2EWCA

Structure of hypothetical protein from streptococcus pyogenes m1 gas, member of highly conserved yjgf family of proteins
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
b'TIRRYDVNEDRGHTGLVEAGDFYYLNYCVGNVGQDIESQINGAFDEMERRLALVGLTLDAVVQMDCLFRDVWNIPVMEKMIKERFNGRYPARKSIQTEFAHHGGPQGLLFQVDGVAYSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
molecule tags Structural genomics, unknown function
source organism Streptococcus pyogenes
publication title Structure of hypothetical protein from Streptococcus pyogenes M1 GAS, member of highly conserved yjgF family of proteins
rcsb
total genus 31
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2ewcA00
1NQ3A 1XRGA 3R0PA 2CHTA 2CSLA 2DYYA 3KJJA 2UYNB 3MQWA 1QAHA 1DBFA 2CVLA 3VCZA 1PF5A 1FNJA 1ODEA 1UFYA 1FNKA 5HP8A 3LYBA 1QU9A 2UYJA 2B33A 3KJKA 4ZK7A 3ZP7A 2CW4A 2EWCA 2UYKA 1COMA 3I7TA 3V4DA 3M1XA 3D01A 1UI9A 3GTZA 5HP7A 3K0TA 3L7QA 3ZO8A 3K12A 1X25A 2CHSA 2UYNA 3LMEA 3ZOPA 3I3FA 4NWOB 1J7HA 2OTMA 3QUWA 3M4SA 3ZP4A 1ONIA 1QD9A 2IG8A 2UYPA 2CWJA 1XHOA 1JD1A
chains in the Genus database with same CATH superfamily
2HQSC 4PWTA 2IAFA 3E20B 4BVTA 3N4ZA 5BMVB 3G71F 4RHAA 1Q8RA 4O2AB 3J81M 3CC4F 2HVYD 1N8RH 1VQKF 3P4EA 3RYFA 1NJIH 4O4HA 4ZHYB 3L7QA 5GONA 4X1IA 3JATA 3G6EF 1SA0A 3HWUA 5EYPB 1KNKA 3NVIB 3D54A 1M1KH 3I3FA 3LWRC 3UT5A 5MN4A 4G4YA 5GIOC 3CCJF 1UFYA 1ODEA 5HY4A 3WXMB 4B5CA 2I6RA 3FPIA 1W5BA 3HKBB 3NVKE 4DRXB 5MN5A 2WALA 3G4SF 3WGMA 1YGYA 5J2UB 1FNKA 1S72F 1NMUB 1RA4A 4NQ3A 5LA6A 3CD6F 2P6YA 1U43A 4O4IA 3U0OA 1VQ4F 1CN7A 2Z1UA 3I56F 4FFBB 2ALEA 3RYFB 3S06A 2BTOA 2RHOA 2OTMA 4DXDA 3WPXA 3JALB 3CG6A 2G9IA 5A2QM 4TUYB 4O4IB 3RYCB 3TD4A 1H48A 3RA6A 5HWEA 3KJKA 3CPWF 3K14A 4ZK7A 1YJWF 5HXZA 5JVDA 2FGYA 3HKBA 2UYKA 5IJ9B 3M1XA 2Z1FA 5GINC 4O2BA 5FNVB 3ZO8A 4I55B 3F6MA 4O4JB 4ZI7B 5DCVA 1J7HA 4B45A 1IV4A 3SIVA 3CC2F 2YYEA 4EB6B 3NK7A 2CHTA 2CSLA 4O2BB 2UYNB 3O85A 4ZHWA 4C82A 5IJ0A 1VH8A 1X7PA 2HS0A 2IQQA 4BT3A 5LYJB 3LYBA 4TZZA 5JH7A 4X3MA 4IHJB 3F0EA 3HTNA 2CW4A 3VTIC 1W59A 2OHWA 4G88A 1W5FA 2DT4A 3OONA 5JVDB 1VQ7F 2LBWA 5LP6C 4EI9A 4IIJB 1RQ2A 1VQ5F 2UYPA 2RHLA 4B62A 1XBIA 2N48A 5EB0A 3N2GB 2QEXF 3RYHA 3S0YA 3KJJA 3E22B 2CVLA 4FFBA 3PAFA 2ZODA 1SDSA 3WJPA 1Z5VA 3CMAF 3CCLF 2OTLF 5KX5A 2NMUA 1JY8A 4LNUB 1E7KA 1IV3A 1U40A 3JAKA 3JAMM 4TV8A 1R1MA 3UT5B 4YJ3B 3LWPC 3CCSF 2ZVYA 3LFOA 5IYZB 1H7MA 3JVHA 1JD1A 1SA0B 1K8AH 3IR9A 4X1IB 3ERNA 4ZHQA 2H8CA 4E6EA 3S03A 5J2TA 1VHAA 2BTUA 4LCKA 4HNAA 1JN1A 1Q7YH 4KWEA 1FFXB 5EYPA 4O4LA 3ZP7A 1X7OA 4I4TB 3D01A 3QHDA 2R751 1TUBB 3WJQA 1IV2A 5LOVB 3RYHB 3LWOC 5IYZA 1QVGF 5B8FA 2PMPA 5EB1B 3HKEB 1U3LA 1TVKA 1VQ6F 3MCAB 1CK2A 1W41A 1W581 3EORA 2GLZA 1OFUA 2HP0B 2MQEA 3MQWA 1DBFA 3RA5A 1FSZA 1KQSF 3VCZA 5HY1A 4IHJA 3JAWB 2B33A 1YITF 2QTPA 5EIBD 3JASA 1OAPA 5IJ0B 1FFXA 3I55F 2LCAA 4EI8A 3AGKA 3S02A 2F9ZC 3ELCA 3K12A 4C8GA 3KHNA 2FC3A 2W8BC 1M90H 3VYTC 4I50B 3P0ZA 3IMPA 2KGWA 2DYYA 3CCQF 1Q82H 1PXWA 3E1YA 4WBNA 4X1YB 3JARA 1SZQA 2L26A 4BT7A 1VQLF 3GYQA 2H6LA 1K9MH 3VO8A 1XV2A 1CLIA 3C9UA 1UI9A 3TD3A 4TUYA 5JCOC 5GANK 2KTVA 1U3PA 5EIBC 3LWQC 1Q81H 4X3LA 1YJNF 4BT4A 3V7QA 3CYQA 3VOAA 2CWJA 5HY0A 3RYIA 1RLGA 4RQOA 3C9TA 5MN6A 1XRGA 4IIJA 2RB9A 2Z01A 2AIFA 4C8IA 5JCOA 1YIJF 3WGKA 3TD5A 3N2KA 3V4DA 3LDTA 5FJ4C 3CCUF 4X1KA 1VQ8F 3J80M 3HKCA 4ZOLB 5CA0B 5CB4B 3QUWA 5C8YB 3M4SA 3NMUC 3MBMA 3M84A 3VYUC 1GO0A 5FLXM 1T0KB 1YQNA 1NQ3A 1JJ2F 4O4HB 1KD1H 4O4JA 3WGLA 4ZI7A 1QAHA 2Q1YA 3K2XA 5FNVA 1PF5A 5C8YA 3PLAC 3ESJA 1QU9A 5JQGA 1W3EX 3HKCB 4ZOLA 1X52A 2HP0A 1JFFA 3T80A 2Q1XA 3JAWA 3N2KB 4BVQA 3V3TA 2BTQB 1VQPF 5LP6B 3CCVF 5GIPC 3Q8HA 1X25A 3ZOPA 2K1SA 3RYCA 3KE1A 5LP6A 3CMEF 3CCEF 3HJWC 1VK3A 1JFFB 3JCMM 1GZ0A 2VAWA 4HNAB 3CXCF 3CCRF 4X20B 1Q86H 3KIZA 3FFMA 5EZYA 4O4LB 5LA6B 3GTZA 4TV9B 3WPWA 1RLUA 3IEQA 4YJ3A 1VQ9F 2CHSA 3N4YA 5EWRA 1K73H 3D00A 3C9RA 1ONIA 1QD9A 2VXYA 5EAZA 1W2BF 4BT2A 2VAMA 5HXUA 3QTYA 2YXZA 1GX1A 2BO1A 5KX5B 3WGNA 4ZHVA 2ZF8A 1H47A 5KMGA 3CPQA 2ZAUA 1Z5WA 3VMFB 5AVMA 2HX0A 4O2AA 4TV9A 3IEWA 1T0AA 3N2GA 3MCQA 3RYIB 3VIUA 3K0TA 5BMVA 5G4UC 4X20A 1GO1A 3LMEA 1ZWZA 4U3JA 4G4XA 3F0GA 4C4WC 2Z1TA 2AIZP 3ZP4A 1IPAA 2VGMA 1VQOF 1XHOA 2KG4A 3LWVC 3P10A 2GVIA 3FBAA 3VYSC 4X1YA 5LYJA 1FNJA 4M8IA 3HKDA 5HP8A 2AMTA 3OBYA 5LOVA 1TUBA 3C8LA 4I50A 2RHJA 4EI7A 1RQ7A 5CA1A 1W5EA 1W42A 5HP7A 2QA4F 2LBTA 4F6RB 1VQVA 2KTUA 1KNJA 1VQMF 3IKFA 2R6R1 3S0WA 5JQGB 2UYNA 5LXTB 3OBWA 4I55A 1VQNF 4EB6A 3VOBA 5LXTA 5CA0A 5CB4A 4ZHQB 2V9YA 2OZBA 4B46A 2HRUA 3V7EA 3WJRA 5IJ9A 4NUTA 4X1KB 3ON1A 3CCMF 4BW0B 3DDNA 3JASB 3J7AR 1QVFF 5CA1B 2GZLA 2ZVZA 2JNBA 2RHHA 1YI2F 2HS3A 1W40A 5IT9M 3JAKB 5ITZA 3B6NA 2HRYA 3JALA 1TVKB 4YJ2A 3FD5A 5HY2A 2CZWA 3HKEA 2QI2A 3CC7F 3F0DA 5GAPK 2VGNA 2HS4A 4G4VA 3S0HA 4U3JB 3E22A 2PHNA 4G4ZA 4BT5A 4I4TA 2I6DA 4BT6A 4C81A 3BYQA 4YJ2B 3SIUA 3CYPB 2UYJA 5J2TB 1W57A 2OTJF 5ITZB 3GHZA 2EWCA 5KMGB 2HP3A 3I7TA 3OW2F 5J2UA 3MDOA 1W55A 5JH7B 5EO3A 3F0FA 4TV8B 3JARB 4DRXA 4NWOB 1KC8H 3CB2A 4WBNB 3JATB 2IG8A 3HAXD 1YJ9F 2Z1EA 3DC2A 1YHQF 2VAPA 1IV1A 4LNUA 3R0PA 3VI6A 4G4WA 4BVRA 4F6RA 3FD6A 5GONB 5EZYB 2H8EA 2LBXA 2ZOVA 3IKEA 4BVSA 1COMA 4ERHA 3WGJA 1W5AA 3C9SA 3RE3A 4U39A 3HKDB 4BY9D 2UZHA 4R40B 4XCQA 3NK6A 4C8EA 5G4VC 1DT9A
chains in the Genus database with same CATH topology
1NQ3A 1XRGA 3R0PA 2CHTA 2CSLA 2DYYA 3KJJA 2UYNB 3MQWA 1QAHA 1DBFA 2CVLA 3VCZA 1PF5A 1FNJA 1ODEA 1UFYA 1FNKA 5HP8A 3LYBA 1QU9A 2UYJA 2B33A 3KJKA 4ZK7A 3ZP7A 2CW4A 2EWCA 2UYKA 1COMA 3I7TA 3V4DA 3M1XA 3D01A 1UI9A 3GTZA 5HP7A 3K0TA 3L7QA 3ZO8A 3K12A 1X25A 2CHSA 2UYNA 3LMEA 3ZOPA 3I3FA 4NWOB 1J7HA 2OTMA 3QUWA 3M4SA 3ZP4A 1ONIA 1QD9A 2IG8A 2UYPA 2CWJA 1XHOA 1JD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQ3 A;  1XRG A;  3R0P A;  2CHT A;  2CSL A;  2DYY A;  3KJJ A;  2UYN B;  3MQW A;  1QAH A;  1DBF A;  2CVL A;  3VCZ A;  1PF5 A;  1FNJ A;  1ODE A;  1UFY A;  1FNK A;  5HP8 A;  3LYB A;  1QU9 A;  2UYJ A;  2B33 A;  3KJK A;  4ZK7 A;  3ZP7 A;  2CW4 A;  2EWC A;  2UYK A;  1COM A;  3I7T A;  3V4D A;  3M1X A;  3D01 A;  1UI9 A;  3GTZ A;  5HP7 A;  3K0T A;  3L7Q A;  3ZO8 A;  3K12 A;  1X25 A;  2CHS A;  2UYN A;  3LME A;  3ZOP A;  3I3F A;  4NWO B;  1J7H A;  2OTM A;  3QUW A;  3M4S A;  3ZP4 A;  1ONI A;  1QD9 A;  2IG8 A;  2UYP A;  2CWJ A;  1XHO A;  1JD1 A; 
#chains in the Genus database with same CATH topology
 2HQS C;  4PWT A;  2IAF A;  3E20 B;  4BVT A;  3N4Z A;  5BMV B;  3G71 F;  4RHA A;  1Q8R A;  4O2A B;  3J81 M;  3CC4 F;  2HVY D;  1N8R H;  1VQK F;  3P4E A;  3RYF A;  1NJI H;  4O4H A;  4ZHY B;  3L7Q A;  5GON A;  4X1I A;  3JAT A;  3G6E F;  1SA0 A;  3HWU A;  5EYP B;  1KNK A;  3NVI B;  3D54 A;  1M1K H;  3I3F A;  3LWR C;  3UT5 A;  5MN4 A;  4G4Y A;  5GIO C;  3CCJ F;  1UFY A;  1ODE A;  5HY4 A;  3WXM B;  4B5C A;  2I6R A;  3FPI A;  1W5B A;  3HKB B;  3NVK E;  4DRX B;  5MN5 A;  2WAL A;  3G4S F;  3WGM A;  1YGY A;  5J2U B;  1FNK A;  1S72 F;  1NMU B;  1RA4 A;  4NQ3 A;  5LA6 A;  3CD6 F;  2P6Y A;  1U43 A;  4O4I A;  3U0O A;  1VQ4 F;  1CN7 A;  2Z1U A;  3I56 F;  4FFB B;  2ALE A;  3RYF B;  3S06 A;  2BTO A;  2RHO A;  2OTM A;  4DXD A;  3WPX A;  3JAL B;  3CG6 A;  2G9I A;  5A2Q M;  4TUY B;  4O4I B;  3RYC B;  3TD4 A;  1H48 A;  3RA6 A;  5HWE A;  3KJK A;  3CPW F;  3K14 A;  4ZK7 A;  1YJW F;  5HXZ A;  5JVD A;  2FGY A;  3HKB A;  2UYK A;  5IJ9 B;  3M1X A;  2Z1F A;  5GIN C;  4O2B A;  5FNV B;  3ZO8 A;  4I55 B;  3F6M A;  4O4J B;  4ZI7 B;  5DCV A;  1J7H A;  4B45 A;  1IV4 A;  3SIV A;  3CC2 F;  2YYE A;  4EB6 B;  3NK7 A;  2CHT A;  2CSL A;  4O2B B;  2UYN B;  3O85 A;  4ZHW A;  4C82 A;  5IJ0 A;  1VH8 A;  1X7P A;  2HS0 A;  2IQQ A;  4BT3 A;  5LYJ B;  3LYB A;  4TZZ A;  5JH7 A;  4X3M A;  4IHJ B;  3F0E A;  3HTN A;  2CW4 A;  3VTI C;  1W59 A;  2OHW A;  4G88 A;  1W5F A;  2DT4 A;  3OON A;  5JVD B;  1VQ7 F;  2LBW A;  5LP6 C;  4EI9 A;  4IIJ B;  1RQ2 A;  1VQ5 F;  2UYP A;  2RHL A;  4B62 A;  1XBI A;  2N48 A;  5EB0 A;  3N2G B;  2QEX F;  3RYH A;  3S0Y A;  3KJJ A;  3E22 B;  2CVL A;  4FFB A;  3PAF A;  2ZOD A;  1SDS A;  3WJP A;  1Z5V A;  3CMA F;  3CCL F;  2OTL F;  5KX5 A;  2NMU A;  1JY8 A;  4LNU B;  1E7K A;  1IV3 A;  1U40 A;  3JAK A;  3JAM M;  4TV8 A;  1R1M A;  3UT5 B;  4YJ3 B;  3LWP C;  3CCS F;  2ZVY A;  3LFO A;  5IYZ B;  1H7M A;  3JVH A;  1JD1 A;  1SA0 B;  1K8A H;  3IR9 A;  4X1I B;  3ERN A;  4ZHQ A;  2H8C A;  4E6E A;  3S03 A;  5J2T A;  1VHA A;  2BTU A;  4LCK A;  4HNA A;  1JN1 A;  1Q7Y H;  4KWE A;  1FFX B;  5EYP A;  4O4L A;  3ZP7 A;  1X7O A;  4I4T B;  3D01 A;  3QHD A;  2R75 1;  1TUB B;  3WJQ A;  1IV2 A;  5LOV B;  3RYH B;  3LWO C;  5IYZ A;  1QVG F;  5B8F A;  2PMP A;  5EB1 B;  3HKE B;  1U3L A;  1TVK A;  1VQ6 F;  3MCA B;  1CK2 A;  1W41 A;  1W58 1;  3EOR A;  2GLZ A;  1OFU A;  2HP0 B;  2MQE A;  3MQW A;  1DBF A;  3RA5 A;  1FSZ A;  1KQS F;  3VCZ A;  5HY1 A;  4IHJ A;  3JAW B;  2B33 A;  1YIT F;  2QTP A;  5EIB D;  3JAS A;  1OAP A;  5IJ0 B;  1FFX A;  3I55 F;  2LCA A;  4EI8 A;  3AGK A;  3S02 A;  2F9Z C;  3ELC A;  3K12 A;  4C8G A;  3KHN A;  2FC3 A;  2W8B C;  1M90 H;  3VYT C;  4I50 B;  3P0Z A;  3IMP A;  2KGW A;  2DYY A;  3CCQ F;  1Q82 H;  1PXW A;  3E1Y A;  4WBN A;  4X1Y B;  3JAR A;  1SZQ A;  2L26 A;  4BT7 A;  1VQL F;  3GYQ A;  2H6L A;  1K9M H;  3VO8 A;  1XV2 A;  1CLI A;  3C9U A;  1UI9 A;  3TD3 A;  4TUY A;  5JCO C;  5GAN K;  2KTV A;  1U3P A;  5EIB C;  3LWQ C;  1Q81 H;  4X3L A;  1YJN F;  4BT4 A;  3V7Q A;  3CYQ A;  3VOA A;  2CWJ A;  5HY0 A;  3RYI A;  1RLG A;  4RQO A;  3C9T A;  5MN6 A;  1XRG A;  4IIJ A;  2RB9 A;  2Z01 A;  2AIF A;  4C8I A;  5JCO A;  1YIJ F;  3WGK A;  3TD5 A;  3N2K A;  3V4D A;  3LDT A;  5FJ4 C;  3CCU F;  4X1K A;  1VQ8 F;  3J80 M;  3HKC A;  4ZOL B;  5CA0 B;  5CB4 B;  3QUW A;  5C8Y B;  3M4S A;  3NMU C;  3MBM A;  3M84 A;  3VYU C;  1GO0 A;  5FLX M;  1T0K B;  1YQN A;  1NQ3 A;  1JJ2 F;  4O4H B;  1KD1 H;  4O4J A;  3WGL A;  4ZI7 A;  1QAH A;  2Q1Y A;  3K2X A;  5FNV A;  1PF5 A;  5C8Y A;  3PLA C;  3ESJ A;  1QU9 A;  5JQG A;  1W3E X;  3HKC B;  4ZOL A;  1X52 A;  2HP0 A;  1JFF A;  3T80 A;  2Q1X A;  3JAW A;  3N2K B;  4BVQ A;  3V3T A;  2BTQ B;  1VQP F;  5LP6 B;  3CCV F;  5GIP C;  3Q8H A;  1X25 A;  3ZOP A;  2K1S A;  3RYC A;  3KE1 A;  5LP6 A;  3CME F;  3CCE F;  3HJW C;  1VK3 A;  1JFF B;  3JCM M;  1GZ0 A;  2VAW A;  4HNA B;  3CXC F;  3CCR F;  4X20 B;  1Q86 H;  3KIZ A;  3FFM A;  5EZY A;  4O4L B;  5LA6 B;  3GTZ A;  4TV9 B;  3WPW A;  1RLU A;  3IEQ A;  4YJ3 A;  1VQ9 F;  2CHS A;  3N4Y A;  5EWR A;  1K73 H;  3D00 A;  3C9R A;  1ONI A;  1QD9 A;  2VXY A;  5EAZ A;  1W2B F;  4BT2 A;  2VAM A;  5HXU A;  3QTY A;  2YXZ A;  1GX1 A;  2BO1 A;  5KX5 B;  3WGN A;  4ZHV A;  2ZF8 A;  1H47 A;  5KMG A;  3CPQ A;  2ZAU A;  1Z5W A;  3VMF B;  5AVM A;  2HX0 A;  4O2A A;  4TV9 A;  3IEW A;  1T0A A;  3N2G A;  3MCQ A;  3RYI B;  3VIU A;  3K0T A;  5BMV A;  5G4U C;  4X20 A;  1GO1 A;  3LME A;  1ZWZ A;  4U3J A;  4G4X A;  3F0G A;  4C4W C;  2Z1T A;  2AIZ P;  3ZP4 A;  1IPA A;  2VGM A;  1VQO F;  1XHO A;  2KG4 A;  3LWV C;  3P10 A;  2GVI A;  3FBA A;  3VYS C;  4X1Y A;  5LYJ A;  1FNJ A;  4M8I A;  3HKD A;  5HP8 A;  2AMT A;  3OBY A;  5LOV A;  1TUB A;  3C8L A;  4I50 A;  2RHJ A;  4EI7 A;  1RQ7 A;  5CA1 A;  1W5E A;  1W42 A;  5HP7 A;  2QA4 F;  2LBT A;  4F6R B;  1VQV A;  2KTU A;  1KNJ A;  1VQM F;  3IKF A;  2R6R 1;  3S0W A;  5JQG B;  2UYN A;  5LXT B;  3OBW A;  4I55 A;  1VQN F;  4EB6 A;  3VOB A;  5LXT A;  5CA0 A;  5CB4 A;  4ZHQ B;  2V9Y A;  2OZB A;  4B46 A;  2HRU A;  3V7E A;  3WJR A;  5IJ9 A;  4NUT A;  4X1K B;  3ON1 A;  3CCM F;  4BW0 B;  3DDN A;  3JAS B;  3J7A R;  1QVF F;  5CA1 B;  2GZL A;  2ZVZ A;  2JNB A;  2RHH A;  1YI2 F;  2HS3 A;  1W40 A;  5IT9 M;  3JAK B;  5ITZ A;  3B6N A;  2HRY A;  3JAL A;  1TVK B;  4YJ2 A;  3FD5 A;  5HY2 A;  2CZW A;  3HKE A;  2QI2 A;  3CC7 F;  3F0D A;  5GAP K;  2VGN A;  2HS4 A;  4G4V A;  3S0H A;  4U3J B;  3E22 A;  2PHN A;  4G4Z A;  4BT5 A;  4I4T A;  2I6D A;  4BT6 A;  4C81 A;  3BYQ A;  4YJ2 B;  3SIU A;  3CYP B;  2UYJ A;  5J2T B;  1W57 A;  2OTJ F;  5ITZ B;  3GHZ A;  2EWC A;  5KMG B;  2HP3 A;  3I7T A;  3OW2 F;  5J2U A;  3MDO A;  1W55 A;  5JH7 B;  5EO3 A;  3F0F A;  4TV8 B;  3JAR B;  4DRX A;  4NWO B;  1KC8 H;  3CB2 A;  4WBN B;  3JAT B;  2IG8 A;  3HAX D;  1YJ9 F;  2Z1E A;  3DC2 A;  1YHQ F;  2VAP A;  1IV1 A;  4LNU A;  3R0P A;  3VI6 A;  4G4W A;  4BVR A;  4F6R A;  3FD6 A;  5GON B;  5EZY B;  2H8E A;  2LBX A;  2ZOV A;  3IKE A;  4BVS A;  1COM A;  4ERH A;  3WGJ A;  1W5A A;  3C9S A;  3RE3 A;  4U39 A;  3HKD B;  4BY9 D;  2UZH A;  4R40 B;  4XCQ A;  3NK6 A;  4C8E A;  5G4V C;  1DT9 A; 
#chains in the Genus database with same CATH homology
 1NQ3 A;  1XRG A;  3R0P A;  2CHT A;  2CSL A;  2DYY A;  3KJJ A;  2UYN B;  3MQW A;  1QAH A;  1DBF A;  2CVL A;  3VCZ A;  1PF5 A;  1FNJ A;  1ODE A;  1UFY A;  1FNK A;  5HP8 A;  3LYB A;  1QU9 A;  2UYJ A;  2B33 A;  3KJK A;  4ZK7 A;  3ZP7 A;  2CW4 A;  2EWC A;  2UYK A;  1COM A;  3I7T A;  3V4D A;  3M1X A;  3D01 A;  1UI9 A;  3GTZ A;  5HP7 A;  3K0T A;  3L7Q A;  3ZO8 A;  3K12 A;  1X25 A;  2CHS A;  2UYN A;  3LME A;  3ZOP A;  3I3F A;  4NWO B;  1J7H A;  2OTM A;  3QUW A;  3M4S A;  3ZP4 A;  1ONI A;  1QD9 A;  2IG8 A;  2UYP A;  2CWJ A;  1XHO A;  1JD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...