3FBAA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
b'LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Escherichia coli
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3fbaA00
1IV4A 1GX1A 1W57A 3QHDA 2GZLA 1U3LA 3IEQA 3Q8HA 4C8EA 1U3PA 3GHZA 3F0GA 2PMPA 3IKEA 1W55A 3F6MA 1H48A 1JN1A 3IKFA 3P10A 2UZHA 1JY8A 3B6NA 3RE3A 1H47A 3F0EA 2AMTA 3FBAA 1KNKA 1U40A 1U43A 3JVHA 1IV1A 3P0ZA 3KE1A 1T0AA 4C8IA 3F0DA 4C82A 3ESJA 3EORA 3K2XA 4C81A 1KNJA 1IV3A 4C8GA 1VH8A 3ERNA 3MBMA 5B8FA 3FPIA 1VHAA 3F0FA 3IEWA 3T80A 1YQNA 3K14A 1IV2A 3ELCA
chains in the Genus database with same CATH superfamily
2ZF8A 1KC8H 5JQGB 1VQMF 1W57A 1W5EA 3GHZA 3OBYA 4NUTA 4O4JA 3CC7F 1JFFA 1H48A 4YJ2B 2QEXF 1PXWA 3S06A 2ZVZA 2KTVA 3JASA 1VQLF 5IJ9B 1CN7A 1J7HA 3V4DA 3P4EA 5G4VC 3ZP7A 3HKBA 3TD4A 3G4SF 4I55B 3E1YA 2ALEA 4O4IB 5ITZB 1PF5A 5KX5A 1VH8A 2OTMA 3TD5A 3PLAC 3ELCA 1H7MA 3I56F 4LNUA 2PMPA 2ZAUA 5CB4B 1SA0A 1YJ9F 4TV9B 4C8IA 3UT5B 5FLXM 2ZVYA 3JASB 5LP6C 3WGJA 1VQ8F 2AIZP 3FD5A 3WGMA 5EIBC 1Q7YH 3WXMB 4X20B 3HKCA 2VGMA 1YI2F 1Z5WA 2R6R1 2LBTA 5FJ4C 3IMPA 1K73H 2RHJA 4EI8A 4BVTA 5HXZA 5JH7B 5IYZA 2Z1UA 5A2QM 3B6NA 5GAPK 4BT4A 2AMTA 5HP7A 3I55F 2WALA 5CA1A 3V3TA 4G4YA 2LCAA 1IPAA 1DT9A 2JNBA 4X1YA 1M90H 2Z1FA 3G71F 4ZHVA 1Q81H 4R40B 3MBMA 3N2GA 1VQ4F 4B46A 3OONA 3CB2A 3RYCA 4ZHWA 5KMGA 5LOVA 1JJ2F 3C9SA 5EB1B 4G4ZA 1W5AA 5G4UC 3VYTC 1NMUB 2DYYA 3IKFA 1ODEA 4BT6A 1NQ3A 2HS0A 3HTNA 3V7EA 3N2KA 5JVDB 2B33A 3CCSF 1TVKA 3LWVC 3JVHA 3VOAA 4O4IA 3WGKA 3JAMM 3M4SA 1VQNF 4B45A 1M1KH 2LBXA 1VQ5F 3JAWA 1KNJA 5IJ9A 3RYIB 4C8GA 3JALB 4O2BA 3JCMM 2I6RA 2NMUA 4YJ2A 2F9ZC 4YJ3A 1YQNA 5J2TA 4G4VA 4U39A 3NMUC 3F6MA 5IJ0B 2KG4A 4X3LA 4M8IA 1U40A 1U43A 4TV8A 1T0AA 3ON1A 2K1SA 3FD6A 4NQ3A 2CVLA 3QUWA 2OTLF 4PWTA 2RB9A 5GIPC 4F6RA 4WBNB 5EIBD 3BYQA 1RQ7A 2I6DA 4ERHA 1QVGF 3T80A 3VCZA 4C4WC 1JFFB 3E20B 1ZWZA 3NK7A 2GZLA 3CCVF 1QU9A 1U3PA 1VQ6F 2BTOA 3CD6F 1JN1A 4BVRA 1JY8A 4I55A 4X1KB 5LP6B 3LYBA 5JCOC 5HY2A 5GIOC 4FFBA 4BW0B 3VOBA 5LXTB 1FSZA 3ZP4A 3JATB 2PHNA 1W5FA 3ESJA 4I4TA 5J2UB 2H8EA 1YITF 3S0HA 3CCRF 2RHHA 5EYPA 5LXTA 4BT5A 4X1IA 4ZOLB 1TUBA 1XBIA 1XHOA 2CW4A 3GYQA 4ZK7A 1SDSA 1W3EX 4DXDA 2G9IA 2UYJA 3GTZA 4HNAA 1W40A 2UYKA 1K8AH 5HP8A 3RE3A 4B5CA 3F0EA 5JCOA 3S0WA 1YGYA 4O4HB 4U3JB 2R751 2Q1XA 2HX0A 4O2AB 4DRXB 3CCMF 1SZQA 2OHWA 3WPWA 3EORA 4B62A 4EI7A 1DBFA 1CLIA 1IV3A 3RA6A 2CWJA 2W8BC 1VQKF 3CCQF 2N48A 3FPIA 3HKDB 2OTJF 2UYNA 1QVFF 3S02A 3LFOA 2GVIA 3N2GB 3VYUC 3F0GA 3CMAF 3NVKE 3C9TA 2HQSC 1E7KA 3RYHB 2AIFA 4DRXA 3HAXD 5C8YB 5LYJB 3LDTA 5CA1B 4ZHQA 4I50B 3AGKA 4O4LA 1VQOF 5EZYB 4TV9A 4X1KA 5LP6A 3HKEB 3CYQA 1RQ2A 1VHAA 3VTIC 3HJWC 3CC4F 4BT2A 4BT7A 4O4JB 1UFYA 1GX1A 2BTUA 3QHDA 3MCAB 3CCLF 2UYPA 3VO8A 2HRUA 2VGNA 3ZO8A 2BTQB 3JAKA 1KNKA 5KX5B 2RHOA 4I50A 1SA0B 3VIUA 1FFXA 3QTYA 3I3FA 4LNUB 5B8FA 3CCEF 3E22B 3CC2F 1X7PA 5FNVA 5IJ0A 5LA6B 3SIUA 3C9UA 3CPWF 3CCUF 1GO1A 1OAPA 4EI9A 5MN6A 4LCKA 1XRGA 1RLGA 3P10A 2FGYA 3HWUA 1VQ7F 2VAMA 3HKBB 2FC3A 3P0ZA 2CZWA 5EZYA 3JAWB 4X20A 1KQSF 2LBWA 3JAKB 3WJPA 2HP0B 1VQ9F 1RLUA 1Q8RA 3C8LA 3DC2A 4BT3A 2CSLA 3JATA 3D54A 3OW2F 3OBWA 2IAFA 3LMEA 1VQPF 3J7AR 3LWOC 4BVQA 3JARA 1IV4A 4YJ3B 2RHLA 4C8EA 3NVIB 2HS4A 3JALA 3ZOPA 3MQWA 5BMVA 3IKEA 3KJKA 2QI2A 3IR9A 4IIJB 1W41A 4RHAA 2UZHA 5EB0A 3CMEF 5GANK 1JD1A 2H8CA 3CCJF 1IV1A 5J2UA 4X1YB 4ZHYB 1RA4A 2IQQA 1TVKB 4G88A 4G4WA 3N2KB 5ITZA 3KHNA 2OZBA 5HY4A 2P6YA 1ONIA 1W581 1K9MH 1KD1H 2CHSA 1R1MA 4ZI7A 4EB6A 2GLZA 5EWRA 3JARB 1W55A 4BY9D 3NK6A 4X1IB 4ZOLA 3J81M 3VMFB 2Z1EA 3S0YA 4WBNA 1FFXB 3M84A 1Q86H 3F0DA 5EAZA 4E6EA 4O2BB 4C82A 1COMA 5GINC 4TZZA 1GZ0A 1XV2A 3WJRA 1X7OA 5IYZB 2VAPA 1IV2A 1Z5VA 2BO1A 2Q1YA 5JVDA 5DCVA 5JQGA 3RYFB 5J2TB 1T0KB 3K12A 1H47A 5LOVB 1S72F 1Q82H 2VXYA 3KE1A 3WPXA 4F6RB 2HS3A 2L26A 3VYSC 5CB4A 2VAWA 2V9YA 5LYJA 3WGNA 1CK2A 4BVSA 1YHQF 3RA5A 2HP3A 3K0TA 3DDNA 3C9RA 2EWCA 3F0FA 3N4YA 4G4XA 4O2AA 5GONB 5CA0B 1W2BF 3RYFA 4IHJB 3E22A 4TUYA 3N4ZA 1U3LA 5GONA 1W5BA 2Z01A 4EB6B 2ZODA 3RYCB 4X3MA 5JH7A 3CXCF 1UI9A 3S03A 3D00A 2KGWA 5HXUA 4XCQA 1YJNF 3M1XA 1YJWF 3D01A 3RYIA 5HWEA 1QAHA 2H6LA 1X25A 4TV8B 3U0OA 5MN5A 4RQOA 5EYPB 3LWQC 1OFUA 2HRYA 1W42A 3L7QA 4O4HA 4U3JA 5C8YA 3R0PA 3CYPB 3ERNA 3MDOA 3UT5A 5EO3A 4IIJA 3TD3A 3K14A 3VI6A 3WJQA 3G6EF 1NJIH 3FFMA 3IEQA 3LWPC 1VQVA 2MQEA 5KMGB 1W59A 4ZI7B 2YXZA 2UYNB 3HKCB 3J80M 5IT9M 4TUYB 4O4LB 4IHJA 3FBAA 3WGLA 5LA6A 2KTUA 2HP0A 3O85A 3I7TA 3RYHA 3KIZA 2QA4F 4FFBB 5AVMA 3SIVA 3K2XA 4C81A 1FNKA 1VK3A 2IG8A 1FNJA 3V7QA 3IEWA 3MCQA 5BMVB 3HKDA 3Q8HA 3CPQA 1YIJF 2QTPA 2CHTA 2Z1TA 5FNVB 2ZOVA 5CA0A 1TUBB 1X52A 4KWEA 4I4TB 3LWRC 2DT4A 3HKEA 3CG6A 2YYEA 1QD9A 3PAFA 1GO0A 5MN4A 5HY1A 4ZHQB 2HVYD 4HNAB 5HY0A 3KJJA 4NWOB 1N8RH
chains in the Genus database with same CATH topology
1IV4A 1GX1A 1W57A 3QHDA 2GZLA 1U3LA 3IEQA 3Q8HA 4C8EA 1U3PA 3GHZA 3F0GA 2PMPA 3IKEA 1W55A 3F6MA 1H48A 1JN1A 3IKFA 3P10A 2UZHA 1JY8A 3B6NA 3RE3A 1H47A 3F0EA 2AMTA 3FBAA 1KNKA 1U40A 1U43A 3JVHA 1IV1A 3P0ZA 3KE1A 1T0AA 4C8IA 3F0DA 4C82A 3ESJA 3EORA 3K2XA 4C81A 1KNJA 1IV3A 4C8GA 1VH8A 3ERNA 3MBMA 5B8FA 3FPIA 1VHAA 3F0FA 3IEWA 3T80A 1YQNA 3K14A 1IV2A 3ELCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV4 A;  1GX1 A;  1W57 A;  3QHD A;  2GZL A;  1U3L A;  3IEQ A;  3Q8H A;  4C8E A;  1U3P A;  3GHZ A;  3F0G A;  2PMP A;  3IKE A;  1W55 A;  3F6M A;  1H48 A;  1JN1 A;  3IKF A;  3P10 A;  2UZH A;  1JY8 A;  3B6N A;  3RE3 A;  1H47 A;  3F0E A;  2AMT A;  3FBA A;  1KNK A;  1U40 A;  1U43 A;  3JVH A;  1IV1 A;  3P0Z A;  3KE1 A;  1T0A A;  4C8I A;  3F0D A;  4C82 A;  3ESJ A;  3EOR A;  3K2X A;  4C81 A;  1KNJ A;  1IV3 A;  4C8G A;  1VH8 A;  3ERN A;  3MBM A;  5B8F A;  3FPI A;  1VHA A;  3F0F A;  3IEW A;  3T80 A;  1YQN A;  3K14 A;  1IV2 A;  3ELC A; 
#chains in the Genus database with same CATH topology
 2ZF8 A;  1KC8 H;  5JQG B;  1VQM F;  1W57 A;  1W5E A;  3GHZ A;  3OBY A;  4NUT A;  4O4J A;  3CC7 F;  1JFF A;  1H48 A;  4YJ2 B;  2QEX F;  1PXW A;  3S06 A;  2ZVZ A;  2KTV A;  3JAS A;  1VQL F;  5IJ9 B;  1CN7 A;  1J7H A;  3V4D A;  3P4E A;  5G4V C;  3ZP7 A;  3HKB A;  3TD4 A;  3G4S F;  4I55 B;  3E1Y A;  2ALE A;  4O4I B;  5ITZ B;  1PF5 A;  5KX5 A;  1VH8 A;  2OTM A;  3TD5 A;  3PLA C;  3ELC A;  1H7M A;  3I56 F;  4LNU A;  2PMP A;  2ZAU A;  5CB4 B;  1SA0 A;  1YJ9 F;  4TV9 B;  4C8I A;  3UT5 B;  5FLX M;  2ZVY A;  3JAS B;  5LP6 C;  3WGJ A;  1VQ8 F;  2AIZ P;  3FD5 A;  3WGM A;  5EIB C;  1Q7Y H;  3WXM B;  4X20 B;  3HKC A;  2VGM A;  1YI2 F;  1Z5W A;  2R6R 1;  2LBT A;  5FJ4 C;  3IMP A;  1K73 H;  2RHJ A;  4EI8 A;  4BVT A;  5HXZ A;  5JH7 B;  5IYZ A;  2Z1U A;  5A2Q M;  3B6N A;  5GAP K;  4BT4 A;  2AMT A;  5HP7 A;  3I55 F;  2WAL A;  5CA1 A;  3V3T A;  4G4Y A;  2LCA A;  1IPA A;  1DT9 A;  2JNB A;  4X1Y A;  1M90 H;  2Z1F A;  3G71 F;  4ZHV A;  1Q81 H;  4R40 B;  3MBM A;  3N2G A;  1VQ4 F;  4B46 A;  3OON A;  3CB2 A;  3RYC A;  4ZHW A;  5KMG A;  5LOV A;  1JJ2 F;  3C9S A;  5EB1 B;  4G4Z A;  1W5A A;  5G4U C;  3VYT C;  1NMU B;  2DYY A;  3IKF A;  1ODE A;  4BT6 A;  1NQ3 A;  2HS0 A;  3HTN A;  3V7E A;  3N2K A;  5JVD B;  2B33 A;  3CCS F;  1TVK A;  3LWV C;  3JVH A;  3VOA A;  4O4I A;  3WGK A;  3JAM M;  3M4S A;  1VQN F;  4B45 A;  1M1K H;  2LBX A;  1VQ5 F;  3JAW A;  1KNJ A;  5IJ9 A;  3RYI B;  4C8G A;  3JAL B;  4O2B A;  3JCM M;  2I6R A;  2NMU A;  4YJ2 A;  2F9Z C;  4YJ3 A;  1YQN A;  5J2T A;  4G4V A;  4U39 A;  3NMU C;  3F6M A;  5IJ0 B;  2KG4 A;  4X3L A;  4M8I A;  1U40 A;  1U43 A;  4TV8 A;  1T0A A;  3ON1 A;  2K1S A;  3FD6 A;  4NQ3 A;  2CVL A;  3QUW A;  2OTL F;  4PWT A;  2RB9 A;  5GIP C;  4F6R A;  4WBN B;  5EIB D;  3BYQ A;  1RQ7 A;  2I6D A;  4ERH A;  1QVG F;  3T80 A;  3VCZ A;  4C4W C;  1JFF B;  3E20 B;  1ZWZ A;  3NK7 A;  2GZL A;  3CCV F;  1QU9 A;  1U3P A;  1VQ6 F;  2BTO A;  3CD6 F;  1JN1 A;  4BVR A;  1JY8 A;  4I55 A;  4X1K B;  5LP6 B;  3LYB A;  5JCO C;  5HY2 A;  5GIO C;  4FFB A;  4BW0 B;  3VOB A;  5LXT B;  1FSZ A;  3ZP4 A;  3JAT B;  2PHN A;  1W5F A;  3ESJ A;  4I4T A;  5J2U B;  2H8E A;  1YIT F;  3S0H A;  3CCR F;  2RHH A;  5EYP A;  5LXT A;  4BT5 A;  4X1I A;  4ZOL B;  1TUB A;  1XBI A;  1XHO A;  2CW4 A;  3GYQ A;  4ZK7 A;  1SDS A;  1W3E X;  4DXD A;  2G9I A;  2UYJ A;  3GTZ A;  4HNA A;  1W40 A;  2UYK A;  1K8A H;  5HP8 A;  3RE3 A;  4B5C A;  3F0E A;  5JCO A;  3S0W A;  1YGY A;  4O4H B;  4U3J B;  2R75 1;  2Q1X A;  2HX0 A;  4O2A B;  4DRX B;  3CCM F;  1SZQ A;  2OHW A;  3WPW A;  3EOR A;  4B62 A;  4EI7 A;  1DBF A;  1CLI A;  1IV3 A;  3RA6 A;  2CWJ A;  2W8B C;  1VQK F;  3CCQ F;  2N48 A;  3FPI A;  3HKD B;  2OTJ F;  2UYN A;  1QVF F;  3S02 A;  3LFO A;  2GVI A;  3N2G B;  3VYU C;  3F0G A;  3CMA F;  3NVK E;  3C9T A;  2HQS C;  1E7K A;  3RYH B;  2AIF A;  4DRX A;  3HAX D;  5C8Y B;  5LYJ B;  3LDT A;  5CA1 B;  4ZHQ A;  4I50 B;  3AGK A;  4O4L A;  1VQO F;  5EZY B;  4TV9 A;  4X1K A;  5LP6 A;  3HKE B;  3CYQ A;  1RQ2 A;  1VHA A;  3VTI C;  3HJW C;  3CC4 F;  4BT2 A;  4BT7 A;  4O4J B;  1UFY A;  1GX1 A;  2BTU A;  3QHD A;  3MCA B;  3CCL F;  2UYP A;  3VO8 A;  2HRU A;  2VGN A;  3ZO8 A;  2BTQ B;  3JAK A;  1KNK A;  5KX5 B;  2RHO A;  4I50 A;  1SA0 B;  3VIU A;  1FFX A;  3QTY A;  3I3F A;  4LNU B;  5B8F A;  3CCE F;  3E22 B;  3CC2 F;  1X7P A;  5FNV A;  5IJ0 A;  5LA6 B;  3SIU A;  3C9U A;  3CPW F;  3CCU F;  1GO1 A;  1OAP A;  4EI9 A;  5MN6 A;  4LCK A;  1XRG A;  1RLG A;  3P10 A;  2FGY A;  3HWU A;  1VQ7 F;  2VAM A;  3HKB B;  2FC3 A;  3P0Z A;  2CZW A;  5EZY A;  3JAW B;  4X20 A;  1KQS F;  2LBW A;  3JAK B;  3WJP A;  2HP0 B;  1VQ9 F;  1RLU A;  1Q8R A;  3C8L A;  3DC2 A;  4BT3 A;  2CSL A;  3JAT A;  3D54 A;  3OW2 F;  3OBW A;  2IAF A;  3LME A;  1VQP F;  3J7A R;  3LWO C;  4BVQ A;  3JAR A;  1IV4 A;  4YJ3 B;  2RHL A;  4C8E A;  3NVI B;  2HS4 A;  3JAL A;  3ZOP A;  3MQW A;  5BMV A;  3IKE A;  3KJK A;  2QI2 A;  3IR9 A;  4IIJ B;  1W41 A;  4RHA A;  2UZH A;  5EB0 A;  3CME F;  5GAN K;  1JD1 A;  2H8C A;  3CCJ F;  1IV1 A;  5J2U A;  4X1Y B;  4ZHY B;  1RA4 A;  2IQQ A;  1TVK B;  4G88 A;  4G4W A;  3N2K B;  5ITZ A;  3KHN A;  2OZB A;  5HY4 A;  2P6Y A;  1ONI A;  1W58 1;  1K9M H;  1KD1 H;  2CHS A;  1R1M A;  4ZI7 A;  4EB6 A;  2GLZ A;  5EWR A;  3JAR B;  1W55 A;  4BY9 D;  3NK6 A;  4X1I B;  4ZOL A;  3J81 M;  3VMF B;  2Z1E A;  3S0Y A;  4WBN A;  1FFX B;  3M84 A;  1Q86 H;  3F0D A;  5EAZ A;  4E6E A;  4O2B B;  4C82 A;  1COM A;  5GIN C;  4TZZ A;  1GZ0 A;  1XV2 A;  3WJR A;  1X7O A;  5IYZ B;  2VAP A;  1IV2 A;  1Z5V A;  2BO1 A;  2Q1Y A;  5JVD A;  5DCV A;  5JQG A;  3RYF B;  5J2T B;  1T0K B;  3K12 A;  1H47 A;  5LOV B;  1S72 F;  1Q82 H;  2VXY A;  3KE1 A;  3WPX A;  4F6R B;  2HS3 A;  2L26 A;  3VYS C;  5CB4 A;  2VAW A;  2V9Y A;  5LYJ A;  3WGN A;  1CK2 A;  4BVS A;  1YHQ F;  3RA5 A;  2HP3 A;  3K0T A;  3DDN A;  3C9R A;  2EWC A;  3F0F A;  3N4Y A;  4G4X A;  4O2A A;  5GON B;  5CA0 B;  1W2B F;  3RYF A;  4IHJ B;  3E22 A;  4TUY A;  3N4Z A;  1U3L A;  5GON A;  1W5B A;  2Z01 A;  4EB6 B;  2ZOD A;  3RYC B;  4X3M A;  5JH7 A;  3CXC F;  1UI9 A;  3S03 A;  3D00 A;  2KGW A;  5HXU A;  4XCQ A;  1YJN F;  3M1X A;  1YJW F;  3D01 A;  3RYI A;  5HWE A;  1QAH A;  2H6L A;  1X25 A;  4TV8 B;  3U0O A;  5MN5 A;  4RQO A;  5EYP B;  3LWQ C;  1OFU A;  2HRY A;  1W42 A;  3L7Q A;  4O4H A;  4U3J A;  5C8Y A;  3R0P A;  3CYP B;  3ERN A;  3MDO A;  3UT5 A;  5EO3 A;  4IIJ A;  3TD3 A;  3K14 A;  3VI6 A;  3WJQ A;  3G6E F;  1NJI H;  3FFM A;  3IEQ A;  3LWP C;  1VQV A;  2MQE A;  5KMG B;  1W59 A;  4ZI7 B;  2YXZ A;  2UYN B;  3HKC B;  3J80 M;  5IT9 M;  4TUY B;  4O4L B;  4IHJ A;  3FBA A;  3WGL A;  5LA6 A;  2KTU A;  2HP0 A;  3O85 A;  3I7T A;  3RYH A;  3KIZ A;  2QA4 F;  4FFB B;  5AVM A;  3SIV A;  3K2X A;  4C81 A;  1FNK A;  1VK3 A;  2IG8 A;  1FNJ A;  3V7Q A;  3IEW A;  3MCQ A;  5BMV B;  3HKD A;  3Q8H A;  3CPQ A;  1YIJ F;  2QTP A;  2CHT A;  2Z1T A;  5FNV B;  2ZOV A;  5CA0 A;  1TUB B;  1X52 A;  4KWE A;  4I4T B;  3LWR C;  2DT4 A;  3HKE A;  3CG6 A;  2YYE A;  1QD9 A;  3PAF A;  1GO0 A;  5MN4 A;  5HY1 A;  4ZHQ B;  2HVY D;  4HNA B;  5HY0 A;  3KJJ A;  4NWO B;  1N8R H; 
#chains in the Genus database with same CATH homology
 1IV4 A;  1GX1 A;  1W57 A;  3QHD A;  2GZL A;  1U3L A;  3IEQ A;  3Q8H A;  4C8E A;  1U3P A;  3GHZ A;  3F0G A;  2PMP A;  3IKE A;  1W55 A;  3F6M A;  1H48 A;  1JN1 A;  3IKF A;  3P10 A;  2UZH A;  1JY8 A;  3B6N A;  3RE3 A;  1H47 A;  3F0E A;  2AMT A;  3FBA A;  1KNK A;  1U40 A;  1U43 A;  3JVH A;  1IV1 A;  3P0Z A;  3KE1 A;  1T0A A;  4C8I A;  3F0D A;  4C82 A;  3ESJ A;  3EOR A;  3K2X A;  4C81 A;  1KNJ A;  1IV3 A;  4C8G A;  1VH8 A;  3ERN A;  3MBM A;  5B8F A;  3FPI A;  1VHA A;  3F0F A;  3IEW A;  3T80 A;  1YQN A;  3K14 A;  1IV2 A;  3ELC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...