1S72F

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1s72F00
1X7PA 1NMUB 1YITF 3I56F 3I55F 1VQ5F 3CPQA 3CCLF 4X3MA 3G4SF 1N8RH 5IT9M 3JAMM 1M90H 3CPWF 3LWRC 1QVGF 2WALA 3CC7F 5EO3A 1YJNF 3HAXD 4C4WC 3NVKE 2KG4A 1CK2A 1W41A 5G4VC 3LFOA 3VI6A 5A2QM 1W3EX 3PAFA 3CCRF 1VQNF 1YJ9F 5FJ4C 1KQSF 3CCMF 1VQLF 1SDSA 3AGKA 2OZBA 5GIPC 3N4YA 3N4ZA 1K9MH 1JJ2F 2ALEA 3E1YA 1VQ9F 3OBWA 3GYQA 3CCQF 1PXWA 3SIVA 4X3LA 1YI2F 3CCEF 1GO1A 2QEXF 3J7AR 3G71F 3NMUC 3VMFB 4LCKA 3PLAC 5DCVA 2VGMA 3CCVF 1H7MA 5GIOC 1CN7A 2AIFA 2OTLF 2HVYD 2QI2A 5G4UC 1VQ8F 5EWRA 1GZ0A 1KD1H 3FFMA 1VQPF 3WXMB 3SIUA 3CCSF 3LWQC 1QVFF 2LBXA 3G6EF 3MCAB 4BY9D 3ON1A 1Q7YH 2CZWA 3JCMM 3CXCF 1YJWF 3E20B 1Q81H 1RA4A 1VQ6F 1ZWZA 1VQMF 1X7OA 3V7EA 2I6DA 3CC4F 1YIJF 2BO1A 3J81M 4BW0B 1NJIH 3CMEF 1VQKF 3J80M 2QA4F 2LBWA 1DT9A 2KTUA 3HJWC 4NUTA 3CMAF 1Q82H 3OBYA 1M1KH 1RLGA 3LWVC 3NK6A 2OTJF 3V7QA 1VQ4F 3NVIB 1KC8H 1YHQF 3CCJF 1IPAA 3RA6A 5GANK 3OW2F 1W40A 3CD6F 3IR9A 3CCUF 1Q86H 1XBIA 2FC3A 2KTVA 1K8AH 4TZZA 3CC2F 3LWPC 2JNBA 2OHWA 5FLXM 1GO0A 5GINC 1W2BF 3RA5A 1E7KA 3NK7A 5GAPK 1K73H 1VQ7F 1X52A 1T0KB 3CG6A 3O85A 1S72F 3LWOC 1W42A 2VGNA 1VQOF
chains in the Genus database with same CATH superfamily
1NMUB 5ITZB 2B33A 3K0TA 3GHZA 5HWEA 5JH7B 3CCLF 3QUWA 3JAKA 3IKFA 3CPWF 3KHNA 3CC7F 4G4XA 4ZHVA 1YJNF 3KIZA 3HKBA 3RYHA 2N48A 3VI6A 3LFOA 1JFFA 2ZF8A 1PF5A 3CCRF 2NMUA 1J7HA 1YJ9F 1KQSF 1ONIA 4DRXA 3N2KA 2H6LA 2OZBA 3N4YA 3VYSC 1JJ2F 4LNUA 4RQOA 3JAKB 1W57A 3GYQA 3SIVA 5CA0B 4NWOB 4BT6A 1TUBA 3CCEF 2CSLA 2GVIA 5B8FA 3J7AR 2RHOA 3G71F 2Z01A 5J2UB 5C8YB 3VTIC 2RB9A 5LP6B 4BVQA 5LA6A 4O4JB 1FNKA 3C9SA 5FNVB 5MN5A 2Z1EA 4DXDA 5IJ9B 5JVDA 4TV8B 5G4UC 1VQ8F 3N2GA 2VXYA 4TUYB 5JCOC 5J2TB 2Q1YA 3FFMA 3RYIB 1W59A 3B6NA 5HXUA 4O2AB 3CCSF 2UYKA 3VIUA 4BT3A 1FFXA 1ODEA 3WGJA 2LBXA 3E22B 5JVDB 3HKCB 3HKDB 3WJQA 1QU9A 1OAPA 5EB1B 1X25A 4BT4A 1YJWF 1VQ6F 3V7EA 2QTPA 3IEWA 2DYYA 4FFBB 5JCOA 4YJ3B 2LBTA 4C82A 3CC4F 3MBMA 3HKCA 4B45A 3J81M 3F0EA 1RQ7A 5JH7A 2HQSC 1VQKF 2RHHA 2P6YA 3EORA 2PHNA 3TD5A 3WPWA 5EIBD 2LBWA 2R751 4HNAA 3S03A 4NUTA 1IV3A 3JASB 1Q82H 2CVLA 1M1KH 3K14A 5IJ0B 1VH8A 2YYEA 3IKEA 4IHJB 3IEQA 1IPAA 1W5FA 3ERNA 4BVRA 5LP6A 2IQQA 1TVKB 3FD6A 3CCUF 2FC3A 5LOVB 3JATB 2JNBA 1W55A 5GINC 4B5CA 1W2BF 4F6RB 3RA5A 1IV1A 1E7KA 1K73H 1U3LA 2CWJA 3ZO8A 3O85A 5KX5B 4E6EA 5LOVA 1S72F 4FFBA 4YJ3A 2VGNA 1X7PA 3FBAA 3HKEA 3IMPA 3VOBA 3ELCA 2ZVZA 2DT4A 3CPQA 3RYFA 5BMVA 5LP6C 3JARA 3T80A 3MDOA 3CB2A 5IT9M 4G4WA 3KJJA 5GONB 3CYPB 5JQGB 5HP8A 2I6RA 1T0AA 3RE3A 4DRXB 3NVKE 4TUYA 2MQEA 4PWTA 5G4VC 5A2QM 4I4TA 2HP0B 5LA6B 3HKEB 1VQLF 4BT7A 5GIPC 1H47A 2W8BC 4O4IB 4ZK7A 4X20B 3CCQF 3ESJA 1PXWA 3TD3A 1VQVA 3VYTC 4BVSA 4EB6A 2V9YA 5KX5A 5HY0A 1JD1A 1GO1A 1YGYA 2QEXF 3K12A 2EWCA 3VMFB 3UT5A 4LCKA 3PLAC 4I55B 2VGMA 2AIFA 2OTLF 3N2KB 5HY2A 5JQGA 2ZAUA 3UT5B 3RYHB 1GZ0A 3RYFB 3QTYA 3ZOPA 2VAMA 3SIUA 4ZHQA 3JAWB 1KNKA 2PMPA 1QVFF 3R0PA 2F9ZC 4BY9D 4B62A 1UFYA 1Q7YH 4TV9B 3JCMM 2BTUA 4C81A 1ZWZA 1VQMF 4B46A 1YIJF 2BO1A 4LNUB 2UYNA 3J80M 4O2BB 5CB4A 2QA4F 1NQ3A 1DT9A 3HJWC 3WJRA 1CLIA 3S0WA 4R40B 3V7QA 3KE1A 3NVIB 4RHAA 4ZI7B 1W5EA 4IIJB 1SZQA 4HNAB 2BTOA 3OW2F 1W40A 5EB0A 2BTQB 3IR9A 2IAFA 3JARB 2KTVA 5FNVA 4U3JA 3LDTA 1U43A 3CC2F 3JAWA 5EYPB 3HTNA 3E22A 5FLXM 1GO0A 3WGLA 3NK7A 3M4SA 5GAPK 4NQ3A 1T0KB 3Q8HA 4I4TB 1VK3A 1W42A 2Z1TA 2OHWA 2OTMA 4BT5A 5IJ9A 1DBFA 3I56F 4X1YB 5HY4A 3S0HA 1RLUA 1W5BA 4WBNA 4X1IB 2K1SA 3P4EA 3BYQA 1N8RH 1M90H 3C8LA 3M1XA 5HP7A 5EO3A 1IV2A 1FNJA 3WPXA 3HAXD 4C4WC 4KWEA 2KG4A 4G4YA 3PAFA 4X20A 3JASA 3DC2A 4X1KA 5MN4A 5CA1A 1K9MH 3N4ZA 4EI7A 2ALEA 3E1YA 3JATA 3F0GA 3OBWA 3WGNA 5LXTB 2L26A 1IV4A 1TVKA 1YI2F 3C9RA 2HS3A 3NMUC 4I50A 3JALA 3QHDA 1U3PA 4O4HB 3CCVF 1CN7A 1FSZA 5CA1B 5EYPA 2HX0A 2QI2A 3D00A 5EWRA 2ZOVA 3WGKA 4EB6B 3WJPA 4O4JA 1Q8RA 3D54A 3JVHA 5J2UA 2HP0A 3G6EF 5KMGA 3MCAB 4XCQA 5LYJA 3VOAA 3OONA 1OFUA 3JALB 3D01A 3F0FA 2CZWA 4WBNB 3CXCF 4ZI7A 4M8IA 3VCZA 4C8GA 2CHTA 3N2GB 3DDNA 1NJIH 1COMA 5C8YA 3ZP7A 2KTUA 3C9TA 2Q1XA 1VHAA 3S0YA 2HS4A 3OBYA 4I55A 3WGMA 3NK6A 2OTJF 3MCQA 3FD5A 1YHQF 4C8IA 3CCJF 1GX1A 2Z1UA 3CYQA 3VYUC 5ITZA 2GLZA 1SA0A 3ZP4A 3RA6A 4O4HA 5GANK 3CD6F 1Q86H 1XBIA 4ZOLA 1K8AH 3P10A 1UI9A 4TZZA 3LWPC 1FFXB 4YJ2B 4IIJA 1W581 5J2TA 3RYIA 1JN1A 1X52A 5MN6A 4U39A 3LWOC 4BVTA 5FJ4C 3M84A 2IG8A 4O4LA 5LYJB 3RYCA 1YITF 1SA0B 3I55F 1VQ5F 4TV9A 4ZOLB 1JY8A 4X3MA 1RQ2A 5LXTA 2AMTA 3G4SF 3JAMM 4BT2A 2RHLA 3LWRC 1QVGF 2WALA 1XHOA 1TUBB 3VO8A 4F6RA 3FPIA 1CK2A 1W41A 2KGWA 1W3EX 2CHSA 5EZYA 1VQNF 2VAWA 3I3FA 3CCMF 2HRYA 1SDSA 3AGKA 4X1YA 3V3TA 4G4ZA 2UYJA 1VQ9F 1QAHA 4O2BA 5CB4B 3F0DA 3I7TA 1H48A 2HS0A 5HXZA 4X3LA 4ERHA 4IHJA 4G4VA 3K2XA 4EI9A 2YXZA 4X1KB 3S02A 5DCVA 5AVMA 2G9IA 1H7MA 5GIOC 3V4DA 1Z5VA 4ZHYB 5IYZB 4O4LB 3RYCB 2HVYD 3HKDA 1KNJA 4C8EA 1KD1H 1VQPF 3WXMB 2ZODA 3LWQC 2Z1FA 3S06A 3P0ZA 4YJ2A 2LCAA 3KJKA 4I50B 4TV8A 5IJ0A 2GZLA 3ON1A 2UYPA 1JFFB 5BMVB 1Z5WA 3E20B 1Q81H 1RA4A 1X7OA 4EI8A 2I6DA 5IYZA 5GONA 2HP3A 3TD4A 3HWUA 5KMGB 3F6MA 2H8CA 3HKBB 4G88A 4BW0B 3CMEF 1QD9A 1U40A 2H8EA 4O4IA 2FGYA 4ZHQB 3GTZA 3MQWA 3CMAF 5CA0A 1RLGA 3LWVC 1VQ4F 4ZHWA 1KC8H 3C9UA 2UZHA 1W5AA 1XRGA 5EIBC 1XV2A 1YQNA 2CW4A 4X1IA 4O2AA 2UYNB 2ZVYA 5EAZA 2R6R1 2HRUA 3U0OA 2RHJA 1R1MA 3LYBA 3L7QA 5HY1A 1VQ7F 3CG6A 4U3JB 5EZYB 2AIZP 2VAPA 3LMEA 1VQOF
chains in the Genus database with same CATH topology
1X7PA 1NMUB 1YITF 3I56F 5HY4A 3I55F 1VQ5F 3CPQA 5HWEA 3CCLF 4X3MA 3G4SF 1N8RH 5IT9M 3JAMM 1M90H 3CPWF 3LWRC 1QVGF 2WALA 3CC7F 5EO3A 1YJNF 3HAXD 4C4WC 3NVKE 2KG4A 1CK2A 1W41A 3LFOA 3VI6A 5A2QM 5G4VC 1W3EX 3PAFA 3CCRF 1VQNF 1YJ9F 5FJ4C 1KQSF 3CCMF 1VQLF 1SDSA 3AGKA 3V3TA 2OZBA 5GIPC 3N4YA 3N4ZA 4EI7A 1K9MH 1JJ2F 2ALEA 3E1YA 1VQ9F 3OBWA 3GYQA 3CCQF 1PXWA 3SIVA 5HXZA 4BVSA 4X3LA 1YI2F 3CCEF 5HY0A 1GO1A 2QEXF 3J7AR 3G71F 4EI9A 3NMUC 3VMFB 4LCKA 3PLAC 5DCVA 4BVQA 2VGMA 3CCVF 1H7MA 5GIOC 1CN7A 2AIFA 2OTLF 5HY2A 2HVYD 2QI2A 3D00A 5G4UC 1VQ8F 5EWRA 1GZ0A 1KD1H 3FFMA 1VQPF 3WXMB 3SIUA 3CCSF 5HXUA 3LWQC 1QVFF 2LBXA 3G6EF 3MCAB 2F9ZC 4BY9D 3ON1A 1Q7YH 2CZWA 3JCMM 3CXCF 1YJWF 3E20B 1Q81H 1RA4A 1VQ6F 1ZWZA 1VQMF 1X7OA 3V7EA 4EI8A 2I6DA 3CC4F 1YIJF 2BO1A 3J81M 4BW0B 1NJIH 3CMEF 1VQKF 3J80M 2QA4F 2FGYA 2LBWA 1DT9A 2KTUA 3HJWC 4NUTA 3CMAF 1Q82H 3OBYA 1M1KH 1RLGA 3LWVC 3NK6A 2OTJF 3V7QA 1VQ4F 3NVIB 1KC8H 1YHQF 3CCJF 1IPAA 2GLZA 3RA6A 4BVRA 5GANK 3OW2F 1W40A 3CD6F 3IR9A 3CCUF 1Q86H 1XBIA 2FC3A 2KTVA 1K8AH 4TZZA 3CC2F 3LWPC 2JNBA 2OHWA 5FLXM 1GO0A 5GINC 1W2BF 3RA5A 1E7KA 3NK7A 5GAPK 1K73H 1VQ7F 5HY1A 4NQ3A 1X52A 1T0KB 3CG6A 3O85A 1S72F 3LWOC 4BVTA 1W42A 4XCQA 2VGNA 1VQOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7P A;  1NMU B;  1YIT F;  3I56 F;  3I55 F;  1VQ5 F;  3CPQ A;  3CCL F;  4X3M A;  3G4S F;  1N8R H;  5IT9 M;  3JAM M;  1M90 H;  3CPW F;  3LWR C;  1QVG F;  2WAL A;  3CC7 F;  5EO3 A;  1YJN F;  3HAX D;  4C4W C;  3NVK E;  2KG4 A;  1CK2 A;  1W41 A;  5G4V C;  3LFO A;  3VI6 A;  5A2Q M;  1W3E X;  3PAF A;  3CCR F;  1VQN F;  1YJ9 F;  5FJ4 C;  1KQS F;  3CCM F;  1VQL F;  1SDS A;  3AGK A;  2OZB A;  5GIP C;  3N4Y A;  3N4Z A;  1K9M H;  1JJ2 F;  2ALE A;  3E1Y A;  1VQ9 F;  3OBW A;  3GYQ A;  3CCQ F;  1PXW A;  3SIV A;  4X3L A;  1YI2 F;  3CCE F;  1GO1 A;  2QEX F;  3J7A R;  3G71 F;  3NMU C;  3VMF B;  4LCK A;  3PLA C;  5DCV A;  2VGM A;  3CCV F;  1H7M A;  5GIO C;  1CN7 A;  2AIF A;  2OTL F;  2HVY D;  2QI2 A;  5G4U C;  1VQ8 F;  5EWR A;  1GZ0 A;  1KD1 H;  3FFM A;  1VQP F;  3WXM B;  3SIU A;  3CCS F;  3LWQ C;  1QVF F;  2LBX A;  3G6E F;  3MCA B;  4BY9 D;  3ON1 A;  1Q7Y H;  2CZW A;  3JCM M;  3CXC F;  1YJW F;  3E20 B;  1Q81 H;  1RA4 A;  1VQ6 F;  1ZWZ A;  1VQM F;  1X7O A;  3V7E A;  2I6D A;  3CC4 F;  1YIJ F;  2BO1 A;  3J81 M;  4BW0 B;  1NJI H;  3CME F;  1VQK F;  3J80 M;  2QA4 F;  2LBW A;  1DT9 A;  2KTU A;  3HJW C;  4NUT A;  3CMA F;  1Q82 H;  3OBY A;  1M1K H;  1RLG A;  3LWV C;  3NK6 A;  2OTJ F;  3V7Q A;  1VQ4 F;  3NVI B;  1KC8 H;  1YHQ F;  3CCJ F;  1IPA A;  3RA6 A;  5GAN K;  3OW2 F;  1W40 A;  3CD6 F;  3IR9 A;  3CCU F;  1Q86 H;  1XBI A;  2FC3 A;  2KTV A;  1K8A H;  4TZZ A;  3CC2 F;  3LWP C;  2JNB A;  2OHW A;  5FLX M;  1GO0 A;  5GIN C;  1W2B F;  3RA5 A;  1E7K A;  3NK7 A;  5GAP K;  1K73 H;  1VQ7 F;  1X52 A;  1T0K B;  3CG6 A;  3O85 A;  1S72 F;  3LWO C;  1W42 A;  2VGN A;  1VQO F; 
#chains in the Genus database with same CATH topology
 1NMU B;  5ITZ B;  2B33 A;  3K0T A;  3GHZ A;  5HWE A;  5JH7 B;  3CCL F;  3QUW A;  3JAK A;  3IKF A;  3CPW F;  3KHN A;  3CC7 F;  4G4X A;  4ZHV A;  1YJN F;  3KIZ A;  3HKB A;  3RYH A;  2N48 A;  3VI6 A;  3LFO A;  1JFF A;  2ZF8 A;  1PF5 A;  3CCR F;  2NMU A;  1J7H A;  1YJ9 F;  1KQS F;  1ONI A;  4DRX A;  3N2K A;  2H6L A;  2OZB A;  3N4Y A;  3VYS C;  1JJ2 F;  4LNU A;  4RQO A;  3JAK B;  1W57 A;  3GYQ A;  3SIV A;  5CA0 B;  4NWO B;  4BT6 A;  1TUB A;  3CCE F;  2CSL A;  2GVI A;  5B8F A;  3J7A R;  2RHO A;  3G71 F;  2Z01 A;  5J2U B;  5C8Y B;  3VTI C;  2RB9 A;  5LP6 B;  4BVQ A;  5LA6 A;  4O4J B;  1FNK A;  3C9S A;  5FNV B;  5MN5 A;  2Z1E A;  4DXD A;  5IJ9 B;  5JVD A;  4TV8 B;  5G4U C;  1VQ8 F;  3N2G A;  2VXY A;  4TUY B;  5JCO C;  5J2T B;  2Q1Y A;  3FFM A;  3RYI B;  1W59 A;  3B6N A;  5HXU A;  4O2A B;  3CCS F;  2UYK A;  3VIU A;  4BT3 A;  1FFX A;  1ODE A;  3WGJ A;  2LBX A;  3E22 B;  5JVD B;  3HKC B;  3HKD B;  3WJQ A;  1QU9 A;  1OAP A;  5EB1 B;  1X25 A;  4BT4 A;  1YJW F;  1VQ6 F;  3V7E A;  2QTP A;  3IEW A;  2DYY A;  4FFB B;  5JCO A;  4YJ3 B;  2LBT A;  4C82 A;  3CC4 F;  3MBM A;  3HKC A;  4B45 A;  3J81 M;  3F0E A;  1RQ7 A;  5JH7 A;  2HQS C;  1VQK F;  2RHH A;  2P6Y A;  3EOR A;  2PHN A;  3TD5 A;  3WPW A;  5EIB D;  2LBW A;  2R75 1;  4HNA A;  3S03 A;  4NUT A;  1IV3 A;  3JAS B;  1Q82 H;  2CVL A;  1M1K H;  3K14 A;  5IJ0 B;  1VH8 A;  2YYE A;  3IKE A;  4IHJ B;  3IEQ A;  1IPA A;  1W5F A;  3ERN A;  4BVR A;  5LP6 A;  2IQQ A;  1TVK B;  3FD6 A;  3CCU F;  2FC3 A;  5LOV B;  3JAT B;  2JNB A;  1W55 A;  5GIN C;  4B5C A;  1W2B F;  4F6R B;  3RA5 A;  1IV1 A;  1E7K A;  1K73 H;  1U3L A;  2CWJ A;  3ZO8 A;  3O85 A;  5KX5 B;  4E6E A;  5LOV A;  1S72 F;  4FFB A;  4YJ3 A;  2VGN A;  1X7P A;  3FBA A;  3HKE A;  3IMP A;  3VOB A;  3ELC A;  2ZVZ A;  2DT4 A;  3CPQ A;  3RYF A;  5BMV A;  5LP6 C;  3JAR A;  3T80 A;  3MDO A;  3CB2 A;  5IT9 M;  4G4W A;  3KJJ A;  5GON B;  3CYP B;  5JQG B;  5HP8 A;  2I6R A;  1T0A A;  3RE3 A;  4DRX B;  3NVK E;  4TUY A;  2MQE A;  4PWT A;  5G4V C;  5A2Q M;  4I4T A;  2HP0 B;  5LA6 B;  3HKE B;  1VQL F;  4BT7 A;  5GIP C;  1H47 A;  2W8B C;  4O4I B;  4ZK7 A;  4X20 B;  3CCQ F;  3ESJ A;  1PXW A;  3TD3 A;  1VQV A;  3VYT C;  4BVS A;  4EB6 A;  2V9Y A;  5KX5 A;  5HY0 A;  1JD1 A;  1GO1 A;  1YGY A;  2QEX F;  3K12 A;  2EWC A;  3VMF B;  3UT5 A;  4LCK A;  3PLA C;  4I55 B;  2VGM A;  2AIF A;  2OTL F;  3N2K B;  5HY2 A;  5JQG A;  2ZAU A;  3UT5 B;  3RYH B;  1GZ0 A;  3RYF B;  3QTY A;  3ZOP A;  2VAM A;  3SIU A;  4ZHQ A;  3JAW B;  1KNK A;  2PMP A;  1QVF F;  3R0P A;  2F9Z C;  4BY9 D;  4B62 A;  1UFY A;  1Q7Y H;  4TV9 B;  3JCM M;  2BTU A;  4C81 A;  1ZWZ A;  1VQM F;  4B46 A;  1YIJ F;  2BO1 A;  4LNU B;  2UYN A;  3J80 M;  4O2B B;  5CB4 A;  2QA4 F;  1NQ3 A;  1DT9 A;  3HJW C;  3WJR A;  1CLI A;  3S0W A;  4R40 B;  3V7Q A;  3KE1 A;  3NVI B;  4RHA A;  4ZI7 B;  1W5E A;  4IIJ B;  1SZQ A;  4HNA B;  2BTO A;  3OW2 F;  1W40 A;  5EB0 A;  2BTQ B;  3IR9 A;  2IAF A;  3JAR B;  2KTV A;  5FNV A;  4U3J A;  3LDT A;  1U43 A;  3CC2 F;  3JAW A;  5EYP B;  3HTN A;  3E22 A;  5FLX M;  1GO0 A;  3WGL A;  3NK7 A;  3M4S A;  5GAP K;  4NQ3 A;  1T0K B;  3Q8H A;  4I4T B;  1VK3 A;  1W42 A;  2Z1T A;  2OHW A;  2OTM A;  4BT5 A;  5IJ9 A;  1DBF A;  3I56 F;  4X1Y B;  5HY4 A;  3S0H A;  1RLU A;  1W5B A;  4WBN A;  4X1I B;  2K1S A;  3P4E A;  3BYQ A;  1N8R H;  1M90 H;  3C8L A;  3M1X A;  5HP7 A;  5EO3 A;  1IV2 A;  1FNJ A;  3WPX A;  3HAX D;  4C4W C;  4KWE A;  2KG4 A;  4G4Y A;  3PAF A;  4X20 A;  3JAS A;  3DC2 A;  4X1K A;  5MN4 A;  5CA1 A;  1K9M H;  3N4Z A;  4EI7 A;  2ALE A;  3E1Y A;  3JAT A;  3F0G A;  3OBW A;  3WGN A;  5LXT B;  2L26 A;  1IV4 A;  1TVK A;  1YI2 F;  3C9R A;  2HS3 A;  3NMU C;  4I50 A;  3JAL A;  3QHD A;  1U3P A;  4O4H B;  3CCV F;  1CN7 A;  1FSZ A;  5CA1 B;  5EYP A;  2HX0 A;  2QI2 A;  3D00 A;  5EWR A;  2ZOV A;  3WGK A;  4EB6 B;  3WJP A;  4O4J A;  1Q8R A;  3D54 A;  3JVH A;  5J2U A;  2HP0 A;  3G6E F;  5KMG A;  3MCA B;  4XCQ A;  5LYJ A;  3VOA A;  3OON A;  1OFU A;  3JAL B;  3D01 A;  3F0F A;  2CZW A;  4WBN B;  3CXC F;  4ZI7 A;  4M8I A;  3VCZ A;  4C8G A;  2CHT A;  3N2G B;  3DDN A;  1NJI H;  1COM A;  5C8Y A;  3ZP7 A;  2KTU A;  3C9T A;  2Q1X A;  1VHA A;  3S0Y A;  2HS4 A;  3OBY A;  4I55 A;  3WGM A;  3NK6 A;  2OTJ F;  3MCQ A;  3FD5 A;  1YHQ F;  4C8I A;  3CCJ F;  1GX1 A;  2Z1U A;  3CYQ A;  3VYU C;  5ITZ A;  2GLZ A;  1SA0 A;  3ZP4 A;  3RA6 A;  4O4H A;  5GAN K;  3CD6 F;  1Q86 H;  1XBI A;  4ZOL A;  1K8A H;  3P10 A;  1UI9 A;  4TZZ A;  3LWP C;  1FFX B;  4YJ2 B;  4IIJ A;  1W58 1;  5J2T A;  3RYI A;  1JN1 A;  1X52 A;  5MN6 A;  4U39 A;  3LWO C;  4BVT A;  5FJ4 C;  3M84 A;  2IG8 A;  4O4L A;  5LYJ B;  3RYC A;  1YIT F;  1SA0 B;  3I55 F;  1VQ5 F;  4TV9 A;  4ZOL B;  1JY8 A;  4X3M A;  1RQ2 A;  5LXT A;  2AMT A;  3G4S F;  3JAM M;  4BT2 A;  2RHL A;  3LWR C;  1QVG F;  2WAL A;  1XHO A;  1TUB B;  3VO8 A;  4F6R A;  3FPI A;  1CK2 A;  1W41 A;  2KGW A;  1W3E X;  2CHS A;  5EZY A;  1VQN F;  2VAW A;  3I3F A;  3CCM F;  2HRY A;  1SDS A;  3AGK A;  4X1Y A;  3V3T A;  4G4Z A;  2UYJ A;  1VQ9 F;  1QAH A;  4O2B A;  5CB4 B;  3F0D A;  3I7T A;  1H48 A;  2HS0 A;  5HXZ A;  4X3L A;  4ERH A;  4IHJ A;  4G4V A;  3K2X A;  4EI9 A;  2YXZ A;  4X1K B;  3S02 A;  5DCV A;  5AVM A;  2G9I A;  1H7M A;  5GIO C;  3V4D A;  1Z5V A;  4ZHY B;  5IYZ B;  4O4L B;  3RYC B;  2HVY D;  3HKD A;  1KNJ A;  4C8E A;  1KD1 H;  1VQP F;  3WXM B;  2ZOD A;  3LWQ C;  2Z1F A;  3S06 A;  3P0Z A;  4YJ2 A;  2LCA A;  3KJK A;  4I50 B;  4TV8 A;  5IJ0 A;  2GZL A;  3ON1 A;  2UYP A;  1JFF B;  5BMV B;  1Z5W A;  3E20 B;  1Q81 H;  1RA4 A;  1X7O A;  4EI8 A;  2I6D A;  5IYZ A;  5GON A;  2HP3 A;  3TD4 A;  3HWU A;  5KMG B;  3F6M A;  2H8C A;  3HKB B;  4G88 A;  4BW0 B;  3CME F;  1QD9 A;  1U40 A;  2H8E A;  4O4I A;  2FGY A;  4ZHQ B;  3GTZ A;  3MQW A;  3CMA F;  5CA0 A;  1RLG A;  3LWV C;  1VQ4 F;  4ZHW A;  1KC8 H;  3C9U A;  2UZH A;  1W5A A;  1XRG A;  5EIB C;  1XV2 A;  1YQN A;  2CW4 A;  4X1I A;  4O2A A;  2UYN B;  2ZVY A;  5EAZ A;  2R6R 1;  2HRU A;  3U0O A;  2RHJ A;  1R1M A;  3LYB A;  3L7Q A;  5HY1 A;  1VQ7 F;  3CG6 A;  4U3J B;  5EZY B;  2AIZ P;  2VAP A;  3LME A;  1VQO F; 
#chains in the Genus database with same CATH homology
 1X7P A;  1NMU B;  1YIT F;  3I56 F;  5HY4 A;  3I55 F;  1VQ5 F;  3CPQ A;  5HWE A;  3CCL F;  4X3M A;  3G4S F;  1N8R H;  5IT9 M;  3JAM M;  1M90 H;  3CPW F;  3LWR C;  1QVG F;  2WAL A;  3CC7 F;  5EO3 A;  1YJN F;  3HAX D;  4C4W C;  3NVK E;  2KG4 A;  1CK2 A;  1W41 A;  3LFO A;  3VI6 A;  5A2Q M;  5G4V C;  1W3E X;  3PAF A;  3CCR F;  1VQN F;  1YJ9 F;  5FJ4 C;  1KQS F;  3CCM F;  1VQL F;  1SDS A;  3AGK A;  3V3T A;  2OZB A;  5GIP C;  3N4Y A;  3N4Z A;  4EI7 A;  1K9M H;  1JJ2 F;  2ALE A;  3E1Y A;  1VQ9 F;  3OBW A;  3GYQ A;  3CCQ F;  1PXW A;  3SIV A;  5HXZ A;  4BVS A;  4X3L A;  1YI2 F;  3CCE F;  5HY0 A;  1GO1 A;  2QEX F;  3J7A R;  3G71 F;  4EI9 A;  3NMU C;  3VMF B;  4LCK A;  3PLA C;  5DCV A;  4BVQ A;  2VGM A;  3CCV F;  1H7M A;  5GIO C;  1CN7 A;  2AIF A;  2OTL F;  5HY2 A;  2HVY D;  2QI2 A;  3D00 A;  5G4U C;  1VQ8 F;  5EWR A;  1GZ0 A;  1KD1 H;  3FFM A;  1VQP F;  3WXM B;  3SIU A;  3CCS F;  5HXU A;  3LWQ C;  1QVF F;  2LBX A;  3G6E F;  3MCA B;  2F9Z C;  4BY9 D;  3ON1 A;  1Q7Y H;  2CZW A;  3JCM M;  3CXC F;  1YJW F;  3E20 B;  1Q81 H;  1RA4 A;  1VQ6 F;  1ZWZ A;  1VQM F;  1X7O A;  3V7E A;  4EI8 A;  2I6D A;  3CC4 F;  1YIJ F;  2BO1 A;  3J81 M;  4BW0 B;  1NJI H;  3CME F;  1VQK F;  3J80 M;  2QA4 F;  2FGY A;  2LBW A;  1DT9 A;  2KTU A;  3HJW C;  4NUT A;  3CMA F;  1Q82 H;  3OBY A;  1M1K H;  1RLG A;  3LWV C;  3NK6 A;  2OTJ F;  3V7Q A;  1VQ4 F;  3NVI B;  1KC8 H;  1YHQ F;  3CCJ F;  1IPA A;  2GLZ A;  3RA6 A;  4BVR A;  5GAN K;  3OW2 F;  1W40 A;  3CD6 F;  3IR9 A;  3CCU F;  1Q86 H;  1XBI A;  2FC3 A;  2KTV A;  1K8A H;  4TZZ A;  3CC2 F;  3LWP C;  2JNB A;  2OHW A;  5FLX M;  1GO0 A;  5GIN C;  1W2B F;  3RA5 A;  1E7K A;  3NK7 A;  5GAP K;  1K73 H;  1VQ7 F;  5HY1 A;  4NQ3 A;  1X52 A;  1T0K B;  3CG6 A;  3O85 A;  1S72 F;  3LWO C;  4BVT A;  1W42 A;  4XCQ A;  2VGN A;  1VQO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...