2EWCA

Structure of hypothetical protein from streptococcus pyogenes m1 gas, member of highly conserved yjgf family of proteins
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
TIRRYDVNEDRGHTGLVEAGDFYYLNYCVGNVGQDIESQINGAFDEMERRLALVGLTLDAVVQMDCLFRDVWNIPVMEKMIKERFNGRYPARKSIQTEFAHHGGPQGLLFQVDGVAYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title Structure of hypothetical protein from Streptococcus pyogenes M1 GAS, member of highly conserved yjgF family of proteins
rcsb
source organism Streptococcus pyogenes
total genus 31
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2ewcA00
1ONIA 3M4SA 1FNJA 1FNKA 1PF5A 3ZP4A 3MQWA 3V4DA 1X25A 2UYJA 2OTMA 3M1XA 2CHTA 2CVLA 2B33A 2CHSA 5HP7A 3I3FA 1QAHA 2UYNA 3L7QA 3ZP7A 1ODEA 2UYKA 2CWJA 3QUWA 2CSLA 1JD1A 3LMEA 3VCZA 1COMA 1NQ3A 1QU9A 2UYPA 2IG8A 3KJJA 1QD9A 1DBFA 3GTZA 5HP8A 3ZO8A 4NWOB 1XHOA 1J7HA 2UYNB 3K0TA 2CW4A 4ZK7A 1UFYA 3LYBA 1UI9A 3R0PA 2EWCA 1XRGA 3K12A 3I7TA 3KJKA 2DYYA 3D01A 3ZOPA
chains in the Genus database with same CATH superfamily
1KD1H 1RA4A 1SA0A 1IV2A 3WJQA 4YJ3A 5CA0B 5LOVB 5KMGA 2L26A 4M8IA 2R751 3FBAA 4YJ2B 4BT7A 1M1KH 1YJNF 1YIJF 3OONA 3VMFB 4X1IA 3J80M 3K0TA 4O2AB 3S0HA 2BO1A 2MQEA 2BTQB 4IHJA 3TD4A 1K9MH 3CCMF 3I55F 1TVKB 2RHOA 3SIVA 3JARB 2FC3A 2ZODA 3ELCA 4X1YA 3JAKB 1OAPA 4BW0B 5JVDB 2UYNA 1VQ8F 4O4LA 4I55B 1PXWA 3LWRC 2VAWA 1W59A 3HKEA 3IKEA 4X20A 3OW2F 5ITZB 1QVGF 4G4WA 4ZI7A 3CD6F 5LXTA 4R40B 5HP8A 3P0ZA 4G4XA 4I4TA 2VGMA 2CZWA 1RQ7A 4U39A 2WALA 3U0OA 2KTUA 5JH7B 4C82A 4RQOA 1JN1A 4G4ZA 2HRYA 3DC2A 4WBNB 3HKCA 1FFXA 3G4SF 4O4IA 2OTLF 1W57A 1W5EA 1Q81H 5LA6B 1W581 3J81M 1U3LA 5CB4B 3I3FA 2AIZP 3QTYA 1YI2F 4IIJB 3IKFA 2I6RA 3WGNA 1VQ7F 1RLUA 1X7OA 2DT4A 5BMVB 5FNVB 1IPAA 2UYPA 3ERNA 3JASB 1VH8A 2NMUA 1Z5WA 2H8EA 3S0WA 5EYPB 1K73H 3GHZA 2LCAA 4ZK7A 3CCUF 4BVTA 5GINC 3TD3A 4X3LA 1VQ4F 3I7TA 1YJ9F 1K8AH 2V9YA 1ONIA 4BT2A 3VYUC 3C9TA 3I56F 1VQ6F 3PAFA 3S06A 3IR9A 4X1KB 3HKDB 2JNBA 3HAXD 1TUBB 3RYIA 1VQVA 2HP0A 3JAMM 3F6MA 2VGNA 2HVYD 5HY4A 5JQGB 3G71F 3F0GA 3JCMM 3V7QA 2I6DA 3K2XA 3CCSF 1FSZA 2ZOVA 3HTNA 5G4VC 5GIPC 2OTJF 3CPQA 5HXZA 3NK7A 1X7PA 3CC2F 3OBYA 1ZWZA 3WJRA 3WGKA 3E22B 1U3PA 3CPWF 5FLXM 4I50A 3MCQA 2F9ZC 3JATA 2H8CA 4C81A 1Z5VA 2AMTA 2Q1YA 2B33A 5MN5A 4LNUA 4FFBA 5CA1B 2ZVYA 5EAZA 5EZYB 3RA6A 3MBMA 4RHAA 5J2UA 4HNAB 2Z1FA 2RHJA 2IAFA 2IG8A 5GONB 3RYCB 3GTZA 1CK2A 2UZHA 1VK3A 3ON1A 5CA0A 2RHHA 4C8GA 3S03A 3N2KB 3RYFB 2DYYA 4ZHWA 1Q82H 3IEWA 2AIFA 1FNJA 3FPIA 4EB6B 3ZP4A 3MQWA 4TUYB 1YGYA 5GAPK 1YHQF 5IJ9A 2GZLA 4O2AA 3LWOC 1H47A 2UYKA 1SZQA 4ZHQB 1N8RH 5MN4A 1TVKA 1NQ3A 3M84A 3JARA 4TV9B 3KJJA 2YXZA 1M90H 4O4HB 5J2TB 2ZF8A 5EIBD 1VQ9F 2Z1EA 4I55A 3ESJA 3CCRF 5DCVA 3N2GB 4B5CA 4C8IA 2HQSC 3D01A 3C9SA 4BVRA 5ITZA 4DRXB 1KNKA 4LCKA 3B6NA 2CHTA 3JALB 1KNJA 3Q8HA 1YJWF 4O4JB 3F0FA 5JH7A 1W5AA 5C8YB 3HWUA 4ZHYB 2HX0A 3VCZA 1QU9A 1NMUB 1SA0B 1VQPF 1CN7A 4YJ3B 4ZOLA 3JVHA 2Z01A 3KHNA 3WPXA 1IV1A 5CB4A 4U3JA 2ZAUA 2OZBA 3R0PA 4IIJA 2GLZA 3WJPA 5BMVA 5FNVA 5EWRA 3JASA 5GIOC 1W5BA 2RB9A 2VAMA 4IHJB 3SIUA 3E20B 3QUWA 4EI7A 3CCLF 5KX5A 4NQ3A 5EO3A 3MDOA 3ZO8A 1T0AA 1XHOA 2UYNB 3IMPA 3HKDA 4O2BB 4X1KA 5EB0A 4B45A 3HKEB 1TUBA 3LYBA 2FGYA 1NJIH 3EORA 3ZOPA 3VIUA 2HS0A 3C9UA 3P10A 4I4TB 3QHDA 5IT9M 4F6RA 2QI2A 2CVLA 3VOAA 3MCAB 2Z1TA 3C8LA 2CSLA 1JD1A 3VO8A 3HKCB 1FFXB 4O4IB 2PHNA 2QEXF 3HKBA 4BT4A 5FJ4C 3LWPC 3CCEF 1CLIA 1UFYA 5CA1A 3N4ZA 1VQKF 5EZYA 4HNAA 4BT3A 5GONA 3RYCA 2BTUA 5LYJB 1Q7YH 2CHSA 2Z1UA 3HJWC 3WXMB 3UT5B 1H48A 3ZP7A 5IJ0B 4EI9A 3N2KA 1DT9A 3LDTA 1VQMF 3RYHA 2PMPA 5IYZB 2LBXA 3KE1A 3CC7F 4TV8B 3VI6A 4EB6A 2N48A 2P6YA 4TUYA 3P4EA 1R1MA 3KIZA 3O85A 1JJ2F 3S0YA 3LWQC 3LFOA 5LOVA 3KJKA 4ZHQA 2G9IA 3TD5A 1VHAA 4E6EA 1U40A 3CB2A 4YJ2A 4KWEA 1FNKA 2QTPA 3V4DA 3D00A 3CYQA 1RQ2A 3N4YA 4O4HA 3VTIC 3WPWA 1W55A 3JAWB 3LMEA 4I50B 5LP6B 3J7AR 2ALEA 3CMEF 5EIBC 1W41A 1J7HA 5AVMA 4BVQA 3CYPB 3JAKA 1XV2A 1W3EX 5JVDA 4O4JA 1JFFB 1U43A 5C8YA 1W5FA 3PLAC 4BT5A 5HWEA 2OTMA 3G6EF 1OFUA 4C4WC 1VQOF 3D54A 2HS3A 1IV4A 3OBWA 3NVIB 4WBNA 3WGMA 2W8BC 5IJ9B 2RHLA 5LA6A 5G4UC 1X52A 5KMGB 1XRGA 1IV3A 1YQNA 3GYQA 4DXDA 1SDSA 5JCOC 1Q86H 3CMAF 3M4SA 2IQQA 4C8EA 4X1IB 4EI8A 3M1XA 2KTVA 4G4VA 4O2BA 4X3MA 5EYPA 3L7QA 3AGKA 5HY2A 4TZZA 2HP3A 4G88A 3VYSC 3E1YA 5EB1B 1QD9A 3VOBA 4X1YB 1W42A 2YYEA 3CCJF 1S72F 2GVIA 1GO0A 4O4LB 5JCOA 1GX1A 1VQLF 4B62A 4NUTA 4X20B 4XCQA 1VQ5F 1W40A 4ZI7B 4ZOLB 3RE3A 3CG6A 1Q8RA 5LXTB 1RLGA 3RA5A 5JQGA 2UYJA 5HY1A 4U3JB 2LBWA 1KC8H 5HP7A 1QAHA 1YITF 4B46A 2CWJA 3LWVC 1E7KA 5HY0A 3VYTC 5A2QM 3WGJA 3E22A 1DBFA 1JY8A 5LYJA 4ZHVA 4BY9D 5B8FA 1QVFF 4ERHA 2BTOA 3UT5A 1T0KB 1UI9A 5IJ0A 2EWCA 3FD5A 3CXCF 2R6R1 5KX5B 5IYZA 3NMUC 1W2BF 3FFMA 4TV8A 3CCQF 1X25A 3IEQA 2VAPA 5LP6C 3S02A 3FD6A 3RYFA 3F0DA 4F6RB 4NWOB 3DDNA 3NK6A 3NVKE 2OHWA 2CW4A 4BT6A 5HXUA 2K1SA 3RYIB 3JAWA 2HP0B 1XBIA 2HRUA 3K12A 3HKBB 2KG4A 2H6LA 5LP6A 3CC4F 1PF5A 4TV9A 5MN6A 2HS4A 1GZ0A 3V3TA 4G4YA 1ODEA 5J2TA 5GANK 3CCVF 1H7MA 3K14A 1JFFA 2LBTA 3N2GA 4BVSA 1COMA 3F0EA 1VQNF 3T80A 2KGWA 2ZVZA 2VXYA 3JATB 4PWTA 2QA4F 4DRXA 3C9RA 1GO1A 4LNUB 4FFBB 2Q1XA 3WGLA 3JALA 3RYHB 1KQSF 5J2UB 3BYQA 3V7EA
chains in the Genus database with same CATH topology
1ONIA 3M4SA 1FNJA 1FNKA 1PF5A 3ZP4A 3MQWA 3V4DA 1X25A 2UYJA 2OTMA 3M1XA 2CHTA 2CVLA 2B33A 2CHSA 5HP7A 3I3FA 1QAHA 2UYNA 3L7QA 3ZP7A 1ODEA 2UYKA 2CWJA 3QUWA 2CSLA 1JD1A 3LMEA 3VCZA 1COMA 1NQ3A 1QU9A 2UYPA 2IG8A 3KJJA 1QD9A 1DBFA 3GTZA 5HP8A 3ZO8A 4NWOB 1XHOA 1J7HA 2UYNB 3K0TA 2CW4A 4ZK7A 1UFYA 3LYBA 1UI9A 3R0PA 2EWCA 1XRGA 3K12A 3I7TA 3KJKA 2DYYA 3D01A 3ZOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONI A;  3M4S A;  1FNJ A;  1FNK A;  1PF5 A;  3ZP4 A;  3MQW A;  3V4D A;  1X25 A;  2UYJ A;  2OTM A;  3M1X A;  2CHT A;  2CVL A;  2B33 A;  2CHS A;  5HP7 A;  3I3F A;  1QAH A;  2UYN A;  3L7Q A;  3ZP7 A;  1ODE A;  2UYK A;  2CWJ A;  3QUW A;  2CSL A;  1JD1 A;  3LME A;  3VCZ A;  1COM A;  1NQ3 A;  1QU9 A;  2UYP A;  2IG8 A;  3KJJ A;  1QD9 A;  1DBF A;  3GTZ A;  5HP8 A;  3ZO8 A;  4NWO B;  1XHO A;  1J7H A;  2UYN B;  3K0T A;  2CW4 A;  4ZK7 A;  1UFY A;  3LYB A;  1UI9 A;  3R0P A;  2EWC A;  1XRG A;  3K12 A;  3I7T A;  3KJK A;  2DYY A;  3D01 A;  3ZOP A; 
#chains in the Genus database with same CATH topology
 1KD1 H;  1RA4 A;  1SA0 A;  1IV2 A;  3WJQ A;  4YJ3 A;  5CA0 B;  5LOV B;  5KMG A;  2L26 A;  4M8I A;  2R75 1;  3FBA A;  4YJ2 B;  4BT7 A;  1M1K H;  1YJN F;  1YIJ F;  3OON A;  3VMF B;  4X1I A;  3J80 M;  3K0T A;  4O2A B;  3S0H A;  2BO1 A;  2MQE A;  2BTQ B;  4IHJ A;  3TD4 A;  1K9M H;  3CCM F;  3I55 F;  1TVK B;  2RHO A;  3SIV A;  3JAR B;  2FC3 A;  2ZOD A;  3ELC A;  4X1Y A;  3JAK B;  1OAP A;  4BW0 B;  5JVD B;  2UYN A;  1VQ8 F;  4O4L A;  4I55 B;  1PXW A;  3LWR C;  2VAW A;  1W59 A;  3HKE A;  3IKE A;  4X20 A;  3OW2 F;  5ITZ B;  1QVG F;  4G4W A;  4ZI7 A;  3CD6 F;  5LXT A;  4R40 B;  5HP8 A;  3P0Z A;  4G4X A;  4I4T A;  2VGM A;  2CZW A;  1RQ7 A;  4U39 A;  2WAL A;  3U0O A;  2KTU A;  5JH7 B;  4C82 A;  4RQO A;  1JN1 A;  4G4Z A;  2HRY A;  3DC2 A;  4WBN B;  3HKC A;  1FFX A;  3G4S F;  4O4I A;  2OTL F;  1W57 A;  1W5E A;  1Q81 H;  5LA6 B;  1W58 1;  3J81 M;  1U3L A;  5CB4 B;  3I3F A;  2AIZ P;  3QTY A;  1YI2 F;  4IIJ B;  3IKF A;  2I6R A;  3WGN A;  1VQ7 F;  1RLU A;  1X7O A;  2DT4 A;  5BMV B;  5FNV B;  1IPA A;  2UYP A;  3ERN A;  3JAS B;  1VH8 A;  2NMU A;  1Z5W A;  2H8E A;  3S0W A;  5EYP B;  1K73 H;  3GHZ A;  2LCA A;  4ZK7 A;  3CCU F;  4BVT A;  5GIN C;  3TD3 A;  4X3L A;  1VQ4 F;  3I7T A;  1YJ9 F;  1K8A H;  2V9Y A;  1ONI A;  4BT2 A;  3VYU C;  3C9T A;  3I56 F;  1VQ6 F;  3PAF A;  3S06 A;  3IR9 A;  4X1K B;  3HKD B;  2JNB A;  3HAX D;  1TUB B;  3RYI A;  1VQV A;  2HP0 A;  3JAM M;  3F6M A;  2VGN A;  2HVY D;  5HY4 A;  5JQG B;  3G71 F;  3F0G A;  3JCM M;  3V7Q A;  2I6D A;  3K2X A;  3CCS F;  1FSZ A;  2ZOV A;  3HTN A;  5G4V C;  5GIP C;  2OTJ F;  3CPQ A;  5HXZ A;  3NK7 A;  1X7P A;  3CC2 F;  3OBY A;  1ZWZ A;  3WJR A;  3WGK A;  3E22 B;  1U3P A;  3CPW F;  5FLX M;  4I50 A;  3MCQ A;  2F9Z C;  3JAT A;  2H8C A;  4C81 A;  1Z5V A;  2AMT A;  2Q1Y A;  2B33 A;  5MN5 A;  4LNU A;  4FFB A;  5CA1 B;  2ZVY A;  5EAZ A;  5EZY B;  3RA6 A;  3MBM A;  4RHA A;  5J2U A;  4HNA B;  2Z1F A;  2RHJ A;  2IAF A;  2IG8 A;  5GON B;  3RYC B;  3GTZ A;  1CK2 A;  2UZH A;  1VK3 A;  3ON1 A;  5CA0 A;  2RHH A;  4C8G A;  3S03 A;  3N2K B;  3RYF B;  2DYY A;  4ZHW A;  1Q82 H;  3IEW A;  2AIF A;  1FNJ A;  3FPI A;  4EB6 B;  3ZP4 A;  3MQW A;  4TUY B;  1YGY A;  5GAP K;  1YHQ F;  5IJ9 A;  2GZL A;  4O2A A;  3LWO C;  1H47 A;  2UYK A;  1SZQ A;  4ZHQ B;  1N8R H;  5MN4 A;  1TVK A;  1NQ3 A;  3M84 A;  3JAR A;  4TV9 B;  3KJJ A;  2YXZ A;  1M90 H;  4O4H B;  5J2T B;  2ZF8 A;  5EIB D;  1VQ9 F;  2Z1E A;  4I55 A;  3ESJ A;  3CCR F;  5DCV A;  3N2G B;  4B5C A;  4C8I A;  2HQS C;  3D01 A;  3C9S A;  4BVR A;  5ITZ A;  4DRX B;  1KNK A;  4LCK A;  3B6N A;  2CHT A;  3JAL B;  1KNJ A;  3Q8H A;  1YJW F;  4O4J B;  3F0F A;  5JH7 A;  1W5A A;  5C8Y B;  3HWU A;  4ZHY B;  2HX0 A;  3VCZ A;  1QU9 A;  1NMU B;  1SA0 B;  1VQP F;  1CN7 A;  4YJ3 B;  4ZOL A;  3JVH A;  2Z01 A;  3KHN A;  3WPX A;  1IV1 A;  5CB4 A;  4U3J A;  2ZAU A;  2OZB A;  3R0P A;  4IIJ A;  2GLZ A;  3WJP A;  5BMV A;  5FNV A;  5EWR A;  3JAS A;  5GIO C;  1W5B A;  2RB9 A;  2VAM A;  4IHJ B;  3SIU A;  3E20 B;  3QUW A;  4EI7 A;  3CCL F;  5KX5 A;  4NQ3 A;  5EO3 A;  3MDO A;  3ZO8 A;  1T0A A;  1XHO A;  2UYN B;  3IMP A;  3HKD A;  4O2B B;  4X1K A;  5EB0 A;  4B45 A;  3HKE B;  1TUB A;  3LYB A;  2FGY A;  1NJI H;  3EOR A;  3ZOP A;  3VIU A;  2HS0 A;  3C9U A;  3P10 A;  4I4T B;  3QHD A;  5IT9 M;  4F6R A;  2QI2 A;  2CVL A;  3VOA A;  3MCA B;  2Z1T A;  3C8L A;  2CSL A;  1JD1 A;  3VO8 A;  3HKC B;  1FFX B;  4O4I B;  2PHN A;  2QEX F;  3HKB A;  4BT4 A;  5FJ4 C;  3LWP C;  3CCE F;  1CLI A;  1UFY A;  5CA1 A;  3N4Z A;  1VQK F;  5EZY A;  4HNA A;  4BT3 A;  5GON A;  3RYC A;  2BTU A;  5LYJ B;  1Q7Y H;  2CHS A;  2Z1U A;  3HJW C;  3WXM B;  3UT5 B;  1H48 A;  3ZP7 A;  5IJ0 B;  4EI9 A;  3N2K A;  1DT9 A;  3LDT A;  1VQM F;  3RYH A;  2PMP A;  5IYZ B;  2LBX A;  3KE1 A;  3CC7 F;  4TV8 B;  3VI6 A;  4EB6 A;  2N48 A;  2P6Y A;  4TUY A;  3P4E A;  1R1M A;  3KIZ A;  3O85 A;  1JJ2 F;  3S0Y A;  3LWQ C;  3LFO A;  5LOV A;  3KJK A;  4ZHQ A;  2G9I A;  3TD5 A;  1VHA A;  4E6E A;  1U40 A;  3CB2 A;  4YJ2 A;  4KWE A;  1FNK A;  2QTP A;  3V4D A;  3D00 A;  3CYQ A;  1RQ2 A;  3N4Y A;  4O4H A;  3VTI C;  3WPW A;  1W55 A;  3JAW B;  3LME A;  4I50 B;  5LP6 B;  3J7A R;  2ALE A;  3CME F;  5EIB C;  1W41 A;  1J7H A;  5AVM A;  4BVQ A;  3CYP B;  3JAK A;  1XV2 A;  1W3E X;  5JVD A;  4O4J A;  1JFF B;  1U43 A;  5C8Y A;  1W5F A;  3PLA C;  4BT5 A;  5HWE A;  2OTM A;  3G6E F;  1OFU A;  4C4W C;  1VQO F;  3D54 A;  2HS3 A;  1IV4 A;  3OBW A;  3NVI B;  4WBN A;  3WGM A;  2W8B C;  5IJ9 B;  2RHL A;  5LA6 A;  5G4U C;  1X52 A;  5KMG B;  1XRG A;  1IV3 A;  1YQN A;  3GYQ A;  4DXD A;  1SDS A;  5JCO C;  1Q86 H;  3CMA F;  3M4S A;  2IQQ A;  4C8E A;  4X1I B;  4EI8 A;  3M1X A;  2KTV A;  4G4V A;  4O2B A;  4X3M A;  5EYP A;  3L7Q A;  3AGK A;  5HY2 A;  4TZZ A;  2HP3 A;  4G88 A;  3VYS C;  3E1Y A;  5EB1 B;  1QD9 A;  3VOB A;  4X1Y B;  1W42 A;  2YYE A;  3CCJ F;  1S72 F;  2GVI A;  1GO0 A;  4O4L B;  5JCO A;  1GX1 A;  1VQL F;  4B62 A;  4NUT A;  4X20 B;  4XCQ A;  1VQ5 F;  1W40 A;  4ZI7 B;  4ZOL B;  3RE3 A;  3CG6 A;  1Q8R A;  5LXT B;  1RLG A;  3RA5 A;  5JQG A;  2UYJ A;  5HY1 A;  4U3J B;  2LBW A;  1KC8 H;  5HP7 A;  1QAH A;  1YIT F;  4B46 A;  2CWJ A;  3LWV C;  1E7K A;  5HY0 A;  3VYT C;  5A2Q M;  3WGJ A;  3E22 A;  1DBF A;  1JY8 A;  5LYJ A;  4ZHV A;  4BY9 D;  5B8F A;  1QVF F;  4ERH A;  2BTO A;  3UT5 A;  1T0K B;  1UI9 A;  5IJ0 A;  2EWC A;  3FD5 A;  3CXC F;  2R6R 1;  5KX5 B;  5IYZ A;  3NMU C;  1W2B F;  3FFM A;  4TV8 A;  3CCQ F;  1X25 A;  3IEQ A;  2VAP A;  5LP6 C;  3S02 A;  3FD6 A;  3RYF A;  3F0D A;  4F6R B;  4NWO B;  3DDN A;  3NK6 A;  3NVK E;  2OHW A;  2CW4 A;  4BT6 A;  5HXU A;  2K1S A;  3RYI B;  3JAW A;  2HP0 B;  1XBI A;  2HRU A;  3K12 A;  3HKB B;  2KG4 A;  2H6L A;  5LP6 A;  3CC4 F;  1PF5 A;  4TV9 A;  5MN6 A;  2HS4 A;  1GZ0 A;  3V3T A;  4G4Y A;  1ODE A;  5J2T A;  5GAN K;  3CCV F;  1H7M A;  3K14 A;  1JFF A;  2LBT A;  3N2G A;  4BVS A;  1COM A;  3F0E A;  1VQN F;  3T80 A;  2KGW A;  2ZVZ A;  2VXY A;  3JAT B;  4PWT A;  2QA4 F;  4DRX A;  3C9R A;  1GO1 A;  4LNU B;  4FFB B;  2Q1X A;  3WGL A;  3JAL A;  3RYH B;  1KQS F;  5J2U B;  3BYQ A;  3V7E A; 
#chains in the Genus database with same CATH homology
 1ONI A;  3M4S A;  1FNJ A;  1FNK A;  1PF5 A;  3ZP4 A;  3MQW A;  3V4D A;  1X25 A;  2UYJ A;  2OTM A;  3M1X A;  2CHT A;  2CVL A;  2B33 A;  2CHS A;  5HP7 A;  3I3F A;  1QAH A;  2UYN A;  3L7Q A;  3ZP7 A;  1ODE A;  2UYK A;  2CWJ A;  3QUW A;  2CSL A;  1JD1 A;  3LME A;  3VCZ A;  1COM A;  1NQ3 A;  1QU9 A;  2UYP A;  2IG8 A;  3KJJ A;  1QD9 A;  1DBF A;  3GTZ A;  5HP8 A;  3ZO8 A;  4NWO B;  1XHO A;  1J7H A;  2UYN B;  3K0T A;  2CW4 A;  4ZK7 A;  1UFY A;  3LYB A;  1UI9 A;  3R0P A;  2EWC A;  1XRG A;  3K12 A;  3I7T A;  3KJK A;  2DYY A;  3D01 A;  3ZOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...