1S72F

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1s72F00
3J80M 1Q81H 3J7AR 4X3LA 1YJWF 4BY9D 3G4SF 3CCMF 3NK6A 1W42A 3HJWC 1YIJF 1SDSA 3AGKA 1K9MH 3LWQC 1N8RH 1GO1A 3CCEF 2QI2A 3CCQF 1Q7YH 1K73H 5G4VC 2HVYD 2OHWA 1VQ5F 2QEXF 1IPAA 1YHQF 1KQSF 2ALEA 3I56F 3OW2F 1X52A 3LWRC 3CXCF 3JCMM 3V7QA 1H7MA 4LCKA 3LFOA 3CD6F 3CC7F 3LWVC 3CCLF 1VQNF 1M90H 2LBXA 5DCVA 2OZBA 3GYQA 3I55F 3CCSF 2BO1A 2I6DA 5GAPK 3PAFA 3CCVF 2KG4A 3OBYA 1JJ2F 3E20B 1ZWZA 3FFMA 3JAMM 1VQMF 3HAXD 1Q86H 3G6EF 1CN7A 1S72F 3RA6A 3J81M 5GANK 5EWRA 1CK2A 1T0KB 5IT9M 1VQKF 1KC8H 3CMAF 2FC3A 3RA5A 3VI6A 1PXWA 2JNBA 1W40A 3LWOC 1Q82H 3CCJF 1RA4A 2AIFA 1VQ8F 4NUTA 1VQ6F 3CCUF 1VQLF 3NVIB 1YI2F 1XBIA 2KTVA 2WALA 3ON1A 5EO3A 1X7OA 1DT9A 2OTLF 3CPQA 1QVFF 1NMUB 3V7EA 5FJ4C 2VGNA 5GIPC 4TZZA 5GIOC 1X7PA 1VQ4F 1VQ9F 1W2BF 1YITF 3NK7A 1RLGA 1YJ9F 5G4UC 3N4YA 3CCRF 1E7KA 3NVKE 2QA4F 3E1YA 1K8AH 3G71F 3LWPC 1M1KH 3SIUA 5GINC 1QVGF 4C4WC 4BW0B 2OTJF 5FLXM 3WXMB 3N4ZA 3CC2F 3CC4F 3IR9A 1YJNF 1GZ0A 3CMEF 1VQPF 3OBWA 3PLAC 2KTUA 2VGMA 3NMUC 3O85A 1GO0A 3CPWF 2CZWA 1VQOF 1W3EX 1W41A 5A2QM 4X3MA 2LBWA 1NJIH 3SIVA 1KD1H 1VQ7F 3MCAB 3VMFB 3CG6A
chains in the Genus database with same CATH superfamily
3J80M 4X3LA 5HY0A 3KJKA 5ITZA 1CLIA 1TVKA 2NMUA 4ERHA 3G4SF 3NK6A 5BMVA 4BVRA 3AGKA 3C9TA 3S02A 3N2KB 3RYHA 1N8RH 2BTQB 2H8CA 3CCQF 2Z1EA 3QTYA 1QD9A 5G4VC 1DBFA 5KMGB 2HS4A 2AMTA 1H47A 1YHQF 4TUYB 1FSZA 4O4HA 3K12A 3OW2F 2DT4A 3WPXA 5C8YA 5GONA 5JQGB 3WGJA 3D01A 1H7MA 4HNAA 1W5EA 5HWEA 1GX1A 1XV2A 1VQNF 1M90H 2LBXA 3I55F 3VIUA 2HRUA 2KG4A 2RHOA 5CA1B 2ZVYA 5JCOA 3ELCA 5HXZA 3HKCB 2ZVZA 3RA6A 3HKBA 4O2AB 4YJ2A 1T0KB 5EIBC 3S0WA 5FNVA 1NQ3A 3WGLA 1XRGA 3JASA 4G4YA 3ERNA 2VAMA 3HTNA 3WGNA 4BT4A 3LWOC 1T0AA 3CCJF 4BT7A 1JY8A 2L26A 4ZI7B 3JAKB 4WBNB 3P10A 3CB2A 1JFFA 4DXDA 1RQ2A 2IQQA 4X1KA 1J7HA 4LNUA 3CPQA 2H6LA 3FPIA 4G88A 3S0YA 1NMUB 3ZO8A 3E22B 5GIOC 4EB6B 1X7PA 1W2BF 3K0TA 1IV4A 1VH8A 3E1YA 2HX0A 4NWOB 5CB4A 1M1KH 3SIUA 3FBAA 2CWJA 4WBNA 3RYFB 5IYZA 3P4EA 5HP8A 2OTJF 3B6NA 3N4ZA 3M84A 3CC4F 5CA0B 1YJNF 3CMEF 3PLAC 2VGMA 2Q1XA 3NMUC 1GO0A 3E22A 4TV8A 4ZOLB 3JARB 3CPWF 1W3EX 3LYBA 4G4WA 2CHSA 5JVDB 3OONA 2LBWA 1NJIH 5EYPB 1OFUA 1KD1H 1VQ7F 3MCAB 3CG6A 1XHOA 1Q81H 4F6RA 2HS3A 2FGYA 3WGKA 2PMPA 3ESJA 3CCMF 2PHNA 4BY9D 4I4TA 3GTZA 1W55A 5EZYA 1ONIA 3JATA 1W42A 3FD5A 1TUBB 1SA0A 4O2BA 3DC2A 4ZHQB 5B8FA 5LA6B 3WPWA 3MDOA 4O4JA 3VYUC 2HVYD 3JAWA 1VQ5F 2QEXF 3WJPA 4YJ3B 4NQ3A 5JH7A 2RB9A 3VOAA 3CXCF 3JALA 1U3PA 2GLZA 2R751 3LFOA 1FNJA 2ZF8A 3VCZA 2R6R1 4G4XA 4ZK7A 3RYCB 3FD6A 2BO1A 2I6DA 1YQNA 3PAFA 4IIJB 3E20B 4FFBA 4B46A 1VQMF 2ZAUA 3HAXD 1CN7A 2G9IA 4O4IB 5IJ0B 1S72F 1COMA 2HQSC 3KJJA 5GANK 3TD3A 1RQ7A 2UZHA 1VQKF 3UT5B 4RQOA 3RA5A 4X20B 1Q82H 5LP6B 3U0OA 4NUTA 1PF5A 1VQVA 1VQLF 1YI2F 2KTVA 2WALA 3ON1A 1W59A 2UYNB 3RYIB 4R40B 3N2KA 1W5AA 3QUWA 2YXZA 5FJ4C 1UI9A 3L7QA 4B5CA 3MCQA 5KMGA 1VQ4F 1VQ9F 3NK7A 3N2GB 4TUYA 1YJ9F 4E6EA 2QA4F 1K8AH 3MBMA 4I55B 3G71F 5JQGA 3LWPC 1IV3A 4IHJB 5GINC 2ZOVA 5J2TB 3C9RA 4X1IB 4M8IA 4BW0B 1H48A 1RLUA 3LDTA 5FLXM 3M4SA 3QHDA 3IR9A 2UYKA 1VK3A 3VOBA 5CA1A 3TD4A 2HRYA 4ZHWA 4EI7A 2KTUA 2Z01A 1KNJA 4G4ZA 2B33A 2UYJA 3HWUA 3HKCA 2LBTA 4O2AA 4EI9A 2CSLA 3VMFB 3J7AR 5MN4A 4ZI7A 5J2TA 3JAKA 4BVQA 2HP0B 3CYQA 5HP7A 3S06A 1YIJF 1W5BA 1SDSA 3EORA 3LWQC 2BTOA 3CCEF 3F0FA 5MN6A 1W5FA 2VAPA 2QI2A 1K73H 3RE3A 5LYJB 1Z5WA 2UYPA 5J2UB 2AIZP 2MQEA 3JVHA 1IV2A 1W57A 2GVIA 1IPAA 4EB6A 5KX5B 1KQSF 4RHAA 4U39A 3LWRC 3KIZA 3JCMM 3S03A 2RHHA 4X1YB 3CC7F 3CCLF 3I7TA 3RYFA 4O4LB 4TV9B 3GYQA 4BT3A 2QTPA 5GAPK 3CCSF 2OZBA 5DCVA 3CCVF 4C81A 3D54A 1JJ2F 4B62A 2HP3A 5CA0A 2BTUA 2Z1TA 4DRXB 1Q86H 2CHTA 1FFXB 2N48A 3HKDB 4ZOLA 3JARA 5EWRA 5IT9M 3F0DA 5JVDA 1Z5VA 5IJ9B 3T80A 5LXTB 4BT2A 5EYPA 2FC3A 3WJQA 2JNBA 1W40A 3GHZA 5LOVB 1RA4A 2AIFA 5ITZB 1VQ8F 1TVKB 5BMVB 3KHNA 2DYYA 3TD5A 5HY2A 1TUBA 3RYHB 4BVSA 2F9ZC 4ZHQA 1U43A 4I50B 1DT9A 2OTLF 5LA6A 1QVFF 1ODEA 3P0ZA 1FFXA 2VGNA 3ZP7A 4TZZA 1YITF 4O4HB 3WGMA 4ZHYB 1RLGA 4YJ3A 3N4YA 1E7KA 3MQWA 5C8YB 2CVLA 5GONB 1U3LA 4HNAB 3C8LA 1U40A 5LOVA 2IG8A 1QVGF 4C4WC 3RYCA 2VXYA 2KGWA 4U3JB 2LCAA 3CC2F 1JN1A 2CW4A 4IIJA 4PWTA 3K14A 1UFYA 3OBWA 2VAWA 4I50A 3VTIC 3O85A 4C82A 4O4IA 5IJ0A 1VQOF 3HKBB 2I6RA 2K1SA 4YJ2B 2YYEA 5FNVB 3VYTC 3JASB 2Z1UA 1R1MA 3UT5A 3SIVA 4X20A 2EWCA 5LP6A 3IMPA 5EB1B 2HS0A 5HY4A 1YJWF 3F0GA 3VO8A 3ZOPA 4ZHVA 3IEWA 1JFFB 4U3JA 1IV1A 4BVTA 3HJWC 3KE1A 4X1KB 1K9MH 2UYNA 4LNUB 1GO1A 1YGYA 3RYIA 2RHLA 3R0PA 5LP6C 1Q7YH 1X25A 3IKEA 4XCQA 2OHWA 4EI8A 3HKEB 2ALEA 2Q1YA 3N2GA 3I56F 5EAZA 2P6YA 4KWEA 3V4DA 1X52A 5CB4B 1KNKA 3D00A 5JCOC 3V7QA 4I55A 5HY1A 4LCKA 1Q8RA 3CD6F 2H8EA 4IHJA 5IYZB 3LWVC 4X1IA 4BT6A 2Z1FA 4G4VA 3OBYA 3CYPB 1QAHA 1ZWZA 3FFMA 3I3FA 3JAMM 1VHAA 3G6EF 3V3TA 4TV8B 3J81M 3HKEA 5AVMA 1CK2A 2ZODA 3S0HA 1KC8H 3IEQA 3CMAF 1PXWA 3VI6A 4C8EA 4C8GA 2IAFA 3M1XA 4F6RB 3IKFA 1VQ6F 5HXUA 3CCUF 4I4TB 2RHJA 5EZYB 3NVIB 1W581 1XBIA 2HP0A 3JATB 1SA0B 5EO3A 4O2BB 1X7OA 3ZP4A 3F6MA 4O4JB 2OTMA 3C9SA 2V9YA 1JD1A 3V7EA 3JAWB 5GIPC 5LYJA 3BYQA 4C8IA 5J2UA 3VYSC 5JH7B 5KX5A 5G4UC 3CCRF 3JALB 3NVKE 1SZQA 3DDNA 3Q8HA 3WJRA 4X1YA 5MN5A 4B45A 1QU9A 5EIBD 1OAPA 4O4LA 4TV9A 3WXMB 4FFBB 1GZ0A 1VQPF 3LMEA 2W8BC 4DRXA 1FNKA 2CZWA 5EB0A 3HKDA 3C9UA 3F0EA 3K2XA 4BT5A 1W41A 5A2QM 4X3MA 5IJ9A 5LXTA 2GZLA
chains in the Genus database with same CATH topology
3J80M 1Q81H 3J7AR 4X3LA 5HY0A 5HY4A 1YJWF 4BY9D 2FGYA 3G4SF 3CCMF 4BVQA 3NK6A 4BVTA 1W42A 3HJWC 1YIJF 4BVRA 1SDSA 3AGKA 1K9MH 3LWQC 1N8RH 1GO1A 3CCEF 2QI2A 3CCQF 1Q7YH 1K73H 5G4VC 2HVYD 4XCQA 2OHWA 1VQ5F 2QEXF 4EI8A 1IPAA 1YHQF 1KQSF 2ALEA 4NQ3A 3I56F 3OW2F 1X52A 3LWRC 3CXCF 2GLZA 3JCMM 3D00A 3V7QA 1H7MA 5HY1A 3LFOA 4LCKA 5HWEA 3CD6F 3CC7F 3LWVC 3CCLF 1VQNF 1M90H 2LBXA 5DCVA 2OZBA 3GYQA 3I55F 3CCSF 2BO1A 2I6DA 5GAPK 3PAFA 3CCVF 2KG4A 3OBYA 1JJ2F 3E20B 1ZWZA 3FFMA 3JAMM 1VQMF 3HAXD 1Q86H 3G6EF 1CN7A 3V3TA 5HXZA 1S72F 3RA6A 3J81M 5GANK 5EWRA 1CK2A 1T0KB 5IT9M 1VQKF 1KC8H 3CMAF 2FC3A 3RA5A 3VI6A 1PXWA 2JNBA 1W40A 3LWOC 1Q82H 3CCJF 1RA4A 2AIFA 1VQ8F 4NUTA 1VQ6F 5HXUA 3CCUF 1VQLF 3NVIB 1YI2F 1XBIA 2KTVA 2WALA 3ON1A 5EO3A 5HY2A 1X7OA 4BVSA 2F9ZC 1DT9A 2OTLF 3CPQA 1QVFF 1NMUB 3V7EA 5FJ4C 2VGNA 5GIPC 4TZZA 5GIOC 1X7PA 1VQ4F 1VQ9F 1W2BF 1YITF 3NK7A 1RLGA 1YJ9F 5G4UC 3N4YA 3CCRF 1E7KA 3NVKE 2QA4F 3E1YA 1K8AH 3G71F 3LWPC 1M1KH 3SIUA 5GINC 1QVGF 4C4WC 4BW0B 2OTJF 5FLXM 3WXMB 3N4ZA 3CC2F 3CC4F 3IR9A 1YJNF 1GZ0A 3CMEF 1VQPF 3OBWA 4EI7A 3PLAC 2KTUA 2VGMA 3NMUC 3O85A 1GO0A 3CPWF 2CZWA 1VQOF 1W3EX 1W41A 5A2QM 4X3MA 2LBWA 1NJIH 3SIVA 1KD1H 1VQ7F 3MCAB 4EI9A 3VMFB 3CG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 M;  1Q81 H;  3J7A R;  4X3L A;  1YJW F;  4BY9 D;  3G4S F;  3CCM F;  3NK6 A;  1W42 A;  3HJW C;  1YIJ F;  1SDS A;  3AGK A;  1K9M H;  3LWQ C;  1N8R H;  1GO1 A;  3CCE F;  2QI2 A;  3CCQ F;  1Q7Y H;  1K73 H;  5G4V C;  2HVY D;  2OHW A;  1VQ5 F;  2QEX F;  1IPA A;  1YHQ F;  1KQS F;  2ALE A;  3I56 F;  3OW2 F;  1X52 A;  3LWR C;  3CXC F;  3JCM M;  3V7Q A;  1H7M A;  4LCK A;  3LFO A;  3CD6 F;  3CC7 F;  3LWV C;  3CCL F;  1VQN F;  1M90 H;  2LBX A;  5DCV A;  2OZB A;  3GYQ A;  3I55 F;  3CCS F;  2BO1 A;  2I6D A;  5GAP K;  3PAF A;  3CCV F;  2KG4 A;  3OBY A;  1JJ2 F;  3E20 B;  1ZWZ A;  3FFM A;  3JAM M;  1VQM F;  3HAX D;  1Q86 H;  3G6E F;  1CN7 A;  1S72 F;  3RA6 A;  3J81 M;  5GAN K;  5EWR A;  1CK2 A;  1T0K B;  5IT9 M;  1VQK F;  1KC8 H;  3CMA F;  2FC3 A;  3RA5 A;  3VI6 A;  1PXW A;  2JNB A;  1W40 A;  3LWO C;  1Q82 H;  3CCJ F;  1RA4 A;  2AIF A;  1VQ8 F;  4NUT A;  1VQ6 F;  3CCU F;  1VQL F;  3NVI B;  1YI2 F;  1XBI A;  2KTV A;  2WAL A;  3ON1 A;  5EO3 A;  1X7O A;  1DT9 A;  2OTL F;  3CPQ A;  1QVF F;  1NMU B;  3V7E A;  5FJ4 C;  2VGN A;  5GIP C;  4TZZ A;  5GIO C;  1X7P A;  1VQ4 F;  1VQ9 F;  1W2B F;  1YIT F;  3NK7 A;  1RLG A;  1YJ9 F;  5G4U C;  3N4Y A;  3CCR F;  1E7K A;  3NVK E;  2QA4 F;  3E1Y A;  1K8A H;  3G71 F;  3LWP C;  1M1K H;  3SIU A;  5GIN C;  1QVG F;  4C4W C;  4BW0 B;  2OTJ F;  5FLX M;  3WXM B;  3N4Z A;  3CC2 F;  3CC4 F;  3IR9 A;  1YJN F;  1GZ0 A;  3CME F;  1VQP F;  3OBW A;  3PLA C;  2KTU A;  2VGM A;  3NMU C;  3O85 A;  1GO0 A;  3CPW F;  2CZW A;  1VQO F;  1W3E X;  1W41 A;  5A2Q M;  4X3M A;  2LBW A;  1NJI H;  3SIV A;  1KD1 H;  1VQ7 F;  3MCA B;  3VMF B;  3CG6 A; 
#chains in the Genus database with same CATH topology
 3J80 M;  4X3L A;  5HY0 A;  3KJK A;  5ITZ A;  1CLI A;  1TVK A;  2NMU A;  4ERH A;  3G4S F;  3NK6 A;  5BMV A;  4BVR A;  3AGK A;  3C9T A;  3S02 A;  3N2K B;  3RYH A;  1N8R H;  2BTQ B;  2H8C A;  3CCQ F;  2Z1E A;  3QTY A;  1QD9 A;  5G4V C;  1DBF A;  5KMG B;  2HS4 A;  2AMT A;  1H47 A;  1YHQ F;  4TUY B;  1FSZ A;  4O4H A;  3K12 A;  3OW2 F;  2DT4 A;  3WPX A;  5C8Y A;  5GON A;  5JQG B;  3WGJ A;  3D01 A;  1H7M A;  4HNA A;  1W5E A;  5HWE A;  1GX1 A;  1XV2 A;  1VQN F;  1M90 H;  2LBX A;  3I55 F;  3VIU A;  2HRU A;  2KG4 A;  2RHO A;  5CA1 B;  2ZVY A;  5JCO A;  3ELC A;  5HXZ A;  3HKC B;  2ZVZ A;  3RA6 A;  3HKB A;  4O2A B;  4YJ2 A;  1T0K B;  5EIB C;  3S0W A;  5FNV A;  1NQ3 A;  3WGL A;  1XRG A;  3JAS A;  4G4Y A;  3ERN A;  2VAM A;  3HTN A;  3WGN A;  4BT4 A;  3LWO C;  1T0A A;  3CCJ F;  4BT7 A;  1JY8 A;  2L26 A;  4ZI7 B;  3JAK B;  4WBN B;  3P10 A;  3CB2 A;  1JFF A;  4DXD A;  1RQ2 A;  2IQQ A;  4X1K A;  1J7H A;  4LNU A;  3CPQ A;  2H6L A;  3FPI A;  4G88 A;  3S0Y A;  1NMU B;  3ZO8 A;  3E22 B;  5GIO C;  4EB6 B;  1X7P A;  1W2B F;  3K0T A;  1IV4 A;  1VH8 A;  3E1Y A;  2HX0 A;  4NWO B;  5CB4 A;  1M1K H;  3SIU A;  3FBA A;  2CWJ A;  4WBN A;  3RYF B;  5IYZ A;  3P4E A;  5HP8 A;  2OTJ F;  3B6N A;  3N4Z A;  3M84 A;  3CC4 F;  5CA0 B;  1YJN F;  3CME F;  3PLA C;  2VGM A;  2Q1X A;  3NMU C;  1GO0 A;  3E22 A;  4TV8 A;  4ZOL B;  3JAR B;  3CPW F;  1W3E X;  3LYB A;  4G4W A;  2CHS A;  5JVD B;  3OON A;  2LBW A;  1NJI H;  5EYP B;  1OFU A;  1KD1 H;  1VQ7 F;  3MCA B;  3CG6 A;  1XHO A;  1Q81 H;  4F6R A;  2HS3 A;  2FGY A;  3WGK A;  2PMP A;  3ESJ A;  3CCM F;  2PHN A;  4BY9 D;  4I4T A;  3GTZ A;  1W55 A;  5EZY A;  1ONI A;  3JAT A;  1W42 A;  3FD5 A;  1TUB B;  1SA0 A;  4O2B A;  3DC2 A;  4ZHQ B;  5B8F A;  5LA6 B;  3WPW A;  3MDO A;  4O4J A;  3VYU C;  2HVY D;  3JAW A;  1VQ5 F;  2QEX F;  3WJP A;  4YJ3 B;  4NQ3 A;  5JH7 A;  2RB9 A;  3VOA A;  3CXC F;  3JAL A;  1U3P A;  2GLZ A;  2R75 1;  3LFO A;  1FNJ A;  2ZF8 A;  3VCZ A;  2R6R 1;  4G4X A;  4ZK7 A;  3RYC B;  3FD6 A;  2BO1 A;  2I6D A;  1YQN A;  3PAF A;  4IIJ B;  3E20 B;  4FFB A;  4B46 A;  1VQM F;  2ZAU A;  3HAX D;  1CN7 A;  2G9I A;  4O4I B;  5IJ0 B;  1S72 F;  1COM A;  2HQS C;  3KJJ A;  5GAN K;  3TD3 A;  1RQ7 A;  2UZH A;  1VQK F;  3UT5 B;  4RQO A;  3RA5 A;  4X20 B;  1Q82 H;  5LP6 B;  3U0O A;  4NUT A;  1PF5 A;  1VQV A;  1VQL F;  1YI2 F;  2KTV A;  2WAL A;  3ON1 A;  1W59 A;  2UYN B;  3RYI B;  4R40 B;  3N2K A;  1W5A A;  3QUW A;  2YXZ A;  5FJ4 C;  1UI9 A;  3L7Q A;  4B5C A;  3MCQ A;  5KMG A;  1VQ4 F;  1VQ9 F;  3NK7 A;  3N2G B;  4TUY A;  1YJ9 F;  4E6E A;  2QA4 F;  1K8A H;  3MBM A;  4I55 B;  3G71 F;  5JQG A;  3LWP C;  1IV3 A;  4IHJ B;  5GIN C;  2ZOV A;  5J2T B;  3C9R A;  4X1I B;  4M8I A;  4BW0 B;  1H48 A;  1RLU A;  3LDT A;  5FLX M;  3M4S A;  3QHD A;  3IR9 A;  2UYK A;  1VK3 A;  3VOB A;  5CA1 A;  3TD4 A;  2HRY A;  4ZHW A;  4EI7 A;  2KTU A;  2Z01 A;  1KNJ A;  4G4Z A;  2B33 A;  2UYJ A;  3HWU A;  3HKC A;  2LBT A;  4O2A A;  4EI9 A;  2CSL A;  3VMF B;  3J7A R;  5MN4 A;  4ZI7 A;  5J2T A;  3JAK A;  4BVQ A;  2HP0 B;  3CYQ A;  5HP7 A;  3S06 A;  1YIJ F;  1W5B A;  1SDS A;  3EOR A;  3LWQ C;  2BTO A;  3CCE F;  3F0F A;  5MN6 A;  1W5F A;  2VAP A;  2QI2 A;  1K73 H;  3RE3 A;  5LYJ B;  1Z5W A;  2UYP A;  5J2U B;  2AIZ P;  2MQE A;  3JVH A;  1IV2 A;  1W57 A;  2GVI A;  1IPA A;  4EB6 A;  5KX5 B;  1KQS F;  4RHA A;  4U39 A;  3LWR C;  3KIZ A;  3JCM M;  3S03 A;  2RHH A;  4X1Y B;  3CC7 F;  3CCL F;  3I7T A;  3RYF A;  4O4L B;  4TV9 B;  3GYQ A;  4BT3 A;  2QTP A;  5GAP K;  3CCS F;  2OZB A;  5DCV A;  3CCV F;  4C81 A;  3D54 A;  1JJ2 F;  4B62 A;  2HP3 A;  5CA0 A;  2BTU A;  2Z1T A;  4DRX B;  1Q86 H;  2CHT A;  1FFX B;  2N48 A;  3HKD B;  4ZOL A;  3JAR A;  5EWR A;  5IT9 M;  3F0D A;  5JVD A;  1Z5V A;  5IJ9 B;  3T80 A;  5LXT B;  4BT2 A;  5EYP A;  2FC3 A;  3WJQ A;  2JNB A;  1W40 A;  3GHZ A;  5LOV B;  1RA4 A;  2AIF A;  5ITZ B;  1VQ8 F;  1TVK B;  5BMV B;  3KHN A;  2DYY A;  3TD5 A;  5HY2 A;  1TUB A;  3RYH B;  4BVS A;  2F9Z C;  4ZHQ A;  1U43 A;  4I50 B;  1DT9 A;  2OTL F;  5LA6 A;  1QVF F;  1ODE A;  3P0Z A;  1FFX A;  2VGN A;  3ZP7 A;  4TZZ A;  1YIT F;  4O4H B;  3WGM A;  4ZHY B;  1RLG A;  4YJ3 A;  3N4Y A;  1E7K A;  3MQW A;  5C8Y B;  2CVL A;  5GON B;  1U3L A;  4HNA B;  3C8L A;  1U40 A;  5LOV A;  2IG8 A;  1QVG F;  4C4W C;  3RYC A;  2VXY A;  2KGW A;  4U3J B;  2LCA A;  3CC2 F;  1JN1 A;  2CW4 A;  4IIJ A;  4PWT A;  3K14 A;  1UFY A;  3OBW A;  2VAW A;  4I50 A;  3VTI C;  3O85 A;  4C82 A;  4O4I A;  5IJ0 A;  1VQO F;  3HKB B;  2I6R A;  2K1S A;  4YJ2 B;  2YYE A;  5FNV B;  3VYT C;  3JAS B;  2Z1U A;  1R1M A;  3UT5 A;  3SIV A;  4X20 A;  2EWC A;  5LP6 A;  3IMP A;  5EB1 B;  2HS0 A;  5HY4 A;  1YJW F;  3F0G A;  3VO8 A;  3ZOP A;  4ZHV A;  3IEW A;  1JFF B;  4U3J A;  1IV1 A;  4BVT A;  3HJW C;  3KE1 A;  4X1K B;  1K9M H;  2UYN A;  4LNU B;  1GO1 A;  1YGY A;  3RYI A;  2RHL A;  3R0P A;  5LP6 C;  1Q7Y H;  1X25 A;  3IKE A;  4XCQ A;  2OHW A;  4EI8 A;  3HKE B;  2ALE A;  2Q1Y A;  3N2G A;  3I56 F;  5EAZ A;  2P6Y A;  4KWE A;  3V4D A;  1X52 A;  5CB4 B;  1KNK A;  3D00 A;  5JCO C;  3V7Q A;  4I55 A;  5HY1 A;  4LCK A;  1Q8R A;  3CD6 F;  2H8E A;  4IHJ A;  5IYZ B;  3LWV C;  4X1I A;  4BT6 A;  2Z1F A;  4G4V A;  3OBY A;  3CYP B;  1QAH A;  1ZWZ A;  3FFM A;  3I3F A;  3JAM M;  1VHA A;  3G6E F;  3V3T A;  4TV8 B;  3J81 M;  3HKE A;  5AVM A;  1CK2 A;  2ZOD A;  3S0H A;  1KC8 H;  3IEQ A;  3CMA F;  1PXW A;  3VI6 A;  4C8E A;  4C8G A;  2IAF A;  3M1X A;  4F6R B;  3IKF A;  1VQ6 F;  5HXU A;  3CCU F;  4I4T B;  2RHJ A;  5EZY B;  3NVI B;  1W58 1;  1XBI A;  2HP0 A;  3JAT B;  1SA0 B;  5EO3 A;  4O2B B;  1X7O A;  3ZP4 A;  3F6M A;  4O4J B;  2OTM A;  3C9S A;  2V9Y A;  1JD1 A;  3V7E A;  3JAW B;  5GIP C;  5LYJ A;  3BYQ A;  4C8I A;  5J2U A;  3VYS C;  5JH7 B;  5KX5 A;  5G4U C;  3CCR F;  3JAL B;  3NVK E;  1SZQ A;  3DDN A;  3Q8H A;  3WJR A;  4X1Y A;  5MN5 A;  4B45 A;  1QU9 A;  5EIB D;  1OAP A;  4O4L A;  4TV9 A;  3WXM B;  4FFB B;  1GZ0 A;  1VQP F;  3LME A;  2W8B C;  4DRX A;  1FNK A;  2CZW A;  5EB0 A;  3HKD A;  3C9U A;  3F0E A;  3K2X A;  4BT5 A;  1W41 A;  5A2Q M;  4X3M A;  5IJ9 A;  5LXT A;  2GZL A; 
#chains in the Genus database with same CATH homology
 3J80 M;  1Q81 H;  3J7A R;  4X3L A;  5HY0 A;  5HY4 A;  1YJW F;  4BY9 D;  2FGY A;  3G4S F;  3CCM F;  4BVQ A;  3NK6 A;  4BVT A;  1W42 A;  3HJW C;  1YIJ F;  4BVR A;  1SDS A;  3AGK A;  1K9M H;  3LWQ C;  1N8R H;  1GO1 A;  3CCE F;  2QI2 A;  3CCQ F;  1Q7Y H;  1K73 H;  5G4V C;  2HVY D;  4XCQ A;  2OHW A;  1VQ5 F;  2QEX F;  4EI8 A;  1IPA A;  1YHQ F;  1KQS F;  2ALE A;  4NQ3 A;  3I56 F;  3OW2 F;  1X52 A;  3LWR C;  3CXC F;  2GLZ A;  3JCM M;  3D00 A;  3V7Q A;  1H7M A;  5HY1 A;  3LFO A;  4LCK A;  5HWE A;  3CD6 F;  3CC7 F;  3LWV C;  3CCL F;  1VQN F;  1M90 H;  2LBX A;  5DCV A;  2OZB A;  3GYQ A;  3I55 F;  3CCS F;  2BO1 A;  2I6D A;  5GAP K;  3PAF A;  3CCV F;  2KG4 A;  3OBY A;  1JJ2 F;  3E20 B;  1ZWZ A;  3FFM A;  3JAM M;  1VQM F;  3HAX D;  1Q86 H;  3G6E F;  1CN7 A;  3V3T A;  5HXZ A;  1S72 F;  3RA6 A;  3J81 M;  5GAN K;  5EWR A;  1CK2 A;  1T0K B;  5IT9 M;  1VQK F;  1KC8 H;  3CMA F;  2FC3 A;  3RA5 A;  3VI6 A;  1PXW A;  2JNB A;  1W40 A;  3LWO C;  1Q82 H;  3CCJ F;  1RA4 A;  2AIF A;  1VQ8 F;  4NUT A;  1VQ6 F;  5HXU A;  3CCU F;  1VQL F;  3NVI B;  1YI2 F;  1XBI A;  2KTV A;  2WAL A;  3ON1 A;  5EO3 A;  5HY2 A;  1X7O A;  4BVS A;  2F9Z C;  1DT9 A;  2OTL F;  3CPQ A;  1QVF F;  1NMU B;  3V7E A;  5FJ4 C;  2VGN A;  5GIP C;  4TZZ A;  5GIO C;  1X7P A;  1VQ4 F;  1VQ9 F;  1W2B F;  1YIT F;  3NK7 A;  1RLG A;  1YJ9 F;  5G4U C;  3N4Y A;  3CCR F;  1E7K A;  3NVK E;  2QA4 F;  3E1Y A;  1K8A H;  3G71 F;  3LWP C;  1M1K H;  3SIU A;  5GIN C;  1QVG F;  4C4W C;  4BW0 B;  2OTJ F;  5FLX M;  3WXM B;  3N4Z A;  3CC2 F;  3CC4 F;  3IR9 A;  1YJN F;  1GZ0 A;  3CME F;  1VQP F;  3OBW A;  4EI7 A;  3PLA C;  2KTU A;  2VGM A;  3NMU C;  3O85 A;  1GO0 A;  3CPW F;  2CZW A;  1VQO F;  1W3E X;  1W41 A;  5A2Q M;  4X3M A;  2LBW A;  1NJI H;  3SIV A;  1KD1 H;  1VQ7 F;  3MCA B;  4EI9 A;  3VMF B;  3CG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...