2KB 2KG4A 5JVDB 1VQ9F 3CCQF 3F0GA 3FD5A 1X25A 5HY0A 2H8EA 1IPAA 3V7EA 5LXTA 3HKCA 3JAWA 4TUYB 3WPXA 3B6NA 5BMVB 4G4YA 1K9MH 3CCUF 4LNUA 2AIFA 2KTUA 3V4DA 5JH7B 4C8IA 3VYSC 5IJ0B 2PHNA 2VGNA 1JFFB 5MN4A 4TZZA 3HKDA 5EYPB 5ITZB 2GZLA 4X1YA 3LWQC 3CPWF 4BVTA 4BW0B 3RYHA 5J2UB 2B33A 3LDTA 4BVQA 5EZYB 3P10A 4BT6A 5HXUA 2KGWA 3MDOA 4IIJB 2LBWA 3NVIB 4I50A 1Z5VA 1SA0B 3NMUC 2GVIA 5LP6A 5A2QM 4G88A 2IAFA 4BVSA 4E6EA 3JATB 3P4EA 3I56F 2HP0A 4X1KA 3S0YA 1W2BF 4ZHQB 3K14A 3MQWA 4TV8A 5FNVB 1T0KB 1VQLF 1IV2A 1UI9A 3I55F 2FGYA 3JASA 3CC4F 3OONA 4O2AB 5FLXM 5G4UC 1RQ7A 3LFOA 4I55B 3JALB 1XV2A 1H48A 3RYIB 1K73H 1QVGF 3MBMA 4C8GA 2WALA 5IJ9B 3RA5A 4DRXA 5C8YA 5IJ9A 4NUTA 4IHJA 5KMGB 3M1XA 3K0TA 3RE3A 3RYIA 3KIZA 4G4ZA 4O2BA 4I4TB 3WPWA 1YIJF 3NVKE 3N4YA 3LWOC 4O4IA 2NMUA 3WGNA 4O4HB 3FFMA 2ZOVA 1CN7A 3WGJA 3OW2F 4U3JA 2UZHA 5HY4A 4YJ2A 4BY9D 1IV3A 1SA0A 5IYZB 1FNJA 4I50B 1VQ5F 1FFXA 4IIJA
chains in the Genus database with same CATH topology
2KG4A 3PAFA 1VQ9F 3CCQF 1CK2A 5IT9M 5HY0A 3LWRC 1YJWF 1IPAA 3CCLF 3V7EA 5G4VC 3HAXD 5GIPC 3D00A 3CCJF 4BVRA 3SIVA 1Q86H 1VQ8F 3CG6A 4XCQA 2F9ZC 2QEXF 1YITF 1K9MH 1YJ9F 2VGMA 3CCUF 3CMEF 2AIFA 1VQ7F 2KTUA 1KD1H 3NK7A 5HY2A 2VGNA 1Q82H 5DCVA 4TZZA 3ON1A 1K8AH 1N8RH 3LWVC 3JCMM 3V3TA 3LWQC 3G6EF 3AGKA 3CPWF 2BO1A 3OBYA 4BVTA 4BW0B 3G71F 1YI2F 5HXZA 2OZBA 1QVFF 1RA4A 4BVQA 3MCAB 3CMAF 3WXMB 2OTJF 1Q7YH 1M1KH 1VQNF 3OBWA 4X3LA 1W42A 5HXUA 3J81M 5GANK 3E1YA 3J7AR 3V7QA 1JJ2F 3NVIB 2OHWA 2LBWA 5HWEA 5EO3A 1GO1A 3CC7F 3CD6F 3NMUC 3N4ZA 5A2QM 4BVSA 4EI8A 1YJNF 1XBIA 2HVYD 1W3EX 3I56F 3CC2F 1NJIH 1W2BF 1VQ6F 3CCMF 1Q81H 1VQMF 1T0KB 1VQLF 1ZWZA 3I55F 2FGYA 3CC4F 3JAMM 1RLGA 2FC3A 5FLXM 5G4UC 2QA4F 1NMUB 3LFOA 3HJWC 1W41A 2CZWA 3CPQA 1SDSA 1S72F 1K73H 1QVGF 3NK6A 5EWRA 2WALA 1KC8H 3IR9A 2I6DA 1VQ4F 5GAPK 3GYQA 3RA5A 3VI6A 4NUTA 1GO0A 1DT9A 3RA6A 3CXCF 4LCKA 3J80M 4X3MA 3LWPC 4C4WC 4EI7A 5HY1A 3G4SF 1KQSF 2OTLF 1VQOF 2QI2A 3VMFB 1GZ0A 5GIOC 3CCEF 1YIJF 2KTVA 2LBXA 1E7KA 1X7PA 3NVKE 1H7MA 4EI9A 3N4YA 1X52A 1X7OA 3LWOC 3CCSF 3FFMA 1CN7A 1M90H 3OW2F 2ALEA 2GLZA 5FJ4C 5HY4A 3CCRF 3SIUA 3O85A 1YHQF 4NQ3A 5GINC 1W40A 4BY9D 3PLAC 2JNBA 1PXWA 3E20B 1VQPF 3CCVF 1VQKF 1VQ5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG4 A;  3PAF A;  1VQ9 F;  3CCQ F;  1CK2 A;  5IT9 M;  3LWR C;  1YJW F;  1IPA A;  3CCL F;  3V7E A;  5G4V C;  3HAX D;  5GIP C;  3CCJ F;  3SIV A;  1Q86 H;  1VQ8 F;  3CG6 A;  2QEX F;  1YIT F;  1K9M H;  1YJ9 F;  2VGM A;  3CCU F;  3CME F;  2AIF A;  1VQ7 F;  2KTU A;  1KD1 H;  3NK7 A;  2VGN A;  1Q82 H;  5DCV A;  4TZZ A;  3ON1 A;  1K8A H;  1N8R H;  3LWV C;  3JCM M;  3LWQ C;  3G6E F;  3AGK A;  3CPW F;  2BO1 A;  3OBY A;  1YI2 F;  4BW0 B;  3G71 F;  2OZB A;  1QVF F;  1RA4 A;  3MCA B;  3CMA F;  3WXM B;  2OTJ F;  1Q7Y H;  1M1K H;  1VQN F;  3OBW A;  4X3L A;  1W42 A;  3J81 M;  5GAN K;  3E1Y A;  3J7A R;  3V7Q A;  1JJ2 F;  3NVI B;  2OHW A;  2LBW A;  5EO3 A;  1GO1 A;  3CC7 F;  3CD6 F;  3NMU C;  3N4Z A;  5A2Q M;  1YJN F;  1XBI A;  2HVY D;  1W3E X;  3I56 F;  3CC2 F;  1NJI H;  1W2B F;  1VQ6 F;  3CCM F;  1Q81 H;  1VQM F;  1T0K B;  1VQL F;  1ZWZ A;  3I55 F;  3CC4 F;  3JAM M;  1RLG A;  2FC3 A;  5FLX M;  5G4U C;  2QA4 F;  1NMU B;  3LFO A;  3HJW C;  1W41 A;  2CZW A;  3CPQ A;  1SDS A;  1S72 F;  1K73 H;  1QVG F;  3NK6 A;  5EWR A;  2WAL A;  1KC8 H;  3IR9 A;  2I6D A;  1VQ4 F;  5GAP K;  3GYQ A;  3RA5 A;  3VI6 A;  4NUT A;  1GO0 A;  1DT9 A;  3RA6 A;  3CXC F;  4LCK A;  3J80 M;  4X3M A;  3LWP C;  4C4W C;  3G4S F;  1KQS F;  2OTL F;  1VQO F;  2QI2 A;  3VMF B;  1GZ0 A;  5GIO C;  3CCE F;  1YIJ F;  2KTV A;  2LBX A;  1E7K A;  1X7P A;  3NVK E;  1H7M A;  3N4Y A;  1X52 A;  1X7O A;  3LWO C;  3CCS F;  3FFM A;  1CN7 A;  1M90 H;  3OW2 F;  2ALE A;  5FJ4 C;  3CCR F;  3SIU A;  3O85 A;  1YHQ F;  5GIN C;  1W40 A;  4BY9 D;  3PLA C;  2JNB A;  1PXW A;  3E20 B;  1VQP F;  3CCV F;  1VQK F;  1VQ5 F; 
#chains in the Genus database with same CATH topology
 2UYN A;  2Z1F A;  1CK2 A;  3CYP B;  5CA1 A;  1RLU A;  2Z1T A;  3WGM A;  5IYZ A;  3LWR C;  1YJW F;  3CCL F;  5IT9 M;  3S02 A;  3HAX D;  1ONI A;  4X20 B;  3D00 A;  5GIP C;  4YJ2 B;  3CCJ F;  5J2U A;  1VQ8 F;  3CG6 A;  4XCQ A;  2F9Z C;  1T0A A;  4X1Y B;  2VGM A;  1XHO A;  3CME F;  4O4H A;  4BT4 A;  4ERH A;  2Q1X A;  1JFF A;  3RYC B;  1QU9 A;  5JH7 A;  3VCZ A;  3E22 A;  5DCV A;  3S06 A;  3K12 A;  3ON1 A;  4ZI7 A;  1RQ2 A;  2RB9 A;  1W55 A;  2BTQ B;  4U39 A;  3G6E F;  1YI2 F;  3C9U A;  3OBY A;  5HXZ A;  2OZB A;  1DBF A;  1QVF F;  1Q7Y H;  1M1K H;  3ZO8 A;  3U0O A;  1VQN F;  5GAN K;  3D54 A;  3E1Y A;  3JAL A;  1JJ2 F;  2OHW A;  1W59 A;  5MN5 A;  3JAS B;  3IEQ A;  4ZOL B;  2VAW A;  4WBN A;  4ZHQ A;  1YJN F;  4RHA A;  2H6L A;  1W3E X;  1VH8 A;  2ZAU A;  1COM A;  2ZVZ A;  3CC2 F;  1VQ6 F;  2V9Y A;  4HNA B;  4B62 A;  1ZWZ A;  4B5C A;  3EOR A;  2LCA A;  3VTI C;  3F0D A;  1RLG A;  2FC3 A;  2W8B C;  4G4W A;  4PWT A;  2QA4 F;  3UT5 B;  4R40 B;  3VOA A;  1NMU B;  3P0Z A;  3LME A;  3HJW C;  3RYF A;  3CPQ A;  1SDS A;  2CW4 A;  3HKE B;  3S0H A;  3NK6 A;  5EWR A;  5EZY A;  3R0P A;  2I6D A;  1VQ4 F;  5GAP K;  1VHA A;  3KHN A;  3I7T A;  3VI6 A;  1CLI A;  1GO0 A;  3LYB A;  3JAK B;  4ZHW A;  3J80 M;  5KX5 B;  3LWP C;  4C4W C;  1VQO F;  3VMF B;  5EIB D;  3TD3 A;  5CB4 A;  2CWJ A;  1OFU A;  5GIO C;  3TD5 A;  1W58 1;  2I6R A;  1H7M A;  1W5E A;  1X52 A;  1X7O A;  2PMP A;  3ZP4 A;  4C82 A;  4G4X A;  4HNA A;  4TV9 A;  2ZVY A;  3JAR A;  5FJ4 C;  3SIU A;  4O4L B;  3O85 A;  1YHQ F;  3WJQ A;  3JAW B;  4TUY A;  1W40 A;  4WBN B;  3QUW A;  1U43 A;  2JNB A;  5JVD A;  3N2K A;  3CCV F;  1VQK F;  3PAF A;  3M4S A;  2RHJ A;  3VIU A;  3WGK A;  5GON B;  3HKB A;  4O4L A;  3BYQ A;  2OTM A;  3SIV A;  3FBA A;  1Q86 H;  5B8F A;  2N48 A;  2QEX F;  4ZHY B;  2ZOD A;  3ZP7 A;  1YJ9 F;  1VQ7 F;  2RHO A;  4ZI7 B;  2HP3 A;  3E22 B;  5HY2 A;  3ESJ A;  4RQO A;  3I3F A;  1TUB B;  3RYC A;  1Q82 H;  5CB4 B;  2HQS C;  3FD6 A;  4O4J B;  3LWV C;  3KJK A;  3JCM M;  2CSL A;  3V3T A;  1IV4 A;  3AGK A;  2BO1 A;  3JAK A;  3G71 F;  4FFB A;  5LOV A;  1OAP A;  1VQV A;  3IEW A;  3CMA F;  1U40 A;  3WXM B;  1W5F A;  3HKE A;  5CA1 B;  3J81 M;  5CA0 B;  3J7A R;  2VXY A;  2CVL A;  2R75 1;  1FFX B;  5KMG A;  2R6R 1;  2G9I A;  1TVK A;  1GO1 A;  3CD6 F;  1JD1 A;  1FNK A;  3HWU A;  3N4Z A;  2L26 A;  3C9T A;  3N2G A;  1U3L A;  3VO8 A;  3F0E A;  4DXD A;  2UYK A;  2CHS A;  1H47 A;  2YXZ A;  4U3J B;  1Q8R A;  2DT4 A;  2ZF8 A;  5EB0 A;  3CCM F;  1VQM F;  2BTO A;  4ZOL A;  2EWC A;  2IQQ A;  1Z5W A;  3GTZ A;  4BT5 A;  3S0W A;  5JQG A;  1JY8 A;  1W41 A;  1S72 F;  1R1M A;  1KC8 H;  4DRX B;  4YJ3 A;  3IR9 A;  3WGL A;  3GYQ A;  2RHL A;  2UYP A;  4EB6 A;  3CXC F;  1W57 A;  4F6R B;  4X3M A;  5EB1 B;  4EI7 A;  5HY1 A;  5JQG B;  3MCQ A;  2OTL F;  2QI2 A;  3VOB A;  4BT7 A;  2AMT A;  1YGY A;  3CB2 A;  5J2T B;  1QAH A;  1W5A A;  1M90 H;  5JCO C;  4NWO B;  2ALE A;  2GLZ A;  5LYJ A;  2HX0 A;  3IKE A;  3TD4 A;  3CCR F;  3JAT A;  4X20 A;  1W5B A;  5GIN C;  3PLA C;  1NQ3 A;  2VAM A;  3N2G B;  4M8I A;  4ZHV A;  5LA6 B;  5LP6 B;  1PF5 A;  2QTP A;  1PXW A;  1VQP F;  4C8E A;  1TVK B;  1J7H A;  2UYN B;  3QHD A;  3GHZ A;  5CA0 A;  5HP8 A;  3L7Q A;  5LA6 A;  5G4V C;  2AIZ P;  3KJJ A;  1SZQ A;  3Q8H A;  4BVR A;  3VYT C;  3IMP A;  2HS0 A;  5LYJ B;  1YIT F;  2RHH A;  3DDN A;  5J2T A;  5ITZ A;  3QTY A;  5EYP A;  4BT2 A;  3HKD B;  4O4J A;  4O4I B;  3DC2 A;  1KD1 H;  3NK7 A;  2HS3 A;  2BTU A;  5IJ0 A;  2Z01 A;  1K8A H;  4I4T A;  5MN6 A;  4O2B B;  1N8R H;  4LNU B;  4F6R A;  3WJR A;  4EB6 B;  1FSZ A;  4IHJ B;  5C8Y B;  2LBT A;  3HKB B;  1RA4 A;  3JVH A;  5GON A;  4YJ3 B;  1VK3 A;  1XRG A;  3HKC B;  3MCA B;  3FPI A;  2OTJ F;  3OBW A;  4X3L A;  1W42 A;  3V7Q A;  4I55 A;  5HWE A;  5EO3 A;  2HRU A;  4O2A A;  5JCO A;  3CC7 F;  1UFY A;  1QD9 A;  3IKF A;  2Q1Y A;  4EI8 A;  4TV8 B;  5FNV A;  3C8L A;  2UYJ A;  1XBI A;  4G4V A;  2HVY D;  2HP0 B;  1KNK A;  4X1K B;  4C81 A;  3F6M A;  4X1I A;  3JAR B;  1NJI H;  3F0F A;  4TV9 B;  2DYY A;  3HTN A;  5EAZ A;  5HP7 A;  1Q81 H;  3K2X A;  5AVM A;  3JAM M;  2Z1U A;  4KWE A;  4ZK7 A;  2CHT A;  3KE1 A;  3ERN A;  5EIB C;  3WJP A;  3M84 A;  4B46 A;  4BT3 A;  5KX5 A;  2CZW A;  2H8C A;  2MQE A;  3ELC A;  3VYU C;  2P6Y A;  2IG8 A;  5LOV B;  4FFB B;  3RYH B;  1DT9 A;  3RA6 A;  1ODE A;  3CYQ A;  1JN1 A;  4LCK A;  3RYF B;  3G4S F;  1KQS F;  3UT5 A;  1GZ0 A;  3CCE F;  2KTV A;  2LBX A;  1TUB A;  1X7P A;  2HRY A;  1E7K A;  4EI9 A;  3S03 A;  5LP6 C;  3CCS F;  3C9R A;  1U3P A;  4X1I B;  2Z1E A;  3T80 A;  1YQN A;  5BMV A;  3ZOP A;  2HS4 A;  1KNJ A;  4NQ3 A;  3C9S A;  3D01 A;  2YYE A;  5LXT B;  1IV1 A;  4B45 A;  2VAP A;  3E20 B;  2K1S A;  1GX1 A;  3N2K B;  2KG4 A;  5JVD B;  1VQ9 F;  3CCQ F;  3F0G A;  3FD5 A;  1X25 A;  5HY0 A;  2H8E A;  1IPA A;  3V7E A;  5LXT A;  3HKC A;  3JAW A;  4TUY B;  3WPX A;  3B6N A;  5BMV B;  4G4Y A;  1K9M H;  3CCU F;  4LNU A;  2AIF A;  2KTU A;  3V4D A;  5JH7 B;  4C8I A;  3VYS C;  5IJ0 B;  2PHN A;  2VGN A;  1JFF B;  5MN4 A;  4TZZ A;  3HKD A;  5EYP B;  5ITZ B;  2GZL A;  4X1Y A;  3LWQ C;  3CPW F;  4BVT A;  4BW0 B;  3RYH A;  5J2U B;  2B33 A;  3LDT A;  4BVQ A;  5EZY B;  3P10 A;  4BT6 A;  5HXU A;  2KGW A;  3MDO A;  4IIJ B;  2LBW A;  3NVI B;  4I50 A;  1Z5V A;  1SA0 B;  3NMU C;  2GVI A;  5LP6 A;  5A2Q M;  4G88 A;  2IAF A;  4BVS A;  4E6E A;  3JAT B;  3P4E A;  3I56 F;  2HP0 A;  4X1K A;  3S0Y A;  1W2B F;  4ZHQ B;  3K14 A;  3MQW A;  4TV8 A;  5FNV B;  1T0K B;  1VQL F;  1IV2 A;  1UI9 A;  3I55 F;  2FGY A;  3JAS A;  3CC4 F;  3OON A;  4O2A B;  5FLX M;  5G4U C;  1RQ7 A;  3LFO A;  4I55 B;  3JAL B;  1XV2 A;  1H48 A;  3RYI B;  1K73 H;  1QVG F;  3MBM A;  4C8G A;  2WAL A;  5IJ9 B;  3RA5 A;  4DRX A;  5C8Y A;  5IJ9 A;  4NUT A;  4IHJ A;  5KMG B;  3M1X A;  3K0T A;  3RE3 A;  3RYI A;  3KIZ A;  4G4Z A;  4O2B A;  4I4T B;  3WPW A;  1YIJ F;  3NVK E;  3N4Y A;  3LWO C;  4O4I A;  2NMU A;  3WGN A;  4O4H B;  3FFM A;  2ZOV A;  1CN7 A;  3WGJ A;  3OW2 F;  4U3J A;  2UZH A;  5HY4 A;  4YJ2 A;  4BY9 D;  1IV3 A;  1SA0 A;  5IYZ B;  1FNJ A;  4I50 B;  1VQ5 F;  1FFX A;  4IIJ A; 
#chains in the Genus database with same CATH homology
 2KG4 A;  3PAF A;  1VQ9 F;  3CCQ F;  1CK2 A;  5IT9 M;  5HY0 A;  3LWR C;  1YJW F;  1IPA A;  3CCL F;  3V7E A;  5G4V C;  3HAX D;  5GIP C;  3D00 A;  3CCJ F;  4BVR A;  3SIV A;  1Q86 H;  1VQ8 F;  3CG6 A;  4XCQ A;  2F9Z C;  2QEX F;  1YIT F;  1K9M H;  1YJ9 F;  2VGM A;  3CCU F;  3CME F;  2AIF A;  1VQ7 F;  2KTU A;  1KD1 H;  3NK7 A;  5HY2 A;  2VGN A;  1Q82 H;  5DCV A;  4TZZ A;  3ON1 A;  1K8A H;  1N8R H;  3LWV C;  3JCM M;  3V3T A;  3LWQ C;  3G6E F;  3AGK A;  3CPW F;  2BO1 A;  3OBY A;  4BVT A;  4BW0 B;  3G71 F;  1YI2 F;  5HXZ A;  2OZB A;  1QVF F;  1RA4 A;  4BVQ A;  3MCA B;  3CMA F;  3WXM B;  2OTJ F;  1Q7Y H;  1M1K H;  1VQN F;  3OBW A;  4X3L A;  1W42 A;  5HXU A;  3J81 M;  5GAN K;  3E1Y A;  3J7A R;  3V7Q A;  1JJ2 F;  3NVI B;  2OHW A;  2LBW A;  5HWE A;  5EO3 A;  1GO1 A;  3CC7 F;  3CD6 F;  3NMU C;  3N4Z A;  5A2Q M;  4BVS A;  4EI8 A;  1YJN F;  1XBI A;  2HVY D;  1W3E X;  3I56 F;  3CC2 F;  1NJI H;  1W2B F;  1VQ6 F;  3CCM F;  1Q81 H;  1VQM F;  1T0K B;  1VQL F;  1ZWZ A;  3I55 F;  2FGY A;  3CC4 F;  3JAM M;  1RLG A;  2FC3 A;  5FLX M;  5G4U C;  2QA4 F;  1NMU B;  3LFO A;  3HJW C;  1W41 A;  2CZW A;  3CPQ A;  1SDS A;  1S72 F;  1K73 H;  1QVG F;  3NK6 A;  5EWR A;  2WAL A;  1KC8 H;  3IR9 A;  2I6D A;  1VQ4 F;  5GAP K;  3GYQ A;  3RA5 A;  3VI6 A;  4NUT A;  1GO0 A;  1DT9 A;  3RA6 A;  3CXC F;  4LCK A;  3J80 M;  4X3M A;  3LWP C;  4C4W C;  4EI7 A;  5HY1 A;  3G4S F;  1KQS F;  2OTL F;  1VQO F;  2QI2 A;  3VMF B;  1GZ0 A;  5GIO C;  3CCE F;  1YIJ F;  2KTV A;  2LBX A;  1E7K A;  1X7P A;  3NVK E;  1H7M A;  4EI9 A;  3N4Y A;  1X52 A;  1X7O A;  3LWO C;  3CCS F;  3FFM A;  1CN7 A;  1M90 H;  3OW2 F;  2ALE A;  2GLZ A;  5FJ4 C;  5HY4 A;  3CCR F;  3SIU A;  3O85 A;  1YHQ F;  4NQ3 A;  5GIN C;  1W40 A;  4BY9 D;  3PLA C;  2JNB A;  1PXW A;  3E20 B;  1VQP F;  3CCV F;  1VQK F;  1VQ5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...