2OTMA

Crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
MNTPESRLVAAGLELPEVAAALGNYEPYSIVGSQLMTSGQFPYLQGKLLYQGQLGADYTVSEGYAACRLATLNAIAQLKQACGELSRIKQIYRLEGVLNVHQSCIEHPKALDGASDLLLEIFGEAGRHSRMIWTNPVMPLNSLCLVYLFAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_717567.1) from Shewanella oneidensis at 1.85 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
molecule keywords Hypothetical protein
total genus 45
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2otmA00
3VCZA 3M4SA 2IG8A 1JD1A 1X25A 3LMEA 3LYBA 2CVLA 3QUWA 2B33A 2OTMA 1J7HA 3D01A 1XHOA 2UYNA 1UFYA 2CHTA 1UI9A 5HP7A 3V4DA 3M1XA 1ONIA 3KJJA 3ZO8A 1FNJA 1PF5A 3R0PA 2CSLA 2CWJA 3K12A 1QU9A 1FNKA 2CW4A 2CHSA 2DYYA 1ODEA 1QAHA 3KJKA 3L7QA 2UYNB 1XRGA 3ZP4A 1QD9A 2UYJA 3I7TA 1COMA 3GTZA 3I3FA 2EWCA 3ZP7A 5HP8A 4ZK7A 3MQWA 2UYPA 3K0TA 1DBFA 4NWOB 2UYKA 3ZOPA 1NQ3A
chains in the Genus database with same CATH superfamily
1R1MA 3PLAC 2IG8A 3J7AR 1J7HA 3QUWA 4DRXB 5G4VC 1TUBA 3CPWF 1Q81H 4BW0B 3LWPC 2CHTA 3F0DA 1UI9A 3J81M 3WPXA 3CD6F 1SA0B 5GANK 4I4TB 2Z1UA 3N4ZA 3HKDA 2L26A 2KTUA 2MQEA 2VGMA 3JAMM 5C8YA 1ODEA 3CG6A 3CYQA 3JATA 3RYHB 5HXUA 2KGWA 3UT5B 1TUBB 2NMUA 4ZHYB 1RQ2A 5LOVB 3CCSF 2YXZA 5JVDA 3ELCA 3ESJA 5AVMA 5JCOA 1X7OA 2B33A 3MCQA 1VQ6F 2P6YA 2H8EA 5J2TA 3M1XA 2VAPA 2OHWA 4RHAA 3NVKE 1XV2A 1YQNA 3HKDB 5IYZB 2I6RA 4I4TA 3AGKA 3I56F 1M90H 1FSZA 3N2KA 5J2UB 3LWQC 1PXWA 3ZP4A 3L7QA 4O4LA 2FC3A 2UYJA 4C8GA 4WBNB 4R40B 1KNJA 3HKCB 5GONA 5IJ0A 2KTVA 4TV8A 4M8IA 1NMUB 3BYQA 3HKBA 2Z1FA 3WJPA 4O4JA 2I6DA 2LCAA 4C81A 3SIUA 4O2AA 2CVLA 3MCAB 5J2TB 3NK6A 4U3JB 1VQ5F 2ZOVA 5LP6C 3HKEA 1KNKA 1CK2A 5FNVB 3LWRC 4B45A 3S02A 3KJKA 4I50A 2GLZA 3QTYA 3CMAF 5IJ0B 3V7EA 2UZHA 1VQMF 3P0ZA 2AIFA 1VQOF 1W55A 4WBNA 3VYSC 2HS3A 4G88A 1KD1H 3D00A 1RLGA 1GO1A 4O2BB 1W57A 3T80A 3UT5A 3OONA 1S72F 1QVGF 3LWOC 1NJIH 1QAHA 4HNAB 1QD9A 4BT4A 5EIBD 3GHZA 2QA4F 1YIJF 3HTNA 2OZBA 1U40A 5JVDB 2Q1YA 4LNUB 4NWOB 1YHQF 4XCQA 3VCZA 2RHHA 5LYJA 1VQKF 5BMVB 3N2GB 4C4WC 4BT7A 3RYFB 3K2XA 2V9YA 1RQ7A 4KWEA 4TV9B 4YJ2B 3CCEF 3R0PA 3Q8HA 2CWJA 1JY8A 4LCKA 1QU9A 2GVIA 1Q8RA 5CB4B 1N8RH 2DYYA 1K73H 4ZOLA 4X1KA 5EWRA 5LP6A 2ALEA 2F9ZC 3KHNA 4NQ3A 1YGYA 1OAPA 3CC4F 3RYIA 2HP3A 4IHJA 2RHOA 4U3JA 5LA6B 5BMVA 5J2UA 4BT6A 4X20B 5MN4A 5EYPA 5CB4A 4LNUA 4F6RB 3HJWC 4BY9D 3ERNA 1FNKA 3LFOA 4E6EA 1YJ9F 3E1YA 3E22B 5EIBC 3CCUF 2ZAUA 3B6NA 2KG4A 1W5FA 3I3FA 2HX0A 2HS0A 1VK3A 3VIUA 3G4SF 1K9MH 3VO8A 5JQGB 2HS4A 1H47A 3P4EA 2OTLF 4BVTA 1NQ3A 2LBTA 1T0KB 4ZI7A 1JD1A 3LMEA 3CYPB 4HNAA 4EI7A 1W40A 2R6R1 3FBAA 5CA0B 2ZVZA 4X1YB 3ZO8A 4B5CA 2BTOA 3JALB 5EYPB 3M84A 1PF5A 2HRYA 5LOVA 1H48A 3JARB 4EB6B 3QHDA 5LA6A 4I55A 1W2BF 3CXCF 1OFUA 2DT4A 4X3LA 2AMTA 3IEQA 5HY4A 2CHSA 5KMGA 1JN1A 5EZYB 3F0EA 3LDTA 3JAWA 1VHAA 3D54A 1QVFF 3JASA 4ZHQB 5A2QM 5IJ9A 3F0GA 3JAKA 3FFMA 4G4ZA 3S03A 1YI2F 3CCQF 2Z1TA 4DRXA 4ERHA 5EZYA 1IV4A 1FNJA 3HKEB 3WJRA 4ZOLB 4X1KB 1KQSF 5LYJB 5EB1B 1VQ8F 5GIPC 3JARA 4EB6A 3C9TA 2N48A 3KIZA 5HY1A 4O2AB 3VMFB 1Z5VA 3V3TA 4BT2A 2HRUA 4ZHQA 1XBIA 3NVIB 5FJ4C 1W42A 2Z01A 4YJ2A 1DBFA 1VQNF 2GZLA 4X1IA 1KC8H 3ZOPA 4G4VA 1U43A 1IV2A 2VAWA 5G4UC 2OTMA 1FFXA 3C9SA 5EB0A 3WPWA 2ZODA 1VQVA 5EAZA 1Q82H 3IEWA 3G6EF 3VOAA 4YJ3A 2HP0A 3IMPA 3GTZA 2YYEA 1VH8A 3PAFA 5LXTB 1IV1A 3M4SA 1GX1A 3RA5A 1VQ9F 3D01A 1XHOA 2UYNA 1IV3A 2H6LA 4DXDA 2PMPA 3S0YA 2IAFA 4U39A 3V4DA 2K1SA 2HQSC 3JAKB 1W5EA 5FNVA 3CPQA 3NK7A 1H7MA 1U3LA 1XRGA 2IQQA 1ZWZA 3RYFA 5FLXM 3JAWB 5MN5A 1TVKA 3O85A 1VQ4F 1JFFA 4C8EA 2UYKA 4I55B 1RLUA 3WJQA 3OBYA 3LYBA 4TUYA 2QI2A 1T0AA 4ZHWA 5GONB 5CA1A 5ITZA 2LBWA 3SIVA 3K14A 3TD3A 4BVQA 2RB9A 4RQOA 2ZF8A 4O4LB 2PHNA 3S0HA 5JQGA 4O2BA 4PWTA 3MDOA 3RA6A 3E20B 4B62A 4BVSA 2WALA 1E7KA 1YJNF 5GINC 3C9UA 3F0FA 5HY0A 3G71F 3OW2F 2RHLA 5HP8A 4ZK7A 2QEXF 3LWVC 4C82A 2VAMA 1SZQA 3JCMM 5JH7B 3CCJF 3KE1A 1M1KH 4ZI7B 3F6MA 5B8FA 3WGLA 4C8IA 1DT9A 1YITF 3S06A 3S0WA 5HP7A 3CCRF 5DCVA 4BT3A 1IPAA 1X52A 1W5AA 2CZWA 1W5BA 3RE3A 3K12A 2CW4A 3JALA 3JATB 3RYHA 5C8YB 2G9IA 2UYNB 3HAXD 3I55F 4F6RA 1W3EX 3V7QA 4G4YA 2EWCA 4X20A 1CN7A 2R751 5KX5B 5LXTA 4BT5A 3C8LA 1U3PA 5MN6A 2HP0B 2Q1XA 1UFYA 4ZHVA 3KJJA 4X1IB 3IKEA 3N2KB 4O4IA 3RYCB 1W41A 2HVYD 2BTQB 4FFBA 4IIJB 3VYUC 3HKCA 5HWEA 5HY2A 2UYPA 4G4XA 1JFFB 1Q7YH 2QTPA 3CMEF 4IIJA 3WGKA 4X1YA 5GIOC 2RHJA 3TD4A 5KX5A 1YJWF 1VQLF 5CA0A 3C9RA 3RYCA 1SDSA 1ONIA 3WGJA 3OBWA 4NUTA 2CSLA 1W59A 3JASB 3P10A 4TV9A 4BVRA 3MBMA 1SA0A 3DDNA 5KMGB 4I50B 1VQPF 3VI6A 1W581 2Z1EA 3CB2A 2AIZP 2JNBA 5EO3A 5GAPK 3DC2A 1X25A 4YJ3B 4EI8A 1VQ7F 1GZ0A 3VYTC 2ZVYA 5JH7A 2FGYA 3CCMF 3HWUA 1Q86H 1X7PA 3HKBB 3CCLF 2OTJF 4IHJB 2VXYA 2BTUA 4G4WA 3VTIC 4TV8B 3CC2F 1FFXB 5HXZA 4EI9A 3WGNA 4TZZA 3NMUC 3GYQA 2H8CA 4O4HA 2BO1A 1COMA 3E22A 3WGMA 5JCOC 3FPIA 3CC7F 1RA4A 3ZP7A 3TD5A 1K8AH 3MQWA 3U0OA 3J80M 3CCVF 3WXMB 5CA1B 4O4JB 5IYZA 3IKFA 4TUYB 3VOBA 1Z5WA 3ON1A 4O4IB 2LBXA 2W8BC 3N2GA 1JJ2F 1TVKB 3N4YA 3RYIB 5IT9M 5ITZB 4FFBB 4X3MA 3FD5A 5LP6B 3JVHA 3IR9A 3EORA 4B46A 1CLIA 3I7TA 1GO0A 5IJ9B 4O4HB 3K0TA 3FD6A 2VGNA
chains in the Genus database with same CATH topology
3VCZA 3M4SA 2IG8A 1JD1A 1X25A 3LMEA 3LYBA 2CVLA 3QUWA 2B33A 2OTMA 1J7HA 3D01A 1XHOA 2UYNA 1UFYA 2CHTA 1UI9A 5HP7A 3V4DA 3M1XA 1ONIA 3KJJA 3ZO8A 1FNJA 1PF5A 3R0PA 2CSLA 2CWJA 3K12A 1QU9A 1FNKA 2CW4A 2CHSA 2DYYA 1ODEA 1QAHA 3KJKA 3L7QA 2UYNB 1XRGA 3ZP4A 1QD9A 2UYJA 3I7TA 1COMA 3GTZA 3I3FA 2EWCA 3ZP7A 5HP8A 4ZK7A 3MQWA 2UYPA 3K0TA 1DBFA 4NWOB 2UYKA 3ZOPA 1NQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VCZ A;  3M4S A;  2IG8 A;  1JD1 A;  1X25 A;  3LME A;  3LYB A;  2CVL A;  3QUW A;  2B33 A;  2OTM A;  1J7H A;  3D01 A;  1XHO A;  2UYN A;  1UFY A;  2CHT A;  1UI9 A;  5HP7 A;  3V4D A;  3M1X A;  1ONI A;  3KJJ A;  3ZO8 A;  1FNJ A;  1PF5 A;  3R0P A;  2CSL A;  2CWJ A;  3K12 A;  1QU9 A;  1FNK A;  2CW4 A;  2CHS A;  2DYY A;  1ODE A;  1QAH A;  3KJK A;  3L7Q A;  2UYN B;  1XRG A;  3ZP4 A;  1QD9 A;  2UYJ A;  3I7T A;  1COM A;  3GTZ A;  3I3F A;  2EWC A;  3ZP7 A;  5HP8 A;  4ZK7 A;  3MQW A;  2UYP A;  3K0T A;  1DBF A;  4NWO B;  2UYK A;  3ZOP A;  1NQ3 A; 
#chains in the Genus database with same CATH topology
 1R1M A;  3PLA C;  2IG8 A;  3J7A R;  1J7H A;  3QUW A;  4DRX B;  5G4V C;  1TUB A;  3CPW F;  1Q81 H;  4BW0 B;  3LWP C;  2CHT A;  3F0D A;  1UI9 A;  3J81 M;  3WPX A;  3CD6 F;  1SA0 B;  5GAN K;  4I4T B;  2Z1U A;  3N4Z A;  3HKD A;  2L26 A;  2KTU A;  2MQE A;  2VGM A;  3JAM M;  5C8Y A;  1ODE A;  3CG6 A;  3CYQ A;  3JAT A;  3RYH B;  5HXU A;  2KGW A;  3UT5 B;  1TUB B;  2NMU A;  4ZHY B;  1RQ2 A;  5LOV B;  3CCS F;  2YXZ A;  5JVD A;  3ELC A;  3ESJ A;  5AVM A;  5JCO A;  1X7O A;  2B33 A;  3MCQ A;  1VQ6 F;  2P6Y A;  2H8E A;  5J2T A;  3M1X A;  2VAP A;  2OHW A;  4RHA A;  3NVK E;  1XV2 A;  1YQN A;  3HKD B;  5IYZ B;  2I6R A;  4I4T A;  3AGK A;  3I56 F;  1M90 H;  1FSZ A;  3N2K A;  5J2U B;  3LWQ C;  1PXW A;  3ZP4 A;  3L7Q A;  4O4L A;  2FC3 A;  2UYJ A;  4C8G A;  4WBN B;  4R40 B;  1KNJ A;  3HKC B;  5GON A;  5IJ0 A;  2KTV A;  4TV8 A;  4M8I A;  1NMU B;  3BYQ A;  3HKB A;  2Z1F A;  3WJP A;  4O4J A;  2I6D A;  2LCA A;  4C81 A;  3SIU A;  4O2A A;  2CVL A;  3MCA B;  5J2T B;  3NK6 A;  4U3J B;  1VQ5 F;  2ZOV A;  5LP6 C;  3HKE A;  1KNK A;  1CK2 A;  5FNV B;  3LWR C;  4B45 A;  3S02 A;  3KJK A;  4I50 A;  2GLZ A;  3QTY A;  3CMA F;  5IJ0 B;  3V7E A;  2UZH A;  1VQM F;  3P0Z A;  2AIF A;  1VQO F;  1W55 A;  4WBN A;  3VYS C;  2HS3 A;  4G88 A;  1KD1 H;  3D00 A;  1RLG A;  1GO1 A;  4O2B B;  1W57 A;  3T80 A;  3UT5 A;  3OON A;  1S72 F;  1QVG F;  3LWO C;  1NJI H;  1QAH A;  4HNA B;  1QD9 A;  4BT4 A;  5EIB D;  3GHZ A;  2QA4 F;  1YIJ F;  3HTN A;  2OZB A;  1U40 A;  5JVD B;  2Q1Y A;  4LNU B;  4NWO B;  1YHQ F;  4XCQ A;  3VCZ A;  2RHH A;  5LYJ A;  1VQK F;  5BMV B;  3N2G B;  4C4W C;  4BT7 A;  3RYF B;  3K2X A;  2V9Y A;  1RQ7 A;  4KWE A;  4TV9 B;  4YJ2 B;  3CCE F;  3R0P A;  3Q8H A;  2CWJ A;  1JY8 A;  4LCK A;  1QU9 A;  2GVI A;  1Q8R A;  5CB4 B;  1N8R H;  2DYY A;  1K73 H;  4ZOL A;  4X1K A;  5EWR A;  5LP6 A;  2ALE A;  2F9Z C;  3KHN A;  4NQ3 A;  1YGY A;  1OAP A;  3CC4 F;  3RYI A;  2HP3 A;  4IHJ A;  2RHO A;  4U3J A;  5LA6 B;  5BMV A;  5J2U A;  4BT6 A;  4X20 B;  5MN4 A;  5EYP A;  5CB4 A;  4LNU A;  4F6R B;  3HJW C;  4BY9 D;  3ERN A;  1FNK A;  3LFO A;  4E6E A;  1YJ9 F;  3E1Y A;  3E22 B;  5EIB C;  3CCU F;  2ZAU A;  3B6N A;  2KG4 A;  1W5F A;  3I3F A;  2HX0 A;  2HS0 A;  1VK3 A;  3VIU A;  3G4S F;  1K9M H;  3VO8 A;  5JQG B;  2HS4 A;  1H47 A;  3P4E A;  2OTL F;  4BVT A;  1NQ3 A;  2LBT A;  1T0K B;  4ZI7 A;  1JD1 A;  3LME A;  3CYP B;  4HNA A;  4EI7 A;  1W40 A;  2R6R 1;  3FBA A;  5CA0 B;  2ZVZ A;  4X1Y B;  3ZO8 A;  4B5C A;  2BTO A;  3JAL B;  5EYP B;  3M84 A;  1PF5 A;  2HRY A;  5LOV A;  1H48 A;  3JAR B;  4EB6 B;  3QHD A;  5LA6 A;  4I55 A;  1W2B F;  3CXC F;  1OFU A;  2DT4 A;  4X3L A;  2AMT A;  3IEQ A;  5HY4 A;  2CHS A;  5KMG A;  1JN1 A;  5EZY B;  3F0E A;  3LDT A;  3JAW A;  1VHA A;  3D54 A;  1QVF F;  3JAS A;  4ZHQ B;  5A2Q M;  5IJ9 A;  3F0G A;  3JAK A;  3FFM A;  4G4Z A;  3S03 A;  1YI2 F;  3CCQ F;  2Z1T A;  4DRX A;  4ERH A;  5EZY A;  1IV4 A;  1FNJ A;  3HKE B;  3WJR A;  4ZOL B;  4X1K B;  1KQS F;  5LYJ B;  5EB1 B;  1VQ8 F;  5GIP C;  3JAR A;  4EB6 A;  3C9T A;  2N48 A;  3KIZ A;  5HY1 A;  4O2A B;  3VMF B;  1Z5V A;  3V3T A;  4BT2 A;  2HRU A;  4ZHQ A;  1XBI A;  3NVI B;  5FJ4 C;  1W42 A;  2Z01 A;  4YJ2 A;  1DBF A;  1VQN F;  2GZL A;  4X1I A;  1KC8 H;  3ZOP A;  4G4V A;  1U43 A;  1IV2 A;  2VAW A;  5G4U C;  2OTM A;  1FFX A;  3C9S A;  5EB0 A;  3WPW A;  2ZOD A;  1VQV A;  5EAZ A;  1Q82 H;  3IEW A;  3G6E F;  3VOA A;  4YJ3 A;  2HP0 A;  3IMP A;  3GTZ A;  2YYE A;  1VH8 A;  3PAF A;  5LXT B;  1IV1 A;  3M4S A;  1GX1 A;  3RA5 A;  1VQ9 F;  3D01 A;  1XHO A;  2UYN A;  1IV3 A;  2H6L A;  4DXD A;  2PMP A;  3S0Y A;  2IAF A;  4U39 A;  3V4D A;  2K1S A;  2HQS C;  3JAK B;  1W5E A;  5FNV A;  3CPQ A;  3NK7 A;  1H7M A;  1U3L A;  1XRG A;  2IQQ A;  1ZWZ A;  3RYF A;  5FLX M;  3JAW B;  5MN5 A;  1TVK A;  3O85 A;  1VQ4 F;  1JFF A;  4C8E A;  2UYK A;  4I55 B;  1RLU A;  3WJQ A;  3OBY A;  3LYB A;  4TUY A;  2QI2 A;  1T0A A;  4ZHW A;  5GON B;  5CA1 A;  5ITZ A;  2LBW A;  3SIV A;  3K14 A;  3TD3 A;  4BVQ A;  2RB9 A;  4RQO A;  2ZF8 A;  4O4L B;  2PHN A;  3S0H A;  5JQG A;  4O2B A;  4PWT A;  3MDO A;  3RA6 A;  3E20 B;  4B62 A;  4BVS A;  2WAL A;  1E7K A;  1YJN F;  5GIN C;  3C9U A;  3F0F A;  5HY0 A;  3G71 F;  3OW2 F;  2RHL A;  5HP8 A;  4ZK7 A;  2QEX F;  3LWV C;  4C82 A;  2VAM A;  1SZQ A;  3JCM M;  5JH7 B;  3CCJ F;  3KE1 A;  1M1K H;  4ZI7 B;  3F6M A;  5B8F A;  3WGL A;  4C8I A;  1DT9 A;  1YIT F;  3S06 A;  3S0W A;  5HP7 A;  3CCR F;  5DCV A;  4BT3 A;  1IPA A;  1X52 A;  1W5A A;  2CZW A;  1W5B A;  3RE3 A;  3K12 A;  2CW4 A;  3JAL A;  3JAT B;  3RYH A;  5C8Y B;  2G9I A;  2UYN B;  3HAX D;  3I55 F;  4F6R A;  1W3E X;  3V7Q A;  4G4Y A;  2EWC A;  4X20 A;  1CN7 A;  2R75 1;  5KX5 B;  5LXT A;  4BT5 A;  3C8L A;  1U3P A;  5MN6 A;  2HP0 B;  2Q1X A;  1UFY A;  4ZHV A;  3KJJ A;  4X1I B;  3IKE A;  3N2K B;  4O4I A;  3RYC B;  1W41 A;  2HVY D;  2BTQ B;  4FFB A;  4IIJ B;  3VYU C;  3HKC A;  5HWE A;  5HY2 A;  2UYP A;  4G4X A;  1JFF B;  1Q7Y H;  2QTP A;  3CME F;  4IIJ A;  3WGK A;  4X1Y A;  5GIO C;  2RHJ A;  3TD4 A;  5KX5 A;  1YJW F;  1VQL F;  5CA0 A;  3C9R A;  3RYC A;  1SDS A;  1ONI A;  3WGJ A;  3OBW A;  4NUT A;  2CSL A;  1W59 A;  3JAS B;  3P10 A;  4TV9 A;  4BVR A;  3MBM A;  1SA0 A;  3DDN A;  5KMG B;  4I50 B;  1VQP F;  3VI6 A;  1W58 1;  2Z1E A;  3CB2 A;  2AIZ P;  2JNB A;  5EO3 A;  5GAP K;  3DC2 A;  1X25 A;  4YJ3 B;  4EI8 A;  1VQ7 F;  1GZ0 A;  3VYT C;  2ZVY A;  5JH7 A;  2FGY A;  3CCM F;  3HWU A;  1Q86 H;  1X7P A;  3HKB B;  3CCL F;  2OTJ F;  4IHJ B;  2VXY A;  2BTU A;  4G4W A;  3VTI C;  4TV8 B;  3CC2 F;  1FFX B;  5HXZ A;  4EI9 A;  3WGN A;  4TZZ A;  3NMU C;  3GYQ A;  2H8C A;  4O4H A;  2BO1 A;  1COM A;  3E22 A;  3WGM A;  5JCO C;  3FPI A;  3CC7 F;  1RA4 A;  3ZP7 A;  3TD5 A;  1K8A H;  3MQW A;  3U0O A;  3J80 M;  3CCV F;  3WXM B;  5CA1 B;  4O4J B;  5IYZ A;  3IKF A;  4TUY B;  3VOB A;  1Z5W A;  3ON1 A;  4O4I B;  2LBX A;  2W8B C;  3N2G A;  1JJ2 F;  1TVK B;  3N4Y A;  3RYI B;  5IT9 M;  5ITZ B;  4FFB B;  4X3M A;  3FD5 A;  5LP6 B;  3JVH A;  3IR9 A;  3EOR A;  4B46 A;  1CLI A;  3I7T A;  1GO0 A;  5IJ9 B;  4O4H B;  3K0T A;  3FD6 A;  2VGN A; 
#chains in the Genus database with same CATH homology
 3VCZ A;  3M4S A;  2IG8 A;  1JD1 A;  1X25 A;  3LME A;  3LYB A;  2CVL A;  3QUW A;  2B33 A;  2OTM A;  1J7H A;  3D01 A;  1XHO A;  2UYN A;  1UFY A;  2CHT A;  1UI9 A;  5HP7 A;  3V4D A;  3M1X A;  1ONI A;  3KJJ A;  3ZO8 A;  1FNJ A;  1PF5 A;  3R0P A;  2CSL A;  2CWJ A;  3K12 A;  1QU9 A;  1FNK A;  2CW4 A;  2CHS A;  2DYY A;  1ODE A;  1QAH A;  3KJK A;  3L7Q A;  2UYN B;  1XRG A;  3ZP4 A;  1QD9 A;  2UYJ A;  3I7T A;  1COM A;  3GTZ A;  3I3F A;  2EWC A;  3ZP7 A;  5HP8 A;  4ZK7 A;  3MQW A;  2UYP A;  3K0T A;  1DBF A;  4NWO B;  2UYK A;  3ZOP A;  1NQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...