2EWCA

Structure of hypothetical protein from streptococcus pyogenes m1 gas, member of highly conserved yjgf family of proteins
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
TIRRYDVNEDRGHTGLVEAGDFYYLNYCVGNVGQDIESQINGAFDEMERRLALVGLTLDAVVQMDCLFRDVWNIPVMEKMIKERFNGRYPARKSIQTEFAHHGGPQGLLFQVDGVAYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hypothetical protein from Streptococcus pyogenes M1 GAS, member of highly conserved yjgF family of proteins
rcsb
source organism Streptococcus pyogenes
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 31
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2ewcA00
3ZP4A 3R0PA 4ZK7A 1FNKA 2OTMA 1ONIA 2UYJA 3L7QA 1QAHA 2B33A 3I7TA 1DBFA 3ZOPA 5HP7A 3QUWA 1COMA 3LMEA 3M4SA 2CWJA 1NQ3A 2CW4A 1QU9A 1QD9A 1UFYA 1X25A 3D01A 2UYKA 2EWCA 5HP8A 3ZP7A 3ZO8A 2UYNA 3V4DA 3K12A 2DYYA 1JD1A 3M1XA 3MQWA 2CVLA 3LYBA 2UYPA 3K0TA 1UI9A 1FNJA 2IG8A 1ODEA 1XHOA 2UYNB 2CSLA 3GTZA 4NWOB 1J7HA 1XRGA 1PF5A 3KJJA 2CHTA 2CHSA 3KJKA 3I3FA 3VCZA
chains in the Genus database with same CATH superfamily
3CPQA 4X1KA 5HXUA 1VQLF 3VOAA 2OTMA 3OW2F 1OAPA 4BT7A 5EZYA 5HP7A 5G4UC 2BTOA 4FFBB 4O2AA 4BT5A 2QI2A 5ITZA 2HRYA 4NUTA 4O4IA 3RYFB 5JVDB 3D00A 2ZF8A 5EAZA 4C8EA 2R6R1 1K9MH 3IMPA 4ZHYB 2OHWA 1S72F 2OTJF 1Q86H 5IJ0B 5EO3A 2UYNB 2CSLA 4NWOB 3JALA 3NK7A 4TV8B 2QEXF 4X3LA 3WXMB 2H8EA 1FNKA 1YI2F 2LBTA 5IYZB 1ZWZA 4TV9A 1QVFF 3JATA 1U40A 1W59A 3QUWA 5J2UB 4F6RA 4BVRA 4I55A 4EI8A 1W581 1TUBB 3ZO8A 2HS4A 3JAKA 3EORA 2W8BC 3QHDA 3HKCA 2HP0A 4BY9D 2OTLF 3IR9A 5C8YB 1CN7A 2Q1YA 1SA0A 5LP6B 5FNVA 3IKEA 1XV2A 1JFFB 1GO1A 5EIBD 5CA0A 5IT9M 3TD5A 3OBYA 3P10A 4I4TB 5IJ9B 2LCAA 4O4HB 3CMAF 2KGWA 1SA0B 5LP6A 1VQ9F 3RYIB 3CCJF 2P6YA 2I6DA 4YJ3A 3S06A 5J2TA 3S02A 4BT3A 2ZVZA 4M8IA 4HNAB 2HS0A 3BYQA 3SIVA 2RHLA 3VIUA 2H8CA 3MBMA 3N4YA 2UZHA 1YGYA 4ZK7A 2HVYD 3J80M 3UT5A 4IIJB 2UYJA 3E1YA 1VQNF 1COMA 1H47A 2CWJA 3CMEF 1QD9A 3J7AR 3JALB 5HY4A 3HKCB 1E7KA 3S0YA 3RYFA 1IV4A 3D54A 2MQEA 2DT4A 5JQGA 3GHZA 1YITF 4WBNA 3I56F 3CC4F 4IIJA 5JVDA 5LA6A 4U39A 1VQ8F 5GONA 5GIOC 3DDNA 3JAKB 5EYPB 2WALA 1XRGA 4PWTA 3P0ZA 2VXYA 3I7TA 3V7QA 4O4LB 2HS3A 3MDOA 3CXCF 2UYKA 3ESJA 4I50A 3N2GA 4BW0B 2CZWA 2Q1XA 1KD1H 3F0FA 2VGNA 4X1IB 3NVKE 1W41A 1FSZA 5HY1A 2Z01A 3WGNA 3CCMF 3CCLF 1Z5VA 1KNJA 2PMPA 3CG6A 4X1YA 3WPWA 1PF5A 2CHTA 5J2TB 1H7MA 5JH7B 3JAMM 5EB0A 1CK2A 1Q82H 4O2AB 4BT2A 2V9YA 3LMEA 4IHJA 4G4YA 1QU9A 4XCQA 4DRXB 5BMVB 1KC8H 4X20A 2IQQA 2RHHA 5LA6B 3JAWA 4O2BB 3JVHA 4FFBA 3LWQC 4ZOLB 1M1KH 3O85A 5KX5B 4DRXA 3K2XA 3F6MA 3R0PA 2OZBA 1Q81H 2VAWA 4X1KB 3NVIB 5HY0A 4O4LA 3ZOPA 3MCAB 5EZYB 1KQSF 4KWEA 3T80A 2UYNA 3HWUA 5EB1B 4BT6A 1X52A 1RLUA 3J81M 1QVGF 4EI9A 1GX1A 3PAFA 1YJNF 3F0DA 3C8LA 5CB4B 4E6EA 3HTNA 4EB6A 3E22A 3FD5A 3G6EF 1RA4A 2GVIA 3RYHA 3CCQF 5HWEA 3S0WA 3CCRF 2ZODA 3ZP4A 1YJ9F 1W5AA 3U0OA 4LNUB 4B62A 1YHQF 1TVKA 2N48A 2LBXA 1X25A 3D01A 2YYEA 3ZP7A 3HKBA 2DYYA 5MN6A 5LXTB 1GZ0A 2H6LA 2NMUA 3LYBA 3ERNA 1SZQA 1IV3A 5JCOC 3OBWA 4TUYA 1W3EX 3CD6F 1ODEA 2KTVA 1FFXA 4G4WA 1Z5WA 2G9IA 3CYPB 1NQ3A 4TUYB 5GANK 1U43A 1W42A 1W55A 5HP8A 3V4DA 1K8AH 2KG4A 4EI7A 3V7EA 3CCUF 2AIFA 2CVLA 4YJ2B 4YJ3B 2AIZP 1H48A 3E20B 3KE1A 3JATB 4X20B 3P4EA 4ZHWA 2I6RA 5LOVB 3KIZA 4I55B 5GONB 2BTQB 3WJPA 1UI9A 5FJ4C 2FGYA 3VMFB 5EYPA 2HQSC 1YIJF 2VGMA 3HKDA 3VYSC 5KX5A 3I3FA 3VCZA 4LNUA 1CLIA 4TZZA 2F9ZC 4RQOA 4WBNB 3DC2A 3WGLA 5CA1B 1VQPF 3S0HA 1UFYA 4C8GA 3FD6A 3M84A 4EB6B 2HP3A 3N2KB 2ZVYA 2AMTA 3VI6A 4ZI7A 2BTUA 1W57A 3Q8HA 1VQOF 1NJIH 2LBWA 4I4TA 5IJ9A 2UYPA 3VO8A 4G4ZA 1YQNA 2RB9A 5HY2A 4X1YB 1XHOA 3G4SF 3KJJA 5LXTA 3CYQA 3KJKA 3VTIC 1VHAA 2HP0B 3L7QA 4X1IA 4ERHA 5LYJB 3RYCB 1VQVA 1TVKB 5FLXM 1JFFA 3K14A 2FC3A 3CCSF 4ZHQB 5KMGA 1JJ2F 3G71F 1VQMF 4I50B 3TD4A 3N4ZA 4G88A 4G4XA 5MN5A 2ZAUA 2L26A 4X3MA 5ITZB 4O4IB 2VAPA 4C82A 3CB2A 3SIUA 3LWPC 5LP6C 3RA6A 1FFXB 4BVTA 1KNKA 5BMVA 3WGMA 1X7OA 1GO0A 5LOVA 5EIBC 1QAHA 5CA1A 3C9TA 4G4VA 4HNAA 5GINC 3B6NA 3M4SA 5AVMA 2CW4A 1K73H 4IHJB 3HKDB 2EWCA 4ZOLA 1RQ7A 2YXZA 2R751 1YJWF 3C9SA 3M1XA 3MQWA 2ALEA 2RHOA 5IYZA 4TV9B 5GAPK 4YJ2A 2HRUA 1JN1A 1RLGA 4LCKA 4O4JB 4O2BA 5CA0B 3RYHB 3WGJA 4ZI7B 3LWRC 5IJ0A 1W5BA 2Z1TA 4C8IA 1JY8A 3RYCA 3LWVC 3C9RA 3IEQA 3GYQA 2QA4F 1VH8A 3CCVF 4U3JA 3NMUC 1VK3A 2PHNA 1JD1A 1Q8RA 3JASB 3MCQA 3WJQA 3RA5A 5HXZA 3JARB 3CCEF 3CPWF 1X7PA 3FFMA 3PLAC 1NMUB 3GTZA 1J7HA 5A2QM 4B46A 3JCMM 2K1SA 3FBAA 4BVSA 2B33A 1VQ5F 1U3LA 3S03A 3LDTA 3QTYA 3LFOA 4O4HA 4ZHVA 4B5CA 1VQKF 5EWRA 3C9UA 3RE3A 3WPXA 3HKBB 5JQGB 5JH7A 3VOBA 4BT4A 3VYUC 5DCVA 1FNJA 3NK6A 2GZLA 4C81A 4TV8A 4C4WC 1M90H 5B8FA 1U3PA 3HKEA 2CHSA 3HAXD 2Z1UA 1SDSA 2IAFA 1ONIA 3AGKA 3UT5B 3JAWB 1DBFA 2Z1EA 3ELCA 4O4JA 2BO1A 1DT9A 3VYTC 5CB4A 3N2KA 1W40A 4BVQA 1RQ2A 3E22B 3N2GB 3LWOC 2GLZA 1W2BF 3JARA 5MN4A 3ON1A 3I55F 2ZOVA 3IKFA 4B45A 1VQ4F 4F6RB 4DXDA 1VQ6F 3F0EA 3KHNA 1PXWA 4U3JB 3WGKA 3WJRA 1TUBA 2RHJA 1N8RH 4NQ3A 3JASA 3OONA 1T0KB 3F0GA 2KTUA 1R1MA 5LYJA 3TD3A 1Q7YH 2Z1FA 3CC7F 3RYIA 1W5EA 2JNBA 4RHAA 5FNVB 5J2UA 5JCOA 1W5FA 1T0AA 3K12A 3CC2F 2QTPA 1XBIA 2VAMA 3K0TA 5GIPC 2HX0A 3IEWA 1OFUA 4R40B 3HJWC 3FPIA 1IV1A 2IG8A 5C8YA 5KMGB 5G4VC 3HKEB 1IV2A 3V3TA 1VQ7F 4ZHQA 1IPAA
chains in the Genus database with same CATH topology
3ZP4A 3R0PA 4ZK7A 1FNKA 2OTMA 1ONIA 2UYJA 3L7QA 1QAHA 2B33A 3I7TA 1DBFA 3ZOPA 5HP7A 3QUWA 1COMA 3LMEA 3M4SA 2CWJA 1NQ3A 2CW4A 1QU9A 1QD9A 1UFYA 1X25A 3D01A 2UYKA 2EWCA 5HP8A 3ZP7A 3ZO8A 2UYNA 3V4DA 3K12A 2DYYA 1JD1A 3M1XA 3MQWA 2CVLA 3LYBA 2UYPA 3K0TA 1UI9A 1FNJA 2IG8A 1ODEA 1XHOA 2UYNB 2CSLA 3GTZA 4NWOB 1J7HA 1XRGA 1PF5A 3KJJA 2CHTA 2CHSA 3KJKA 3I3FA 3VCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZP4 A;  3R0P A;  4ZK7 A;  1FNK A;  2OTM A;  1ONI A;  2UYJ A;  3L7Q A;  1QAH A;  2B33 A;  3I7T A;  1DBF A;  3ZOP A;  5HP7 A;  3QUW A;  1COM A;  3LME A;  3M4S A;  2CWJ A;  1NQ3 A;  2CW4 A;  1QU9 A;  1QD9 A;  1UFY A;  1X25 A;  3D01 A;  2UYK A;  2EWC A;  5HP8 A;  3ZP7 A;  3ZO8 A;  2UYN A;  3V4D A;  3K12 A;  2DYY A;  1JD1 A;  3M1X A;  3MQW A;  2CVL A;  3LYB A;  2UYP A;  3K0T A;  1UI9 A;  1FNJ A;  2IG8 A;  1ODE A;  1XHO A;  2UYN B;  2CSL A;  3GTZ A;  4NWO B;  1J7H A;  1XRG A;  1PF5 A;  3KJJ A;  2CHT A;  2CHS A;  3KJK A;  3I3F A;  3VCZ A; 
#chains in the Genus database with same CATH topology
 3CPQ A;  4X1K A;  5HXU A;  1VQL F;  3VOA A;  2OTM A;  3OW2 F;  1OAP A;  4BT7 A;  5EZY A;  5HP7 A;  5G4U C;  2BTO A;  4FFB B;  4O2A A;  4BT5 A;  2QI2 A;  5ITZ A;  2HRY A;  4NUT A;  4O4I A;  3RYF B;  5JVD B;  3D00 A;  2ZF8 A;  5EAZ A;  4C8E A;  2R6R 1;  1K9M H;  3IMP A;  4ZHY B;  2OHW A;  1S72 F;  2OTJ F;  1Q86 H;  5IJ0 B;  5EO3 A;  2UYN B;  2CSL A;  4NWO B;  3JAL A;  3NK7 A;  4TV8 B;  2QEX F;  4X3L A;  3WXM B;  2H8E A;  1FNK A;  1YI2 F;  2LBT A;  5IYZ B;  1ZWZ A;  4TV9 A;  1QVF F;  3JAT A;  1U40 A;  1W59 A;  3QUW A;  5J2U B;  4F6R A;  4BVR A;  4I55 A;  4EI8 A;  1W58 1;  1TUB B;  3ZO8 A;  2HS4 A;  3JAK A;  3EOR A;  2W8B C;  3QHD A;  3HKC A;  2HP0 A;  4BY9 D;  2OTL F;  3IR9 A;  5C8Y B;  1CN7 A;  2Q1Y A;  1SA0 A;  5LP6 B;  5FNV A;  3IKE A;  1XV2 A;  1JFF B;  1GO1 A;  5EIB D;  5CA0 A;  5IT9 M;  3TD5 A;  3OBY A;  3P10 A;  4I4T B;  5IJ9 B;  2LCA A;  4O4H B;  3CMA F;  2KGW A;  1SA0 B;  5LP6 A;  1VQ9 F;  3RYI B;  3CCJ F;  2P6Y A;  2I6D A;  4YJ3 A;  3S06 A;  5J2T A;  3S02 A;  4BT3 A;  2ZVZ A;  4M8I A;  4HNA B;  2HS0 A;  3BYQ A;  3SIV A;  2RHL A;  3VIU A;  2H8C A;  3MBM A;  3N4Y A;  2UZH A;  1YGY A;  4ZK7 A;  2HVY D;  3J80 M;  3UT5 A;  4IIJ B;  2UYJ A;  3E1Y A;  1VQN F;  1COM A;  1H47 A;  2CWJ A;  3CME F;  1QD9 A;  3J7A R;  3JAL B;  5HY4 A;  3HKC B;  1E7K A;  3S0Y A;  3RYF A;  1IV4 A;  3D54 A;  2MQE A;  2DT4 A;  5JQG A;  3GHZ A;  1YIT F;  4WBN A;  3I56 F;  3CC4 F;  4IIJ A;  5JVD A;  5LA6 A;  4U39 A;  1VQ8 F;  5GON A;  5GIO C;  3DDN A;  3JAK B;  5EYP B;  2WAL A;  1XRG A;  4PWT A;  3P0Z A;  2VXY A;  3I7T A;  3V7Q A;  4O4L B;  2HS3 A;  3MDO A;  3CXC F;  2UYK A;  3ESJ A;  4I50 A;  3N2G A;  4BW0 B;  2CZW A;  2Q1X A;  1KD1 H;  3F0F A;  2VGN A;  4X1I B;  3NVK E;  1W41 A;  1FSZ A;  5HY1 A;  2Z01 A;  3WGN A;  3CCM F;  3CCL F;  1Z5V A;  1KNJ A;  2PMP A;  3CG6 A;  4X1Y A;  3WPW A;  1PF5 A;  2CHT A;  5J2T B;  1H7M A;  5JH7 B;  3JAM M;  5EB0 A;  1CK2 A;  1Q82 H;  4O2A B;  4BT2 A;  2V9Y A;  3LME A;  4IHJ A;  4G4Y A;  1QU9 A;  4XCQ A;  4DRX B;  5BMV B;  1KC8 H;  4X20 A;  2IQQ A;  2RHH A;  5LA6 B;  3JAW A;  4O2B B;  3JVH A;  4FFB A;  3LWQ C;  4ZOL B;  1M1K H;  3O85 A;  5KX5 B;  4DRX A;  3K2X A;  3F6M A;  3R0P A;  2OZB A;  1Q81 H;  2VAW A;  4X1K B;  3NVI B;  5HY0 A;  4O4L A;  3ZOP A;  3MCA B;  5EZY B;  1KQS F;  4KWE A;  3T80 A;  2UYN A;  3HWU A;  5EB1 B;  4BT6 A;  1X52 A;  1RLU A;  3J81 M;  1QVG F;  4EI9 A;  1GX1 A;  3PAF A;  1YJN F;  3F0D A;  3C8L A;  5CB4 B;  4E6E A;  3HTN A;  4EB6 A;  3E22 A;  3FD5 A;  3G6E F;  1RA4 A;  2GVI A;  3RYH A;  3CCQ F;  5HWE A;  3S0W A;  3CCR F;  2ZOD A;  3ZP4 A;  1YJ9 F;  1W5A A;  3U0O A;  4LNU B;  4B62 A;  1YHQ F;  1TVK A;  2N48 A;  2LBX A;  1X25 A;  3D01 A;  2YYE A;  3ZP7 A;  3HKB A;  2DYY A;  5MN6 A;  5LXT B;  1GZ0 A;  2H6L A;  2NMU A;  3LYB A;  3ERN A;  1SZQ A;  1IV3 A;  5JCO C;  3OBW A;  4TUY A;  1W3E X;  3CD6 F;  1ODE A;  2KTV A;  1FFX A;  4G4W A;  1Z5W A;  2G9I A;  3CYP B;  1NQ3 A;  4TUY B;  5GAN K;  1U43 A;  1W42 A;  1W55 A;  5HP8 A;  3V4D A;  1K8A H;  2KG4 A;  4EI7 A;  3V7E A;  3CCU F;  2AIF A;  2CVL A;  4YJ2 B;  4YJ3 B;  2AIZ P;  1H48 A;  3E20 B;  3KE1 A;  3JAT B;  4X20 B;  3P4E A;  4ZHW A;  2I6R A;  5LOV B;  3KIZ A;  4I55 B;  5GON B;  2BTQ B;  3WJP A;  1UI9 A;  5FJ4 C;  2FGY A;  3VMF B;  5EYP A;  2HQS C;  1YIJ F;  2VGM A;  3HKD A;  3VYS C;  5KX5 A;  3I3F A;  3VCZ A;  4LNU A;  1CLI A;  4TZZ A;  2F9Z C;  4RQO A;  4WBN B;  3DC2 A;  3WGL A;  5CA1 B;  1VQP F;  3S0H A;  1UFY A;  4C8G A;  3FD6 A;  3M84 A;  4EB6 B;  2HP3 A;  3N2K B;  2ZVY A;  2AMT A;  3VI6 A;  4ZI7 A;  2BTU A;  1W57 A;  3Q8H A;  1VQO F;  1NJI H;  2LBW A;  4I4T A;  5IJ9 A;  2UYP A;  3VO8 A;  4G4Z A;  1YQN A;  2RB9 A;  5HY2 A;  4X1Y B;  1XHO A;  3G4S F;  3KJJ A;  5LXT A;  3CYQ A;  3KJK A;  3VTI C;  1VHA A;  2HP0 B;  3L7Q A;  4X1I A;  4ERH A;  5LYJ B;  3RYC B;  1VQV A;  1TVK B;  5FLX M;  1JFF A;  3K14 A;  2FC3 A;  3CCS F;  4ZHQ B;  5KMG A;  1JJ2 F;  3G71 F;  1VQM F;  4I50 B;  3TD4 A;  3N4Z A;  4G88 A;  4G4X A;  5MN5 A;  2ZAU A;  2L26 A;  4X3M A;  5ITZ B;  4O4I B;  2VAP A;  4C82 A;  3CB2 A;  3SIU A;  3LWP C;  5LP6 C;  3RA6 A;  1FFX B;  4BVT A;  1KNK A;  5BMV A;  3WGM A;  1X7O A;  1GO0 A;  5LOV A;  5EIB C;  1QAH A;  5CA1 A;  3C9T A;  4G4V A;  4HNA A;  5GIN C;  3B6N A;  3M4S A;  5AVM A;  2CW4 A;  1K73 H;  4IHJ B;  3HKD B;  2EWC A;  4ZOL A;  1RQ7 A;  2YXZ A;  2R75 1;  1YJW F;  3C9S A;  3M1X A;  3MQW A;  2ALE A;  2RHO A;  5IYZ A;  4TV9 B;  5GAP K;  4YJ2 A;  2HRU A;  1JN1 A;  1RLG A;  4LCK A;  4O4J B;  4O2B A;  5CA0 B;  3RYH B;  3WGJ A;  4ZI7 B;  3LWR C;  5IJ0 A;  1W5B A;  2Z1T A;  4C8I A;  1JY8 A;  3RYC A;  3LWV C;  3C9R A;  3IEQ A;  3GYQ A;  2QA4 F;  1VH8 A;  3CCV F;  4U3J A;  3NMU C;  1VK3 A;  2PHN A;  1JD1 A;  1Q8R A;  3JAS B;  3MCQ A;  3WJQ A;  3RA5 A;  5HXZ A;  3JAR B;  3CCE F;  3CPW F;  1X7P A;  3FFM A;  3PLA C;  1NMU B;  3GTZ A;  1J7H A;  5A2Q M;  4B46 A;  3JCM M;  2K1S A;  3FBA A;  4BVS A;  2B33 A;  1VQ5 F;  1U3L A;  3S03 A;  3LDT A;  3QTY A;  3LFO A;  4O4H A;  4ZHV A;  4B5C A;  1VQK F;  5EWR A;  3C9U A;  3RE3 A;  3WPX A;  3HKB B;  5JQG B;  5JH7 A;  3VOB A;  4BT4 A;  3VYU C;  5DCV A;  1FNJ A;  3NK6 A;  2GZL A;  4C81 A;  4TV8 A;  4C4W C;  1M90 H;  5B8F A;  1U3P A;  3HKE A;  2CHS A;  3HAX D;  2Z1U A;  1SDS A;  2IAF A;  1ONI A;  3AGK A;  3UT5 B;  3JAW B;  1DBF A;  2Z1E A;  3ELC A;  4O4J A;  2BO1 A;  1DT9 A;  3VYT C;  5CB4 A;  3N2K A;  1W40 A;  4BVQ A;  1RQ2 A;  3E22 B;  3N2G B;  3LWO C;  2GLZ A;  1W2B F;  3JAR A;  5MN4 A;  3ON1 A;  3I55 F;  2ZOV A;  3IKF A;  4B45 A;  1VQ4 F;  4F6R B;  4DXD A;  1VQ6 F;  3F0E A;  3KHN A;  1PXW A;  4U3J B;  3WGK A;  3WJR A;  1TUB A;  2RHJ A;  1N8R H;  4NQ3 A;  3JAS A;  3OON A;  1T0K B;  3F0G A;  2KTU A;  1R1M A;  5LYJ A;  3TD3 A;  1Q7Y H;  2Z1F A;  3CC7 F;  3RYI A;  1W5E A;  2JNB A;  4RHA A;  5FNV B;  5J2U A;  5JCO A;  1W5F A;  1T0A A;  3K12 A;  3CC2 F;  2QTP A;  1XBI A;  2VAM A;  3K0T A;  5GIP C;  2HX0 A;  3IEW A;  1OFU A;  4R40 B;  3HJW C;  3FPI A;  1IV1 A;  2IG8 A;  5C8Y A;  5KMG B;  5G4V C;  3HKE B;  1IV2 A;  3V3T A;  1VQ7 F;  4ZHQ A;  1IPA A; 
#chains in the Genus database with same CATH homology
 3ZP4 A;  3R0P A;  4ZK7 A;  1FNK A;  2OTM A;  1ONI A;  2UYJ A;  3L7Q A;  1QAH A;  2B33 A;  3I7T A;  1DBF A;  3ZOP A;  5HP7 A;  3QUW A;  1COM A;  3LME A;  3M4S A;  2CWJ A;  1NQ3 A;  2CW4 A;  1QU9 A;  1QD9 A;  1UFY A;  1X25 A;  3D01 A;  2UYK A;  2EWC A;  5HP8 A;  3ZP7 A;  3ZO8 A;  2UYN A;  3V4D A;  3K12 A;  2DYY A;  1JD1 A;  3M1X A;  3MQW A;  2CVL A;  3LYB A;  2UYP A;  3K0T A;  1UI9 A;  1FNJ A;  2IG8 A;  1ODE A;  1XHO A;  2UYN B;  2CSL A;  3GTZ A;  4NWO B;  1J7H A;  1XRG A;  1PF5 A;  3KJJ A;  2CHT A;  2CHS A;  3KJK A;  3I3F A;  3VCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...