3T80A

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
AMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Salmonella typhimurium bound to cytidine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3t80A00
3GHZA 3FPIA 1YQNA 3IEWA 3MBMA 1VHAA 3ESJA 3F6MA 1JY8A 4C81A 3Q8HA 3ERNA 1U3PA 3JVHA 3ELCA 3P10A 3IKEA 1H47A 1T0AA 1IV2A 3FBAA 3P0ZA 3F0GA 3T80A 3EORA 1IV1A 4C8EA 3RE3A 3B6NA 1W55A 2GZLA 4C8IA 1VH8A 1U43A 1KNJA 1U3LA 1H48A 1U40A 4C82A 3K2XA 4C8GA 3IEQA 2AMTA 3IKFA 3QHDA 1GX1A 1IV4A 1IV3A 2UZHA 3KE1A 3F0DA 2PMPA 1W57A 1KNKA 3F0EA 1JN1A 3K14A 5B8FA 3F0FA
chains in the Genus database with same CATH superfamily
3WJRA 4LCKA 1YJWF 2HQSC 3JATB 4B45A 1NQ3A 5EB1B 5EYPB 1X52A 4NUTA 5C8YA 1IPAA 3HKCB 5LYJA 4ERHA 1ONIA 4BVRA 2KGWA 2I6DA 4X20B 2CZWA 3HKDA 4E6EA 5GAPK 1W5EA 3WGMA 2GVIA 5LYJB 4X1KB 5LOVB 3JAKA 2IAFA 5FLXM 5HY2A 3KE1A 3G4SF 5GIOC 1W41A 3IR9A 5JCOA 5HXZA 3FPIA 2BO1A 4ZK7A 2WALA 5J2TA 3I7TA 1JD1A 3VYUC 2VAMA 3LWQC 4BT7A 5JCOC 4G4YA 5KX5B 3WGLA 3ZP4A 2CWJA 1JFFB 1Q82H 5ITZB 2PHNA 1OAPA 3T80A 4KWEA 2KTVA 2K1SA 5LOVA 1W55A 3S0WA 3HWUA 1YHQF 1Z5VA 3F0DA 3IEWA 2FC3A 5JVDB 1VQ9F 3LFOA 3KHNA 5FNVA 4RHAA 5HP7A 2Z1UA 3C8LA 3KJKA 4DXDA 2EWCA 5IT9M 5IJ9B 1RLUA 4O4LA 4I50A 3CCEF 3CCSF 5CA1A 1QAHA 3RE3A 5HWEA 4IIJB 3ZP7A 1H48A 1U40A 4I4TB 4X1IA 3UT5A 1N8RH 3JARA 2UZHA 5IJ0B 3CG6A 5EAZA 5ITZA 3CMEF 3CYQA 3ZO8A 3GHZA 3U0OA 1TUBB 4TV8B 2JNBA 1TUBA 4TV8A 5LXTA 3CCJF 1SZQA 1VQ4F 5LP6B 4C81A 3CMAF 2ZOVA 1VQNF 5EWRA 5CB4A 3E20B 4B46A 4O4HA 3R0PA 1IV1A 1QU9A 1VQ8F 3V3TA 4B5CA 1YI2F 3G71F 1U3LA 1W581 4O2BB 4TUYB 2AIZP 3CCRF 3IEQA 5HP8A 3NK6A 3CCLF 1KNKA 4BY9D 2R751 2IG8A 3JATA 3S0HA 3JAWB 4ZHVA 1Q81H 3NK7A 3RYHA 4M8IA 2Z1EA 2DT4A 2L26A 3O85A 4YJ2B 3I55F 2UYNA 1W2BF 1XHOA 1M90H 4ZHWA 4ZHQB 3V7QA 4ZHQA 4U3JA 3LDTA 4X3LA 3MQWA 3IMPA 2CSLA 4ZI7A 1JFFA 1RQ7A 5IYZB 3J7AR 2HVYD 2OTJF 1IV4A 3V7EA 3PLAC 3K0TA 5LA6A 1DT9A 3WJQA 5HXUA 4IHJB 3KJJA 2BTUA 3S02A 4G4VA 3CCUF 3FFMA 2Q1XA 3S06A 1COMA 2V9YA 1W5FA 3L7QA 4O2AA 4X3MA 3VO8A 1KQSF 1VQ5F 1VQLF 4BW0B 4B62A 4IHJA 4BVQA 2CHTA 1YITF 1Q7YH 1FFXB 1Z5WA 3P10A 1T0AA 1RLGA 4O4IB 5EZYA 1VQOF 1ODEA 3B6NA 3HKBA 4TV9A 5JH7B 3SIUA 5EB0A 1TVKA 5HY4A 4C8GA 2LBWA 2AMTA 3I56F 3MDOA 1SA0B 1FNJA 3N4ZA 1K73H 1VQ7F 1T0KB 2PMPA 4O4JA 5A2QM 3NVIB 1GZ0A 3M4SA 5J2UB 5BMVB 3ERNA 2H8EA 3P4EA 1YJ9F 5CA1B 5DCVA 4X1KA 2LCAA 2ZODA 5MN4A 1TVKB 3E22B 4C8EA 5EIBC 1CK2A 1VQVA 3TD5A 1U43A 1GO0A 4EI8A 2HRYA 3J80M 3TD3A 4LNUA 1W5AA 1K9MH 2BTOA 2Z1TA 3JALA 2OHWA 1W42A 3MCAB 3CCMF 1QVGF 1VHAA 5LP6A 3WGNA 5JVDA 2H6LA 4G88A 4G4WA 5G4UC 3HJWC 1PF5A 5LP6C 3JASA 2YYEA 3BYQA 3D54A 1RA4A 5HY0A 2MQEA 5EIBD 3CD6F 1W40A 3QUWA 2R6R1 3C9TA 2B33A 4ZHYB 2ALEA 5LXTB 3VTIC 3LWPC 3CC2F 2OTMA 2FGYA 3LYBA 1E7KA 1JY8A 1CLIA 3GTZA 3UT5B 4I4TA 4X1IB 1SA0A 2RHJA 2N48A 3JVHA 3RA5A 5EZYB 3WPXA 2Z1FA 3WPWA 2P6YA 2YXZA 3VYTC 1YIJF 2I6RA 4O4HB 1PXWA 1W3EX 4EI9A 5C8YB 5CA0A 2QA4F 3MBMA 3D00A 2OTLF 3HAXD 5JQGA 3OW2F 3OONA 1FSZA 1R1MA 3CPWF 3HKEA 3RA6A 4O4JB 1U3PA 3C9SA 4DRXA 3E1YA 1NMUB 3WXMB 4F6RA 2G9IA 2H8CA 2BTQB 3AGKA 1ZWZA 5GONB 1QD9A 3OBWA 1UFYA 3NVKE 3D01A 4C4WC 3HKBB 4TV9B 5MN5A 1KC8H 4IIJA 1VQKF 5IJ9A 3J81M 4ZOLB 3JASB 3OBYA 3JAMM 1OFUA 3CB2A 3F0EA 1XV2A 3K14A 3RYHB 3CXCF 5FNVB 3WGJA 1FNKA 2VGNA 2Q1YA 3VOAA 3VCZA 4LNUB 3KIZA 4BVTA 3I3FA 3Q8HA 4G4ZA 3JALB 3VMFB 3CYPB 5LA6B 3CCVF 1H47A 3FBAA 4I55B 1IV2A 5EO3A 2DYYA 4BT5A 3N2GB 2UYKA 4WBNB 1VH8A 2UYJA 3IKFA 5EYPA 1GX1A 4R40B 4F6RB 5GINC 1DBFA 3DDNA 5JQGB 2W8BC 4XCQA 3RYFA 5J2UA 3HKEB 5CA0B 3VOBA 1X25A 1JJ2F 3WJPA 3JAKB 3ELCA 3NMUC 2VXYA 3M84A 3CC7F 4G4XA 3LWVC 4WBNA 3F0GA 3ON1A 2QEXF 3RYCB 3LMEA 1H7MA 4X1YA 2ZVYA 4U39A 2CVLA 2HP0A 2CHSA 3RYIB 1J7HA 1IV3A 4HNAA 4YJ3A 3S0YA 2QTPA 1W57A 5KMGB 1XRGA 5HY1A 3M1XA 4BVSA 1VK3A 4O2AB 2RHLA 3PAFA 5FJ4C 4FFBA 4BT4A 1Q86H 3S03A 3VYSC 3CPQA 4RQOA 2HX0A 3IKEA 1YJNF 2VAWA 3P0ZA 2ZAUA 2ZF8A 2LBXA 2HS3A 2GZLA 2ZVZA 4BT6A 5JH7A 1KNJA 3G6EF 3N2GA 2RHHA 2UYNB 3K2XA 4TZZA 5KX5A 4FFBB 2NMUA 3LWOC 2KG4A 1FFXA 4EI7A 5B8FA 2LBTA 5GIPC 5GANK 3HTNA 5KMGA 3ESJA 3JAWA 3QTYA 2HS0A 1XBIA 2UYPA 3RYIA 2KTUA 3FD5A 3JCMM 2VGMA 4O2BA 1X7PA 3C9RA 4TUYA 4YJ3B 4X1YB 1KD1H 1UI9A 4ZOLA 2VAPA 3N2KA 5AVMA 2HP0B 3N2KB 3C9UA 3E22A 3LWRC 2RB9A 1VQPF 2QI2A 4U3JB 2AIFA 5GONA 3VIUA 2HRUA 1CN7A 3F0FA 1YQNA 1W59A 5MN6A 3K12A 1VQ6F 5BMVA 5G4VC 5J2TB 1QVFF 3TD4A 1YGYA 2HS4A 4ZI7B 5IYZA 3DC2A 3N4YA 3JARB 4NWOB 3WGKA 5IJ0A 2F9ZC 3GYQA 3MCQA 1X7OA 2IQQA 2GLZA 4I50B 4O4LB 3ZOPA 4O4IA 1VQMF 4EB6B 3HKDB 3VI6A 4X20A 4C82A 4I55A 4YJ2A 1RQ2A 3QHDA 2RHOA 3SIVA 4BT2A 3HKCA 1JN1A 1S72F 2CW4A 3F6MA 4HNAB 3V4DA 1W5BA 4PWTA 2HP3A 3RYFB 2Z01A 1SDSA 3FD6A 4EB6A 3RYCA 3EORA 2OZBA 1GO1A 3CCQF 4NQ3A 4C8IA 1M1KH 1K8AH 5CB4B 1Q8RA 4BT3A 4DRXB 3CC4F 1NJIH
chains in the Genus database with same CATH topology
3GHZA 3FPIA 1YQNA 3IEWA 3MBMA 1VHAA 3ESJA 3F6MA 1JY8A 4C81A 3Q8HA 3ERNA 1U3PA 3JVHA 3ELCA 3P10A 3IKEA 1H47A 1T0AA 1IV2A 3FBAA 3P0ZA 3F0GA 3T80A 3EORA 1IV1A 4C8EA 3RE3A 3B6NA 1W55A 2GZLA 4C8IA 1VH8A 1U43A 1KNJA 1U3LA 1H48A 1U40A 4C82A 3K2XA 4C8GA 3IEQA 2AMTA 3IKFA 3QHDA 1GX1A 1IV4A 1IV3A 2UZHA 3KE1A 3F0DA 2PMPA 1W57A 1KNKA 3F0EA 1JN1A 3K14A 5B8FA 3F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHZ A;  3FPI A;  1YQN A;  3IEW A;  3MBM A;  1VHA A;  3ESJ A;  3F6M A;  1JY8 A;  4C81 A;  3Q8H A;  3ERN A;  1U3P A;  3JVH A;  3ELC A;  3P10 A;  3IKE A;  1H47 A;  1T0A A;  1IV2 A;  3FBA A;  3P0Z A;  3F0G A;  3T80 A;  3EOR A;  1IV1 A;  4C8E A;  3RE3 A;  3B6N A;  1W55 A;  2GZL A;  4C8I A;  1VH8 A;  1U43 A;  1KNJ A;  1U3L A;  1H48 A;  1U40 A;  4C82 A;  3K2X A;  4C8G A;  3IEQ A;  2AMT A;  3IKF A;  3QHD A;  1GX1 A;  1IV4 A;  1IV3 A;  2UZH A;  3KE1 A;  3F0D A;  2PMP A;  1W57 A;  1KNK A;  3F0E A;  1JN1 A;  3K14 A;  5B8F A;  3F0F A; 
#chains in the Genus database with same CATH topology
 3WJR A;  4LCK A;  1YJW F;  2HQS C;  3JAT B;  4B45 A;  1NQ3 A;  5EB1 B;  5EYP B;  1X52 A;  4NUT A;  5C8Y A;  1IPA A;  3HKC B;  5LYJ A;  4ERH A;  1ONI A;  4BVR A;  2KGW A;  2I6D A;  4X20 B;  2CZW A;  3HKD A;  4E6E A;  5GAP K;  1W5E A;  3WGM A;  2GVI A;  5LYJ B;  4X1K B;  5LOV B;  3JAK A;  2IAF A;  5FLX M;  5HY2 A;  3KE1 A;  3G4S F;  5GIO C;  1W41 A;  3IR9 A;  5JCO A;  5HXZ A;  3FPI A;  2BO1 A;  4ZK7 A;  2WAL A;  5J2T A;  3I7T A;  1JD1 A;  3VYU C;  2VAM A;  3LWQ C;  4BT7 A;  5JCO C;  4G4Y A;  5KX5 B;  3WGL A;  3ZP4 A;  2CWJ A;  1JFF B;  1Q82 H;  5ITZ B;  2PHN A;  1OAP A;  3T80 A;  4KWE A;  2KTV A;  2K1S A;  5LOV A;  1W55 A;  3S0W A;  3HWU A;  1YHQ F;  1Z5V A;  3F0D A;  3IEW A;  2FC3 A;  5JVD B;  1VQ9 F;  3LFO A;  3KHN A;  5FNV A;  4RHA A;  5HP7 A;  2Z1U A;  3C8L A;  3KJK A;  4DXD A;  2EWC A;  5IT9 M;  5IJ9 B;  1RLU A;  4O4L A;  4I50 A;  3CCE F;  3CCS F;  5CA1 A;  1QAH A;  3RE3 A;  5HWE A;  4IIJ B;  3ZP7 A;  1H48 A;  1U40 A;  4I4T B;  4X1I A;  3UT5 A;  1N8R H;  3JAR A;  2UZH A;  5IJ0 B;  3CG6 A;  5EAZ A;  5ITZ A;  3CME F;  3CYQ A;  3ZO8 A;  3GHZ A;  3U0O A;  1TUB B;  4TV8 B;  2JNB A;  1TUB A;  4TV8 A;  5LXT A;  3CCJ F;  1SZQ A;  1VQ4 F;  5LP6 B;  4C81 A;  3CMA F;  2ZOV A;  1VQN F;  5EWR A;  5CB4 A;  3E20 B;  4B46 A;  4O4H A;  3R0P A;  1IV1 A;  1QU9 A;  1VQ8 F;  3V3T A;  4B5C A;  1YI2 F;  3G71 F;  1U3L A;  1W58 1;  4O2B B;  4TUY B;  2AIZ P;  3CCR F;  3IEQ A;  5HP8 A;  3NK6 A;  3CCL F;  1KNK A;  4BY9 D;  2R75 1;  2IG8 A;  3JAT A;  3S0H A;  3JAW B;  4ZHV A;  1Q81 H;  3NK7 A;  3RYH A;  4M8I A;  2Z1E A;  2DT4 A;  2L26 A;  3O85 A;  4YJ2 B;  3I55 F;  2UYN A;  1W2B F;  1XHO A;  1M90 H;  4ZHW A;  4ZHQ B;  3V7Q A;  4ZHQ A;  4U3J A;  3LDT A;  4X3L A;  3MQW A;  3IMP A;  2CSL A;  4ZI7 A;  1JFF A;  1RQ7 A;  5IYZ B;  3J7A R;  2HVY D;  2OTJ F;  1IV4 A;  3V7E A;  3PLA C;  3K0T A;  5LA6 A;  1DT9 A;  3WJQ A;  5HXU A;  4IHJ B;  3KJJ A;  2BTU A;  3S02 A;  4G4V A;  3CCU F;  3FFM A;  2Q1X A;  3S06 A;  1COM A;  2V9Y A;  1W5F A;  3L7Q A;  4O2A A;  4X3M A;  3VO8 A;  1KQS F;  1VQ5 F;  1VQL F;  4BW0 B;  4B62 A;  4IHJ A;  4BVQ A;  2CHT A;  1YIT F;  1Q7Y H;  1FFX B;  1Z5W A;  3P10 A;  1T0A A;  1RLG A;  4O4I B;  5EZY A;  1VQO F;  1ODE A;  3B6N A;  3HKB A;  4TV9 A;  5JH7 B;  3SIU A;  5EB0 A;  1TVK A;  5HY4 A;  4C8G A;  2LBW A;  2AMT A;  3I56 F;  3MDO A;  1SA0 B;  1FNJ A;  3N4Z A;  1K73 H;  1VQ7 F;  1T0K B;  2PMP A;  4O4J A;  5A2Q M;  3NVI B;  1GZ0 A;  3M4S A;  5J2U B;  5BMV B;  3ERN A;  2H8E A;  3P4E A;  1YJ9 F;  5CA1 B;  5DCV A;  4X1K A;  2LCA A;  2ZOD A;  5MN4 A;  1TVK B;  3E22 B;  4C8E A;  5EIB C;  1CK2 A;  1VQV A;  3TD5 A;  1U43 A;  1GO0 A;  4EI8 A;  2HRY A;  3J80 M;  3TD3 A;  4LNU A;  1W5A A;  1K9M H;  2BTO A;  2Z1T A;  3JAL A;  2OHW A;  1W42 A;  3MCA B;  3CCM F;  1QVG F;  1VHA A;  5LP6 A;  3WGN A;  5JVD A;  2H6L A;  4G88 A;  4G4W A;  5G4U C;  3HJW C;  1PF5 A;  5LP6 C;  3JAS A;  2YYE A;  3BYQ A;  3D54 A;  1RA4 A;  5HY0 A;  2MQE A;  5EIB D;  3CD6 F;  1W40 A;  3QUW A;  2R6R 1;  3C9T A;  2B33 A;  4ZHY B;  2ALE A;  5LXT B;  3VTI C;  3LWP C;  3CC2 F;  2OTM A;  2FGY A;  3LYB A;  1E7K A;  1JY8 A;  1CLI A;  3GTZ A;  3UT5 B;  4I4T A;  4X1I B;  1SA0 A;  2RHJ A;  2N48 A;  3JVH A;  3RA5 A;  5EZY B;  3WPX A;  2Z1F A;  3WPW A;  2P6Y A;  2YXZ A;  3VYT C;  1YIJ F;  2I6R A;  4O4H B;  1PXW A;  1W3E X;  4EI9 A;  5C8Y B;  5CA0 A;  2QA4 F;  3MBM A;  3D00 A;  2OTL F;  3HAX D;  5JQG A;  3OW2 F;  3OON A;  1FSZ A;  1R1M A;  3CPW F;  3HKE A;  3RA6 A;  4O4J B;  1U3P A;  3C9S A;  4DRX A;  3E1Y A;  1NMU B;  3WXM B;  4F6R A;  2G9I A;  2H8C A;  2BTQ B;  3AGK A;  1ZWZ A;  5GON B;  1QD9 A;  3OBW A;  1UFY A;  3NVK E;  3D01 A;  4C4W C;  3HKB B;  4TV9 B;  5MN5 A;  1KC8 H;  4IIJ A;  1VQK F;  5IJ9 A;  3J81 M;  4ZOL B;  3JAS B;  3OBY A;  3JAM M;  1OFU A;  3CB2 A;  3F0E A;  1XV2 A;  3K14 A;  3RYH B;  3CXC F;  5FNV B;  3WGJ A;  1FNK A;  2VGN A;  2Q1Y A;  3VOA A;  3VCZ A;  4LNU B;  3KIZ A;  4BVT A;  3I3F A;  3Q8H A;  4G4Z A;  3JAL B;  3VMF B;  3CYP B;  5LA6 B;  3CCV F;  1H47 A;  3FBA A;  4I55 B;  1IV2 A;  5EO3 A;  2DYY A;  4BT5 A;  3N2G B;  2UYK A;  4WBN B;  1VH8 A;  2UYJ A;  3IKF A;  5EYP A;  1GX1 A;  4R40 B;  4F6R B;  5GIN C;  1DBF A;  3DDN A;  5JQG B;  2W8B C;  4XCQ A;  3RYF A;  5J2U A;  3HKE B;  5CA0 B;  3VOB A;  1X25 A;  1JJ2 F;  3WJP A;  3JAK B;  3ELC A;  3NMU C;  2VXY A;  3M84 A;  3CC7 F;  4G4X A;  3LWV C;  4WBN A;  3F0G A;  3ON1 A;  2QEX F;  3RYC B;  3LME A;  1H7M A;  4X1Y A;  2ZVY A;  4U39 A;  2CVL A;  2HP0 A;  2CHS A;  3RYI B;  1J7H A;  1IV3 A;  4HNA A;  4YJ3 A;  3S0Y A;  2QTP A;  1W57 A;  5KMG B;  1XRG A;  5HY1 A;  3M1X A;  4BVS A;  1VK3 A;  4O2A B;  2RHL A;  3PAF A;  5FJ4 C;  4FFB A;  4BT4 A;  1Q86 H;  3S03 A;  3VYS C;  3CPQ A;  4RQO A;  2HX0 A;  3IKE A;  1YJN F;  2VAW A;  3P0Z A;  2ZAU A;  2ZF8 A;  2LBX A;  2HS3 A;  2GZL A;  2ZVZ A;  4BT6 A;  5JH7 A;  1KNJ A;  3G6E F;  3N2G A;  2RHH A;  2UYN B;  3K2X A;  4TZZ A;  5KX5 A;  4FFB B;  2NMU A;  3LWO C;  2KG4 A;  1FFX A;  4EI7 A;  5B8F A;  2LBT A;  5GIP C;  5GAN K;  3HTN A;  5KMG A;  3ESJ A;  3JAW A;  3QTY A;  2HS0 A;  1XBI A;  2UYP A;  3RYI A;  2KTU A;  3FD5 A;  3JCM M;  2VGM A;  4O2B A;  1X7P A;  3C9R A;  4TUY A;  4YJ3 B;  4X1Y B;  1KD1 H;  1UI9 A;  4ZOL A;  2VAP A;  3N2K A;  5AVM A;  2HP0 B;  3N2K B;  3C9U A;  3E22 A;  3LWR C;  2RB9 A;  1VQP F;  2QI2 A;  4U3J B;  2AIF A;  5GON A;  3VIU A;  2HRU A;  1CN7 A;  3F0F A;  1YQN A;  1W59 A;  5MN6 A;  3K12 A;  1VQ6 F;  5BMV A;  5G4V C;  5J2T B;  1QVF F;  3TD4 A;  1YGY A;  2HS4 A;  4ZI7 B;  5IYZ A;  3DC2 A;  3N4Y A;  3JAR B;  4NWO B;  3WGK A;  5IJ0 A;  2F9Z C;  3GYQ A;  3MCQ A;  1X7O A;  2IQQ A;  2GLZ A;  4I50 B;  4O4L B;  3ZOP A;  4O4I A;  1VQM F;  4EB6 B;  3HKD B;  3VI6 A;  4X20 A;  4C82 A;  4I55 A;  4YJ2 A;  1RQ2 A;  3QHD A;  2RHO A;  3SIV A;  4BT2 A;  3HKC A;  1JN1 A;  1S72 F;  2CW4 A;  3F6M A;  4HNA B;  3V4D A;  1W5B A;  4PWT A;  2HP3 A;  3RYF B;  2Z01 A;  1SDS A;  3FD6 A;  4EB6 A;  3RYC A;  3EOR A;  2OZB A;  1GO1 A;  3CCQ F;  4NQ3 A;  4C8I A;  1M1K H;  1K8A H;  5CB4 B;  1Q8R A;  4BT3 A;  4DRX B;  3CC4 F;  1NJI H; 
#chains in the Genus database with same CATH homology
 3GHZ A;  3FPI A;  1YQN A;  3IEW A;  3MBM A;  1VHA A;  3ESJ A;  3F6M A;  1JY8 A;  4C81 A;  3Q8H A;  3ERN A;  1U3P A;  3JVH A;  3ELC A;  3P10 A;  3IKE A;  1H47 A;  1T0A A;  1IV2 A;  3FBA A;  3P0Z A;  3F0G A;  3T80 A;  3EOR A;  1IV1 A;  4C8E A;  3RE3 A;  3B6N A;  1W55 A;  2GZL A;  4C8I A;  1VH8 A;  1U43 A;  1KNJ A;  1U3L A;  1H48 A;  1U40 A;  4C82 A;  3K2X A;  4C8G A;  3IEQ A;  2AMT A;  3IKF A;  3QHD A;  1GX1 A;  1IV4 A;  1IV3 A;  2UZH A;  3KE1 A;  3F0D A;  2PMP A;  1W57 A;  1KNK A;  3F0E A;  1JN1 A;  3K14 A;  5B8F A;  3F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...