1S72F

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1s72F00
3CMEF 3CPQA 3RA5A 3CC4F 1N8RH 2LBWA 3NVIB 3V7EA 1JJ2F 3LWOC 5G4UC 1VQ6F 3WXMB 1X7OA 2QEXF 3CCEF 3SIUA 2VGMA 1VQ8F 3OBYA 2VGNA 1X52A 1Q86H 1S72F 1VQLF 3CCMF 1VQ4F 5IT9M 1DT9A 3LWQC 3OBWA 1NMUB 1ZWZA 1K8AH 2QI2A 4NUTA 1YJWF 5GIPC 1VQNF 1H7MA 3V7QA 2BO1A 1T0KB 2CZWA 3PAFA 1YJNF 1VQKF 3AGKA 2OTLF 1QVGF 3N4ZA 3J7AR 5A2QM 3CXCF 1YITF 1E7KA 3CCUF 2JNBA 3FFMA 3RA6A 1YHQF 3G71F 1W3EX 5GANK 2LBXA 5DCVA 3CC2F 1VQOF 5GAPK 1Q82H 3NK7A 3CMAF 3HJWC 4TZZA 3J81M 1YI2F 1M1KH 3E20B 2KTVA 4X3LA 1GZ0A 3LWVC 3IR9A 1QVFF 2OTJF 2WALA 2KTUA 3OW2F 3CPWF 1CN7A 3O85A 3CC7F 1CK2A 1W42A 3NMUC 3PLAC 3E1YA 3VMFB 2QA4F 3GYQA 1IPAA 3CCRF 1Q81H 3JAMM 1VQMF 1RLGA 3CCSF 1PXWA 5G4VC 1GO1A 5EO3A 5EWRA 3CCJF 5GINC 1W40A 3LWPC 1VQPF 3CCVF 5GIOC 1K73H 3HAXD 3I56F 3NK6A 3G6EF 3LWRC 3JCMM 1GO0A 1KC8H 3MCAB 3I55F 2AIFA 1Q7YH 1XBIA 3CD6F 5FLXM 1VQ9F 3N4YA 2OZBA 3J80M 1X7PA 2FC3A 5FJ4C 4C4WC 1KQSF 1K9MH 4BY9D 3CG6A 3ON1A 1VQ7F 3G4SF 2KG4A 2ALEA 1NJIH 1M90H 1W41A 1KD1H 3NVKE 3CCQF 2HVYD 4X3MA 1SDSA 1YJ9F 2OHWA 3CCLF 2I6DA 3VI6A 4LCKA 1VQ5F 1RA4A 4BW0B 3LFOA 3SIVA 1W2BF 1YIJF
chains in the Genus database with same CATH superfamily
5EZYA 1SA0B 5C8YB 1TVKB 3IMPA 1N8RH 3VOBA 4BT7A 3NVIB 3WJRA 3WGJA 1VQ6F 3C9TA 3JVHA 5G4UC 2LBTA 3S06A 1X7OA 4LNUB 4C8IA 5J2TA 3VCZA 3KE1A 3CCEF 4X1YB 1VQ8F 4ZHYB 5EB1B 1QD9A 3KJKA 4BVSA 2EWCA 1JFFA 2VGNA 4IHJA 4B62A 1XRGA 3RYFA 3RYIA 3LWQC 5EAZA 2H8EA 5JVDA 5LXTB 5CA0A 5J2UA 5GIPC 1VQNF 5HP8A 2BO1A 3EORA 2CZWA 3K12A 3CB2A 3S02A 2OTLF 1QVGF 2AMTA 3VO8A 3HKCB 3FFMA 5KX5A 5HY4A 1XV2A 3HKBA 3MDOA 4O4IB 3RE3A 4B45A 3G71F 4C81A 3IKEA 4U3JB 3CC2F 3F0GA 3CMAF 3V3TA 3CYPB 3VYSC 3BYQA 4YJ3A 4BT5A 4ZK7A 2BTUA 2L26A 3WJQA 3LWVC 3IR9A 3ZP7A 5CB4B 2OTJF 2WALA 3D54A 3E22A 4NQ3A 2G9IA 2HP0A 1T0AA 2RB9A 4G88A 3O85A 3UT5A 2CW4A 5IJ9A 4M8IA 1W42A 5CA1A 3PLAC 4ZHQA 3L7QA 4O2BA 5ITZB 2HX0A 4O4HA 1IV3A 3P0ZA 1U40A 5EZYB 3V4DA 3CCRF 3JAMM 1RLGA 4TUYA 1VQVA 5EO3A 1TUBA 5GONA 1W40A 3LWPC 1UFYA 5J2TB 2HS3A 1QAHA 2UYPA 1KC8H 3I55F 5EIBD 3R0PA 3CD6F 5FLXM 3N4YA 2F9ZC 1JFFB 2MQEA 3D00A 3RYFB 1ONIA 4PWTA 5BMVA 4F6RA 2DT4A 5MN4A 4NWOB 5CA0B 3K2XA 2HQSC 1W5EA 3F0EA 1YJ9F 3M4SA 2VAPA 4G4WA 3CCLF 3LFOA 3HKBB 1UI9A 1KNKA 2CVLA 3B6NA 3JATA 3TD4A 3LDTA 2I6RA 4YJ3B 1JJ2F 1JD1A 4I4TA 3LWOC 2GLZA 3TD3A 3VYUC 4WBNA 2RHJA 4ZHVA 3SIUA 4I55A 2VGMA 3E22B 3S0WA 1J7HA 2HP0B 3OBYA 5CB4A 5IJ0A 3UT5B 5IJ9B 5JCOC 1X52A 2DYYA 1Z5WA 4O4JB 5CA1B 1S72F 1Q86H 3K14A 4O4HB 4G4YA 4TUYB 2QI2A 5HXUA 1TUBB 4NUTA 5GONB 3D01A 2HS0A 4O4LA 4ERHA 1T0KB 2Z1FA 1H47A 1FFXA 3DC2A 3HKDB 1QU9A 3J7AR 4ZI7A 3RA6A 3F0FA 5LA6B 1VK3A 1YHQF 5HY1A 3CYQA 2CSLA 5BMVB 4C82A 3J81M 2PMPA 4F6RB 1YI2F 2ZVZA 4BT6A 5B8FA 3C9UA 2H6LA 1QVFF 3LMEA 3JARA 4EI8A 3OW2F 2RHHA 3CPWF 2OTMA 1KNJA 1DBFA 3GTZA 1CK2A 3IKFA 3JALB 4KWEA 1R1MA 1OAPA 3GYQA 3ESJA 3P4EA 1Q81H 1VQMF 3WPXA 3JATB 5G4VC 1GO1A 4C8EA 2ZOVA 5GINC 1VQPF 5MN6A 1GX1A 1K73H 3NK6A 2IQQA 4FFBB 4I4TB 2B33A 3JCMM 5IYZB 2LCAA 1OFUA 5EB0A 4WBNB 1GO0A 2UYNA 4I55B 5AVMA 1XBIA 5IJ0B 2ZVYA 2BTQB 3J80M 4TV9A 5FJ4C 2HRYA 3ON1A 3JASA 5HY2A 4O4JA 2KG4A 3QUWA 2UYJA 3JAWB 4O4LB 1W41A 1KD1H 1M90H 1RQ7A 3NVKE 3CCQF 5LP6B 2Z1TA 1FFXB 3K0TA 1PF5A 4IIJB 4X20A 2BTOA 4LCKA 1VQ5F 1RA4A 4ZI7B 3WJPA 3HKDA 3DDNA 1FNJA 3I3FA 1YIJF 3CMEF 3N2GA 5LA6A 2GVIA 4BT4A 3CC4F 2K1SA 2KGWA 3V7EA 3WGNA 5MN5A 3MBMA 5LOVA 5HP7A 1W57A 2PHNA 4E6EA 4EI7A 3JARB 3ELCA 3GHZA 3ERNA 2CWJA 1COMA 3HTNA 3WGLA 3HWUA 1IV2A 1FNKA 1VQLF 5IT9M 1VQ4F 3JAKB 4BVQA 1DT9A 3OBWA 1NMUB 1ZWZA 3JALA 3VOAA 5FNVA 1K8AH 5KMGA 5EIBC 3KHNA 1H7MA 1ODEA 3T80A 3V7QA 3PAFA 1W5AA 1VQKF 2W8BC 2ZODA 3N4ZA 3CXCF 1YQNA 3S03A 1YITF 3CCUF 2UYNB 4DRXA 4FFBA 2JNBA 5IYZA 2N48A 1W3EX 5GANK 2LBXA 4TV9B 3ZP4A 2QTPA 2Z1EA 5GAPK 1Q82H 2YXZA 3NK7A 4XCQA 4R40B 2HS4A 3I7TA 3JASB 5JH7A 3RYCB 4BT2A 4X3LA 1XHOA 1X25A 2VAWA 2ZAUA 2KTUA 3IEQA 3RYHB 4X20B 3JAWA 3QHDA 4O2AA 3WGKA 1JN1A 1FSZA 4TV8A 4B5CA 1CN7A 3TD5A 2Z1UA 5LP6A 3VYTC 2CHTA 4IIJA 3E1YA 2QA4F 2V9YA 1IPAA 4HNAA 3U0OA 3N2GB 1PXWA 3CCJF 3C9SA 1VH8A 2RHLA 3HAXD 1RQ2A 2NMUA 1JY8A 4RHAA 5LOVB 3F6MA 4EI9A 3M84A 3M1XA 4BVRA 1H48A 5JCOA 3VTIC 1VQ9F 1X7PA 2FC3A 3IEWA 4BY9D 4G4VA 3CG6A 5FNVB 5KMGB 3JAKA 1NJIH 3KJJA 4ZHWA 5LYJB 2HVYD 4X3MA 5JQGB 2GZLA 2VXYA 5EYPA 3S0YA 2AIZP 4B46A 3VI6A 3Q8HA 4BT3A 4DRXB 1W5BA 2CHSA 3N2KB 3SIVA 1U3LA 4X1KA 3VIUA 1W2BF 1NQ3A 4ZOLA 3CPQA 3MCQA 3RA5A 5JH7B 5HXZA 2LBWA 2Z01A 2R751 1IV1A 3F0DA 1RLUA 4YJ2A 3WXMB 3RYCA 2QEXF 3C8LA 4RQOA 4O2AB 3QTYA 4I50A 4X1IA 4TV8B 2UZHA 3RYHA 3CCMF 3KIZA 2P6YA 4HNAB 3WGMA 1CLIA 1YJWF 3HKEA 1YJNF 4EB6A 3FD5A 4BVTA 3AGKA 2Q1YA 2VAMA 5A2QM 2FGYA 2ZF8A 3WPWA 1E7KA 2YYEA 5HY0A 5DCVA 1SA0A 5C8YA 1VQOF 1W59A 4G4XA 1TVKA 2Q1XA 3ZOPA 3HJWC 4TZZA 1M1KH 1SZQA 1IV4A 2KTVA 3E20B 1GZ0A 4LNUA 2R6R1 5EYPB 4X1YA 4IHJB 5LYJA 3LYBA 3RYIB 3CC7F 5JQGA 3NMUC 4X1KB 1W55A 1Q8RA 2IAFA 3VMFB 5JVDB 5J2UB 3C9RA 1U43A 4C8GA 3N2KA 2HRUA 4ZOLB 3CCSF 5EWRA 5LXTA 1U3PA 3CCVF 5GIOC 3OONA 3I56F 1Z5VA 3FD6A 3G6EF 3FPIA 4YJ2B 5LP6C 5KX5B 1YGYA 3LWRC 4DXDA 3P10A 2H8CA 3HKCA 3MCAB 3ZO8A 1Q7YH 2AIFA 3FBAA 4I50B 4X1IB 4O4IA 2OZBA 2RHOA 4G4ZA 4U3JA 4C4WC 1KQSF 1K9MH 1VQ7F 3G4SF 2ALEA 3S0HA 3HKEB 3MQWA 4EB6B 2HP3A 1SDSA 1VHAA 1W581 2IG8A 4O2BB 4ZHQB 2OHWA 2I6DA 4BW0B 1W5FA 5HWEA 4U39A 5ITZA 2UYKA
chains in the Genus database with same CATH topology
3CMEF 3CPQA 3RA5A 3CC4F 5HXZA 1N8RH 2LBWA 3NVIB 3V7EA 1JJ2F 3LWOC 5G4UC 2GLZA 1VQ6F 3WXMB 1X7OA 4EI7A 2QEXF 3CCEF 3SIUA 2VGMA 1VQ8F 3OBYA 4BVSA 2VGNA 1X52A 1Q86H 1S72F 1VQLF 3CCMF 1VQ4F 4BVQA 5IT9M 1DT9A 3LWQC 3OBWA 1NMUB 1ZWZA 1K8AH 2QI2A 5HXUA 4NUTA 1YJWF 5GIPC 1VQNF 1H7MA 3V7QA 2BO1A 1T0KB 2CZWA 3PAFA 1YJNF 1VQKF 4BVTA 3AGKA 2OTLF 1QVGF 3N4ZA 3J7AR 5A2QM 3CXCF 2FGYA 1YITF 1E7KA 3CCUF 2JNBA 3FFMA 3RA6A 5HY4A 1YHQF 5HY1A 3G71F 1W3EX 5HY0A 5GANK 2LBXA 5DCVA 3CC2F 1VQOF 5GAPK 1Q82H 3NK7A 3CMAF 4XCQA 3V3TA 3HJWC 4TZZA 3J81M 1YI2F 1M1KH 3E20B 2KTVA 4X3LA 1GZ0A 3LWVC 3IR9A 1QVFF 2OTJF 2WALA 4EI8A 2KTUA 4NQ3A 3OW2F 3CPWF 1CN7A 3O85A 3CC7F 1CK2A 1W42A 3NMUC 3PLAC 3E1YA 3VMFB 2QA4F 3GYQA 1IPAA 3CCRF 1Q81H 3JAMM 1VQMF 1RLGA 3CCSF 1PXWA 5G4VC 1GO1A 5EO3A 5EWRA 3CCJF 5GINC 1W40A 3LWPC 1VQPF 3CCVF 5GIOC 1K73H 3HAXD 3I56F 3NK6A 3G6EF 3LWRC 3JCMM 4EI9A 4BVRA 1GO0A 1KC8H 3MCAB 3I55F 2AIFA 1Q7YH 1XBIA 3CD6F 5FLXM 1VQ9F 3N4YA 2F9ZC 2OZBA 3J80M 1X7PA 2FC3A 3D00A 5FJ4C 4C4WC 1KQSF 1K9MH 4BY9D 3CG6A 3ON1A 1VQ7F 5HY2A 3G4SF 2KG4A 2ALEA 1NJIH 1M90H 1W41A 1KD1H 3NVKE 3CCQF 2HVYD 4X3MA 1SDSA 1YJ9F 2OHWA 3CCLF 2I6DA 3VI6A 4LCKA 1VQ5F 1RA4A 4BW0B 3LFOA 5HWEA 3SIVA 1W2BF 1YIJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME F;  3CPQ A;  3RA5 A;  3CC4 F;  1N8R H;  2LBW A;  3NVI B;  3V7E A;  1JJ2 F;  3LWO C;  5G4U C;  1VQ6 F;  3WXM B;  1X7O A;  2QEX F;  3CCE F;  3SIU A;  2VGM A;  1VQ8 F;  3OBY A;  2VGN A;  1X52 A;  1Q86 H;  1S72 F;  1VQL F;  3CCM F;  1VQ4 F;  5IT9 M;  1DT9 A;  3LWQ C;  3OBW A;  1NMU B;  1ZWZ A;  1K8A H;  2QI2 A;  4NUT A;  1YJW F;  5GIP C;  1VQN F;  1H7M A;  3V7Q A;  2BO1 A;  1T0K B;  2CZW A;  3PAF A;  1YJN F;  1VQK F;  3AGK A;  2OTL F;  1QVG F;  3N4Z A;  3J7A R;  5A2Q M;  3CXC F;  1YIT F;  1E7K A;  3CCU F;  2JNB A;  3FFM A;  3RA6 A;  1YHQ F;  3G71 F;  1W3E X;  5GAN K;  2LBX A;  5DCV A;  3CC2 F;  1VQO F;  5GAP K;  1Q82 H;  3NK7 A;  3CMA F;  3HJW C;  4TZZ A;  3J81 M;  1YI2 F;  1M1K H;  3E20 B;  2KTV A;  4X3L A;  1GZ0 A;  3LWV C;  3IR9 A;  1QVF F;  2OTJ F;  2WAL A;  2KTU A;  3OW2 F;  3CPW F;  1CN7 A;  3O85 A;  3CC7 F;  1CK2 A;  1W42 A;  3NMU C;  3PLA C;  3E1Y A;  3VMF B;  2QA4 F;  3GYQ A;  1IPA A;  3CCR F;  1Q81 H;  3JAM M;  1VQM F;  1RLG A;  3CCS F;  1PXW A;  5G4V C;  1GO1 A;  5EO3 A;  5EWR A;  3CCJ F;  5GIN C;  1W40 A;  3LWP C;  1VQP F;  3CCV F;  5GIO C;  1K73 H;  3HAX D;  3I56 F;  3NK6 A;  3G6E F;  3LWR C;  3JCM M;  1GO0 A;  1KC8 H;  3MCA B;  3I55 F;  2AIF A;  1Q7Y H;  1XBI A;  3CD6 F;  5FLX M;  1VQ9 F;  3N4Y A;  2OZB A;  3J80 M;  1X7P A;  2FC3 A;  5FJ4 C;  4C4W C;  1KQS F;  1K9M H;  4BY9 D;  3CG6 A;  3ON1 A;  1VQ7 F;  3G4S F;  2KG4 A;  2ALE A;  1NJI H;  1M90 H;  1W41 A;  1KD1 H;  3NVK E;  3CCQ F;  2HVY D;  4X3M A;  1SDS A;  1YJ9 F;  2OHW A;  3CCL F;  2I6D A;  3VI6 A;  4LCK A;  1VQ5 F;  1RA4 A;  4BW0 B;  3LFO A;  3SIV A;  1W2B F;  1YIJ F; 
#chains in the Genus database with same CATH topology
 5EZY A;  1SA0 B;  5C8Y B;  1TVK B;  3IMP A;  1N8R H;  3VOB A;  4BT7 A;  3NVI B;  3WJR A;  3WGJ A;  1VQ6 F;  3C9T A;  3JVH A;  5G4U C;  2LBT A;  3S06 A;  1X7O A;  4LNU B;  4C8I A;  5J2T A;  3VCZ A;  3KE1 A;  3CCE F;  4X1Y B;  1VQ8 F;  4ZHY B;  5EB1 B;  1QD9 A;  3KJK A;  4BVS A;  2EWC A;  1JFF A;  2VGN A;  4IHJ A;  4B62 A;  1XRG A;  3RYF A;  3RYI A;  3LWQ C;  5EAZ A;  2H8E A;  5JVD A;  5LXT B;  5CA0 A;  5J2U A;  5GIP C;  1VQN F;  5HP8 A;  2BO1 A;  3EOR A;  2CZW A;  3K12 A;  3CB2 A;  3S02 A;  2OTL F;  1QVG F;  2AMT A;  3VO8 A;  3HKC B;  3FFM A;  5KX5 A;  5HY4 A;  1XV2 A;  3HKB A;  3MDO A;  4O4I B;  3RE3 A;  4B45 A;  3G71 F;  4C81 A;  3IKE A;  4U3J B;  3CC2 F;  3F0G A;  3CMA F;  3V3T A;  3CYP B;  3VYS C;  3BYQ A;  4YJ3 A;  4BT5 A;  4ZK7 A;  2BTU A;  2L26 A;  3WJQ A;  3LWV C;  3IR9 A;  3ZP7 A;  5CB4 B;  2OTJ F;  2WAL A;  3D54 A;  3E22 A;  4NQ3 A;  2G9I A;  2HP0 A;  1T0A A;  2RB9 A;  4G88 A;  3O85 A;  3UT5 A;  2CW4 A;  5IJ9 A;  4M8I A;  1W42 A;  5CA1 A;  3PLA C;  4ZHQ A;  3L7Q A;  4O2B A;  5ITZ B;  2HX0 A;  4O4H A;  1IV3 A;  3P0Z A;  1U40 A;  5EZY B;  3V4D A;  3CCR F;  3JAM M;  1RLG A;  4TUY A;  1VQV A;  5EO3 A;  1TUB A;  5GON A;  1W40 A;  3LWP C;  1UFY A;  5J2T B;  2HS3 A;  1QAH A;  2UYP A;  1KC8 H;  3I55 F;  5EIB D;  3R0P A;  3CD6 F;  5FLX M;  3N4Y A;  2F9Z C;  1JFF B;  2MQE A;  3D00 A;  3RYF B;  1ONI A;  4PWT A;  5BMV A;  4F6R A;  2DT4 A;  5MN4 A;  4NWO B;  5CA0 B;  3K2X A;  2HQS C;  1W5E A;  3F0E A;  1YJ9 F;  3M4S A;  2VAP A;  4G4W A;  3CCL F;  3LFO A;  3HKB B;  1UI9 A;  1KNK A;  2CVL A;  3B6N A;  3JAT A;  3TD4 A;  3LDT A;  2I6R A;  4YJ3 B;  1JJ2 F;  1JD1 A;  4I4T A;  3LWO C;  2GLZ A;  3TD3 A;  3VYU C;  4WBN A;  2RHJ A;  4ZHV A;  3SIU A;  4I55 A;  2VGM A;  3E22 B;  3S0W A;  1J7H A;  2HP0 B;  3OBY A;  5CB4 A;  5IJ0 A;  3UT5 B;  5IJ9 B;  5JCO C;  1X52 A;  2DYY A;  1Z5W A;  4O4J B;  5CA1 B;  1S72 F;  1Q86 H;  3K14 A;  4O4H B;  4G4Y A;  4TUY B;  2QI2 A;  5HXU A;  1TUB B;  4NUT A;  5GON B;  3D01 A;  2HS0 A;  4O4L A;  4ERH A;  1T0K B;  2Z1F A;  1H47 A;  1FFX A;  3DC2 A;  3HKD B;  1QU9 A;  3J7A R;  4ZI7 A;  3RA6 A;  3F0F A;  5LA6 B;  1VK3 A;  1YHQ F;  5HY1 A;  3CYQ A;  2CSL A;  5BMV B;  4C82 A;  3J81 M;  2PMP A;  4F6R B;  1YI2 F;  2ZVZ A;  4BT6 A;  5B8F A;  3C9U A;  2H6L A;  1QVF F;  3LME A;  3JAR A;  4EI8 A;  3OW2 F;  2RHH A;  3CPW F;  2OTM A;  1KNJ A;  1DBF A;  3GTZ A;  1CK2 A;  3IKF A;  3JAL B;  4KWE A;  1R1M A;  1OAP A;  3GYQ A;  3ESJ A;  3P4E A;  1Q81 H;  1VQM F;  3WPX A;  3JAT B;  5G4V C;  1GO1 A;  4C8E A;  2ZOV A;  5GIN C;  1VQP F;  5MN6 A;  1GX1 A;  1K73 H;  3NK6 A;  2IQQ A;  4FFB B;  4I4T B;  2B33 A;  3JCM M;  5IYZ B;  2LCA A;  1OFU A;  5EB0 A;  4WBN B;  1GO0 A;  2UYN A;  4I55 B;  5AVM A;  1XBI A;  5IJ0 B;  2ZVY A;  2BTQ B;  3J80 M;  4TV9 A;  5FJ4 C;  2HRY A;  3ON1 A;  3JAS A;  5HY2 A;  4O4J A;  2KG4 A;  3QUW A;  2UYJ A;  3JAW B;  4O4L B;  1W41 A;  1KD1 H;  1M90 H;  1RQ7 A;  3NVK E;  3CCQ F;  5LP6 B;  2Z1T A;  1FFX B;  3K0T A;  1PF5 A;  4IIJ B;  4X20 A;  2BTO A;  4LCK A;  1VQ5 F;  1RA4 A;  4ZI7 B;  3WJP A;  3HKD A;  3DDN A;  1FNJ A;  3I3F A;  1YIJ F;  3CME F;  3N2G A;  5LA6 A;  2GVI A;  4BT4 A;  3CC4 F;  2K1S A;  2KGW A;  3V7E A;  3WGN A;  5MN5 A;  3MBM A;  5LOV A;  5HP7 A;  1W57 A;  2PHN A;  4E6E A;  4EI7 A;  3JAR B;  3ELC A;  3GHZ A;  3ERN A;  2CWJ A;  1COM A;  3HTN A;  3WGL A;  3HWU A;  1IV2 A;  1FNK A;  1VQL F;  5IT9 M;  1VQ4 F;  3JAK B;  4BVQ A;  1DT9 A;  3OBW A;  1NMU B;  1ZWZ A;  3JAL A;  3VOA A;  5FNV A;  1K8A H;  5KMG A;  5EIB C;  3KHN A;  1H7M A;  1ODE A;  3T80 A;  3V7Q A;  3PAF A;  1W5A A;  1VQK F;  2W8B C;  2ZOD A;  3N4Z A;  3CXC F;  1YQN A;  3S03 A;  1YIT F;  3CCU F;  2UYN B;  4DRX A;  4FFB A;  2JNB A;  5IYZ A;  2N48 A;  1W3E X;  5GAN K;  2LBX A;  4TV9 B;  3ZP4 A;  2QTP A;  2Z1E A;  5GAP K;  1Q82 H;  2YXZ A;  3NK7 A;  4XCQ A;  4R40 B;  2HS4 A;  3I7T A;  3JAS B;  5JH7 A;  3RYC B;  4BT2 A;  4X3L A;  1XHO A;  1X25 A;  2VAW A;  2ZAU A;  2KTU A;  3IEQ A;  3RYH B;  4X20 B;  3JAW A;  3QHD A;  4O2A A;  3WGK A;  1JN1 A;  1FSZ A;  4TV8 A;  4B5C A;  1CN7 A;  3TD5 A;  2Z1U A;  5LP6 A;  3VYT C;  2CHT A;  4IIJ A;  3E1Y A;  2QA4 F;  2V9Y A;  1IPA A;  4HNA A;  3U0O A;  3N2G B;  1PXW A;  3CCJ F;  3C9S A;  1VH8 A;  2RHL A;  3HAX D;  1RQ2 A;  2NMU A;  1JY8 A;  4RHA A;  5LOV B;  3F6M A;  4EI9 A;  3M84 A;  3M1X A;  4BVR A;  1H48 A;  5JCO A;  3VTI C;  1VQ9 F;  1X7P A;  2FC3 A;  3IEW A;  4BY9 D;  4G4V A;  3CG6 A;  5FNV B;  5KMG B;  3JAK A;  1NJI H;  3KJJ A;  4ZHW A;  5LYJ B;  2HVY D;  4X3M A;  5JQG B;  2GZL A;  2VXY A;  5EYP A;  3S0Y A;  2AIZ P;  4B46 A;  3VI6 A;  3Q8H A;  4BT3 A;  4DRX B;  1W5B A;  2CHS A;  3N2K B;  3SIV A;  1U3L A;  4X1K A;  3VIU A;  1W2B F;  1NQ3 A;  4ZOL A;  3CPQ A;  3MCQ A;  3RA5 A;  5JH7 B;  5HXZ A;  2LBW A;  2Z01 A;  2R75 1;  1IV1 A;  3F0D A;  1RLU A;  4YJ2 A;  3WXM B;  3RYC A;  2QEX F;  3C8L A;  4RQO A;  4O2A B;  3QTY A;  4I50 A;  4X1I A;  4TV8 B;  2UZH A;  3RYH A;  3CCM F;  3KIZ A;  2P6Y A;  4HNA B;  3WGM A;  1CLI A;  1YJW F;  3HKE A;  1YJN F;  4EB6 A;  3FD5 A;  4BVT A;  3AGK A;  2Q1Y A;  2VAM A;  5A2Q M;  2FGY A;  2ZF8 A;  3WPW A;  1E7K A;  2YYE A;  5HY0 A;  5DCV A;  1SA0 A;  5C8Y A;  1VQO F;  1W59 A;  4G4X A;  1TVK A;  2Q1X A;  3ZOP A;  3HJW C;  4TZZ A;  1M1K H;  1SZQ A;  1IV4 A;  2KTV A;  3E20 B;  1GZ0 A;  4LNU A;  2R6R 1;  5EYP B;  4X1Y A;  4IHJ B;  5LYJ A;  3LYB A;  3RYI B;  3CC7 F;  5JQG A;  3NMU C;  4X1K B;  1W55 A;  1Q8R A;  2IAF A;  3VMF B;  5JVD B;  5J2U B;  3C9R A;  1U43 A;  4C8G A;  3N2K A;  2HRU A;  4ZOL B;  3CCS F;  5EWR A;  5LXT A;  1U3P A;  3CCV F;  5GIO C;  3OON A;  3I56 F;  1Z5V A;  3FD6 A;  3G6E F;  3FPI A;  4YJ2 B;  5LP6 C;  5KX5 B;  1YGY A;  3LWR C;  4DXD A;  3P10 A;  2H8C A;  3HKC A;  3MCA B;  3ZO8 A;  1Q7Y H;  2AIF A;  3FBA A;  4I50 B;  4X1I B;  4O4I A;  2OZB A;  2RHO A;  4G4Z A;  4U3J A;  4C4W C;  1KQS F;  1K9M H;  1VQ7 F;  3G4S F;  2ALE A;  3S0H A;  3HKE B;  3MQW A;  4EB6 B;  2HP3 A;  1SDS A;  1VHA A;  1W58 1;  2IG8 A;  4O2B B;  4ZHQ B;  2OHW A;  2I6D A;  4BW0 B;  1W5F A;  5HWE A;  4U39 A;  5ITZ A;  2UYK A; 
#chains in the Genus database with same CATH homology
 3CME F;  3CPQ A;  3RA5 A;  3CC4 F;  5HXZ A;  1N8R H;  2LBW A;  3NVI B;  3V7E A;  1JJ2 F;  3LWO C;  5G4U C;  2GLZ A;  1VQ6 F;  3WXM B;  1X7O A;  4EI7 A;  2QEX F;  3CCE F;  3SIU A;  2VGM A;  1VQ8 F;  3OBY A;  4BVS A;  2VGN A;  1X52 A;  1Q86 H;  1S72 F;  1VQL F;  3CCM F;  1VQ4 F;  4BVQ A;  5IT9 M;  1DT9 A;  3LWQ C;  3OBW A;  1NMU B;  1ZWZ A;  1K8A H;  2QI2 A;  5HXU A;  4NUT A;  1YJW F;  5GIP C;  1VQN F;  1H7M A;  3V7Q A;  2BO1 A;  1T0K B;  2CZW A;  3PAF A;  1YJN F;  1VQK F;  4BVT A;  3AGK A;  2OTL F;  1QVG F;  3N4Z A;  3J7A R;  5A2Q M;  3CXC F;  2FGY A;  1YIT F;  1E7K A;  3CCU F;  2JNB A;  3FFM A;  3RA6 A;  5HY4 A;  1YHQ F;  5HY1 A;  3G71 F;  1W3E X;  5HY0 A;  5GAN K;  2LBX A;  5DCV A;  3CC2 F;  1VQO F;  5GAP K;  1Q82 H;  3NK7 A;  3CMA F;  4XCQ A;  3V3T A;  3HJW C;  4TZZ A;  3J81 M;  1YI2 F;  1M1K H;  3E20 B;  2KTV A;  4X3L A;  1GZ0 A;  3LWV C;  3IR9 A;  1QVF F;  2OTJ F;  2WAL A;  4EI8 A;  2KTU A;  4NQ3 A;  3OW2 F;  3CPW F;  1CN7 A;  3O85 A;  3CC7 F;  1CK2 A;  1W42 A;  3NMU C;  3PLA C;  3E1Y A;  3VMF B;  2QA4 F;  3GYQ A;  1IPA A;  3CCR F;  1Q81 H;  3JAM M;  1VQM F;  1RLG A;  3CCS F;  1PXW A;  5G4V C;  1GO1 A;  5EO3 A;  5EWR A;  3CCJ F;  5GIN C;  1W40 A;  3LWP C;  1VQP F;  3CCV F;  5GIO C;  1K73 H;  3HAX D;  3I56 F;  3NK6 A;  3G6E F;  3LWR C;  3JCM M;  4EI9 A;  4BVR A;  1GO0 A;  1KC8 H;  3MCA B;  3I55 F;  2AIF A;  1Q7Y H;  1XBI A;  3CD6 F;  5FLX M;  1VQ9 F;  3N4Y A;  2F9Z C;  2OZB A;  3J80 M;  1X7P A;  2FC3 A;  3D00 A;  5FJ4 C;  4C4W C;  1KQS F;  1K9M H;  4BY9 D;  3CG6 A;  3ON1 A;  1VQ7 F;  5HY2 A;  3G4S F;  2KG4 A;  2ALE A;  1NJI H;  1M90 H;  1W41 A;  1KD1 H;  3NVK E;  3CCQ F;  2HVY D;  4X3M A;  1SDS A;  1YJ9 F;  2OHW A;  3CCL F;  2I6D A;  3VI6 A;  4LCK A;  1VQ5 F;  1RA4 A;  4BW0 B;  3LFO A;  5HWE A;  3SIV A;  1W2B F;  1YIJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...