2OTMA

Crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
b'MNTPESRLVAAGLELPEVAAALGNYEPYSIVGSQLMTSGQFPYLQGKLLYQGQLGADYTVSEGYAACRLATLNAIAQLKQACGELSRIKQIYRLEGVLNVHQSCIEHPKALDGASDLLLEIFGEAGRHSRMIWTNPVMPLNSLCLVYLFAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
molecule tags Unknown function
source organism Shewanella oneidensis
publication title Crystal structure of hypothetical protein (NP_717567.1) from Shewanella oneidensis at 1.85 A resolution
rcsb
total genus 45
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2otmA00
2IG8A 1UFYA 3K12A 3KJKA 1XHOA 2CVLA 3L7QA 1QD9A 2DYYA 2UYKA 3K0TA 3KJJA 3MQWA 4ZK7A 1UI9A 1DBFA 3GTZA 2CSLA 1PF5A 3ZO8A 2CHSA 1J7HA 2EWCA 2UYPA 1JD1A 3ZOPA 2UYNB 3ZP7A 1ODEA 1QU9A 4NWOB 1FNJA 3LYBA 2CWJA 3V4DA 3R0PA 3M4SA 2UYJA 1COMA 3LMEA 1NQ3A 3ZP4A 1XRGA 2OTMA 1ONIA 3I3FA 3I7TA 1QAHA 3M1XA 3VCZA 2CW4A 1X25A 2B33A 5HP8A 5HP7A 3D01A 3QUWA 1FNKA 2CHTA 2UYNA
chains in the Genus database with same CATH superfamily
2IG8A 3E22A 3KIZA 3C8LA 1UFYA 1IV3A 2VAWA 1QD9A 3WXMB 1VK3A 3TD4A 4I50B 2G9IA 4X3MA 3CCSF 4I50A 2Q1XA 4EI7A 1CK2A 1OAPA 1VQ8F 1W40A 2VGMA 3ERNA 1Q7YH 1VH8A 3G71F 3JARA 4I55A 3CPWF 4U39A 5CA1A 5JH7A 5MN4A 3LWRC 3NK6A 3VMFB 5LP6C 5HY4A 4BT5A 4X3LA 3IR9A 1VQPF 3QUWA 2CHTA 3C9TA 3B6NA 5HY2A 3ESJA 4ZK7A 4WBNA 1UI9A 2V9YA 1RQ7A 2QI2A 1VQ4F 5FJ4C 3JALB 4O4JB 3MCQA 3HAXD 1FFXB 4X1IA 2JNBA 2OTMA 1YJ9F 4F6RA 1T0AA 1YI2F 2ZODA 4XCQA 3LWVC 1KNJA 5EYPB 3CD6F 2HRYA 4C8GA 5HXUA 1Z5WA 4LCKA 4DRXB 4RHAA 2H8CA 3J81M 2DYYA 2AIZP 1DBFA 3JAWB 2QEXF 2RHLA 3N4ZA 4B46A 3FBAA 3JALA 5LOVB 2ALEA 3P0ZA 5LP6B 2AIFA 3WJRA 1RLUA 2CWJA 3RE3A 1X7OA 4BT6A 3F0EA 1W5AA 1RLGA 1RQ2A 2FC3A 5KX5A 3LFOA 4HNAA 3VCZA 3OW2F 5KX5B 1JY8A 4DRXA 1KC8H 4I55B 4X20A 5JCOC 1JFFB 4TV9A 4BT7A 5KMGB 1XHOA 4C8EA 1NMUB 1TVKB 1IV1A 5LOVA 3S0WA 1U40A 3M84A 4X1YB 1QVFF 1W5BA 1KD1H 2LCAA 1FSZA 3JVHA 3VOBA 3VOAA 4WBNB 1K9MH 4BT2A 4YJ3A 3VI6A 4ERHA 3ZP4A 1YGYA 3HKDA 4YJ2A 5GANK 2Q1YA 4ZOLA 4ZHQB 3I56F 1X25A 3CYPB 1YJWF 3D01A 3RYFA 4B45A 1W57A 1VQKF 2BTQB 3RYFB 4ZI7B 1OFUA 4ZHYB 4C82A 4X1YA 3WGMA 4BVSA 5BMVB 3K0TA 3G6EF 3GTZA 3OBYA 1XBIA 3ZOPA 3CCLF 1K73H 1U3PA 2GVIA 3GYQA 3K2XA 1QU9A 5JVDA 1FNJA 1W3EX 5JVDB 5GIOC 1TUBB 1XRGA 5AVMA 3JCMM 3WGLA 3JATA 2PMPA 5HP8A 1NJIH 5LA6B 3KE1A 3J7AR 2GZLA 3CCQF 5IJ0B 1IV2A 1GZ0A 2HS3A 4BW0B 2GLZA 3N2KB 4O4IB 5CB4B 5FLXM 5EWRA 3ZO8A 2HP0B 4ZHVA 3ZP7A 4TV9B 1VQVA 3C9RA 1TVKA 1R1MA 4ZI7A 3JATB 1W55A 3E22B 4O4LA 3V7QA 2Z1FA 1VQOF 2BTOA 4BT4A 4X1KA 2OTLF 5GONB 3IEWA 2R751 3C9SA 3FD5A 2ZOVA 3DDNA 3IKFA 4ZOLB 5LYJA 4TV8A 2ZVZA 2HQSC 4E6EA 2EWCA 1M90H 2UYPA 5B8FA 2RHJA 4ZHWA 5IJ9A 5EIBD 5IYZA 3KHNA 1Q81H 4IHJA 1VQ6F 2H8EA 3NVKE 3LMEA 4BY9D 1Q8RA 3RA5A 2OHWA 4BVRA 2NMUA 4EI9A 4G4VA 4EB6A 2ZAUA 2KGWA 3LWPC 3G4SF 2B33A 5J2TB 3AGKA 2YYEA 4EB6B 4I4TB 1Q82H 5EZYA 3WGJA 3CCMF 3RYIB 2UYNA 2KTVA 4LNUB 1GO0A 1RA4A 3DC2A 3L7QA 2KG4A 3Q8HA 3MQWA 1M1KH 4O4HA 2WALA 4O2BA 4X1IB 1H47A 3S02A 1PXWA 2CZWA 3GHZA 2UZHA 5IYZB 4O2BB 3V4DA 3HKEB 3RYHB 1COMA 3O85A 4RQOA 2HP0A 3E1YA 3VTIC 1VHAA 2CW4A 2L26A 3JASA 3F6MA 5EZYB 3VO8A 5HWEA 5JQGB 4TV8B 4G4YA 5JCOA 1VQLF 2RHOA 1XV2A 5CA0B 3J80M 5EO3A 2HRUA 3V7EA 5LP6A 1Q86H 3K12A 1IV4A 3D00A 3PAFA 3VYUC 2VGNA 2ZVYA 3S0HA 3S0YA 1YHQF 1N8RH 1W42A 3P4EA 5EYPA 5LYJB 1W41A 4O2AB 4C4WC 5MN6A 2UYJA 1IPAA 1VQ9F 3CPQA 5CA1B 5JH7B 3U0OA 1U3LA 1VQNF 1JJ2F 4IHJB 3HJWC 1FNKA 2Z1EA 2HX0A 1SZQA 1JN1A 3F0DA 2I6RA 4FFBB 2UYKA 2MQEA 3P10A 2QTPA 2CHSA 3HKCA 1JD1A 4U3JA 5GAPK 5A2QM 5J2UA 3PLAC 1JFFA 3HKBA 3R0PA 4G88A 3M4SA 3F0FA 1YJNF 5EAZA 1H48A 4TZZA 3WGKA 3M1XA 3HWUA 3IEQA 3VIUA 1U43A 5IT9M 2BO1A 4HNAB 3HKEA 1DT9A 4F6RB 3WJPA 3RYHA 4EI8A 4B5CA 2LBXA 2ZF8A 5EB1B 4O2AA 2Z1TA 1W5FA 1ZWZA 3HKCB 3S03A 2F9ZC 3KJJA 3RYCB 1GX1A 4U3JB 3WPXA 1PF5A 5FNVA 2PHNA 3JAWA 3CCEF 4O4JA 5FNVB 1W59A 5HY0A 1ODEA 4NWOB 2QA4F 5G4UC 4BVTA 3WPWA 3CMEF 3LDTA 2VAMA 3SIUA 2R6R1 4G4ZA 3WJQA 2YXZA 3N2KA 4X20B 4DXDA 4IIJA 5J2UB 5HP7A 3FPIA 1X52A 2FGYA 3HTNA 5BMVA 5HY1A 2HS0A 5HXZA 4YJ3B 4FFBA 4X1KB 2Z01A 3MDOA 3RA6A 3T80A 2RHHA 4R40B 3I7TA 4NQ3A 5EB0A 2VXYA 4IIJB 3BYQA 4NUTA 3NVIB 3FD6A 3ON1A 1T0KB 2Z1UA 3N4YA 3KJKA 3IMPA 1YIJF 5GIPC 1VQ7F 1H7MA 5C8YA 4G4XA 3MCAB 3LWOC 1KNKA 5CB4A 1VQ5F 3OONA 1Z5VA 3CG6A 3EORA 3LYBA 3MBMA 4TUYB 3RYCA 3QTYA 2N48A 3I3FA 3V3TA 1TUBA 5IJ0A 2OZBA 4O4LB 2I6DA 4B62A 4C81A 3CCVF 2DT4A 5GONA 3TD3A 1YITF 2CVLA 1QVGF 1SDSA 2K1SA 3FFMA 5EIBC 1E7KA 4ZHQA 1KQSF 2UYNB 4TUYA 4G4WA 1W5EA 5KMGA 1SA0B 5LXTA 2P6YA 2LBTA 3IKEA 3F0GA 3CMAF 1QAHA 1W2BF 3OBWA 5ITZB 3CC7F 2RB9A 3JAKA 3CC4F 5ITZA 4I4TA 3HKDB 4KWEA 4YJ2B 3NK7A 5GINC 3RYIA 2VAPA 3CB2A 2CSLA 3JARB 3CXCF 1CN7A 3VYTC 2IAFA 2H6LA 1VQMF 2LBWA 4BVQA 1S72F 1K8AH 2AMTA 5IJ9B 3LWQC 5C8YB 3VYSC 4BT3A 2HP3A 1ONIA 5J2TA 3N2GA 3E20B 3JAKB 2BTUA 3CYQA 2HS4A 3N2GB 5DCVA 3S06A 3ELCA 1GO1A 4PWTA 2IQQA 3I55F 3C9UA 2HVYD 2OTJF 5LA6A 3HKBB 3UT5A 1FFXA 1J7HA 3UT5B 4O4HB 1YQNA 5MN5A 3K14A 4M8IA 4O4IA 3CC2F 3NMUC 1NQ3A 1W581 1X7PA 3JASB 3WGNA 4C8IA 3SIVA 3QHDA 3TD5A 3D54A 1CLIA 3JAMM 3CCRF 3CCJF 1SA0A 2KTUA 2W8BC 5JQGA 4LNUA 5LXTB 3CCUF 5CA0A 5G4VC
chains in the Genus database with same CATH topology
2IG8A 1UFYA 3K12A 3KJKA 1XHOA 2CVLA 3L7QA 1QD9A 2DYYA 2UYKA 3K0TA 3KJJA 3MQWA 4ZK7A 1UI9A 1DBFA 3GTZA 2CSLA 1PF5A 3ZO8A 2CHSA 1J7HA 2EWCA 2UYPA 1JD1A 3ZOPA 2UYNB 3ZP7A 1ODEA 1QU9A 4NWOB 1FNJA 3LYBA 2CWJA 3V4DA 3R0PA 3M4SA 2UYJA 1COMA 3LMEA 1NQ3A 3ZP4A 1XRGA 2OTMA 1ONIA 3I3FA 3I7TA 1QAHA 3M1XA 3VCZA 2CW4A 1X25A 2B33A 5HP8A 5HP7A 3D01A 3QUWA 1FNKA 2CHTA 2UYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IG8 A;  1UFY A;  3K12 A;  3KJK A;  1XHO A;  2CVL A;  3L7Q A;  1QD9 A;  2DYY A;  2UYK A;  3K0T A;  3KJJ A;  3MQW A;  4ZK7 A;  1UI9 A;  1DBF A;  3GTZ A;  2CSL A;  1PF5 A;  3ZO8 A;  2CHS A;  1J7H A;  2EWC A;  2UYP A;  1JD1 A;  3ZOP A;  2UYN B;  3ZP7 A;  1ODE A;  1QU9 A;  4NWO B;  1FNJ A;  3LYB A;  2CWJ A;  3V4D A;  3R0P A;  3M4S A;  2UYJ A;  1COM A;  3LME A;  1NQ3 A;  3ZP4 A;  1XRG A;  2OTM A;  1ONI A;  3I3F A;  3I7T A;  1QAH A;  3M1X A;  3VCZ A;  2CW4 A;  1X25 A;  2B33 A;  5HP8 A;  5HP7 A;  3D01 A;  3QUW A;  1FNK A;  2CHT A;  2UYN A; 
#chains in the Genus database with same CATH topology
 2IG8 A;  3E22 A;  3KIZ A;  3C8L A;  1UFY A;  1IV3 A;  2VAW A;  1QD9 A;  3WXM B;  1VK3 A;  3TD4 A;  4I50 B;  2G9I A;  4X3M A;  3CCS F;  4I50 A;  2Q1X A;  4EI7 A;  1CK2 A;  1OAP A;  1VQ8 F;  1W40 A;  2VGM A;  3ERN A;  1Q7Y H;  1VH8 A;  3G71 F;  3JAR A;  4I55 A;  3CPW F;  4U39 A;  5CA1 A;  5JH7 A;  5MN4 A;  3LWR C;  3NK6 A;  3VMF B;  5LP6 C;  5HY4 A;  4BT5 A;  4X3L A;  3IR9 A;  1VQP F;  3QUW A;  2CHT A;  3C9T A;  3B6N A;  5HY2 A;  3ESJ A;  4ZK7 A;  4WBN A;  1UI9 A;  2V9Y A;  1RQ7 A;  2QI2 A;  1VQ4 F;  5FJ4 C;  3JAL B;  4O4J B;  3MCQ A;  3HAX D;  1FFX B;  4X1I A;  2JNB A;  2OTM A;  1YJ9 F;  4F6R A;  1T0A A;  1YI2 F;  2ZOD A;  4XCQ A;  3LWV C;  1KNJ A;  5EYP B;  3CD6 F;  2HRY A;  4C8G A;  5HXU A;  1Z5W A;  4LCK A;  4DRX B;  4RHA A;  2H8C A;  3J81 M;  2DYY A;  2AIZ P;  1DBF A;  3JAW B;  2QEX F;  2RHL A;  3N4Z A;  4B46 A;  3FBA A;  3JAL A;  5LOV B;  2ALE A;  3P0Z A;  5LP6 B;  2AIF A;  3WJR A;  1RLU A;  2CWJ A;  3RE3 A;  1X7O A;  4BT6 A;  3F0E A;  1W5A A;  1RLG A;  1RQ2 A;  2FC3 A;  5KX5 A;  3LFO A;  4HNA A;  3VCZ A;  3OW2 F;  5KX5 B;  1JY8 A;  4DRX A;  1KC8 H;  4I55 B;  4X20 A;  5JCO C;  1JFF B;  4TV9 A;  4BT7 A;  5KMG B;  1XHO A;  4C8E A;  1NMU B;  1TVK B;  1IV1 A;  5LOV A;  3S0W A;  1U40 A;  3M84 A;  4X1Y B;  1QVF F;  1W5B A;  1KD1 H;  2LCA A;  1FSZ A;  3JVH A;  3VOB A;  3VOA A;  4WBN B;  1K9M H;  4BT2 A;  4YJ3 A;  3VI6 A;  4ERH A;  3ZP4 A;  1YGY A;  3HKD A;  4YJ2 A;  5GAN K;  2Q1Y A;  4ZOL A;  4ZHQ B;  3I56 F;  1X25 A;  3CYP B;  1YJW F;  3D01 A;  3RYF A;  4B45 A;  1W57 A;  1VQK F;  2BTQ B;  3RYF B;  4ZI7 B;  1OFU A;  4ZHY B;  4C82 A;  4X1Y A;  3WGM A;  4BVS A;  5BMV B;  3K0T A;  3G6E F;  3GTZ A;  3OBY A;  1XBI A;  3ZOP A;  3CCL F;  1K73 H;  1U3P A;  2GVI A;  3GYQ A;  3K2X A;  1QU9 A;  5JVD A;  1FNJ A;  1W3E X;  5JVD B;  5GIO C;  1TUB B;  1XRG A;  5AVM A;  3JCM M;  3WGL A;  3JAT A;  2PMP A;  5HP8 A;  1NJI H;  5LA6 B;  3KE1 A;  3J7A R;  2GZL A;  3CCQ F;  5IJ0 B;  1IV2 A;  1GZ0 A;  2HS3 A;  4BW0 B;  2GLZ A;  3N2K B;  4O4I B;  5CB4 B;  5FLX M;  5EWR A;  3ZO8 A;  2HP0 B;  4ZHV A;  3ZP7 A;  4TV9 B;  1VQV A;  3C9R A;  1TVK A;  1R1M A;  4ZI7 A;  3JAT B;  1W55 A;  3E22 B;  4O4L A;  3V7Q A;  2Z1F A;  1VQO F;  2BTO A;  4BT4 A;  4X1K A;  2OTL F;  5GON B;  3IEW A;  2R75 1;  3C9S A;  3FD5 A;  2ZOV A;  3DDN A;  3IKF A;  4ZOL B;  5LYJ A;  4TV8 A;  2ZVZ A;  2HQS C;  4E6E A;  2EWC A;  1M90 H;  2UYP A;  5B8F A;  2RHJ A;  4ZHW A;  5IJ9 A;  5EIB D;  5IYZ A;  3KHN A;  1Q81 H;  4IHJ A;  1VQ6 F;  2H8E A;  3NVK E;  3LME A;  4BY9 D;  1Q8R A;  3RA5 A;  2OHW A;  4BVR A;  2NMU A;  4EI9 A;  4G4V A;  4EB6 A;  2ZAU A;  2KGW A;  3LWP C;  3G4S F;  2B33 A;  5J2T B;  3AGK A;  2YYE A;  4EB6 B;  4I4T B;  1Q82 H;  5EZY A;  3WGJ A;  3CCM F;  3RYI B;  2UYN A;  2KTV A;  4LNU B;  1GO0 A;  1RA4 A;  3DC2 A;  3L7Q A;  2KG4 A;  3Q8H A;  3MQW A;  1M1K H;  4O4H A;  2WAL A;  4O2B A;  4X1I B;  1H47 A;  3S02 A;  1PXW A;  2CZW A;  3GHZ A;  2UZH A;  5IYZ B;  4O2B B;  3V4D A;  3HKE B;  3RYH B;  1COM A;  3O85 A;  4RQO A;  2HP0 A;  3E1Y A;  3VTI C;  1VHA A;  2CW4 A;  2L26 A;  3JAS A;  3F6M A;  5EZY B;  3VO8 A;  5HWE A;  5JQG B;  4TV8 B;  4G4Y A;  5JCO A;  1VQL F;  2RHO A;  1XV2 A;  5CA0 B;  3J80 M;  5EO3 A;  2HRU A;  3V7E A;  5LP6 A;  1Q86 H;  3K12 A;  1IV4 A;  3D00 A;  3PAF A;  3VYU C;  2VGN A;  2ZVY A;  3S0H A;  3S0Y A;  1YHQ F;  1N8R H;  1W42 A;  3P4E A;  5EYP A;  5LYJ B;  1W41 A;  4O2A B;  4C4W C;  5MN6 A;  2UYJ A;  1IPA A;  1VQ9 F;  3CPQ A;  5CA1 B;  5JH7 B;  3U0O A;  1U3L A;  1VQN F;  1JJ2 F;  4IHJ B;  3HJW C;  1FNK A;  2Z1E A;  2HX0 A;  1SZQ A;  1JN1 A;  3F0D A;  2I6R A;  4FFB B;  2UYK A;  2MQE A;  3P10 A;  2QTP A;  2CHS A;  3HKC A;  1JD1 A;  4U3J A;  5GAP K;  5A2Q M;  5J2U A;  3PLA C;  1JFF A;  3HKB A;  3R0P A;  4G88 A;  3M4S A;  3F0F A;  1YJN F;  5EAZ A;  1H48 A;  4TZZ A;  3WGK A;  3M1X A;  3HWU A;  3IEQ A;  3VIU A;  1U43 A;  5IT9 M;  2BO1 A;  4HNA B;  3HKE A;  1DT9 A;  4F6R B;  3WJP A;  3RYH A;  4EI8 A;  4B5C A;  2LBX A;  2ZF8 A;  5EB1 B;  4O2A A;  2Z1T A;  1W5F A;  1ZWZ A;  3HKC B;  3S03 A;  2F9Z C;  3KJJ A;  3RYC B;  1GX1 A;  4U3J B;  3WPX A;  1PF5 A;  5FNV A;  2PHN A;  3JAW A;  3CCE F;  4O4J A;  5FNV B;  1W59 A;  5HY0 A;  1ODE A;  4NWO B;  2QA4 F;  5G4U C;  4BVT A;  3WPW A;  3CME F;  3LDT A;  2VAM A;  3SIU A;  2R6R 1;  4G4Z A;  3WJQ A;  2YXZ A;  3N2K A;  4X20 B;  4DXD A;  4IIJ A;  5J2U B;  5HP7 A;  3FPI A;  1X52 A;  2FGY A;  3HTN A;  5BMV A;  5HY1 A;  2HS0 A;  5HXZ A;  4YJ3 B;  4FFB A;  4X1K B;  2Z01 A;  3MDO A;  3RA6 A;  3T80 A;  2RHH A;  4R40 B;  3I7T A;  4NQ3 A;  5EB0 A;  2VXY A;  4IIJ B;  3BYQ A;  4NUT A;  3NVI B;  3FD6 A;  3ON1 A;  1T0K B;  2Z1U A;  3N4Y A;  3KJK A;  3IMP A;  1YIJ F;  5GIP C;  1VQ7 F;  1H7M A;  5C8Y A;  4G4X A;  3MCA B;  3LWO C;  1KNK A;  5CB4 A;  1VQ5 F;  3OON A;  1Z5V A;  3CG6 A;  3EOR A;  3LYB A;  3MBM A;  4TUY B;  3RYC A;  3QTY A;  2N48 A;  3I3F A;  3V3T A;  1TUB A;  5IJ0 A;  2OZB A;  4O4L B;  2I6D A;  4B62 A;  4C81 A;  3CCV F;  2DT4 A;  5GON A;  3TD3 A;  1YIT F;  2CVL A;  1QVG F;  1SDS A;  2K1S A;  3FFM A;  5EIB C;  1E7K A;  4ZHQ A;  1KQS F;  2UYN B;  4TUY A;  4G4W A;  1W5E A;  5KMG A;  1SA0 B;  5LXT A;  2P6Y A;  2LBT A;  3IKE A;  3F0G A;  3CMA F;  1QAH A;  1W2B F;  3OBW A;  5ITZ B;  3CC7 F;  2RB9 A;  3JAK A;  3CC4 F;  5ITZ A;  4I4T A;  3HKD B;  4KWE A;  4YJ2 B;  3NK7 A;  5GIN C;  3RYI A;  2VAP A;  3CB2 A;  2CSL A;  3JAR B;  3CXC F;  1CN7 A;  3VYT C;  2IAF A;  2H6L A;  1VQM F;  2LBW A;  4BVQ A;  1S72 F;  1K8A H;  2AMT A;  5IJ9 B;  3LWQ C;  5C8Y B;  3VYS C;  4BT3 A;  2HP3 A;  1ONI A;  5J2T A;  3N2G A;  3E20 B;  3JAK B;  2BTU A;  3CYQ A;  2HS4 A;  3N2G B;  5DCV A;  3S06 A;  3ELC A;  1GO1 A;  4PWT A;  2IQQ A;  3I55 F;  3C9U A;  2HVY D;  2OTJ F;  5LA6 A;  3HKB B;  3UT5 A;  1FFX A;  1J7H A;  3UT5 B;  4O4H B;  1YQN A;  5MN5 A;  3K14 A;  4M8I A;  4O4I A;  3CC2 F;  3NMU C;  1NQ3 A;  1W58 1;  1X7P A;  3JAS B;  3WGN A;  4C8I A;  3SIV A;  3QHD A;  3TD5 A;  3D54 A;  1CLI A;  3JAM M;  3CCR F;  3CCJ F;  1SA0 A;  2KTU A;  2W8B C;  5JQG A;  4LNU A;  5LXT B;  3CCU F;  5CA0 A;  5G4V C; 
#chains in the Genus database with same CATH homology
 2IG8 A;  1UFY A;  3K12 A;  3KJK A;  1XHO A;  2CVL A;  3L7Q A;  1QD9 A;  2DYY A;  2UYK A;  3K0T A;  3KJJ A;  3MQW A;  4ZK7 A;  1UI9 A;  1DBF A;  3GTZ A;  2CSL A;  1PF5 A;  3ZO8 A;  2CHS A;  1J7H A;  2EWC A;  2UYP A;  1JD1 A;  3ZOP A;  2UYN B;  3ZP7 A;  1ODE A;  1QU9 A;  4NWO B;  1FNJ A;  3LYB A;  2CWJ A;  3V4D A;  3R0P A;  3M4S A;  2UYJ A;  1COM A;  3LME A;  1NQ3 A;  3ZP4 A;  1XRG A;  2OTM A;  1ONI A;  3I3F A;  3I7T A;  1QAH A;  3M1X A;  3VCZ A;  2CW4 A;  1X25 A;  2B33 A;  5HP8 A;  5HP7 A;  3D01 A;  3QUW A;  1FNK A;  2CHT A;  2UYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...