3T80A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
AMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium bound to cytidine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3t80A00
3IKEA 3F6MA 1KNKA 3P0ZA 3T80A 3KE1A 3IKFA 3ELCA 3K14A 1KNJA 1YQNA 3JVHA 1IV2A 1IV1A 3F0EA 2PMPA 1U3LA 5B8FA 3F0DA 4C8IA 2GZLA 3QHDA 1GX1A 3FBAA 3Q8HA 1JN1A 3EORA 1W57A 1IV3A 1T0AA 1VH8A 2UZHA 3FPIA 2AMTA 3K2XA 3P10A 4C81A 1U43A 3B6NA 1U40A 3IEWA 1H47A 1JY8A 3MBMA 1W55A 4C8GA 3ERNA 3GHZA 1H48A 1VHAA 4C8EA 3F0GA 3IEQA 1U3PA 3F0FA 4C82A 3ESJA 1IV4A 3RE3A
chains in the Genus database with same CATH superfamily
2GVIA 4ZK7A 1IV2A 2CSLA 4B45A 5MN6A 1J7HA 3F0DA 1W2BF 1NJIH 3HKDB 3PAFA 2KTVA 3FBAA 1VQ7F 3C9SA 2UYNB 1ZWZA 2HRYA 1W40A 1YJ9F 3LWQC 3WGJA 1KD1H 1XHOA 3JAWA 5KX5B 1XRGA 5IJ0A 5G4UC 2K1SA 5FNVB 4C82A 3F0FA 3SIUA 1YJNF 3T80A 4YJ2A 3CCVF 3KE1A 5A2QM 5KMGB 1VQOF 1GO0A 2UYPA 1RLUA 2HQSC 2BTUA 3HKDA 1VK3A 3GTZA 3G6EF 2HVYD 1JN1A 1RQ2A 4I50B 4X20A 4YJ3B 5GIPC 1U43A 5KX5A 3FD5A 4U3JB 4X1IB 3I55F 2HS3A 2YXZA 2F9ZC 2VAWA 4HNAB 3HAXD 2KTUA 5FNVA 4TUYB 3VI6A 3L7QA 3JALB 4BT2A 5EWRA 4ZHVA 1KC8H 5KMGA 3F6MA 3P0ZA 3HKCA 5B8FA 3WGMA 1JFFA 1UI9A 2RB9A 2ZODA 5IJ9A 2GZLA 2PHNA 1VQ9F 5IT9M 3N2GB 5JH7B 4X1IA 4ZOLB 1W581 2DT4A 5EAZA 3M84A 2GLZA 4O2AA 5BMVB 2OTLF 3CCLF 4I4TB 2WALA 3MBMA 2CWJA 1VQ8F 2I6RA 3GHZA 3GYQA 3NK6A 3WGNA 3JAMM 1QVFF 3HKEB 2L26A 1U3PA 3CD6F 1TUBB 4B46A 1KNKA 2Q1YA 5IYZA 5LP6A 4ZI7A 3JCMM 1W5FA 2VGMA 3CG6A 1Q8RA 3CB2A 1CN7A 2B33A 3VOBA 2Z1TA 2R751 2ZF8A 3CMAF 3CCMF 4O4IB 3ON1A 3AGKA 3FPIA 3I56F 4FFBB 2RHOA 2Z1UA 2CVLA 3V3TA 4X1YA 3N4YA 3LWVC 5JVDA 4G4XA 1SA0B 3LYBA 5EIBD 2AIFA 3RYCA 1TUBA 3P4EA 2HP0B 2N48A 2ZVZA 2CZWA 1VQVA 3J81M 3VYUC 3CC2F 3EORA 3S06A 3S03A 5LA6B 2VXYA 4O2BB 5DCVA 2CW4A 2RHLA 3MCQA 3S0HA 3UT5A 4F6RA 5GANK 1NMUB 2HP0A 3ZOPA 1VQMF 5LXTB 3KJKA 1RA4A 4ZHQB 4E6EA 4LNUA 3IMPA 4B5CA 3JATA 3VOAA 3KJJA 3CC7F 1CK2A 3TD3A 1Z5VA 3RYFA 3HKBB 2VAPA 4O4LA 4WBNB 3CCUF 4BT4A 1VQ6F 1TVKB 4EI9A 1X7PA 3VYTC 1QAHA 3CMEF 4IHJB 4EB6A 5G4VC 2HS0A 1X25A 3RA5A 3ELCA 3J80M 1YIJF 1ODEA 1N8RH 5GINC 1DT9A 2HX0A 3U0OA 4G88A 3HKBA 2Z01A 3SIVA 1W5BA 2UYNA 1T0AA 4C81A 1TVKA 1VQNF 5CA0B 2UYJA 1FNJA 2OTMA 5FJ4C 4DXDA 3M4SA 5ITZB 3LWOC 3BYQA 3V4DA 1OAPA 4U39A 2P6YA 4TV9B 2MQEA 3TD5A 3KIZA 5CA1B 1RQ7A 2CHTA 3JVHA 4RHAA 3D00A 4BVSA 3N2KB 3V7EA 5J2TB 3WGLA 1U3LA 1K73H 1XV2A 3QHDA 4I50A 4YJ3A 3VO8A 3CYPB 4TZZA 3M1XA 2QEXF 1R1MA 4U3JA 5J2UB 2Z1FA 5EB1B 3HWUA 4HNAA 2RHJA 3ERNA 4TUYA 1H48A 5HP8A 3JALA 3RYIB 3NVKE 5JCOC 3G4SF 1W3EX 5EYPB 3IKFA 3O85A 5J2TA 1IV1A 4I55B 1W42A 3WJQA 3JAKB 3N2GA 3QUWA 2BO1A 2VGNA 1Q7YH 5JH7A 3WPWA 3K0TA 5AVMA 1VQKF 3C9RA 4ZOLA 2AMTA 2ZAUA 4M8IA 4BVRA 1K9MH 3VYSC 5BMVA 3B6NA 3V7QA 2LBTA 5LYJB 1FFXB 2VAMA 4I4TA 3C9UA 2V9YA 4C4WC 1YITF 3CCEF 3HKEA 2QA4F 3JASB 1IV4A 4TV8B 1W5AA 3D01A 3RE3A 3WJPA 3OW2F 5LP6C 4RQOA 4XCQA 3CCJF 3CPWF 5EZYB 4BT3A 1VQ4F 2BTOA 1Z5WA 2LBWA 4O4IA 5GONB 2ALEA 2G9IA 3Q8HA 1VQ5F 3RYHB 3K12A 5HY0A 4BVQA 1YJWF 3K2XA 4FFBA 1VQPF 4O4JB 2QI2A 3LMEA 1RLGA 3J7AR 1SA0A 4C8GA 5LOVB 4NQ3A 2OZBA 4PWTA 3WJRA 1GZ0A 3TD4A 3MDOA 5EZYA 2ZVYA 1Q82H 3CYQA 1QVGF 1XBIA 3NMUC 4DRXB 3CPQA 1X52A 3JARB 3PLAC 5LA6A 1W57A 4O2BA 2DYYA 1OFUA 1T0KB 3FFMA 1YGYA 3E22B 3IEWA 2FC3A 5HY4A 1VQLF 1KQSF 3JAWB 1W59A 3MCAB 1VHAA 5IJ0B 5LXTA 3CC4F 1ONIA 4ZHQA 4G4ZA 3IKEA 2HS4A 3R0PA 4DRXA 4YJ2B 2LCAA 1YQNA 1IPAA 1PF5A 4KWEA 5HY1A 1DBFA 3JARA 5GAPK 5GIOC 3N4ZA 1Q86H 5HXUA 4WBNA 3E22A 3OONA 4X20B 2I6DA 3VIUA 1CLIA 4X3MA 5MN5A 4O4HB 3S0YA 2Z1EA 3VCZA 3MQWA 1NQ3A 3C9TA 2AIZP 2QTPA 3FD6A 1JD1A 4IHJA 3ZP4A 1M90H 4ZHYB 3DDNA 2IG8A 4LCKA 2JNBA 1KNJA 3I3FA 3HKCB 1H7MA 2PMPA 4G4YA 4EI8A 1JFFB 5IJ9B 3NVIB 5EB0A 3RA6A 5CA0A 3P10A 4O4HA 1SZQA 1QD9A 1GO1A 1FNKA 1YI2F 4O2AB 1JY8A 3WPXA 1YHQF 5MN4A 4X1KB 5ITZA 5EIBC 1PXWA 4IIJB 3ZP7A 1UFYA 3IEQA 4TV9A 1SDSA 2EWCA 5JCOA 4BT6A 5CA1A 3CCSF 3HTNA 3N2KA 2LBXA 5IYZB 2H6LA 5LP6B 2HP3A 2KGWA 3QTYA 4ZI7B 5HXZA 1X7OA 3WGKA 1Q81H 1M1KH 1GX1A 2CHSA 3CXCF 4BW0B 2HRUA 1VH8A 4EI7A 1S72F 5J2UA 3S0WA 4X1KA 3S02A 1FSZA 2IQQA 2NMUA 4X1YB 4IIJA 5JVDB 2ZOVA 3RYIA 4C8EA 4ZHWA 3RYCB 3E20B 3F0GA 2BTQB 5EYPA 3D54A 4G4WA 5C8YB 2UYKA 3K14A 4I55A 3E1YA 3DC2A 5HY2A 3JAKA 4C8IA 3HJWC 1COMA 5EO3A 5HWEA 2OTJF 2UZHA 5JQGB 4BT5A 3LWRC 4NWOB 5LYJA 3CCQF 1FFXA 3OBYA 2W8BC 3IR9A 3UT5B 2KG4A 5FLXM 4R40B 5CB4B 1W5EA 4F6RB 1W55A 2IAFA 2RHHA 3LDTA 3VTIC 3JASA 4ERHA 3G71F 4TV8A 5C8YA 3ESJA 3LFOA 4BVTA 1JJ2F 4NUTA 1K8AH 4LNUB 2H8CA 2OHWA 3JATB 3KHNA 3F0EA 5GONA 3WXMB 3NK7A 5JQGA 2FGYA 3RYHA 2H8EA 3C8LA 4BT7A 1IV3A 3LWPC 4BY9D 2YYEA 3RYFB 4O4JA 4O4LB 1U40A 5CB4A 1W41A 1H47A 3OBWA 5LOVA 5HP7A 1E7KA 2Q1XA 1QU9A 4G4VA 3ZO8A 4X3LA 3VMFB 4B62A 3I7TA 4EB6B 3CCRF 2R6R1
chains in the Genus database with same CATH topology
3IKEA 3F6MA 1KNKA 3P0ZA 3T80A 3KE1A 3IKFA 3ELCA 3K14A 1KNJA 1YQNA 3JVHA 1IV2A 1IV1A 3F0EA 2PMPA 1U3LA 5B8FA 3F0DA 4C8IA 2GZLA 3QHDA 1GX1A 3FBAA 3Q8HA 1JN1A 3EORA 1W57A 1IV3A 1T0AA 1VH8A 2UZHA 3FPIA 2AMTA 3K2XA 3P10A 4C81A 1U43A 3B6NA 1U40A 3IEWA 1H47A 1JY8A 3MBMA 1W55A 4C8GA 3ERNA 3GHZA 1H48A 1VHAA 4C8EA 3F0GA 3IEQA 1U3PA 3F0FA 4C82A 3ESJA 1IV4A 3RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKE A;  3F6M A;  1KNK A;  3P0Z A;  3T80 A;  3KE1 A;  3IKF A;  3ELC A;  3K14 A;  1KNJ A;  1YQN A;  3JVH A;  1IV2 A;  1IV1 A;  3F0E A;  2PMP A;  1U3L A;  5B8F A;  3F0D A;  4C8I A;  2GZL A;  3QHD A;  1GX1 A;  3FBA A;  3Q8H A;  1JN1 A;  3EOR A;  1W57 A;  1IV3 A;  1T0A A;  1VH8 A;  2UZH A;  3FPI A;  2AMT A;  3K2X A;  3P10 A;  4C81 A;  1U43 A;  3B6N A;  1U40 A;  3IEW A;  1H47 A;  1JY8 A;  3MBM A;  1W55 A;  4C8G A;  3ERN A;  3GHZ A;  1H48 A;  1VHA A;  4C8E A;  3F0G A;  3IEQ A;  1U3P A;  3F0F A;  4C82 A;  3ESJ A;  1IV4 A;  3RE3 A; 
#chains in the Genus database with same CATH topology
 2GVI A;  4ZK7 A;  1IV2 A;  2CSL A;  4B45 A;  5MN6 A;  1J7H A;  3F0D A;  1W2B F;  1NJI H;  3HKD B;  3PAF A;  2KTV A;  3FBA A;  1VQ7 F;  3C9S A;  2UYN B;  1ZWZ A;  2HRY A;  1W40 A;  1YJ9 F;  3LWQ C;  3WGJ A;  1KD1 H;  1XHO A;  3JAW A;  5KX5 B;  1XRG A;  5IJ0 A;  5G4U C;  2K1S A;  5FNV B;  4C82 A;  3F0F A;  3SIU A;  1YJN F;  3T80 A;  4YJ2 A;  3CCV F;  3KE1 A;  5A2Q M;  5KMG B;  1VQO F;  1GO0 A;  2UYP A;  1RLU A;  2HQS C;  2BTU A;  3HKD A;  1VK3 A;  3GTZ A;  3G6E F;  2HVY D;  1JN1 A;  1RQ2 A;  4I50 B;  4X20 A;  4YJ3 B;  5GIP C;  1U43 A;  5KX5 A;  3FD5 A;  4U3J B;  4X1I B;  3I55 F;  2HS3 A;  2YXZ A;  2F9Z C;  2VAW A;  4HNA B;  3HAX D;  2KTU A;  5FNV A;  4TUY B;  3VI6 A;  3L7Q A;  3JAL B;  4BT2 A;  5EWR A;  4ZHV A;  1KC8 H;  5KMG A;  3F6M A;  3P0Z A;  3HKC A;  5B8F A;  3WGM A;  1JFF A;  1UI9 A;  2RB9 A;  2ZOD A;  5IJ9 A;  2GZL A;  2PHN A;  1VQ9 F;  5IT9 M;  3N2G B;  5JH7 B;  4X1I A;  4ZOL B;  1W58 1;  2DT4 A;  5EAZ A;  3M84 A;  2GLZ A;  4O2A A;  5BMV B;  2OTL F;  3CCL F;  4I4T B;  2WAL A;  3MBM A;  2CWJ A;  1VQ8 F;  2I6R A;  3GHZ A;  3GYQ A;  3NK6 A;  3WGN A;  3JAM M;  1QVF F;  3HKE B;  2L26 A;  1U3P A;  3CD6 F;  1TUB B;  4B46 A;  1KNK A;  2Q1Y A;  5IYZ A;  5LP6 A;  4ZI7 A;  3JCM M;  1W5F A;  2VGM A;  3CG6 A;  1Q8R A;  3CB2 A;  1CN7 A;  2B33 A;  3VOB A;  2Z1T A;  2R75 1;  2ZF8 A;  3CMA F;  3CCM F;  4O4I B;  3ON1 A;  3AGK A;  3FPI A;  3I56 F;  4FFB B;  2RHO A;  2Z1U A;  2CVL A;  3V3T A;  4X1Y A;  3N4Y A;  3LWV C;  5JVD A;  4G4X A;  1SA0 B;  3LYB A;  5EIB D;  2AIF A;  3RYC A;  1TUB A;  3P4E A;  2HP0 B;  2N48 A;  2ZVZ A;  2CZW A;  1VQV A;  3J81 M;  3VYU C;  3CC2 F;  3EOR A;  3S06 A;  3S03 A;  5LA6 B;  2VXY A;  4O2B B;  5DCV A;  2CW4 A;  2RHL A;  3MCQ A;  3S0H A;  3UT5 A;  4F6R A;  5GAN K;  1NMU B;  2HP0 A;  3ZOP A;  1VQM F;  5LXT B;  3KJK A;  1RA4 A;  4ZHQ B;  4E6E A;  4LNU A;  3IMP A;  4B5C A;  3JAT A;  3VOA A;  3KJJ A;  3CC7 F;  1CK2 A;  3TD3 A;  1Z5V A;  3RYF A;  3HKB B;  2VAP A;  4O4L A;  4WBN B;  3CCU F;  4BT4 A;  1VQ6 F;  1TVK B;  4EI9 A;  1X7P A;  3VYT C;  1QAH A;  3CME F;  4IHJ B;  4EB6 A;  5G4V C;  2HS0 A;  1X25 A;  3RA5 A;  3ELC A;  3J80 M;  1YIJ F;  1ODE A;  1N8R H;  5GIN C;  1DT9 A;  2HX0 A;  3U0O A;  4G88 A;  3HKB A;  2Z01 A;  3SIV A;  1W5B A;  2UYN A;  1T0A A;  4C81 A;  1TVK A;  1VQN F;  5CA0 B;  2UYJ A;  1FNJ A;  2OTM A;  5FJ4 C;  4DXD A;  3M4S A;  5ITZ B;  3LWO C;  3BYQ A;  3V4D A;  1OAP A;  4U39 A;  2P6Y A;  4TV9 B;  2MQE A;  3TD5 A;  3KIZ A;  5CA1 B;  1RQ7 A;  2CHT A;  3JVH A;  4RHA A;  3D00 A;  4BVS A;  3N2K B;  3V7E A;  5J2T B;  3WGL A;  1U3L A;  1K73 H;  1XV2 A;  3QHD A;  4I50 A;  4YJ3 A;  3VO8 A;  3CYP B;  4TZZ A;  3M1X A;  2QEX F;  1R1M A;  4U3J A;  5J2U B;  2Z1F A;  5EB1 B;  3HWU A;  4HNA A;  2RHJ A;  3ERN A;  4TUY A;  1H48 A;  5HP8 A;  3JAL A;  3RYI B;  3NVK E;  5JCO C;  3G4S F;  1W3E X;  5EYP B;  3IKF A;  3O85 A;  5J2T A;  1IV1 A;  4I55 B;  1W42 A;  3WJQ A;  3JAK B;  3N2G A;  3QUW A;  2BO1 A;  2VGN A;  1Q7Y H;  5JH7 A;  3WPW A;  3K0T A;  5AVM A;  1VQK F;  3C9R A;  4ZOL A;  2AMT A;  2ZAU A;  4M8I A;  4BVR A;  1K9M H;  3VYS C;  5BMV A;  3B6N A;  3V7Q A;  2LBT A;  5LYJ B;  1FFX B;  2VAM A;  4I4T A;  3C9U A;  2V9Y A;  4C4W C;  1YIT F;  3CCE F;  3HKE A;  2QA4 F;  3JAS B;  1IV4 A;  4TV8 B;  1W5A A;  3D01 A;  3RE3 A;  3WJP A;  3OW2 F;  5LP6 C;  4RQO A;  4XCQ A;  3CCJ F;  3CPW F;  5EZY B;  4BT3 A;  1VQ4 F;  2BTO A;  1Z5W A;  2LBW A;  4O4I A;  5GON B;  2ALE A;  2G9I A;  3Q8H A;  1VQ5 F;  3RYH B;  3K12 A;  5HY0 A;  4BVQ A;  1YJW F;  3K2X A;  4FFB A;  1VQP F;  4O4J B;  2QI2 A;  3LME A;  1RLG A;  3J7A R;  1SA0 A;  4C8G A;  5LOV B;  4NQ3 A;  2OZB A;  4PWT A;  3WJR A;  1GZ0 A;  3TD4 A;  3MDO A;  5EZY A;  2ZVY A;  1Q82 H;  3CYQ A;  1QVG F;  1XBI A;  3NMU C;  4DRX B;  3CPQ A;  1X52 A;  3JAR B;  3PLA C;  5LA6 A;  1W57 A;  4O2B A;  2DYY A;  1OFU A;  1T0K B;  3FFM A;  1YGY A;  3E22 B;  3IEW A;  2FC3 A;  5HY4 A;  1VQL F;  1KQS F;  3JAW B;  1W59 A;  3MCA B;  1VHA A;  5IJ0 B;  5LXT A;  3CC4 F;  1ONI A;  4ZHQ A;  4G4Z A;  3IKE A;  2HS4 A;  3R0P A;  4DRX A;  4YJ2 B;  2LCA A;  1YQN A;  1IPA A;  1PF5 A;  4KWE A;  5HY1 A;  1DBF A;  3JAR A;  5GAP K;  5GIO C;  3N4Z A;  1Q86 H;  5HXU A;  4WBN A;  3E22 A;  3OON A;  4X20 B;  2I6D A;  3VIU A;  1CLI A;  4X3M A;  5MN5 A;  4O4H B;  3S0Y A;  2Z1E A;  3VCZ A;  3MQW A;  1NQ3 A;  3C9T A;  2AIZ P;  2QTP A;  3FD6 A;  1JD1 A;  4IHJ A;  3ZP4 A;  1M90 H;  4ZHY B;  3DDN A;  2IG8 A;  4LCK A;  2JNB A;  1KNJ A;  3I3F A;  3HKC B;  1H7M A;  2PMP A;  4G4Y A;  4EI8 A;  1JFF B;  5IJ9 B;  3NVI B;  5EB0 A;  3RA6 A;  5CA0 A;  3P10 A;  4O4H A;  1SZQ A;  1QD9 A;  1GO1 A;  1FNK A;  1YI2 F;  4O2A B;  1JY8 A;  3WPX A;  1YHQ F;  5MN4 A;  4X1K B;  5ITZ A;  5EIB C;  1PXW A;  4IIJ B;  3ZP7 A;  1UFY A;  3IEQ A;  4TV9 A;  1SDS A;  2EWC A;  5JCO A;  4BT6 A;  5CA1 A;  3CCS F;  3HTN A;  3N2K A;  2LBX A;  5IYZ B;  2H6L A;  5LP6 B;  2HP3 A;  2KGW A;  3QTY A;  4ZI7 B;  5HXZ A;  1X7O A;  3WGK A;  1Q81 H;  1M1K H;  1GX1 A;  2CHS A;  3CXC F;  4BW0 B;  2HRU A;  1VH8 A;  4EI7 A;  1S72 F;  5J2U A;  3S0W A;  4X1K A;  3S02 A;  1FSZ A;  2IQQ A;  2NMU A;  4X1Y B;  4IIJ A;  5JVD B;  2ZOV A;  3RYI A;  4C8E A;  4ZHW A;  3RYC B;  3E20 B;  3F0G A;  2BTQ B;  5EYP A;  3D54 A;  4G4W A;  5C8Y B;  2UYK A;  3K14 A;  4I55 A;  3E1Y A;  3DC2 A;  5HY2 A;  3JAK A;  4C8I A;  3HJW C;  1COM A;  5EO3 A;  5HWE A;  2OTJ F;  2UZH A;  5JQG B;  4BT5 A;  3LWR C;  4NWO B;  5LYJ A;  3CCQ F;  1FFX A;  3OBY A;  2W8B C;  3IR9 A;  3UT5 B;  2KG4 A;  5FLX M;  4R40 B;  5CB4 B;  1W5E A;  4F6R B;  1W55 A;  2IAF A;  2RHH A;  3LDT A;  3VTI C;  3JAS A;  4ERH A;  3G71 F;  4TV8 A;  5C8Y A;  3ESJ A;  3LFO A;  4BVT A;  1JJ2 F;  4NUT A;  1K8A H;  4LNU B;  2H8C A;  2OHW A;  3JAT B;  3KHN A;  3F0E A;  5GON A;  3WXM B;  3NK7 A;  5JQG A;  2FGY A;  3RYH A;  2H8E A;  3C8L A;  4BT7 A;  1IV3 A;  3LWP C;  4BY9 D;  2YYE A;  3RYF B;  4O4J A;  4O4L B;  1U40 A;  5CB4 A;  1W41 A;  1H47 A;  3OBW A;  5LOV A;  5HP7 A;  1E7K A;  2Q1X A;  1QU9 A;  4G4V A;  3ZO8 A;  4X3L A;  3VMF B;  4B62 A;  3I7T A;  4EB6 B;  3CCR F;  2R6R 1; 
#chains in the Genus database with same CATH homology
 3IKE A;  3F6M A;  1KNK A;  3P0Z A;  3T80 A;  3KE1 A;  3IKF A;  3ELC A;  3K14 A;  1KNJ A;  1YQN A;  3JVH A;  1IV2 A;  1IV1 A;  3F0E A;  2PMP A;  1U3L A;  5B8F A;  3F0D A;  4C8I A;  2GZL A;  3QHD A;  1GX1 A;  3FBA A;  3Q8H A;  1JN1 A;  3EOR A;  1W57 A;  1IV3 A;  1T0A A;  1VH8 A;  2UZH A;  3FPI A;  2AMT A;  3K2X A;  3P10 A;  4C81 A;  1U43 A;  3B6N A;  1U40 A;  3IEW A;  1H47 A;  1JY8 A;  3MBM A;  1W55 A;  4C8G A;  3ERN A;  3GHZ A;  1H48 A;  1VHA A;  4C8E A;  3F0G A;  3IEQ A;  1U3P A;  3F0F A;  4C82 A;  3ESJ A;  1IV4 A;  3RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...