3FBAA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
LEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3fbaA00
4C8GA 1IV2A 1IV4A 3F0EA 3Q8HA 3IKEA 3KE1A 1U3PA 2AMTA 3F0GA 3IEWA 3K2XA 3RE3A 1VH8A 3P10A 1GX1A 4C8EA 4C81A 1IV1A 3ERNA 1W57A 1JN1A 3P0ZA 4C82A 1YQNA 2UZHA 3K14A 3JVHA 2GZLA 3FPIA 4C8IA 3ELCA 1U3LA 3IKFA 1H47A 2PMPA 3MBMA 5B8FA 1KNKA 3EORA 3GHZA 3F6MA 3FBAA 1H48A 1JY8A 3B6NA 3F0DA 1KNJA 3F0FA 3T80A 1U40A 3QHDA 3ESJA 1IV3A 3IEQA 1VHAA 1W55A 1T0AA 1U43A
chains in the Genus database with same CATH superfamily
4ZI7B 3C9SA 1W581 1VQ8F 3SIUA 2Z01A 3S06A 2QEXF 4G4WA 4I55B 4TV9A 2B33A 5LP6C 3OONA 3ZOPA 2UZHA 1RLGA 5GIPC 2LBTA 3FPIA 4EI7A 5C8YB 3RYHA 1Z5WA 5DCVA 2OTMA 1M1KH 5MN6A 1VQPF 1X52A 2KTUA 3SIVA 5GAPK 1W5FA 3WGMA 1W5BA 4HNAB 3D01A 3IEQA 3RYIB 2Z1UA 3M1XA 3PAFA 1W40A 4I50B 1TUBA 3CCJF 4YJ2B 1VQ5F 4EI8A 4HNAA 4X1KB 4X1IB 4BT6A 1FSZA 3MQWA 4B62A 3HKCB 3OBYA 2I6DA 3LFOA 3NVIB 4O4LA 3FD6A 4G4ZA 5JH7A 3HTNA 4NQ3A 2HP3A 5LOVB 1VQMF 5EYPB 2VGNA 4BVRA 5GIOC 2RHOA 3E20B 3JARB 4TUYB 4PWTA 3VOAA 3CCEF 3CCMF 1H48A 2IG8A 1JFFB 5IJ0A 4IIJA 5JVDB 4RQOA 3LWVC 3ZO8A 3IKEA 2QTPA 2VAMA 3JALB 1GX1A 2DT4A 3UT5B 5HY2A 5J2TB 4C4WC 1YIJF 3VO8A 1FFXA 1OFUA 2HS3A 2RHLA 3JAWA 5EZYB 1W5AA 3VYSC 3NVKE 4B46A 3CCUF 3N2GB 3G6EF 1QAHA 1KNKA 4X1YB 1VQVA 1W3EX 1N8RH 2EWCA 4R40B 3T80A 4O4HA 3G4SF 4O2BB 3TD5A 5LXTB 2ZF8A 1YJWF 1VQ7F 1NMUB 1SA0A 2HX0A 2CWJA 3I7TA 2ZVYA 2Q1XA 4DRXA 3N2KB 1H7MA 2F9ZC 2BO1A 1E7KA 2RHJA 2CZWA 3K2XA 3CCLF 3RYCA 2UYNB 3AGKA 3IMPA 1IPAA 4EB6B 5HP7A 3ELCA 1COMA 3C9UA 4U3JA 5LA6B 5KMGB 3MCAB 3EORA 1OAPA 3FD5A 3F0DA 2HP0B 3CG6A 1U40A 1ODEA 1VQ9F 4ZHYB 3V7EA 2ZODA 4EB6A 1X7OA 3LMEA 5FLXM 1VQ6F 1ONIA 5LA6A 5EIBD 3WPWA 4C8EA 2RB9A 1FNJA 3CPQA 2YYEA 1K9MH 3HKBB 1T0KB 3M84A 1YJ9F 3CXCF 1X7PA 5JQGA 4I4TB 4O4JB 5JCOA 3JATA 2K1SA 2ZVZA 4TV8B 1XBIA 4X20A 4ZHQA 3P4EA 1SZQA 3CB2A 5GONB 4I4TA 3K0TA 1GZ0A 2KG4A 3NMUC 1U3PA 4IHJB 5LYJB 3LWQC 2LCAA 5EB0A 1RQ7A 5KX5B 5GONA 2HVYD 3ERNA 1W57A 2R6R1 1YI2F 1JN1A 4ZHWA 4LCKA 3P0ZA 4BT4A 4ZI7A 1FNKA 4IHJA 3VTIC 3RYFB 3C9TA 3WGLA 3B6NA 4I55A 3VI6A 2I6RA 1KD1H 5C8YA 2OZBA 3CC2F 1GO0A 3KHNA 3GYQA 5LP6B 3LWPC 3O85A 3CC4F 1PF5A 1VQLF 5ITZB 2VGMA 3WJPA 3RYIA 4ZOLB 3K14A 4WBNB 4EI9A 5HWEA 2GZLA 4X3MA 4I50A 3MCQA 1QVGF 3VCZA 5HXUA 3F6MA 4YJ2A 3I3FA 3VYUC 4X1IA 4X1KA 5IYZB 1NQ3A 1W41A 3ESJA 3HKCA 4ZOLA 3CYPB 3JAKB 2N48A 4F6RB 2R751 1U43A 1X25A 2JNBA 2VAPA 2OTLF 3F0EA 3J7AR 5LOVA 5EYPA 3CC7F 3P10A 2BTUA 3J80M 2HS4A 2FGYA 3JARA 4TUYA 1XHOA 2MQEA 2UYKA 3I56F 2PHNA 2QA4F 4C82A 5GINC 1JFFA 2IAFA 4RHAA 3HJWC 5HY4A 5JVDA 1RQ2A 2HQSC 2W8BC 1GO1A 3JALA 3I55F 2BTOA 1UI9A 1JY8A 3UT5A 1W2BF 4B5CA 5J2TA 5EZYA 2L26A 4TZZA 1IV3A 3MDOA 1W42A 2V9YA 2AIZP 1YJNF 4O4IB 1CN7A 3JASB 3N2GA 5J2UB 2CVLA 4X1YA 4BW0B 3IEWA 5HY1A 1VH8A 2CHTA 4O2BA 5LXTA 5EWRA 3E1YA 1ZWZA 1YQNA 2Z1FA 3JASA 5IJ9B 2H6LA 3PLAC 3C8LA 4XCQA 3N2KA 3LYBA 4BT2A 1NJIH 1QD9A 2IQQA 4ZHVA 1JD1A 1CLIA 5BMVB 2UYNA 3HWUA 5CB4B 4G4XA 5KMGA 3HKEB 4O2AB 3Q8HA 3TD4A 5G4UC 1UFYA 5CA1B 5CA0B 4X3LA 3RE3A 2HP0A 4B45A 5BMVA 5FNVB 4C81A 1QVFF 3LDTA 5JCOC 1RLUA 1VQNF 3E22B 3VIUA 4G88A 3IKFA 3ON1A 1H47A 2G9IA 3MBMA 2OHWA 2H8CA 1PXWA 3GTZA 4LNUB 4BVTA 3G71F 3F0FA 3RA5A 2ZAUA 3HKBA 3ZP7A 4YJ3B 4BVQA 2RHHA 3S0YA 2YXZA 1XRGA 3KIZA 4O4JA 1K73H 3JAMM 3CCVF 1Z5VA 2Z1EA 1K8AH 4NWOB 2DYYA 4TV8A 3WGNA 3KE1A 3F0GA 1M90H 4YJ3A 3J81M 5HY0A 3OW2F 3CD6F 3C9RA 2UYPA 5AVMA 4ZK7A 1YITF 5FJ4C 4BVSA 3GHZA 3WGKA 5LYJA 3S0WA 3VMFB 1JJ2F 5KX5A 4TV9B 5G4VC 1KQSF 3BYQA 3ZP4A 2NMUA 3V3TA 3RYHB 1VQKF 4M8IA 1DBFA 1SDSA 4BT7A 1Q7YH 3RYFA 5EB1B 3KJKA 1KC8H 3L7QA 1RA4A 3V4DA 1Q82H 3CCQF 1W5EA 2LBXA 4KWEA 3S02A 2WALA 5LP6A 3LWRC 1TUBB 3FBAA 5ITZA 1Q81H 2BTQB 3QTYA 3K12A 4BY9D 4WBNA 1Q8RA 2HRYA 4O4LB 1IV2A 3JCMM 5MN4A 5JH7B 3NK6A 3FFMA 3LWOC 5IYZA 1IV1A 1J7HA 3JAKA 3RA6A 4F6RA 3JVHA 2Z1TA 5IJ0B 1U3LA 3CYQA 4IIJB 2PMPA 2AIFA 3CMEF 1QU9A 4G4VA 1W59A 1KNJA 3CPWF 3D00A 4NUTA 3D54A 3QHDA 5IT9M 2ZOVA 1FFXB 1DT9A 1VHAA 3JAWB 3NK7A 1TVKB 3N4ZA 4BT3A 3S03A 1VQ4F 5EIBC 5HP8A 4FFBB 4O4HB 4DXDA 3QUWA 1TVKA 4O4IA 4C8IA 1SA0B 5J2UA 5B8FA 4DRXB 5GANK 4FFBA 3OBWA 3S0HA 1YHQF 3RYCB 2VXYA 1W55A 1T0AA 1Q86H 5IJ9A 3VOBA 3CCRF 2GVIA 3TD3A 4U3JB 1XV2A 2H8EA 3N4YA 2AMTA 2VAWA 2OTJF 5HXZA 2GLZA 5CB4A 2FC3A 3WJRA 3HKEA 3VYTC 4O2AA 5EO3A 5MN5A 1CK2A 1R1MA 2KGWA 2CW4A 5CA0A 5CA1A 2LBWA 5FNVA 4ERHA 3U0OA 3E22A 3WJQA 1VQOF 3WXMB 3KJJA 5JQGB 2HRUA 2Q1YA 3JATB 4C8GA 1IV4A 4LNUA 4X20B 3WGJA 4ZHQB 5EAZA 4U39A 2CHSA 1YGYA 3M4SA 4BT5A 1VK3A 3DC2A 3HKDB 3V7QA 2CSLA 3HAXD 2P6YA 2ALEA 5A2QM 3IR9A 3WPXA 4G4YA 1S72F 2KTVA 3CMAF 2UYJA 3DDNA 3HKDA 2QI2A 2HS0A 3R0PA 4E6EA 3CCSF
chains in the Genus database with same CATH topology
4C8GA 1IV2A 1IV4A 3F0EA 3Q8HA 3IKEA 3KE1A 1U3PA 2AMTA 3F0GA 3IEWA 3K2XA 3RE3A 1VH8A 3P10A 1GX1A 4C8EA 4C81A 1IV1A 3ERNA 1W57A 1JN1A 3P0ZA 4C82A 1YQNA 2UZHA 3K14A 3JVHA 2GZLA 3FPIA 4C8IA 3ELCA 1U3LA 3IKFA 1H47A 2PMPA 3MBMA 5B8FA 1KNKA 3EORA 3GHZA 3F6MA 3FBAA 1H48A 1JY8A 3B6NA 3F0DA 1KNJA 3F0FA 3T80A 1U40A 3QHDA 3ESJA 1IV3A 3IEQA 1VHAA 1W55A 1T0AA 1U43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8G A;  1IV2 A;  1IV4 A;  3F0E A;  3Q8H A;  3IKE A;  3KE1 A;  1U3P A;  2AMT A;  3F0G A;  3IEW A;  3K2X A;  3RE3 A;  1VH8 A;  3P10 A;  1GX1 A;  4C8E A;  4C81 A;  1IV1 A;  3ERN A;  1W57 A;  1JN1 A;  3P0Z A;  4C82 A;  1YQN A;  2UZH A;  3K14 A;  3JVH A;  2GZL A;  3FPI A;  4C8I A;  3ELC A;  1U3L A;  3IKF A;  1H47 A;  2PMP A;  3MBM A;  5B8F A;  1KNK A;  3EOR A;  3GHZ A;  3F6M A;  3FBA A;  1H48 A;  1JY8 A;  3B6N A;  3F0D A;  1KNJ A;  3F0F A;  3T80 A;  1U40 A;  3QHD A;  3ESJ A;  1IV3 A;  3IEQ A;  1VHA A;  1W55 A;  1T0A A;  1U43 A; 
#chains in the Genus database with same CATH topology
 4ZI7 B;  3C9S A;  1W58 1;  1VQ8 F;  3SIU A;  2Z01 A;  3S06 A;  2QEX F;  4G4W A;  4I55 B;  4TV9 A;  2B33 A;  5LP6 C;  3OON A;  3ZOP A;  2UZH A;  1RLG A;  5GIP C;  2LBT A;  3FPI A;  4EI7 A;  5C8Y B;  3RYH A;  1Z5W A;  5DCV A;  2OTM A;  1M1K H;  5MN6 A;  1VQP F;  1X52 A;  2KTU A;  3SIV A;  5GAP K;  1W5F A;  3WGM A;  1W5B A;  4HNA B;  3D01 A;  3IEQ A;  3RYI B;  2Z1U A;  3M1X A;  3PAF A;  1W40 A;  4I50 B;  1TUB A;  3CCJ F;  4YJ2 B;  1VQ5 F;  4EI8 A;  4HNA A;  4X1K B;  4X1I B;  4BT6 A;  1FSZ A;  3MQW A;  4B62 A;  3HKC B;  3OBY A;  2I6D A;  3LFO A;  3NVI B;  4O4L A;  3FD6 A;  4G4Z A;  5JH7 A;  3HTN A;  4NQ3 A;  2HP3 A;  5LOV B;  1VQM F;  5EYP B;  2VGN A;  4BVR A;  5GIO C;  2RHO A;  3E20 B;  3JAR B;  4TUY B;  4PWT A;  3VOA A;  3CCE F;  3CCM F;  1H48 A;  2IG8 A;  1JFF B;  5IJ0 A;  4IIJ A;  5JVD B;  4RQO A;  3LWV C;  3ZO8 A;  3IKE A;  2QTP A;  2VAM A;  3JAL B;  1GX1 A;  2DT4 A;  3UT5 B;  5HY2 A;  5J2T B;  4C4W C;  1YIJ F;  3VO8 A;  1FFX A;  1OFU A;  2HS3 A;  2RHL A;  3JAW A;  5EZY B;  1W5A A;  3VYS C;  3NVK E;  4B46 A;  3CCU F;  3N2G B;  3G6E F;  1QAH A;  1KNK A;  4X1Y B;  1VQV A;  1W3E X;  1N8R H;  2EWC A;  4R40 B;  3T80 A;  4O4H A;  3G4S F;  4O2B B;  3TD5 A;  5LXT B;  2ZF8 A;  1YJW F;  1VQ7 F;  1NMU B;  1SA0 A;  2HX0 A;  2CWJ A;  3I7T A;  2ZVY A;  2Q1X A;  4DRX A;  3N2K B;  1H7M A;  2F9Z C;  2BO1 A;  1E7K A;  2RHJ A;  2CZW A;  3K2X A;  3CCL F;  3RYC A;  2UYN B;  3AGK A;  3IMP A;  1IPA A;  4EB6 B;  5HP7 A;  3ELC A;  1COM A;  3C9U A;  4U3J A;  5LA6 B;  5KMG B;  3MCA B;  3EOR A;  1OAP A;  3FD5 A;  3F0D A;  2HP0 B;  3CG6 A;  1U40 A;  1ODE A;  1VQ9 F;  4ZHY B;  3V7E A;  2ZOD A;  4EB6 A;  1X7O A;  3LME A;  5FLX M;  1VQ6 F;  1ONI A;  5LA6 A;  5EIB D;  3WPW A;  4C8E A;  2RB9 A;  1FNJ A;  3CPQ A;  2YYE A;  1K9M H;  3HKB B;  1T0K B;  3M84 A;  1YJ9 F;  3CXC F;  1X7P A;  5JQG A;  4I4T B;  4O4J B;  5JCO A;  3JAT A;  2K1S A;  2ZVZ A;  4TV8 B;  1XBI A;  4X20 A;  4ZHQ A;  3P4E A;  1SZQ A;  3CB2 A;  5GON B;  4I4T A;  3K0T A;  1GZ0 A;  2KG4 A;  3NMU C;  1U3P A;  4IHJ B;  5LYJ B;  3LWQ C;  2LCA A;  5EB0 A;  1RQ7 A;  5KX5 B;  5GON A;  2HVY D;  3ERN A;  1W57 A;  2R6R 1;  1YI2 F;  1JN1 A;  4ZHW A;  4LCK A;  3P0Z A;  4BT4 A;  4ZI7 A;  1FNK A;  4IHJ A;  3VTI C;  3RYF B;  3C9T A;  3WGL A;  3B6N A;  4I55 A;  3VI6 A;  2I6R A;  1KD1 H;  5C8Y A;  2OZB A;  3CC2 F;  1GO0 A;  3KHN A;  3GYQ A;  5LP6 B;  3LWP C;  3O85 A;  3CC4 F;  1PF5 A;  1VQL F;  5ITZ B;  2VGM A;  3WJP A;  3RYI A;  4ZOL B;  3K14 A;  4WBN B;  4EI9 A;  5HWE A;  2GZL A;  4X3M A;  4I50 A;  3MCQ A;  1QVG F;  3VCZ A;  5HXU A;  3F6M A;  4YJ2 A;  3I3F A;  3VYU C;  4X1I A;  4X1K A;  5IYZ B;  1NQ3 A;  1W41 A;  3ESJ A;  3HKC A;  4ZOL A;  3CYP B;  3JAK B;  2N48 A;  4F6R B;  2R75 1;  1U43 A;  1X25 A;  2JNB A;  2VAP A;  2OTL F;  3F0E A;  3J7A R;  5LOV A;  5EYP A;  3CC7 F;  3P10 A;  2BTU A;  3J80 M;  2HS4 A;  2FGY A;  3JAR A;  4TUY A;  1XHO A;  2MQE A;  2UYK A;  3I56 F;  2PHN A;  2QA4 F;  4C82 A;  5GIN C;  1JFF A;  2IAF A;  4RHA A;  3HJW C;  5HY4 A;  5JVD A;  1RQ2 A;  2HQS C;  2W8B C;  1GO1 A;  3JAL A;  3I55 F;  2BTO A;  1UI9 A;  1JY8 A;  3UT5 A;  1W2B F;  4B5C A;  5J2T A;  5EZY A;  2L26 A;  4TZZ A;  1IV3 A;  3MDO A;  1W42 A;  2V9Y A;  2AIZ P;  1YJN F;  4O4I B;  1CN7 A;  3JAS B;  3N2G A;  5J2U B;  2CVL A;  4X1Y A;  4BW0 B;  3IEW A;  5HY1 A;  1VH8 A;  2CHT A;  4O2B A;  5LXT A;  5EWR A;  3E1Y A;  1ZWZ A;  1YQN A;  2Z1F A;  3JAS A;  5IJ9 B;  2H6L A;  3PLA C;  3C8L A;  4XCQ A;  3N2K A;  3LYB A;  4BT2 A;  1NJI H;  1QD9 A;  2IQQ A;  4ZHV A;  1JD1 A;  1CLI A;  5BMV B;  2UYN A;  3HWU A;  5CB4 B;  4G4X A;  5KMG A;  3HKE B;  4O2A B;  3Q8H A;  3TD4 A;  5G4U C;  1UFY A;  5CA1 B;  5CA0 B;  4X3L A;  3RE3 A;  2HP0 A;  4B45 A;  5BMV A;  5FNV B;  4C81 A;  1QVF F;  3LDT A;  5JCO C;  1RLU A;  1VQN F;  3E22 B;  3VIU A;  4G88 A;  3IKF A;  3ON1 A;  1H47 A;  2G9I A;  3MBM A;  2OHW A;  2H8C A;  1PXW A;  3GTZ A;  4LNU B;  4BVT A;  3G71 F;  3F0F A;  3RA5 A;  2ZAU A;  3HKB A;  3ZP7 A;  4YJ3 B;  4BVQ A;  2RHH A;  3S0Y A;  2YXZ A;  1XRG A;  3KIZ A;  4O4J A;  1K73 H;  3JAM M;  3CCV F;  1Z5V A;  2Z1E A;  1K8A H;  4NWO B;  2DYY A;  4TV8 A;  3WGN A;  3KE1 A;  3F0G A;  1M90 H;  4YJ3 A;  3J81 M;  5HY0 A;  3OW2 F;  3CD6 F;  3C9R A;  2UYP A;  5AVM A;  4ZK7 A;  1YIT F;  5FJ4 C;  4BVS A;  3GHZ A;  3WGK A;  5LYJ A;  3S0W A;  3VMF B;  1JJ2 F;  5KX5 A;  4TV9 B;  5G4V C;  1KQS F;  3BYQ A;  3ZP4 A;  2NMU A;  3V3T A;  3RYH B;  1VQK F;  4M8I A;  1DBF A;  1SDS A;  4BT7 A;  1Q7Y H;  3RYF A;  5EB1 B;  3KJK A;  1KC8 H;  3L7Q A;  1RA4 A;  3V4D A;  1Q82 H;  3CCQ F;  1W5E A;  2LBX A;  4KWE A;  3S02 A;  2WAL A;  5LP6 A;  3LWR C;  1TUB B;  3FBA A;  5ITZ A;  1Q81 H;  2BTQ B;  3QTY A;  3K12 A;  4BY9 D;  4WBN A;  1Q8R A;  2HRY A;  4O4L B;  1IV2 A;  3JCM M;  5MN4 A;  5JH7 B;  3NK6 A;  3FFM A;  3LWO C;  5IYZ A;  1IV1 A;  1J7H A;  3JAK A;  3RA6 A;  4F6R A;  3JVH A;  2Z1T A;  5IJ0 B;  1U3L A;  3CYQ A;  4IIJ B;  2PMP A;  2AIF A;  3CME F;  1QU9 A;  4G4V A;  1W59 A;  1KNJ A;  3CPW F;  3D00 A;  4NUT A;  3D54 A;  3QHD A;  5IT9 M;  2ZOV A;  1FFX B;  1DT9 A;  1VHA A;  3JAW B;  3NK7 A;  1TVK B;  3N4Z A;  4BT3 A;  3S03 A;  1VQ4 F;  5EIB C;  5HP8 A;  4FFB B;  4O4H B;  4DXD A;  3QUW A;  1TVK A;  4O4I A;  4C8I A;  1SA0 B;  5J2U A;  5B8F A;  4DRX B;  5GAN K;  4FFB A;  3OBW A;  3S0H A;  1YHQ F;  3RYC B;  2VXY A;  1W55 A;  1T0A A;  1Q86 H;  5IJ9 A;  3VOB A;  3CCR F;  2GVI A;  3TD3 A;  4U3J B;  1XV2 A;  2H8E A;  3N4Y A;  2AMT A;  2VAW A;  2OTJ F;  5HXZ A;  2GLZ A;  5CB4 A;  2FC3 A;  3WJR A;  3HKE A;  3VYT C;  4O2A A;  5EO3 A;  5MN5 A;  1CK2 A;  1R1M A;  2KGW A;  2CW4 A;  5CA0 A;  5CA1 A;  2LBW A;  5FNV A;  4ERH A;  3U0O A;  3E22 A;  3WJQ A;  1VQO F;  3WXM B;  3KJJ A;  5JQG B;  2HRU A;  2Q1Y A;  3JAT B;  4C8G A;  1IV4 A;  4LNU A;  4X20 B;  3WGJ A;  4ZHQ B;  5EAZ A;  4U39 A;  2CHS A;  1YGY A;  3M4S A;  4BT5 A;  1VK3 A;  3DC2 A;  3HKD B;  3V7Q A;  2CSL A;  3HAX D;  2P6Y A;  2ALE A;  5A2Q M;  3IR9 A;  3WPX A;  4G4Y A;  1S72 F;  2KTV A;  3CMA F;  2UYJ A;  3DDN A;  3HKD A;  2QI2 A;  2HS0 A;  3R0P A;  4E6E A;  3CCS F; 
#chains in the Genus database with same CATH homology
 4C8G A;  1IV2 A;  1IV4 A;  3F0E A;  3Q8H A;  3IKE A;  3KE1 A;  1U3P A;  2AMT A;  3F0G A;  3IEW A;  3K2X A;  3RE3 A;  1VH8 A;  3P10 A;  1GX1 A;  4C8E A;  4C81 A;  1IV1 A;  3ERN A;  1W57 A;  1JN1 A;  3P0Z A;  4C82 A;  1YQN A;  2UZH A;  3K14 A;  3JVH A;  2GZL A;  3FPI A;  4C8I A;  3ELC A;  1U3L A;  3IKF A;  1H47 A;  2PMP A;  3MBM A;  5B8F A;  1KNK A;  3EOR A;  3GHZ A;  3F6M A;  3FBA A;  1H48 A;  1JY8 A;  3B6N A;  3F0D A;  1KNJ A;  3F0F A;  3T80 A;  1U40 A;  3QHD A;  3ESJ A;  1IV3 A;  3IEQ A;  1VHA A;  1W55 A;  1T0A A;  1U43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...