3T80A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
AMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium bound to cytidine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3t80A00
3KE1A 1H47A 1IV3A 3IKFA 1VH8A 2UZHA 4C8GA 1JY8A 3K14A 3B6NA 1VHAA 1GX1A 1U3LA 4C81A 1U40A 3T80A 1U43A 3ESJA 1W57A 1H48A 2PMPA 1IV2A 1IV4A 3K2XA 3IEQA 3P10A 3RE3A 4C82A 3F0DA 4C8IA 3MBMA 1YQNA 3QHDA 3F0FA 3ELCA 1U3PA 1T0AA 1IV1A 3FPIA 1KNKA 4C8EA 3EORA 1W55A 5B8FA 3JVHA 1KNJA 3IEWA 3F0EA 3F0GA 3F6MA 3Q8HA 2AMTA 2GZLA 3P0ZA 3GHZA 3ERNA 1JN1A 3FBAA 3IKEA
chains in the Genus database with same CATH superfamily
4X20B 2H8EA 4I55A 4B46A 2UZHA 4X1YB 5EYPA 2G9IA 3VTIC 2RHOA 2NMUA 4O4JB 4ZHQA 5KMGB 1S72F 5LP6C 4IIJA 4X1KB 4F6RB 3UT5B 2Z1UA 1NJIH 3NK7A 4G4WA 1YITF 1Q86H 4U39A 3ZO8A 3E20B 3OW2F 2N48A 3ON1A 2V9YA 2FGYA 5J2TB 3MCQA 5J2TA 3CC2F 4ZOLA 1T0KB 3JALA 1W2BF 4DXDA 2VAPA 5CA1A 4B5CA 1RA4A 3KE1A 3I7TA 5HP8A 5LP6B 4O2BA 5GIOC 3WGMA 3JARA 2H8CA 2ZVZA 3JARB 3CCVF 4I55B 3N4ZA 3CCJF 2HS0A 2UYNA 5G4UC 4BY9D 2BTQB 1W5FA 2OTJF 2ZOVA 3RYHA 5FNVB 1RQ7A 1W42A 3LDTA 3ZP7A 3CYQA 4ZHYB 3IKFA 1VH8A 1Q82H 1FNJA 5FNVA 1X52A 5LA6A 4B62A 2HS4A 3N2GB 2P6YA 3GTZA 3LWOC 3HKCB 3K2XA 1VQ7F 3VCZA 5KX5B 2Q1XA 4X20A 3JAKA 3WJPA 5EZYB 3MBMA 1VQ9F 1Q7YH 1VQKF 2EWCA 3NMUC 1T0AA 4C8EA 4G4ZA 1QVGF 2QTPA 5BMVA 4TUYA 3JCMM 2K1SA 5JCOC 2Z1TA 3IMPA 3FBAA 3MCAB 1VK3A 4EI9A 1GO1A 3D01A 3L7QA 1GO0A 2W8BC 1QVFF 3T80A 1RLUA 3QTYA 4O2BB 4X3MA 3M84A 3MQWA 5FJ4C 3JAKB 5JVDB 1YQNA 4B45A 4G88A 3RYCA 3RYIA 2YYEA 5LYJB 2BTOA 5HY2A 2ZVYA 4RHAA 3S02A 3VO8A 5EYPB 3RA5A 5C8YB 2B33A 3WPXA 4LNUA 3M1XA 5HY4A 1Z5WA 3WGLA 4C8GA 4NQ3A 4O4IB 3HKBA 3LWRC 3HKDB 4X3LA 3E22B 1VQLF 1W55A 3HTNA 1N8RH 2OHWA 3KJKA 1YI2F 3JVHA 5IYZA 5LXTA 2AIFA 5JH7A 1PXWA 2VGNA 1CN7A 5IJ9B 3BYQA 4LNUB 3CC7F 1QAHA 1SA0A 2LBTA 3RYFB 3ZP4A 3CCMF 2CVLA 2ALEA 2ZF8A 4FFBA 3M4SA 1JFFB 2CHTA 2UYPA 3ZOPA 1SA0B 2L26A 1H48A 3JATA 3P10A 3IEQA 4TV9A 3N2KA 2RHHA 3D54A 1FSZA 2LCAA 5AVMA 5G4VC 1IV1A 4HNAB 1Q8RA 1FFXA 1NQ3A 5CB4A 5LOVB 4I50A 3V7QA 1VQNF 5CA0A 3G4SF 1OAPA 1VQ5F 5HXZA 3PLAC 3NVIB 3PAFA 2Q1YA 5JH7B 1XV2A 4ZI7A 3FD5A 2ZAUA 3K0TA 1W581 1X7PA 1CK2A 3G6EF 3VYUC 1SZQA 1XHOA 3J81M 4TV9B 4X1IB 3TD5A 3FPIA 1KNKA 1W59A 3FFMA 3S0HA 3HKBB 3DDNA 2VAMA 3FD6A 4TV8B 4YJ3A 1DBFA 1TVKB 3GHZA 1JN1A 2CZWA 2F9ZC 3VIUA 1IV3A 1PF5A 5EWRA 3CMEF 1UI9A 5IYZB 1W5AA 3JASA 1TUBA 1KD1H 3NK6A 3DC2A 3HAXD 1J7HA 2PMPA 2Z1FA 3I56F 3QHDA 4I4TA 2FC3A 4O4LB 2RHJA 3WXMB 3CYPB 3D00A 5BMVB 1K8AH 1KNJA 2LBWA 3F6MA 2AMTA 1ZWZA 2GZLA 3VYSC 2BO1A 3S03A 4ZK7A 4O4HA 5GINC 2HVYD 3CCSF 3JALB 1YJWF 5HXUA 5EB1B 4BVTA 5MN6A 3HWUA 3CXCF 4O4IA 1GX1A 1U3LA 5HWEA 5DCVA 3RYCB 1FFXB 1W5EA 5CB4B 5LOVA 4IHJA 5LP6A 1YJNF 3SIVA 3WGNA 2QA4F 2CSLA 2HP3A 1GZ0A 4C8IA 4M8IA 5GONA 3WJQA 5C8YA 3HJWC 4IHJB 4BVQA 5JQGB 2IQQA 1RQ2A 5LYJA 4ZHWA 3RYHB 5JQGA 3RYIB 4G4VA 5HY1A 4X1YA 2RHLA 4O2AB 5GAPK 4R40B 3I55F 3JAMM 1COMA 4XCQA 3V7EA 4EB6A 3B6NA 1VHAA 2HS3A 1U43A 1OFUA 3JAWB 3LWPC 2BTUA 5KX5A 1H7MA 1U3PA 3J80M 3KHNA 2VGMA 3K12A 3OONA 3LWVC 1TUBB 3VOBA 1M90H 3JASB 5LA6B 3C9SA 3C9RA 3CPQA 3LWQC 5HP7A 4O4LA 5EIBC 2YXZA 5GONB 1VQ8F 3WGJA 3IKEA 2HQSC 4ZHVA 1YGYA 2UYKA 3U0OA 4LCKA 3OBWA 2WALA 2HX0A 4O4JA 5KMGA 5EO3A 1X25A 4TZZA 3O85A 1R1MA 4DRXA 3MDOA 4BT2A 3JAWA 1ODEA 3ELCA 4G4XA 1TVKA 4G4YA 4YJ3B 5ITZB 1VQOF 3IR9A 3P0ZA 4ZI7B 1YHQF 4BW0B 5JCOA 4WBNB 5GIPC 1QU9A 3CD6F 2IG8A 5EB0A 2R6R1 3LFOA 4RQOA 1X7OA 2Z01A 4EB6B 3ESJA 2KGWA 1ONIA 3OBYA 3F0DA 4O2AA 4C4WC 4DRXB 2I6DA 3EORA 1YIJF 4ZOLB 2RB9A 4FFBB 3LYBA 1VQ4F 3S0YA 3P4EA 3CCRF 3ERNA 5A2QM 1FNKA 3VYTC 3HKEB 5EIBD 1H47A 3V4DA 5LXTB 2H6LA 5EAZA 2Z1EA 1SDSA 3RYFA 1NMUB 1M1KH 1IV4A 3TD3A 2UYNB 1VQVA 2PHNA 5IJ9A 4BT3A 2DT4A 3NVKE 1IPAA 4KWEA 2HP0B 5B8FA 2HP0A 3CC4F 3C9UA 4I50B 1Q81H 2MQEA 2ZODA 3Q8HA 4BT7A 1JD1A 1VQ6F 2R751 1Z5VA 2CWJA 3TD4A 3GYQA 2KG4A 4EI7A 5CA1B 3N2KB 3QUWA 1W3EX 3N4YA 4NUTA 3WGKA 4U3JA 1JY8A 3C8LA 3K14A 2GLZA 2IAFA 3G71F 3CCLF 2KTUA 1E7KA 3N2GA 3R0PA 3WJRA 5CA0B 1K9MH 4C81A 3WPWA 3CG6A 3J7AR 1U40A 3S0WA 1JJ2F 4BT5A 3VMFB 1VQMF 2AIZP 5JVDA 1DT9A 2VXYA 2I6RA 4BVRA 5GANK 3VOAA 2QEXF 3UT5A 4E6EA 1JFFA 1W5BA 4IIJB 4X1KA 4F6RA 2HRUA 1RLGA 3CCEF 2CW4A 1XBIA 3F0EA 3F0GA 4ZHQB 1UFYA 5IJ0A 2GVIA 3CCUF 3VI6A 3CPWF 4X1IA 5IT9M 1K73H 1QD9A 4O4HB 2KTVA 3HKDA 2OTMA 5IJ0B 4EI8A 1W41A 4TUYB 3KIZA 2JNBA 4YJ2B 2DYYA 5HY0A 1W40A 3E1YA 1W57A 4HNAA 2HRYA 3KJJA 3HKEA 3LMEA 4ERHA 3F0FA 3HKCA 2OZBA 3CB2A 2VAWA 1CLIA 5ITZA 3IEWA 4BVSA 1KQSF 3C9TA 5EZYA 1VQPF 3JATB 3SIUA 3AGKA 1YJ9F 2CHSA 3RA6A 4TV8A 4NWOB 4U3JB 3RE3A 3S06A 1IV2A 3I3FA 3V3TA 3E22A 4PWTA 4C82A 4BT4A 2UYJA 5J2UB 5MN5A 4BT6A 3CMAF 4YJ2A 1KC8H 1XRGA 2QI2A 2OTLF 3CCQF 5J2UA 5MN4A 5FLXM 4I4TB 2LBXA 4WBNA
chains in the Genus database with same CATH topology
3KE1A 1H47A 1IV3A 3IKFA 1VH8A 2UZHA 4C8GA 1JY8A 3K14A 3B6NA 1VHAA 1GX1A 1U3LA 4C81A 1U40A 3T80A 1U43A 3ESJA 1W57A 1H48A 2PMPA 1IV2A 1IV4A 3K2XA 3IEQA 3P10A 3RE3A 4C82A 3F0DA 4C8IA 3MBMA 1YQNA 3QHDA 3F0FA 3ELCA 1U3PA 1T0AA 1IV1A 3FPIA 1KNKA 4C8EA 3EORA 1W55A 5B8FA 3JVHA 1KNJA 3IEWA 3F0EA 3F0GA 3F6MA 3Q8HA 2AMTA 2GZLA 3P0ZA 3GHZA 3ERNA 1JN1A 3FBAA 3IKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KE1 A;  1H47 A;  1IV3 A;  3IKF A;  1VH8 A;  2UZH A;  4C8G A;  1JY8 A;  3K14 A;  3B6N A;  1VHA A;  1GX1 A;  1U3L A;  4C81 A;  1U40 A;  3T80 A;  1U43 A;  3ESJ A;  1W57 A;  1H48 A;  2PMP A;  1IV2 A;  1IV4 A;  3K2X A;  3IEQ A;  3P10 A;  3RE3 A;  4C82 A;  3F0D A;  4C8I A;  3MBM A;  1YQN A;  3QHD A;  3F0F A;  3ELC A;  1U3P A;  1T0A A;  1IV1 A;  3FPI A;  1KNK A;  4C8E A;  3EOR A;  1W55 A;  5B8F A;  3JVH A;  1KNJ A;  3IEW A;  3F0E A;  3F0G A;  3F6M A;  3Q8H A;  2AMT A;  2GZL A;  3P0Z A;  3GHZ A;  3ERN A;  1JN1 A;  3FBA A;  3IKE A; 
#chains in the Genus database with same CATH topology
 4X20 B;  2H8E A;  4I55 A;  4B46 A;  2UZH A;  4X1Y B;  5EYP A;  2G9I A;  3VTI C;  2RHO A;  2NMU A;  4O4J B;  4ZHQ A;  5KMG B;  1S72 F;  5LP6 C;  4IIJ A;  4X1K B;  4F6R B;  3UT5 B;  2Z1U A;  1NJI H;  3NK7 A;  4G4W A;  1YIT F;  1Q86 H;  4U39 A;  3ZO8 A;  3E20 B;  3OW2 F;  2N48 A;  3ON1 A;  2V9Y A;  2FGY A;  5J2T B;  3MCQ A;  5J2T A;  3CC2 F;  4ZOL A;  1T0K B;  3JAL A;  1W2B F;  4DXD A;  2VAP A;  5CA1 A;  4B5C A;  1RA4 A;  3KE1 A;  3I7T A;  5HP8 A;  5LP6 B;  4O2B A;  5GIO C;  3WGM A;  3JAR A;  2H8C A;  2ZVZ A;  3JAR B;  3CCV F;  4I55 B;  3N4Z A;  3CCJ F;  2HS0 A;  2UYN A;  5G4U C;  4BY9 D;  2BTQ B;  1W5F A;  2OTJ F;  2ZOV A;  3RYH A;  5FNV B;  1RQ7 A;  1W42 A;  3LDT A;  3ZP7 A;  3CYQ A;  4ZHY B;  3IKF A;  1VH8 A;  1Q82 H;  1FNJ A;  5FNV A;  1X52 A;  5LA6 A;  4B62 A;  2HS4 A;  3N2G B;  2P6Y A;  3GTZ A;  3LWO C;  3HKC B;  3K2X A;  1VQ7 F;  3VCZ A;  5KX5 B;  2Q1X A;  4X20 A;  3JAK A;  3WJP A;  5EZY B;  3MBM A;  1VQ9 F;  1Q7Y H;  1VQK F;  2EWC A;  3NMU C;  1T0A A;  4C8E A;  4G4Z A;  1QVG F;  2QTP A;  5BMV A;  4TUY A;  3JCM M;  2K1S A;  5JCO C;  2Z1T A;  3IMP A;  3FBA A;  3MCA B;  1VK3 A;  4EI9 A;  1GO1 A;  3D01 A;  3L7Q A;  1GO0 A;  2W8B C;  1QVF F;  3T80 A;  1RLU A;  3QTY A;  4O2B B;  4X3M A;  3M84 A;  3MQW A;  5FJ4 C;  3JAK B;  5JVD B;  1YQN A;  4B45 A;  4G88 A;  3RYC A;  3RYI A;  2YYE A;  5LYJ B;  2BTO A;  5HY2 A;  2ZVY A;  4RHA A;  3S02 A;  3VO8 A;  5EYP B;  3RA5 A;  5C8Y B;  2B33 A;  3WPX A;  4LNU A;  3M1X A;  5HY4 A;  1Z5W A;  3WGL A;  4C8G A;  4NQ3 A;  4O4I B;  3HKB A;  3LWR C;  3HKD B;  4X3L A;  3E22 B;  1VQL F;  1W55 A;  3HTN A;  1N8R H;  2OHW A;  3KJK A;  1YI2 F;  3JVH A;  5IYZ A;  5LXT A;  2AIF A;  5JH7 A;  1PXW A;  2VGN A;  1CN7 A;  5IJ9 B;  3BYQ A;  4LNU B;  3CC7 F;  1QAH A;  1SA0 A;  2LBT A;  3RYF B;  3ZP4 A;  3CCM F;  2CVL A;  2ALE A;  2ZF8 A;  4FFB A;  3M4S A;  1JFF B;  2CHT A;  2UYP A;  3ZOP A;  1SA0 B;  2L26 A;  1H48 A;  3JAT A;  3P10 A;  3IEQ A;  4TV9 A;  3N2K A;  2RHH A;  3D54 A;  1FSZ A;  2LCA A;  5AVM A;  5G4V C;  1IV1 A;  4HNA B;  1Q8R A;  1FFX A;  1NQ3 A;  5CB4 A;  5LOV B;  4I50 A;  3V7Q A;  1VQN F;  5CA0 A;  3G4S F;  1OAP A;  1VQ5 F;  5HXZ A;  3PLA C;  3NVI B;  3PAF A;  2Q1Y A;  5JH7 B;  1XV2 A;  4ZI7 A;  3FD5 A;  2ZAU A;  3K0T A;  1W58 1;  1X7P A;  1CK2 A;  3G6E F;  3VYU C;  1SZQ A;  1XHO A;  3J81 M;  4TV9 B;  4X1I B;  3TD5 A;  3FPI A;  1KNK A;  1W59 A;  3FFM A;  3S0H A;  3HKB B;  3DDN A;  2VAM A;  3FD6 A;  4TV8 B;  4YJ3 A;  1DBF A;  1TVK B;  3GHZ A;  1JN1 A;  2CZW A;  2F9Z C;  3VIU A;  1IV3 A;  1PF5 A;  5EWR A;  3CME F;  1UI9 A;  5IYZ B;  1W5A A;  3JAS A;  1TUB A;  1KD1 H;  3NK6 A;  3DC2 A;  3HAX D;  1J7H A;  2PMP A;  2Z1F A;  3I56 F;  3QHD A;  4I4T A;  2FC3 A;  4O4L B;  2RHJ A;  3WXM B;  3CYP B;  3D00 A;  5BMV B;  1K8A H;  1KNJ A;  2LBW A;  3F6M A;  2AMT A;  1ZWZ A;  2GZL A;  3VYS C;  2BO1 A;  3S03 A;  4ZK7 A;  4O4H A;  5GIN C;  2HVY D;  3CCS F;  3JAL B;  1YJW F;  5HXU A;  5EB1 B;  4BVT A;  5MN6 A;  3HWU A;  3CXC F;  4O4I A;  1GX1 A;  1U3L A;  5HWE A;  5DCV A;  3RYC B;  1FFX B;  1W5E A;  5CB4 B;  5LOV A;  4IHJ A;  5LP6 A;  1YJN F;  3SIV A;  3WGN A;  2QA4 F;  2CSL A;  2HP3 A;  1GZ0 A;  4C8I A;  4M8I A;  5GON A;  3WJQ A;  5C8Y A;  3HJW C;  4IHJ B;  4BVQ A;  5JQG B;  2IQQ A;  1RQ2 A;  5LYJ A;  4ZHW A;  3RYH B;  5JQG A;  3RYI B;  4G4V A;  5HY1 A;  4X1Y A;  2RHL A;  4O2A B;  5GAP K;  4R40 B;  3I55 F;  3JAM M;  1COM A;  4XCQ A;  3V7E A;  4EB6 A;  3B6N A;  1VHA A;  2HS3 A;  1U43 A;  1OFU A;  3JAW B;  3LWP C;  2BTU A;  5KX5 A;  1H7M A;  1U3P A;  3J80 M;  3KHN A;  2VGM A;  3K12 A;  3OON A;  3LWV C;  1TUB B;  3VOB A;  1M90 H;  3JAS B;  5LA6 B;  3C9S A;  3C9R A;  3CPQ A;  3LWQ C;  5HP7 A;  4O4L A;  5EIB C;  2YXZ A;  5GON B;  1VQ8 F;  3WGJ A;  3IKE A;  2HQS C;  4ZHV A;  1YGY A;  2UYK A;  3U0O A;  4LCK A;  3OBW A;  2WAL A;  2HX0 A;  4O4J A;  5KMG A;  5EO3 A;  1X25 A;  4TZZ A;  3O85 A;  1R1M A;  4DRX A;  3MDO A;  4BT2 A;  3JAW A;  1ODE A;  3ELC A;  4G4X A;  1TVK A;  4G4Y A;  4YJ3 B;  5ITZ B;  1VQO F;  3IR9 A;  3P0Z A;  4ZI7 B;  1YHQ F;  4BW0 B;  5JCO A;  4WBN B;  5GIP C;  1QU9 A;  3CD6 F;  2IG8 A;  5EB0 A;  2R6R 1;  3LFO A;  4RQO A;  1X7O A;  2Z01 A;  4EB6 B;  3ESJ A;  2KGW A;  1ONI A;  3OBY A;  3F0D A;  4O2A A;  4C4W C;  4DRX B;  2I6D A;  3EOR A;  1YIJ F;  4ZOL B;  2RB9 A;  4FFB B;  3LYB A;  1VQ4 F;  3S0Y A;  3P4E A;  3CCR F;  3ERN A;  5A2Q M;  1FNK A;  3VYT C;  3HKE B;  5EIB D;  1H47 A;  3V4D A;  5LXT B;  2H6L A;  5EAZ A;  2Z1E A;  1SDS A;  3RYF A;  1NMU B;  1M1K H;  1IV4 A;  3TD3 A;  2UYN B;  1VQV A;  2PHN A;  5IJ9 A;  4BT3 A;  2DT4 A;  3NVK E;  1IPA A;  4KWE A;  2HP0 B;  5B8F A;  2HP0 A;  3CC4 F;  3C9U A;  4I50 B;  1Q81 H;  2MQE A;  2ZOD A;  3Q8H A;  4BT7 A;  1JD1 A;  1VQ6 F;  2R75 1;  1Z5V A;  2CWJ A;  3TD4 A;  3GYQ A;  2KG4 A;  4EI7 A;  5CA1 B;  3N2K B;  3QUW A;  1W3E X;  3N4Y A;  4NUT A;  3WGK A;  4U3J A;  1JY8 A;  3C8L A;  3K14 A;  2GLZ A;  2IAF A;  3G71 F;  3CCL F;  2KTU A;  1E7K A;  3N2G A;  3R0P A;  3WJR A;  5CA0 B;  1K9M H;  4C81 A;  3WPW A;  3CG6 A;  3J7A R;  1U40 A;  3S0W A;  1JJ2 F;  4BT5 A;  3VMF B;  1VQM F;  2AIZ P;  5JVD A;  1DT9 A;  2VXY A;  2I6R A;  4BVR A;  5GAN K;  3VOA A;  2QEX F;  3UT5 A;  4E6E A;  1JFF A;  1W5B A;  4IIJ B;  4X1K A;  4F6R A;  2HRU A;  1RLG A;  3CCE F;  2CW4 A;  1XBI A;  3F0E A;  3F0G A;  4ZHQ B;  1UFY A;  5IJ0 A;  2GVI A;  3CCU F;  3VI6 A;  3CPW F;  4X1I A;  5IT9 M;  1K73 H;  1QD9 A;  4O4H B;  2KTV A;  3HKD A;  2OTM A;  5IJ0 B;  4EI8 A;  1W41 A;  4TUY B;  3KIZ A;  2JNB A;  4YJ2 B;  2DYY A;  5HY0 A;  1W40 A;  3E1Y A;  1W57 A;  4HNA A;  2HRY A;  3KJJ A;  3HKE A;  3LME A;  4ERH A;  3F0F A;  3HKC A;  2OZB A;  3CB2 A;  2VAW A;  1CLI A;  5ITZ A;  3IEW A;  4BVS A;  1KQS F;  3C9T A;  5EZY A;  1VQP F;  3JAT B;  3SIU A;  3AGK A;  1YJ9 F;  2CHS A;  3RA6 A;  4TV8 A;  4NWO B;  4U3J B;  3RE3 A;  3S06 A;  1IV2 A;  3I3F A;  3V3T A;  3E22 A;  4PWT A;  4C82 A;  4BT4 A;  2UYJ A;  5J2U B;  5MN5 A;  4BT6 A;  3CMA F;  4YJ2 A;  1KC8 H;  1XRG A;  2QI2 A;  2OTL F;  3CCQ F;  5J2U A;  5MN4 A;  5FLX M;  4I4T B;  2LBX A;  4WBN A; 
#chains in the Genus database with same CATH homology
 3KE1 A;  1H47 A;  1IV3 A;  3IKF A;  1VH8 A;  2UZH A;  4C8G A;  1JY8 A;  3K14 A;  3B6N A;  1VHA A;  1GX1 A;  1U3L A;  4C81 A;  1U40 A;  3T80 A;  1U43 A;  3ESJ A;  1W57 A;  1H48 A;  2PMP A;  1IV2 A;  1IV4 A;  3K2X A;  3IEQ A;  3P10 A;  3RE3 A;  4C82 A;  3F0D A;  4C8I A;  3MBM A;  1YQN A;  3QHD A;  3F0F A;  3ELC A;  1U3P A;  1T0A A;  1IV1 A;  3FPI A;  1KNK A;  4C8E A;  3EOR A;  1W55 A;  5B8F A;  3JVH A;  1KNJ A;  3IEW A;  3F0E A;  3F0G A;  3F6M A;  3Q8H A;  2AMT A;  2GZL A;  3P0Z A;  3GHZ A;  3ERN A;  1JN1 A;  3FBA A;  3IKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...