3FBAA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3fbaA00
1KNJA 3IEQA 5B8FA 1U40A 3JVHA 1JN1A 1YQNA 3IKEA 1U3PA 3P10A 3ESJA 3K14A 4C82A 1VH8A 3ELCA 1U3LA 1H47A 1W55A 2PMPA 3F0EA 1H48A 3KE1A 4C81A 3FPIA 3B6NA 3EORA 3F0DA 3T80A 3F0GA 3P0ZA 3IEWA 1U43A 3K2XA 4C8IA 4C8EA 3QHDA 1GX1A 3F6MA 3FBAA 1IV1A 4C8GA 3RE3A 1W57A 3ERNA 2UZHA 1T0AA 1IV2A 1JY8A 1KNKA 3GHZA 3IKFA 3MBMA 2GZLA 1IV3A 1VHAA 2AMTA 1IV4A 3Q8HA 3F0FA
chains in the Genus database with same CATH superfamily
1KNJA 1JFFB 2CWJA 2OHWA 4KWEA 2H6LA 1YQNA 3TD3A 4IHJA 4YJ3A 3RYHA 1W55A 4X3MA 2H8CA 1RQ7A 4IHJB 4YJ3B 2ZVYA 3RYHB 5J2UA 4C8IA 3J7AR 4BY9D 1M90H 2Z1FA 3VIUA 5J2UB 3WGJA 4ZHWA 1KD1H 1W2BF 1QAHA 2Z01A 3WJPA 3VYTC 5HY0A 1T0AA 1JY8A 2ALEA 3CC2F 2GLZA 2CVLA 3JVHA 3HWUA 4RHAA 2HP0A 5ITZA 1TUBA 1FNJA 2KG4A 3NK6A 2HP0B 1VQPF 3CCEF 4RQOA 5JCOC 5ITZB 1OFUA 1Z5VA 3QHDA 1TUBB 2H8EA 2HRUA 3M1XA 5EAZA 1QVGF 3VCZA 1VQ4F 3SIUA 1IV1A 3LWQC 1JJ2F 2R6R1 1FNKA 2IG8A 3ERNA 2HQSC 3IR9A 5LA6A 2Z1EA 5MN5A 2Q1XA 2UYPA 4B45A 1RLUA 1XRGA 3ZP7A 5CA1A 3GHZA 3CCLF 4BT2A 3KE1A 5LA6B 5CA1B 3JATA 4O2AA 5LP6A 3S06A 3JATB 5HP8A 3HKDA 4LCKA 4O2AB 5LP6B 4TZZA 3HKDB 3VO8A 4G4VA 5IJ0A 4EI9A 2W8BC 1RQ2A 4FFBA 1IPAA 1X52A 4C8GA 5IJ0B 5J2TA 5JVDA 3KJKA 4FFBB 3VOAA 4BVTA 1NQ3A 5JVDB 5J2TB 4BT6A 4O4JA 4R40B 1CN7A 3WGNA 3HKBA 5AVMA 3KJJA 3G6EF 3AGKA 1W581 1H47A 4G4YA 4DXDA 3HKBB 1VQ8F 2ZOVA 2QEXF 3M4SA 3FD6A 1W3EX 3CCMF 1M1KH 5EYPA 2RHHA 3JAWA 2KGWA 1JD1A 4X3LA 5DCVA 3LFOA 3RA6A 1KQSF 5EYPB 3JAWB 3JASA 3IKFA 1VHAA 2LBTA 2WALA 1J7HA 5HY4A 3ON1A 3JASB 2HS3A 3QTYA 2LBXA 1NMUB 2UYKA 1SDSA 3ESJA 4ZHQA 4O4HA 3ELCA 3F0EA 3S02A 3HAXD 3J81M 1H48A 3CXCF 2ZVZA 4ZHQB 4O4HB 2QI2A 3L7QA 4X20A 1W40A 5KMGA 3WXMB 3VYSC 3BYQA 4EB6A 1VK3A 3RYFA 4X20B 3WPWA 1YGYA 5KMGB 3J80M 3CCSF 1VQOF 5GANK 4EB6B 3CC7F 5EIBC 3RYFB 2VAMA 5EWRA 1Q8RA 3D54A 3S0YA 2KTUA 2R751 5IT9M 3MBMA 1IV3A 2AMTA 1VQMF 1ONIA 2VAPA 2CW4A 3RYIA 5FJ4C 2F9ZC 3V3TA 1XV2A 2HS4A 4ZK7A 3I55F 3RYIB 4PWTA 2JNBA 2N48A 3NMUC 1PF5A 3VMFB 1ZWZA 4B62A 2EWCA 2ZODA 3SIVA 2Z1TA 3I3FA 3S03A 2BO1A 4F6RA 3NVIB 2QTPA 3GYQA 1RA4A 3CCQF 3N2GA 3F6MA 4LNUA 3MCQA 4I55A 3VTIC 4F6RB 5BMVA 3CC4F 3N4ZA 3N2GB 4LNUB 5HP7A 4ZOLA 5BMVB 3C8LA 3C9SA 1YI2F 4ZOLB 3WPXA 5A2QM 2GVIA 5FNVA 4ZI7A 2UYNA 3CG6A 1JN1A 3JCMM 1XBIA 4I50A 5FNVB 1DT9A 2CHSA 2VXYA 2RHOA 2UYNB 4ZI7B 1QU9A 2I6RA 5CB4A 1XHOA 4I50B 1K73H 1DBFA 1QD9A 3LMEA 4BT7A 3CCUF 3S0HA 2IQQA 5CB4B 3R0PA 1YJ9F 3FFMA 5MN4A 3FBAA 4IIJA 1CK2A 3C9RA 5GINC 4IIJB 1Z5WA 5GIOC 3VYUC 1W41A 3FD5A 5FLXM 4NUTA 2CSLA 3CCVF 1KC8H 5KX5A 4BT4A 3IKEA 3P10A 5KX5B 3CYPB 2I6DA 4EI7A 5HXUA 3EORA 3O85A 4ZHVA 1Q86H 3TD5A 4C8EA 3ZOPA 3OW2F 2LCAA 1FFXA 4O4LA 3VOBA 1TVKA 1K8AH 1UFYA 3D00A 3N2KA 1FFXB 4O4LB 3CYQA 3WGLA 3RYCA 4X1YA 2VGNA 1TVKB 2GZLA 3U0OA 5EZYA 3N2KB 2V9YA 4M8IA 3RYCB 4X1YB 3JALA 5EZYB 4YJ2A 1W59A 4O4JB 3HJWC 3JAMM 2AIZP 1YJNF 1Q7YH 2YXZA 2PMPA 3JALB 4YJ2B 3F0DA 3LWOC 1Q82H 1U43A 3MDOA 5IJ9A 3NVKE 2B33A 5LOVA 5IJ9B 1VQNF 5JCOA 2ZF8A 3WJQA 2MQEA 1KNKA 5LOVB 3D01A 4TV8A 4X1IA 2Q1YA 5C8YA 1SZQA 3OONA 4BVQA 4BVSA 4TV8B 4X1IB 4C82A 5C8YB 2NMUA 4C81A 3LDTA 1VQKF 2HX0A 2RHJA 1YHQF 2ZAUA 1S72F 1CLIA 2CZWA 1GX1A 3N4YA 1VQ7F 3OBYA 3G71F 3CMEF 5EO3A 1X25A 2L26A 1Q81H 3K0TA 5JQGA 5HWEA 1H7MA 3LWVC 3MQWA 4I4TA 2OTLF 3M84A 5JQGB 2YYEA 3IEQA 3NK7A 1YITF 4I4TB 1VQ9F 5LXTA 3P4EA 1QVFF 2RB9A 1X7PA 5LXTB 2BTQB 5HXZA 3RA5A 2OTJF 1W42A 2OTMA 3QUWA 4BVRA 5HY2A 4TUYA 1W57A 4E6EA 5GIPC 2G9IA 5LP6C 4BW0B 4I55B 3ZO8A 4TUYB 4O4IA 1X7OA 2CHTA 2PHNA 3V7QA 3DDNA 4B5CA 5B8FA 1VQLF 3V7EA 4O4IB 3WGKA 4U3JA 2KTVA 1U3PA 1K9MH 3JARA 4BT3A 1VQVA 3IMPA 4U3JB 3CD6F 2HRYA 2RHLA 3P0ZA 3JARB 2DYYA 1SA0A 2HS0A 2VAWA 3E20B 1GO1A 2K1SA 1SA0B 3OBWA 3TD4A 1R1MA 4EI8A 3CCRF 5LYJA 4XCQA 1PXWA 1U40A 5LYJB 3ZP4A 3KHNA 4U39A 3CPQA 4WBNA 1N8RH 1GO0A 1YIJF 2BTOA 3T80A 4WBNB 4NQ3A 4C4WC 3IEWA 4G4XA 4O2BA 5GAPK 4HNAA 3WGMA 4G4ZA 1NJIH 3UT5A 4O2BB 5G4VC 1UI9A 4HNAB 5G4UC 3HKCA 3UT5B 2QA4F 2OZBA 3I7TA 3HKCB 3JAKA 5JH7A 4X1KA 3KIZA 1COMA 2FGYA 3HTNA 3K14A 1VH8A 3HKEA 3JAKB 5JH7B 4G88A 3PLAC 2Z1UA 4X1KB 1ODEA 3HKEB 1RLGA 5IYZA 5MN6A 3K2XA 1OAPA 2HVYD 3C9UA 5IYZB 3K12A 5GONA 3LYBA 3GTZA 3RE3A 3PAFA 4BT5A 2UZHA 2HP3A 4B46A 5GONB 2FC3A 3MCAB 1W5EA 5HY1A 1VQ6F 5EIBD 1IV4A 1W5FA 2IAFA 3F0FA 1YJWF 4ERHA 2AIFA 4NWOB 1T0KB 1W5BA 3E22A 3FPIA 2P6YA 2LBWA 3CCJF 3DC2A 3E22B 3VI6A 3LWPC 4TV9A 1VQ5F 4G4WA 3I56F 1FSZA 3CB2A 5EB0A 3S0WA 4TV9B 4DRXA 1GZ0A 1E7KA 4DRXB 2BTUA 3B6NA 3LWRC 3E1YA 3G4SF 2UYJA 1U3LA 3C9TA 3WJRA 3F0GA 5CA0A 5EB1B 3CMAF 5CA0B 1W5AA 4ZHYB 1IV2A 3V4DA 1JFFA 3CPWF 2VGMA 2DT4A 3Q8HA
chains in the Genus database with same CATH topology
1KNJA 3IEQA 5B8FA 1U40A 3JVHA 1JN1A 1YQNA 3IKEA 1U3PA 3P10A 3ESJA 3K14A 4C82A 1VH8A 3ELCA 1U3LA 1H47A 1W55A 2PMPA 3F0EA 1H48A 3KE1A 4C81A 3FPIA 3B6NA 3EORA 3F0DA 3T80A 3F0GA 3P0ZA 3IEWA 1U43A 3K2XA 4C8IA 4C8EA 3QHDA 1GX1A 3F6MA 3FBAA 1IV1A 4C8GA 3RE3A 1W57A 3ERNA 2UZHA 1T0AA 1IV2A 1JY8A 1KNKA 3GHZA 3IKFA 3MBMA 2GZLA 1IV3A 1VHAA 2AMTA 1IV4A 3Q8HA 3F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNJ A;  3IEQ A;  5B8F A;  1U40 A;  3JVH A;  1JN1 A;  1YQN A;  3IKE A;  1U3P A;  3P10 A;  3ESJ A;  3K14 A;  4C82 A;  1VH8 A;  3ELC A;  1U3L A;  1H47 A;  1W55 A;  2PMP A;  3F0E A;  1H48 A;  3KE1 A;  4C81 A;  3FPI A;  3B6N A;  3EOR A;  3F0D A;  3T80 A;  3F0G A;  3P0Z A;  3IEW A;  1U43 A;  3K2X A;  4C8I A;  4C8E A;  3QHD A;  1GX1 A;  3F6M A;  3FBA A;  1IV1 A;  4C8G A;  3RE3 A;  1W57 A;  3ERN A;  2UZH A;  1T0A A;  1IV2 A;  1JY8 A;  1KNK A;  3GHZ A;  3IKF A;  3MBM A;  2GZL A;  1IV3 A;  1VHA A;  2AMT A;  1IV4 A;  3Q8H A;  3F0F A; 
#chains in the Genus database with same CATH topology
 1KNJ A;  1JFF B;  2CWJ A;  2OHW A;  4KWE A;  2H6L A;  1YQN A;  3TD3 A;  4IHJ A;  4YJ3 A;  3RYH A;  1W55 A;  4X3M A;  2H8C A;  1RQ7 A;  4IHJ B;  4YJ3 B;  2ZVY A;  3RYH B;  5J2U A;  4C8I A;  3J7A R;  4BY9 D;  1M90 H;  2Z1F A;  3VIU A;  5J2U B;  3WGJ A;  4ZHW A;  1KD1 H;  1W2B F;  1QAH A;  2Z01 A;  3WJP A;  3VYT C;  5HY0 A;  1T0A A;  1JY8 A;  2ALE A;  3CC2 F;  2GLZ A;  2CVL A;  3JVH A;  3HWU A;  4RHA A;  2HP0 A;  5ITZ A;  1TUB A;  1FNJ A;  2KG4 A;  3NK6 A;  2HP0 B;  1VQP F;  3CCE F;  4RQO A;  5JCO C;  5ITZ B;  1OFU A;  1Z5V A;  3QHD A;  1TUB B;  2H8E A;  2HRU A;  3M1X A;  5EAZ A;  1QVG F;  3VCZ A;  1VQ4 F;  3SIU A;  1IV1 A;  3LWQ C;  1JJ2 F;  2R6R 1;  1FNK A;  2IG8 A;  3ERN A;  2HQS C;  3IR9 A;  5LA6 A;  2Z1E A;  5MN5 A;  2Q1X A;  2UYP A;  4B45 A;  1RLU A;  1XRG A;  3ZP7 A;  5CA1 A;  3GHZ A;  3CCL F;  4BT2 A;  3KE1 A;  5LA6 B;  5CA1 B;  3JAT A;  4O2A A;  5LP6 A;  3S06 A;  3JAT B;  5HP8 A;  3HKD A;  4LCK A;  4O2A B;  5LP6 B;  4TZZ A;  3HKD B;  3VO8 A;  4G4V A;  5IJ0 A;  4EI9 A;  2W8B C;  1RQ2 A;  4FFB A;  1IPA A;  1X52 A;  4C8G A;  5IJ0 B;  5J2T A;  5JVD A;  3KJK A;  4FFB B;  3VOA A;  4BVT A;  1NQ3 A;  5JVD B;  5J2T B;  4BT6 A;  4O4J A;  4R40 B;  1CN7 A;  3WGN A;  3HKB A;  5AVM A;  3KJJ A;  3G6E F;  3AGK A;  1W58 1;  1H47 A;  4G4Y A;  4DXD A;  3HKB B;  1VQ8 F;  2ZOV A;  2QEX F;  3M4S A;  3FD6 A;  1W3E X;  3CCM F;  1M1K H;  5EYP A;  2RHH A;  3JAW A;  2KGW A;  1JD1 A;  4X3L A;  5DCV A;  3LFO A;  3RA6 A;  1KQS F;  5EYP B;  3JAW B;  3JAS A;  3IKF A;  1VHA A;  2LBT A;  2WAL A;  1J7H A;  5HY4 A;  3ON1 A;  3JAS B;  2HS3 A;  3QTY A;  2LBX A;  1NMU B;  2UYK A;  1SDS A;  3ESJ A;  4ZHQ A;  4O4H A;  3ELC A;  3F0E A;  3S02 A;  3HAX D;  3J81 M;  1H48 A;  3CXC F;  2ZVZ A;  4ZHQ B;  4O4H B;  2QI2 A;  3L7Q A;  4X20 A;  1W40 A;  5KMG A;  3WXM B;  3VYS C;  3BYQ A;  4EB6 A;  1VK3 A;  3RYF A;  4X20 B;  3WPW A;  1YGY A;  5KMG B;  3J80 M;  3CCS F;  1VQO F;  5GAN K;  4EB6 B;  3CC7 F;  5EIB C;  3RYF B;  2VAM A;  5EWR A;  1Q8R A;  3D54 A;  3S0Y A;  2KTU A;  2R75 1;  5IT9 M;  3MBM A;  1IV3 A;  2AMT A;  1VQM F;  1ONI A;  2VAP A;  2CW4 A;  3RYI A;  5FJ4 C;  2F9Z C;  3V3T A;  1XV2 A;  2HS4 A;  4ZK7 A;  3I55 F;  3RYI B;  4PWT A;  2JNB A;  2N48 A;  3NMU C;  1PF5 A;  3VMF B;  1ZWZ A;  4B62 A;  2EWC A;  2ZOD A;  3SIV A;  2Z1T A;  3I3F A;  3S03 A;  2BO1 A;  4F6R A;  3NVI B;  2QTP A;  3GYQ A;  1RA4 A;  3CCQ F;  3N2G A;  3F6M A;  4LNU A;  3MCQ A;  4I55 A;  3VTI C;  4F6R B;  5BMV A;  3CC4 F;  3N4Z A;  3N2G B;  4LNU B;  5HP7 A;  4ZOL A;  5BMV B;  3C8L A;  3C9S A;  1YI2 F;  4ZOL B;  3WPX A;  5A2Q M;  2GVI A;  5FNV A;  4ZI7 A;  2UYN A;  3CG6 A;  1JN1 A;  3JCM M;  1XBI A;  4I50 A;  5FNV B;  1DT9 A;  2CHS A;  2VXY A;  2RHO A;  2UYN B;  4ZI7 B;  1QU9 A;  2I6R A;  5CB4 A;  1XHO A;  4I50 B;  1K73 H;  1DBF A;  1QD9 A;  3LME A;  4BT7 A;  3CCU F;  3S0H A;  2IQQ A;  5CB4 B;  3R0P A;  1YJ9 F;  3FFM A;  5MN4 A;  3FBA A;  4IIJ A;  1CK2 A;  3C9R A;  5GIN C;  4IIJ B;  1Z5W A;  5GIO C;  3VYU C;  1W41 A;  3FD5 A;  5FLX M;  4NUT A;  2CSL A;  3CCV F;  1KC8 H;  5KX5 A;  4BT4 A;  3IKE A;  3P10 A;  5KX5 B;  3CYP B;  2I6D A;  4EI7 A;  5HXU A;  3EOR A;  3O85 A;  4ZHV A;  1Q86 H;  3TD5 A;  4C8E A;  3ZOP A;  3OW2 F;  2LCA A;  1FFX A;  4O4L A;  3VOB A;  1TVK A;  1K8A H;  1UFY A;  3D00 A;  3N2K A;  1FFX B;  4O4L B;  3CYQ A;  3WGL A;  3RYC A;  4X1Y A;  2VGN A;  1TVK B;  2GZL A;  3U0O A;  5EZY A;  3N2K B;  2V9Y A;  4M8I A;  3RYC B;  4X1Y B;  3JAL A;  5EZY B;  4YJ2 A;  1W59 A;  4O4J B;  3HJW C;  3JAM M;  2AIZ P;  1YJN F;  1Q7Y H;  2YXZ A;  2PMP A;  3JAL B;  4YJ2 B;  3F0D A;  3LWO C;  1Q82 H;  1U43 A;  3MDO A;  5IJ9 A;  3NVK E;  2B33 A;  5LOV A;  5IJ9 B;  1VQN F;  5JCO A;  2ZF8 A;  3WJQ A;  2MQE A;  1KNK A;  5LOV B;  3D01 A;  4TV8 A;  4X1I A;  2Q1Y A;  5C8Y A;  1SZQ A;  3OON A;  4BVQ A;  4BVS A;  4TV8 B;  4X1I B;  4C82 A;  5C8Y B;  2NMU A;  4C81 A;  3LDT A;  1VQK F;  2HX0 A;  2RHJ A;  1YHQ F;  2ZAU A;  1S72 F;  1CLI A;  2CZW A;  1GX1 A;  3N4Y A;  1VQ7 F;  3OBY A;  3G71 F;  3CME F;  5EO3 A;  1X25 A;  2L26 A;  1Q81 H;  3K0T A;  5JQG A;  5HWE A;  1H7M A;  3LWV C;  3MQW A;  4I4T A;  2OTL F;  3M84 A;  5JQG B;  2YYE A;  3IEQ A;  3NK7 A;  1YIT F;  4I4T B;  1VQ9 F;  5LXT A;  3P4E A;  1QVF F;  2RB9 A;  1X7P A;  5LXT B;  2BTQ B;  5HXZ A;  3RA5 A;  2OTJ F;  1W42 A;  2OTM A;  3QUW A;  4BVR A;  5HY2 A;  4TUY A;  1W57 A;  4E6E A;  5GIP C;  2G9I A;  5LP6 C;  4BW0 B;  4I55 B;  3ZO8 A;  4TUY B;  4O4I A;  1X7O A;  2CHT A;  2PHN A;  3V7Q A;  3DDN A;  4B5C A;  5B8F A;  1VQL F;  3V7E A;  4O4I B;  3WGK A;  4U3J A;  2KTV A;  1U3P A;  1K9M H;  3JAR A;  4BT3 A;  1VQV A;  3IMP A;  4U3J B;  3CD6 F;  2HRY A;  2RHL A;  3P0Z A;  3JAR B;  2DYY A;  1SA0 A;  2HS0 A;  2VAW A;  3E20 B;  1GO1 A;  2K1S A;  1SA0 B;  3OBW A;  3TD4 A;  1R1M A;  4EI8 A;  3CCR F;  5LYJ A;  4XCQ A;  1PXW A;  1U40 A;  5LYJ B;  3ZP4 A;  3KHN A;  4U39 A;  3CPQ A;  4WBN A;  1N8R H;  1GO0 A;  1YIJ F;  2BTO A;  3T80 A;  4WBN B;  4NQ3 A;  4C4W C;  3IEW A;  4G4X A;  4O2B A;  5GAP K;  4HNA A;  3WGM A;  4G4Z A;  1NJI H;  3UT5 A;  4O2B B;  5G4V C;  1UI9 A;  4HNA B;  5G4U C;  3HKC A;  3UT5 B;  2QA4 F;  2OZB A;  3I7T A;  3HKC B;  3JAK A;  5JH7 A;  4X1K A;  3KIZ A;  1COM A;  2FGY A;  3HTN A;  3K14 A;  1VH8 A;  3HKE A;  3JAK B;  5JH7 B;  4G88 A;  3PLA C;  2Z1U A;  4X1K B;  1ODE A;  3HKE B;  1RLG A;  5IYZ A;  5MN6 A;  3K2X A;  1OAP A;  2HVY D;  3C9U A;  5IYZ B;  3K12 A;  5GON A;  3LYB A;  3GTZ A;  3RE3 A;  3PAF A;  4BT5 A;  2UZH A;  2HP3 A;  4B46 A;  5GON B;  2FC3 A;  3MCA B;  1W5E A;  5HY1 A;  1VQ6 F;  5EIB D;  1IV4 A;  1W5F A;  2IAF A;  3F0F A;  1YJW F;  4ERH A;  2AIF A;  4NWO B;  1T0K B;  1W5B A;  3E22 A;  3FPI A;  2P6Y A;  2LBW A;  3CCJ F;  3DC2 A;  3E22 B;  3VI6 A;  3LWP C;  4TV9 A;  1VQ5 F;  4G4W A;  3I56 F;  1FSZ A;  3CB2 A;  5EB0 A;  3S0W A;  4TV9 B;  4DRX A;  1GZ0 A;  1E7K A;  4DRX B;  2BTU A;  3B6N A;  3LWR C;  3E1Y A;  3G4S F;  2UYJ A;  1U3L A;  3C9T A;  3WJR A;  3F0G A;  5CA0 A;  5EB1 B;  3CMA F;  5CA0 B;  1W5A A;  4ZHY B;  1IV2 A;  3V4D A;  1JFF A;  3CPW F;  2VGM A;  2DT4 A;  3Q8H A; 
#chains in the Genus database with same CATH homology
 1KNJ A;  3IEQ A;  5B8F A;  1U40 A;  3JVH A;  1JN1 A;  1YQN A;  3IKE A;  1U3P A;  3P10 A;  3ESJ A;  3K14 A;  4C82 A;  1VH8 A;  3ELC A;  1U3L A;  1H47 A;  1W55 A;  2PMP A;  3F0E A;  1H48 A;  3KE1 A;  4C81 A;  3FPI A;  3B6N A;  3EOR A;  3F0D A;  3T80 A;  3F0G A;  3P0Z A;  3IEW A;  1U43 A;  3K2X A;  4C8I A;  4C8E A;  3QHD A;  1GX1 A;  3F6M A;  3FBA A;  1IV1 A;  4C8G A;  3RE3 A;  1W57 A;  3ERN A;  2UZH A;  1T0A A;  1IV2 A;  1JY8 A;  1KNK A;  3GHZ A;  3IKF A;  3MBM A;  2GZL A;  1IV3 A;  1VHA A;  2AMT A;  1IV4 A;  3Q8H A;  3F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...