3T80A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
AMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium bound to cytidine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3t80A00
3GHZA 1YQNA 1H48A 1IV1A 1GX1A 1U3PA 1U43A 1H47A 3IEQA 3F0EA 3IKEA 4C8EA 3B6NA 3K2XA 3FPIA 3ERNA 1IV3A 3KE1A 2GZLA 1VHAA 3K14A 4C8IA 3F6MA 4C81A 3FBAA 3ELCA 5B8FA 3ESJA 4C82A 1U3LA 3RE3A 3T80A 3IKFA 1JN1A 3JVHA 3P0ZA 1W57A 3IEWA 3P10A 1KNJA 1IV4A 1JY8A 1KNKA 1U40A 3F0GA 1VH8A 1T0AA 3EORA 3Q8HA 1IV2A 2PMPA 3F0DA 2UZHA 3F0FA 3MBMA 4C8GA 1W55A 3QHDA 2AMTA
chains in the Genus database with same CATH superfamily
4I4TB 4I50B 3GHZA 2ZF8A 3N4YA 2HRYA 2L26A 5LXTB 2H6LA 1ZWZA 3HKEB 2GZLA 3FFMA 1UI9A 4DRXB 3JAKB 4O4HB 5IYZA 1U3LA 5GIOC 4RQOA 5FJ4C 5G4UC 4BT3A 1W40A 4I4TA 1KNJA 4I50A 1RQ7A 2HQSC 4O2AB 3VI6A 3V4DA 3LWVC 5LXTA 3VIUA 5A2QM 5LA6B 2V9YA 3QHDA 4DRXA 3JAKA 5G4VC 4O4HA 1JD1A 1H47A 4BT5A 3I56F 3G4SF 3P4EA 3RYIB 4O2AA 1K73H 4EI7A 4B45A 3KJJA 1ODEA 4ERHA 2CZWA 2G9IA 5LA6A 3OBWA 3CCQF 5GANK 4G4VA 1Q8RA 1JJ2F 3M1XA 3I55F 2VGNA 3CPQA 3RYIA 4BVRA 2AMTA 1VQ6F 4HNAB 2BTQB 3TD3A 1U3PA 4X1YB 3JALB 4ZHVA 3E20B 3LFOA 3KE1A 1Q86H 3CCSF 5EWRA 3F6MA 1PF5A 4C81A 4R40B 3LMEA 1RQ2A 4B62A 3VOBA 5IT9M 3ZP4A 4HNAA 4RHAA 3VOAA 4X1YA 3CXCF 3RYFB 3U0OA 3JALA 3VYTC 1CLIA 3S0YA 1RLGA 3IMPA 2VGMA 3CCRF 3CC2F 2FC3A 2DT4A 3IEQA 4LNUB 3F0EA 3RYHB 2VAPA 3ERNA 1N8RH 2UYJA 3M84A 4WBNB 1NMUB 4BVSA 5MN4A 3RYFA 1ONIA 4IHJB 2OTLF 3S03A 3CC7F 2Z01A 2CW4A 3T80A 1VQ5F 1H7MA 2Z1FA 3OBYA 4FFBB 1VQVA 3ZP7A 4ZI7B 2HRUA 3LWQC 4BY9D 3J80M 3O85A 5C8YB 4LNUA 5KMGB 3F0DA 2UZHA 1W5EA 4E6EA 3RYHA 4TUYB 1FSZA 4WBNA 2QEXF 3JVHA 2P6YA 4IHJA 1U43A 4G4YA 2RHHA 1K8AH 4ZI7A 4FFBA 2Q1YA 5JQGB 2I6DA 5ITZB 1J7HA 3HAXD 3SIVA 2HP3A 5EAZA 3VYUC 5KMGA 2LBXA 3NK7A 4TUYA 5HY4A 2LBTA 1K9MH 1IV4A 1W41A 4DXDA 1OAPA 5IJ9B 1X52A 4KWEA 3WXMB 3M4SA 1X7OA 2AIZP 5JQGA 1W59A 3WJQA 5ITZA 1H48A 3CCMF 1KC8H 3MDOA 4TV8A 2GLZA 5JVDB 3IKEA 3VO8A 1X25A 3JASB 1DT9A 4O2BB 4M8IA 2BTOA 4ZHWA 1UFYA 3C9TA 5IJ9A 3JAMM 5LP6B 2DYYA 3I3FA 1FNKA 2RHOA 3KIZA 1VH8A 5JVDA 2CSLA 2MQEA 1GO0A 1W581 3JASA 4O2BA 3V3TA 1M1KH 1IV1A 2VXYA 2W8BC 5LP6A 3C9UA 1W3EX 4X3LA 5JH7B 1GZ0A 2R751 3VYSC 4B46A 3RYCB 3WPXA 2ZVYA 5JCOA 3OONA 2ZOVA 4BT4A 4O4LB 2HS3A 4ZOLB 2UYPA 1QVFF 2OTJF 1CN7A 3D01A 5JH7A 2N48A 2QI2A 2YYEA 3RYCA 1E7KA 2ALEA 5GONA 3CCJF 3SIUA 3WGKA 3S06A 5BMVB 4BT2A 3N2KB 4YJ2B 2UYKA 2HS0A 4O4LA 1KQSF 1M90H 1Q82H 4ZOLA 4X1KB 5GINC 3OW2F 1VQ7F 2FGYA 3V7EA 3AGKA 2UYNB 2RHJA 1YJ9F 1JN1A 3P0ZA 5CA1B 3CPWF 1X7PA 3J7AR 5HP8A 2K1SA 3Q8HA 2CHTA 5BMVA 3D54A 2KTUA 5EYPB 3VMFB 3N2KA 4YJ2A 3MBMA 1Z5VA 2VAWA 2RB9A 1OFUA 3QTYA 4X1KA 1YHQF 3ZO8A 2UYNA 2HS4A 2CWJA 5J2TB 3B6NA 5CA1A 3V7QA 4ZHQB 1VQKF 4TV9A 2IG8A 4G88A 3S0WA 1XRGA 2CHSA 1QD9A 5EB1B 5EO3A 5EYPA 4C4WC 3G6EF 1T0KB 3P10A 3CD6F 5LP6C 5FLXM 2H8EA 5J2TA 4ZHQA 5JCOC 3E22B 1XHOA 5IJ0B 3HJWC 3DC2A 1S72F 4BVQA 1W5FA 1TVKB 4C8EA 5CB4B 1W42A 1VQ4F 1VHAA 3K14A 5FNVB 2RHLA 3C9SA 3ESJA 3CCVF 3QUWA 4TV8B 5LOVB 1R1MA 3E22A 5IJ0A 3CCLF 2HVYD 5EZYB 1CK2A 2QTPA 3IR9A 3VCZA 3CMEF 1T0AA 1IPAA 3L7QA 1TVKA 3HKBB 2PMPA 1SZQA 3WGMA 3F0FA 4O4JB 5CB4A 3LWPC 1VQ9F 5FNVA 3HKDB 1YQNA 1KD1H 3WGJA 3LWRC 5LOVA 5MN5A 3FPIA 3N2GB 5EZYA 1YI2F 3GYQA 2BTUA 2I6RA 3PAFA 1YITF 3FD5A 3HKBA 4PWTA 3MQWA 4B5CA 4O4JA 4C82A 5CA0B 5MN6A 2NMUA 1YJNF 3CCUF 1W5BA 1FNJA 3HKDA 3HTNA 4G4XA 3WJPA 5HWEA 2IQQA 5HY0A 4EI8A 3N2GA 4G4ZA 4YJ3B 2LCAA 3CCEF 4NUTA 3I7TA 5CA0A 3CMAF 1Q7YH 3VTIC 4U39A 1VQNF 5GONB 1XV2A 4U3JB 3K0TA 4YJ3A 3NK6A 2KGWA 3IEWA 3R0PA 4EI9A 1SA0B 3TD4A 1KNKA 3E1YA 1U40A 2Z1TA 3EORA 2ZAUA 1YGYA 5KX5B 3HKEA 1QAHA 4C8GA 1VK3A 4IIJB 2B33A 4X3MA 1TUBB 3S02A 1W5AA 2H8CA 2R6R1 4U3JA 3HKCB 1VQLF 2OHWA 3RA5A 2BO1A 3MCQA 2KTVA 1SA0A 5HY1A 2JNBA 3KJKA 1GO1A 3FBAA 5B8FA 5KX5A 5HXZA 1RLUA 1RA4A 4IIJA 1YIJF 1TUBA 4BT7A 3N4ZA 3NVKE 2KG4A 3CB2A 4X20B 3F0GA 4TV9B 3HKCA 3CG6A 3JCMM 5DCVA 4O4IB 5J2UB 1FFXB 4BW0B 1W55A 2EWCA 3C8LA 3ON1A 3DDNA 2PHNA 4EB6B 5GAPK 1COMA 3TD5A 1GX1A 2ZODA 4G4WA 1Q81H 1QVGF 4F6RB 2ZVZA 3LWOC 3CC4F 3K2XA 1JFFB 1IV3A 3WGNA 4X20A 3CYPB 2Q1XA 3KHNA 3ELCA 4XCQA 3S0HA 4O4IA 3JATB 5J2UA 5HXUA 1FFXA 4NWOB 3GTZA 3NMUC 3JARB 1W57A 4EB6A 2AIFA 1JY8A 3LDTA 4I55B 4F6RA 3CYQA 2CVLA 1JFFA 3K12A 5EIBD 1VQOF 1XBIA 4ZHYB 5GIPC 1VQMF 3JATA 2F9ZC 4ZK7A 1SDSA 3JARA 5EIBC 2Z1EA 4X1IB 2YXZA 3WJRA 4I55A 2HP0B 4NQ3A 1YJWF 2WALA 3PLAC 3UT5B 3JAWB 5EB0A 1QU9A 3J81M 4TZZA 1NJIH 1VQ8F 1IV2A 3MCAB 2OZBA 4X1IA 4LCKA 1VQPF 2HP0A 2QA4F 1NQ3A 3RA6A 5HP7A 5HY2A 5LYJB 2GVIA 3D00A 3JAWA 3UT5A 3ZOPA 3C9RA 3NVIB 5C8YA 4BT6A 1Z5WA 1W2BF 4C8IA 2IAFA 3LYBA 3WGLA 2VAMA 3HWUA 3WPWA 2LBWA 3RE3A 3IKFA 5AVMA 2Z1UA 3FD6A 2HX0A 1PXWA 1DBFA 5LYJA 2OTMA 3BYQA 5IYZB 3G71F 4BVTA
chains in the Genus database with same CATH topology
3GHZA 1YQNA 1H48A 1IV1A 1GX1A 1U3PA 1U43A 1H47A 3IEQA 3F0EA 3IKEA 4C8EA 3B6NA 3K2XA 3FPIA 3ERNA 1IV3A 3KE1A 2GZLA 1VHAA 3K14A 4C8IA 3F6MA 4C81A 3FBAA 3ELCA 5B8FA 3ESJA 4C82A 1U3LA 3RE3A 3T80A 3IKFA 1JN1A 3JVHA 3P0ZA 1W57A 3IEWA 3P10A 1KNJA 1IV4A 1JY8A 1KNKA 1U40A 3F0GA 1VH8A 1T0AA 3EORA 3Q8HA 1IV2A 2PMPA 3F0DA 2UZHA 3F0FA 3MBMA 4C8GA 1W55A 3QHDA 2AMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHZ A;  1YQN A;  1H48 A;  1IV1 A;  1GX1 A;  1U3P A;  1U43 A;  1H47 A;  3IEQ A;  3F0E A;  3IKE A;  4C8E A;  3B6N A;  3K2X A;  3FPI A;  3ERN A;  1IV3 A;  3KE1 A;  2GZL A;  1VHA A;  3K14 A;  4C8I A;  3F6M A;  4C81 A;  3FBA A;  3ELC A;  5B8F A;  3ESJ A;  4C82 A;  1U3L A;  3RE3 A;  3T80 A;  3IKF A;  1JN1 A;  3JVH A;  3P0Z A;  1W57 A;  3IEW A;  3P10 A;  1KNJ A;  1IV4 A;  1JY8 A;  1KNK A;  1U40 A;  3F0G A;  1VH8 A;  1T0A A;  3EOR A;  3Q8H A;  1IV2 A;  2PMP A;  3F0D A;  2UZH A;  3F0F A;  3MBM A;  4C8G A;  1W55 A;  3QHD A;  2AMT A; 
#chains in the Genus database with same CATH topology
 4I4T B;  4I50 B;  3GHZ A;  2ZF8 A;  3N4Y A;  2HRY A;  2L26 A;  5LXT B;  2H6L A;  1ZWZ A;  3HKE B;  2GZL A;  3FFM A;  1UI9 A;  4DRX B;  3JAK B;  4O4H B;  5IYZ A;  1U3L A;  5GIO C;  4RQO A;  5FJ4 C;  5G4U C;  4BT3 A;  1W40 A;  4I4T A;  1KNJ A;  4I50 A;  1RQ7 A;  2HQS C;  4O2A B;  3VI6 A;  3V4D A;  3LWV C;  5LXT A;  3VIU A;  5A2Q M;  5LA6 B;  2V9Y A;  3QHD A;  4DRX A;  3JAK A;  5G4V C;  4O4H A;  1JD1 A;  1H47 A;  4BT5 A;  3I56 F;  3G4S F;  3P4E A;  3RYI B;  4O2A A;  1K73 H;  4EI7 A;  4B45 A;  3KJJ A;  1ODE A;  4ERH A;  2CZW A;  2G9I A;  5LA6 A;  3OBW A;  3CCQ F;  5GAN K;  4G4V A;  1Q8R A;  1JJ2 F;  3M1X A;  3I55 F;  2VGN A;  3CPQ A;  3RYI A;  4BVR A;  2AMT A;  1VQ6 F;  4HNA B;  2BTQ B;  3TD3 A;  1U3P A;  4X1Y B;  3JAL B;  4ZHV A;  3E20 B;  3LFO A;  3KE1 A;  1Q86 H;  3CCS F;  5EWR A;  3F6M A;  1PF5 A;  4C81 A;  4R40 B;  3LME A;  1RQ2 A;  4B62 A;  3VOB A;  5IT9 M;  3ZP4 A;  4HNA A;  4RHA A;  3VOA A;  4X1Y A;  3CXC F;  3RYF B;  3U0O A;  3JAL A;  3VYT C;  1CLI A;  3S0Y A;  1RLG A;  3IMP A;  2VGM A;  3CCR F;  3CC2 F;  2FC3 A;  2DT4 A;  3IEQ A;  4LNU B;  3F0E A;  3RYH B;  2VAP A;  3ERN A;  1N8R H;  2UYJ A;  3M84 A;  4WBN B;  1NMU B;  4BVS A;  5MN4 A;  3RYF A;  1ONI A;  4IHJ B;  2OTL F;  3S03 A;  3CC7 F;  2Z01 A;  2CW4 A;  3T80 A;  1VQ5 F;  1H7M A;  2Z1F A;  3OBY A;  4FFB B;  1VQV A;  3ZP7 A;  4ZI7 B;  2HRU A;  3LWQ C;  4BY9 D;  3J80 M;  3O85 A;  5C8Y B;  4LNU A;  5KMG B;  3F0D A;  2UZH A;  1W5E A;  4E6E A;  3RYH A;  4TUY B;  1FSZ A;  4WBN A;  2QEX F;  3JVH A;  2P6Y A;  4IHJ A;  1U43 A;  4G4Y A;  2RHH A;  1K8A H;  4ZI7 A;  4FFB A;  2Q1Y A;  5JQG B;  2I6D A;  5ITZ B;  1J7H A;  3HAX D;  3SIV A;  2HP3 A;  5EAZ A;  3VYU C;  5KMG A;  2LBX A;  3NK7 A;  4TUY A;  5HY4 A;  2LBT A;  1K9M H;  1IV4 A;  1W41 A;  4DXD A;  1OAP A;  5IJ9 B;  1X52 A;  4KWE A;  3WXM B;  3M4S A;  1X7O A;  2AIZ P;  5JQG A;  1W59 A;  3WJQ A;  5ITZ A;  1H48 A;  3CCM F;  1KC8 H;  3MDO A;  4TV8 A;  2GLZ A;  5JVD B;  3IKE A;  3VO8 A;  1X25 A;  3JAS B;  1DT9 A;  4O2B B;  4M8I A;  2BTO A;  4ZHW A;  1UFY A;  3C9T A;  5IJ9 A;  3JAM M;  5LP6 B;  2DYY A;  3I3F A;  1FNK A;  2RHO A;  3KIZ A;  1VH8 A;  5JVD A;  2CSL A;  2MQE A;  1GO0 A;  1W58 1;  3JAS A;  4O2B A;  3V3T A;  1M1K H;  1IV1 A;  2VXY A;  2W8B C;  5LP6 A;  3C9U A;  1W3E X;  4X3L A;  5JH7 B;  1GZ0 A;  2R75 1;  3VYS C;  4B46 A;  3RYC B;  3WPX A;  2ZVY A;  5JCO A;  3OON A;  2ZOV A;  4BT4 A;  4O4L B;  2HS3 A;  4ZOL B;  2UYP A;  1QVF F;  2OTJ F;  1CN7 A;  3D01 A;  5JH7 A;  2N48 A;  2QI2 A;  2YYE A;  3RYC A;  1E7K A;  2ALE A;  5GON A;  3CCJ F;  3SIU A;  3WGK A;  3S06 A;  5BMV B;  4BT2 A;  3N2K B;  4YJ2 B;  2UYK A;  2HS0 A;  4O4L A;  1KQS F;  1M90 H;  1Q82 H;  4ZOL A;  4X1K B;  5GIN C;  3OW2 F;  1VQ7 F;  2FGY A;  3V7E A;  3AGK A;  2UYN B;  2RHJ A;  1YJ9 F;  1JN1 A;  3P0Z A;  5CA1 B;  3CPW F;  1X7P A;  3J7A R;  5HP8 A;  2K1S A;  3Q8H A;  2CHT A;  5BMV A;  3D54 A;  2KTU A;  5EYP B;  3VMF B;  3N2K A;  4YJ2 A;  3MBM A;  1Z5V A;  2VAW A;  2RB9 A;  1OFU A;  3QTY A;  4X1K A;  1YHQ F;  3ZO8 A;  2UYN A;  2HS4 A;  2CWJ A;  5J2T B;  3B6N A;  5CA1 A;  3V7Q A;  4ZHQ B;  1VQK F;  4TV9 A;  2IG8 A;  4G88 A;  3S0W A;  1XRG A;  2CHS A;  1QD9 A;  5EB1 B;  5EO3 A;  5EYP A;  4C4W C;  3G6E F;  1T0K B;  3P10 A;  3CD6 F;  5LP6 C;  5FLX M;  2H8E A;  5J2T A;  4ZHQ A;  5JCO C;  3E22 B;  1XHO A;  5IJ0 B;  3HJW C;  3DC2 A;  1S72 F;  4BVQ A;  1W5F A;  1TVK B;  4C8E A;  5CB4 B;  1W42 A;  1VQ4 F;  1VHA A;  3K14 A;  5FNV B;  2RHL A;  3C9S A;  3ESJ A;  3CCV F;  3QUW A;  4TV8 B;  5LOV B;  1R1M A;  3E22 A;  5IJ0 A;  3CCL F;  2HVY D;  5EZY B;  1CK2 A;  2QTP A;  3IR9 A;  3VCZ A;  3CME F;  1T0A A;  1IPA A;  3L7Q A;  1TVK A;  3HKB B;  2PMP A;  1SZQ A;  3WGM A;  3F0F A;  4O4J B;  5CB4 A;  3LWP C;  1VQ9 F;  5FNV A;  3HKD B;  1YQN A;  1KD1 H;  3WGJ A;  3LWR C;  5LOV A;  5MN5 A;  3FPI A;  3N2G B;  5EZY A;  1YI2 F;  3GYQ A;  2BTU A;  2I6R A;  3PAF A;  1YIT F;  3FD5 A;  3HKB A;  4PWT A;  3MQW A;  4B5C A;  4O4J A;  4C82 A;  5CA0 B;  5MN6 A;  2NMU A;  1YJN F;  3CCU F;  1W5B A;  1FNJ A;  3HKD A;  3HTN A;  4G4X A;  3WJP A;  5HWE A;  2IQQ A;  5HY0 A;  4EI8 A;  3N2G A;  4G4Z A;  4YJ3 B;  2LCA A;  3CCE F;  4NUT A;  3I7T A;  5CA0 A;  3CMA F;  1Q7Y H;  3VTI C;  4U39 A;  1VQN F;  5GON B;  1XV2 A;  4U3J B;  3K0T A;  4YJ3 A;  3NK6 A;  2KGW A;  3IEW A;  3R0P A;  4EI9 A;  1SA0 B;  3TD4 A;  1KNK A;  3E1Y A;  1U40 A;  2Z1T A;  3EOR A;  2ZAU A;  1YGY A;  5KX5 B;  3HKE A;  1QAH A;  4C8G A;  1VK3 A;  4IIJ B;  2B33 A;  4X3M A;  1TUB B;  3S02 A;  1W5A A;  2H8C A;  2R6R 1;  4U3J A;  3HKC B;  1VQL F;  2OHW A;  3RA5 A;  2BO1 A;  3MCQ A;  2KTV A;  1SA0 A;  5HY1 A;  2JNB A;  3KJK A;  1GO1 A;  3FBA A;  5B8F A;  5KX5 A;  5HXZ A;  1RLU A;  1RA4 A;  4IIJ A;  1YIJ F;  1TUB A;  4BT7 A;  3N4Z A;  3NVK E;  2KG4 A;  3CB2 A;  4X20 B;  3F0G A;  4TV9 B;  3HKC A;  3CG6 A;  3JCM M;  5DCV A;  4O4I B;  5J2U B;  1FFX B;  4BW0 B;  1W55 A;  2EWC A;  3C8L A;  3ON1 A;  3DDN A;  2PHN A;  4EB6 B;  5GAP K;  1COM A;  3TD5 A;  1GX1 A;  2ZOD A;  4G4W A;  1Q81 H;  1QVG F;  4F6R B;  2ZVZ A;  3LWO C;  3CC4 F;  3K2X A;  1JFF B;  1IV3 A;  3WGN A;  4X20 A;  3CYP B;  2Q1X A;  3KHN A;  3ELC A;  4XCQ A;  3S0H A;  4O4I A;  3JAT B;  5J2U A;  5HXU A;  1FFX A;  4NWO B;  3GTZ A;  3NMU C;  3JAR B;  1W57 A;  4EB6 A;  2AIF A;  1JY8 A;  3LDT A;  4I55 B;  4F6R A;  3CYQ A;  2CVL A;  1JFF A;  3K12 A;  5EIB D;  1VQO F;  1XBI A;  4ZHY B;  5GIP C;  1VQM F;  3JAT A;  2F9Z C;  4ZK7 A;  1SDS A;  3JAR A;  5EIB C;  2Z1E A;  4X1I B;  2YXZ A;  3WJR A;  4I55 A;  2HP0 B;  4NQ3 A;  1YJW F;  2WAL A;  3PLA C;  3UT5 B;  3JAW B;  5EB0 A;  1QU9 A;  3J81 M;  4TZZ A;  1NJI H;  1VQ8 F;  1IV2 A;  3MCA B;  2OZB A;  4X1I A;  4LCK A;  1VQP F;  2HP0 A;  2QA4 F;  1NQ3 A;  3RA6 A;  5HP7 A;  5HY2 A;  5LYJ B;  2GVI A;  3D00 A;  3JAW A;  3UT5 A;  3ZOP A;  3C9R A;  3NVI B;  5C8Y A;  4BT6 A;  1Z5W A;  1W2B F;  4C8I A;  2IAF A;  3LYB A;  3WGL A;  2VAM A;  3HWU A;  3WPW A;  2LBW A;  3RE3 A;  3IKF A;  5AVM A;  2Z1U A;  3FD6 A;  2HX0 A;  1PXW A;  1DBF A;  5LYJ A;  2OTM A;  3BYQ A;  5IYZ B;  3G71 F;  4BVT A; 
#chains in the Genus database with same CATH homology
 3GHZ A;  1YQN A;  1H48 A;  1IV1 A;  1GX1 A;  1U3P A;  1U43 A;  1H47 A;  3IEQ A;  3F0E A;  3IKE A;  4C8E A;  3B6N A;  3K2X A;  3FPI A;  3ERN A;  1IV3 A;  3KE1 A;  2GZL A;  1VHA A;  3K14 A;  4C8I A;  3F6M A;  4C81 A;  3FBA A;  3ELC A;  5B8F A;  3ESJ A;  4C82 A;  1U3L A;  3RE3 A;  3T80 A;  3IKF A;  1JN1 A;  3JVH A;  3P0Z A;  1W57 A;  3IEW A;  3P10 A;  1KNJ A;  1IV4 A;  1JY8 A;  1KNK A;  1U40 A;  3F0G A;  1VH8 A;  1T0A A;  3EOR A;  3Q8H A;  1IV2 A;  2PMP A;  3F0D A;  2UZH A;  3F0F A;  3MBM A;  4C8G A;  1W55 A;  3QHD A;  2AMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...