3T80A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
b'AMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Salmonella enterica subsp. enterica serovar typhimurium
publication title Crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium bound to cytidine
rcsb
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3t80A00
3F6MA 3P10A 3Q8HA 1W55A 3RE3A 3IEWA 1IV3A 4C8GA 3QHDA 3EORA 1KNJA 3JVHA 1T0AA 1IV4A 1IV2A 1VHAA 3ERNA 3F0DA 3F0GA 1JY8A 3F0FA 3K2XA 1H48A 2AMTA 3K14A 5B8FA 3IKFA 4C81A 3B6NA 1IV1A 2PMPA 3ELCA 1KNKA 3P0ZA 4C8EA 1YQNA 1H47A 3FPIA 1U40A 3MBMA 4C82A 3ESJA 3IKEA 1U3PA 1GX1A 2GZLA 1W57A 3IEQA 3F0EA 1JN1A 1VH8A 3GHZA 3T80A 3KE1A 1U3LA 3FBAA 1U43A 2UZHA 4C8IA
chains in the Genus database with same CATH superfamily
5LOVB 1VQOF 3CCRF 3CCQF 1W5BA 5ITZA 3QHDA 2BO1A 5LA6A 1YGYA 3MDOA 3ZO8A 4BT3A 1COMA 3C9RA 1GZ0A 1RQ2A 2ALEA 3NMUC 1Q7YH 2JNBA 2QTPA 1KNKA 4ZK7A 1Q86H 1K9MH 3FFMA 4O2BB 4ZHVA 3RYIB 1X52A 3CCSF 3HTNA 5EZYB 5G4VC 5EYPB 2CHTA 4O4IA 2HP0B 5EIBC 3F0EA 3WPWA 3M1XA 3MCAB 3N2KB 5ITZB 3S02A 2UYNA 4X1KA 2HVYD 3VOAA 2HS3A 3JAKB 2QA4F 3JVHA 3RA5A 2UYKA 1JY8A 3WGMA 2W8BC 5IT9M 2ZF8A 2PMPA 4EB6A 5HP7A 4LNUB 1SA0B 2V9YA 3WGNA 3E22A 3JAWA 1YJWF 2HP0A 2ZODA 4RHAA 4O4JB 2MQEA 3HAXD 1DT9A 3RYHA 3IMPA 2CSLA 2Z1UA 1TUBA 1U3LA 3CPQA 3CMAF 1YJ9F 2FGYA 3L7QA 1R1MA 2HS0A 3QUWA 3HKEA 5IJ9B 3KIZA 3GYQA 3ZOPA 1NJIH 4BT6A 1VQPF 4U3JB 4O4LB 3ESJA 4G4XA 2LCAA 3M4SA 3RA6A 4EI8A 2GLZA 5LXTA 3I7TA 2CHSA 3HKEB 5DCVA 4G4ZA 1X7PA 3HKCB 3FBAA 2KTUA 3JARB 3TD3A 4EI7A 2HQSC 3UT5A 3JCMM 2RB9A 2VGMA 4YJ3B 5FNVA 1W55A 4I55A 1W42A 3N4ZA 4TUYB 4I4TB 1JFFA 3CC4F 1H7MA 3HKDA 2CZWA 3M84A 4B5CA 3WJPA 4NWOB 4C81A 4G4VA 1N8RH 3V4DA 1VQ7F 3LWRC 4X1YA 5BMVB 3E1YA 3VTIC 3VOBA 2CWJA 2F9ZC 2VAMA 2ZVYA 5JQGA 5IJ0A 2QI2A 3S03A 1VQVA 1U43A 4I55B 3LWOC 4WBNB 3HKDB 4ZHYB 1KD1H 4ZHWA 3NVIB 4C8GA 4ZOLB 4IHJB 1IV2A 5HWEA 3CC2F 1X25A 4PWTA 2AMTA 3OONA 2OTJF 3D00A 4ERHA 1IV1A 2Q1YA 3K0TA 3P0ZA 1ODEA 4NUTA 5J2UA 5J2TA 5HY0A 3JAMM 2Z01A 5A2QM 4BVSA 1GO1A 5KX5B 1GO0A 1Q81H 4I50B 3V3TA 3NK7A 5IYZA 2HRYA 4X1IB 5C8YB 1QVGF 3DC2A 1VQ4F 3CCJF 1RLUA 3LYBA 1JJ2F 3VI6A 3N2KA 3G6EF 4XCQA 5CB4B 1VQ9F 3JALB 3VYSC 1VQKF 4YJ2B 1W2BF 5HY4A 4EI9A 3TD4A 4RQOA 3V7QA 1Q8RA 1NMUB 3JAWB 2H8CA 1Z5WA 3GTZA 1FFXB 4C8IA 4G4WA 5CA0A 5G4UC 2DYYA 3RYFB 1QU9A 4FFBA 5GINC 2YYEA 5HP8A 3TD5A 1YHQF 2GVIA 3C9TA 5GAPK 1H47A 3MQWA 2BTQB 1W59A 4U3JA 3I56F 4O2AA 4KWEA 3CG6A 3CCLF 3ZP7A 3E20B 1ONIA 1IV4A 1Z5VA 1PXWA 1VHAA 4YJ3A 5JCOA 4O4IB 5GANK 3CCMF 3KJJA 4C8EA 4ZI7B 1UI9A 3FD6A 1Q82H 4LCKA 1YI2F 2RHOA 5HXZA 1YJNF 3GHZA 5JH7A 2UYPA 3LFOA 4BT5A 5HY1A 3O85A 4TV8A 3RE3A 1FSZA 2QEXF 3JASB 1T0AA 2G9IA 1VQ8F 1H48A 4DRXB 1W5AA 3RYHB 5LYJB 1SDSA 5MN4A 1W3EX 2DT4A 5EIBD 2VAWA 5CA1A 2KG4A 3G4SF 4C82A 1K73H 4G4YA 5AVMA 1CN7A 4HNAA 3IEQA 3CB2A 1QAHA 3D01A 5J2UB 5J2TB 2OTLF 5IJ9A 1E7KA 2RHHA 5EB0A 5EWRA 1CLIA 3AGKA 2K1SA 1KC8H 3SIVA 1KQSF 3LWVC 1IV3A 4ZHQA 4BT7A 3RYFA 2EWCA 3F0DA 2VAPA 3F0GA 1YIJF 5IYZB 5LXTB 4HNAB 5B8FA 5JVDA 3IR9A 3HKBA 4G88A 3N4YA 1SA0A 1PF5A 1VQLF 2GZLA 1W57A 4TUYA 5CB4A 3VO8A 3DDNA 3I3FA 3D54A 3U0OA 4O2AB 2RHJA 4DXDA 1TUBB 4YJ2A 3C9UA 2KGWA 3R0PA 3J7AR 5KMGA 3LWQC 3ZP4A 4U39A 4C4WC 2R6R1 3ELCA 3KJKA 3CCUF 1T0KB 2IG8A 5IJ0B 1YQNA 1OFUA 2R751 4ZI7A 1FNJA 1U40A 3FPIA 4B62A 4I50A 2I6DA 3IKEA 3WGLA 3FD5A 1GX1A 5GIOC 3WXMB 5HY2A 5C8YA 3T80A 4LNUA 5EYPA 1XRGA 4O4HB 3OW2F 1DBFA 3BYQA 1JD1A 2UYNB 1IPAA 3CYPB 3P10A 4X1KB 4X3LA 3UT5B 3VYTC 5KMGB 4TZZA 5LP6B 2IAFA 4B45A 4X20B 2OHWA 1TVKA 3VYUC 3JAKA 2LBXA 3WGJA 2Z1FA 5HXUA 2LBTA 4BT2A 5BMVA 1QD9A 2YXZA 5LOVA 4NQ3A 1CK2A 2AIZP 1VQNF 3JATB 2RHLA 2HP3A 2HS4A 3NK6A 3LMEA 2CW4A 3LWPC 2VXYA 1SZQA 1VH8A 5EAZA 5CA0B 3KE1A 3RYCB 4O4JA 3ON1A 5LA6B 2UZHA 5JCOC 1X7OA 3I55F 4IHJA 2VGNA 3C8LA 1RQ7A 1TVKB 2P6YA 3PAFA 2OTMA 3JATA 3KHNA 1S72F 3B6NA 3CPWF 1J7HA 2NMUA 3RYCA 3VIUA 4DRXA 3MCQA 3N2GA 3S0WA 1UFYA 1OAPA 5KX5A 3P4EA 3PLAC 1W5FA 3VCZA 5CA1B 3OBYA 4EB6B 4E6EA 1VK3A 3CD6F 3F6MA 2HX0A 3Q8HA 3NVKE 2I6RA 3J80M 3EORA 3V7EA 3JALA 5JQGB 5FNVB 3CYQA 2LBWA 2IQQA 5GONB 2AIFA 2ZOVA 4I4TA 4ZHQB 1M90H 4WBNA 2FC3A 3N2GB 4X3MA 4IIJA 4TV9A 1XBIA 4R40B 3J81M 3RYIA 3MBMA 3G71F 5GIPC 1W41A 4BY9D 5LP6C 2Q1XA 4TV8B 5MN6A 3S06A 3CC7F 2BTOA 5GONA 3HKBB 3WPXA 1FFXA 3IEWA 3CXCF 3OBWA 3VMFB 5LP6A 1KNJA 1XHOA 3ERNA 4X20A 2PHNA 5MN5A 4O4LA 4FFBB 4IIJB 4TV9B 3HWUA 3JARA 3LDTA 3WJRA 3E22B 1FNKA 5FLXM 4F6RA 2KTVA 3HKCA 3S0HA 1QVFF 3C9SA 2H8EA 4BT4A 3JASA 1K8AH 1JN1A 4BVRA 1M1KH 1RLGA 1VQMF 1JFFB 2CVLA 1VQ5F 3SIUA 2Z1EA 5LYJA 2HRUA 2BTUA 1W5EA 4M8IA 4BVTA 4O4HA 2B33A 2L26A 1RA4A 5FJ4C 2Z1TA 3K2XA 3F0FA 4X1IA 4X1YB 3K14A 4BW0B 1ZWZA 2ZAUA 3IKFA 3QTYA 1YITF 3WJQA 3WGKA 4F6RB 4B46A 1NQ3A 2ZVZA 2N48A 3CCVF 1VQ6F 1U3PA 3CCEF 5JH7B 4BVQA 1W581 2UYJA 3S0YA 1XV2A 1W40A 2WALA 3CMEF 4O2BA 3HJWC 5EB1B 4ZOLA 2H6LA 5EZYA 5EO3A 2OZBA 5JVDB 3K12A
chains in the Genus database with same CATH topology
3F6MA 3P10A 3Q8HA 1W55A 3RE3A 3IEWA 1IV3A 4C8GA 3QHDA 3EORA 1KNJA 3JVHA 1T0AA 1IV4A 1IV2A 1VHAA 3ERNA 3F0DA 3F0GA 1JY8A 3F0FA 3K2XA 1H48A 2AMTA 3K14A 5B8FA 3IKFA 4C81A 3B6NA 1IV1A 2PMPA 3ELCA 1KNKA 3P0ZA 4C8EA 1YQNA 1H47A 3FPIA 1U40A 3MBMA 4C82A 3ESJA 3IKEA 1U3PA 1GX1A 2GZLA 1W57A 3IEQA 3F0EA 1JN1A 1VH8A 3GHZA 3T80A 3KE1A 1U3LA 3FBAA 1U43A 2UZHA 4C8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6M A;  3P10 A;  3Q8H A;  1W55 A;  3RE3 A;  3IEW A;  1IV3 A;  4C8G A;  3QHD A;  3EOR A;  1KNJ A;  3JVH A;  1T0A A;  1IV4 A;  1IV2 A;  1VHA A;  3ERN A;  3F0D A;  3F0G A;  1JY8 A;  3F0F A;  3K2X A;  1H48 A;  2AMT A;  3K14 A;  5B8F A;  3IKF A;  4C81 A;  3B6N A;  1IV1 A;  2PMP A;  3ELC A;  1KNK A;  3P0Z A;  4C8E A;  1YQN A;  1H47 A;  3FPI A;  1U40 A;  3MBM A;  4C82 A;  3ESJ A;  3IKE A;  1U3P A;  1GX1 A;  2GZL A;  1W57 A;  3IEQ A;  3F0E A;  1JN1 A;  1VH8 A;  3GHZ A;  3T80 A;  3KE1 A;  1U3L A;  3FBA A;  1U43 A;  2UZH A;  4C8I A; 
#chains in the Genus database with same CATH topology
 5LOV B;  1VQO F;  3CCR F;  3CCQ F;  1W5B A;  5ITZ A;  3QHD A;  2BO1 A;  5LA6 A;  1YGY A;  3MDO A;  3ZO8 A;  4BT3 A;  1COM A;  3C9R A;  1GZ0 A;  1RQ2 A;  2ALE A;  3NMU C;  1Q7Y H;  2JNB A;  2QTP A;  1KNK A;  4ZK7 A;  1Q86 H;  1K9M H;  3FFM A;  4O2B B;  4ZHV A;  3RYI B;  1X52 A;  3CCS F;  3HTN A;  5EZY B;  5G4V C;  5EYP B;  2CHT A;  4O4I A;  2HP0 B;  5EIB C;  3F0E A;  3WPW A;  3M1X A;  3MCA B;  3N2K B;  5ITZ B;  3S02 A;  2UYN A;  4X1K A;  2HVY D;  3VOA A;  2HS3 A;  3JAK B;  2QA4 F;  3JVH A;  3RA5 A;  2UYK A;  1JY8 A;  3WGM A;  2W8B C;  5IT9 M;  2ZF8 A;  2PMP A;  4EB6 A;  5HP7 A;  4LNU B;  1SA0 B;  2V9Y A;  3WGN A;  3E22 A;  3JAW A;  1YJW F;  2HP0 A;  2ZOD A;  4RHA A;  4O4J B;  2MQE A;  3HAX D;  1DT9 A;  3RYH A;  3IMP A;  2CSL A;  2Z1U A;  1TUB A;  1U3L A;  3CPQ A;  3CMA F;  1YJ9 F;  2FGY A;  3L7Q A;  1R1M A;  2HS0 A;  3QUW A;  3HKE A;  5IJ9 B;  3KIZ A;  3GYQ A;  3ZOP A;  1NJI H;  4BT6 A;  1VQP F;  4U3J B;  4O4L B;  3ESJ A;  4G4X A;  2LCA A;  3M4S A;  3RA6 A;  4EI8 A;  2GLZ A;  5LXT A;  3I7T A;  2CHS A;  3HKE B;  5DCV A;  4G4Z A;  1X7P A;  3HKC B;  3FBA A;  2KTU A;  3JAR B;  3TD3 A;  4EI7 A;  2HQS C;  3UT5 A;  3JCM M;  2RB9 A;  2VGM A;  4YJ3 B;  5FNV A;  1W55 A;  4I55 A;  1W42 A;  3N4Z A;  4TUY B;  4I4T B;  1JFF A;  3CC4 F;  1H7M A;  3HKD A;  2CZW A;  3M84 A;  4B5C A;  3WJP A;  4NWO B;  4C81 A;  4G4V A;  1N8R H;  3V4D A;  1VQ7 F;  3LWR C;  4X1Y A;  5BMV B;  3E1Y A;  3VTI C;  3VOB A;  2CWJ A;  2F9Z C;  2VAM A;  2ZVY A;  5JQG A;  5IJ0 A;  2QI2 A;  3S03 A;  1VQV A;  1U43 A;  4I55 B;  3LWO C;  4WBN B;  3HKD B;  4ZHY B;  1KD1 H;  4ZHW A;  3NVI B;  4C8G A;  4ZOL B;  4IHJ B;  1IV2 A;  5HWE A;  3CC2 F;  1X25 A;  4PWT A;  2AMT A;  3OON A;  2OTJ F;  3D00 A;  4ERH A;  1IV1 A;  2Q1Y A;  3K0T A;  3P0Z A;  1ODE A;  4NUT A;  5J2U A;  5J2T A;  5HY0 A;  3JAM M;  2Z01 A;  5A2Q M;  4BVS A;  1GO1 A;  5KX5 B;  1GO0 A;  1Q81 H;  4I50 B;  3V3T A;  3NK7 A;  5IYZ A;  2HRY A;  4X1I B;  5C8Y B;  1QVG F;  3DC2 A;  1VQ4 F;  3CCJ F;  1RLU A;  3LYB A;  1JJ2 F;  3VI6 A;  3N2K A;  3G6E F;  4XCQ A;  5CB4 B;  1VQ9 F;  3JAL B;  3VYS C;  1VQK F;  4YJ2 B;  1W2B F;  5HY4 A;  4EI9 A;  3TD4 A;  4RQO A;  3V7Q A;  1Q8R A;  1NMU B;  3JAW B;  2H8C A;  1Z5W A;  3GTZ A;  1FFX B;  4C8I A;  4G4W A;  5CA0 A;  5G4U C;  2DYY A;  3RYF B;  1QU9 A;  4FFB A;  5GIN C;  2YYE A;  5HP8 A;  3TD5 A;  1YHQ F;  2GVI A;  3C9T A;  5GAP K;  1H47 A;  3MQW A;  2BTQ B;  1W59 A;  4U3J A;  3I56 F;  4O2A A;  4KWE A;  3CG6 A;  3CCL F;  3ZP7 A;  3E20 B;  1ONI A;  1IV4 A;  1Z5V A;  1PXW A;  1VHA A;  4YJ3 A;  5JCO A;  4O4I B;  5GAN K;  3CCM F;  3KJJ A;  4C8E A;  4ZI7 B;  1UI9 A;  3FD6 A;  1Q82 H;  4LCK A;  1YI2 F;  2RHO A;  5HXZ A;  1YJN F;  3GHZ A;  5JH7 A;  2UYP A;  3LFO A;  4BT5 A;  5HY1 A;  3O85 A;  4TV8 A;  3RE3 A;  1FSZ A;  2QEX F;  3JAS B;  1T0A A;  2G9I A;  1VQ8 F;  1H48 A;  4DRX B;  1W5A A;  3RYH B;  5LYJ B;  1SDS A;  5MN4 A;  1W3E X;  2DT4 A;  5EIB D;  2VAW A;  5CA1 A;  2KG4 A;  3G4S F;  4C82 A;  1K73 H;  4G4Y A;  5AVM A;  1CN7 A;  4HNA A;  3IEQ A;  3CB2 A;  1QAH A;  3D01 A;  5J2U B;  5J2T B;  2OTL F;  5IJ9 A;  1E7K A;  2RHH A;  5EB0 A;  5EWR A;  1CLI A;  3AGK A;  2K1S A;  1KC8 H;  3SIV A;  1KQS F;  3LWV C;  1IV3 A;  4ZHQ A;  4BT7 A;  3RYF A;  2EWC A;  3F0D A;  2VAP A;  3F0G A;  1YIJ F;  5IYZ B;  5LXT B;  4HNA B;  5B8F A;  5JVD A;  3IR9 A;  3HKB A;  4G88 A;  3N4Y A;  1SA0 A;  1PF5 A;  1VQL F;  2GZL A;  1W57 A;  4TUY A;  5CB4 A;  3VO8 A;  3DDN A;  3I3F A;  3D54 A;  3U0O A;  4O2A B;  2RHJ A;  4DXD A;  1TUB B;  4YJ2 A;  3C9U A;  2KGW A;  3R0P A;  3J7A R;  5KMG A;  3LWQ C;  3ZP4 A;  4U39 A;  4C4W C;  2R6R 1;  3ELC A;  3KJK A;  3CCU F;  1T0K B;  2IG8 A;  5IJ0 B;  1YQN A;  1OFU A;  2R75 1;  4ZI7 A;  1FNJ A;  1U40 A;  3FPI A;  4B62 A;  4I50 A;  2I6D A;  3IKE A;  3WGL A;  3FD5 A;  1GX1 A;  5GIO C;  3WXM B;  5HY2 A;  5C8Y A;  3T80 A;  4LNU A;  5EYP A;  1XRG A;  4O4H B;  3OW2 F;  1DBF A;  3BYQ A;  1JD1 A;  2UYN B;  1IPA A;  3CYP B;  3P10 A;  4X1K B;  4X3L A;  3UT5 B;  3VYT C;  5KMG B;  4TZZ A;  5LP6 B;  2IAF A;  4B45 A;  4X20 B;  2OHW A;  1TVK A;  3VYU C;  3JAK A;  2LBX A;  3WGJ A;  2Z1F A;  5HXU A;  2LBT A;  4BT2 A;  5BMV A;  1QD9 A;  2YXZ A;  5LOV A;  4NQ3 A;  1CK2 A;  2AIZ P;  1VQN F;  3JAT B;  2RHL A;  2HP3 A;  2HS4 A;  3NK6 A;  3LME A;  2CW4 A;  3LWP C;  2VXY A;  1SZQ A;  1VH8 A;  5EAZ A;  5CA0 B;  3KE1 A;  3RYC B;  4O4J A;  3ON1 A;  5LA6 B;  2UZH A;  5JCO C;  1X7O A;  3I55 F;  4IHJ A;  2VGN A;  3C8L A;  1RQ7 A;  1TVK B;  2P6Y A;  3PAF A;  2OTM A;  3JAT A;  3KHN A;  1S72 F;  3B6N A;  3CPW F;  1J7H A;  2NMU A;  3RYC A;  3VIU A;  4DRX A;  3MCQ A;  3N2G A;  3S0W A;  1UFY A;  1OAP A;  5KX5 A;  3P4E A;  3PLA C;  1W5F A;  3VCZ A;  5CA1 B;  3OBY A;  4EB6 B;  4E6E A;  1VK3 A;  3CD6 F;  3F6M A;  2HX0 A;  3Q8H A;  3NVK E;  2I6R A;  3J80 M;  3EOR A;  3V7E A;  3JAL A;  5JQG B;  5FNV B;  3CYQ A;  2LBW A;  2IQQ A;  5GON B;  2AIF A;  2ZOV A;  4I4T A;  4ZHQ B;  1M90 H;  4WBN A;  2FC3 A;  3N2G B;  4X3M A;  4IIJ A;  4TV9 A;  1XBI A;  4R40 B;  3J81 M;  3RYI A;  3MBM A;  3G71 F;  5GIP C;  1W41 A;  4BY9 D;  5LP6 C;  2Q1X A;  4TV8 B;  5MN6 A;  3S06 A;  3CC7 F;  2BTO A;  5GON A;  3HKB B;  3WPX A;  1FFX A;  3IEW A;  3CXC F;  3OBW A;  3VMF B;  5LP6 A;  1KNJ A;  1XHO A;  3ERN A;  4X20 A;  2PHN A;  5MN5 A;  4O4L A;  4FFB B;  4IIJ B;  4TV9 B;  3HWU A;  3JAR A;  3LDT A;  3WJR A;  3E22 B;  1FNK A;  5FLX M;  4F6R A;  2KTV A;  3HKC A;  3S0H A;  1QVF F;  3C9S A;  2H8E A;  4BT4 A;  3JAS A;  1K8A H;  1JN1 A;  4BVR A;  1M1K H;  1RLG A;  1VQM F;  1JFF B;  2CVL A;  1VQ5 F;  3SIU A;  2Z1E A;  5LYJ A;  2HRU A;  2BTU A;  1W5E A;  4M8I A;  4BVT A;  4O4H A;  2B33 A;  2L26 A;  1RA4 A;  5FJ4 C;  2Z1T A;  3K2X A;  3F0F A;  4X1I A;  4X1Y B;  3K14 A;  4BW0 B;  1ZWZ A;  2ZAU A;  3IKF A;  3QTY A;  1YIT F;  3WJQ A;  3WGK A;  4F6R B;  4B46 A;  1NQ3 A;  2ZVZ A;  2N48 A;  3CCV F;  1VQ6 F;  1U3P A;  3CCE F;  5JH7 B;  4BVQ A;  1W58 1;  2UYJ A;  3S0Y A;  1XV2 A;  1W40 A;  2WAL A;  3CME F;  4O2B A;  3HJW C;  5EB1 B;  4ZOL A;  2H6L A;  5EZY A;  5EO3 A;  2OZB A;  5JVD B;  3K12 A; 
#chains in the Genus database with same CATH homology
 3F6M A;  3P10 A;  3Q8H A;  1W55 A;  3RE3 A;  3IEW A;  1IV3 A;  4C8G A;  3QHD A;  3EOR A;  1KNJ A;  3JVH A;  1T0A A;  1IV4 A;  1IV2 A;  1VHA A;  3ERN A;  3F0D A;  3F0G A;  1JY8 A;  3F0F A;  3K2X A;  1H48 A;  2AMT A;  3K14 A;  5B8F A;  3IKF A;  4C81 A;  3B6N A;  1IV1 A;  2PMP A;  3ELC A;  1KNK A;  3P0Z A;  4C8E A;  1YQN A;  1H47 A;  3FPI A;  1U40 A;  3MBM A;  4C82 A;  3ESJ A;  3IKE A;  1U3P A;  1GX1 A;  2GZL A;  1W57 A;  3IEQ A;  3F0E A;  1JN1 A;  1VH8 A;  3GHZ A;  3T80 A;  3KE1 A;  1U3L A;  3FBA A;  1U43 A;  2UZH A;  4C8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...