2OTMA

Crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
MNTPESRLVAAGLELPEVAAALGNYEPYSIVGSQLMTSGQFPYLQGKLLYQGQLGADYTVSEGYAACRLATLNAIAQLKQACGELSRIKQIYRLEGVLNVHQSCIEHPKALDGASDLLLEIFGEAGRHSRMIWTNPVMPLNSLCLVYLFAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_717567.1) from Shewanella oneidensis at 1.85 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
molecule keywords Hypothetical protein
total genus 45
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2otmA00
2OTMA 1QD9A 2UYJA 3M1XA 1X25A 2DYYA 2B33A 3V4DA 1ONIA 3R0PA 1COMA 3LYBA 1FNJA 1PF5A 2CWJA 2CSLA 3ZOPA 5HP7A 3KJJA 4ZK7A 1NQ3A 2UYKA 2EWCA 5HP8A 3ZP4A 1UFYA 1XHOA 1DBFA 2IG8A 2CW4A 1UI9A 2UYNA 3I7TA 1JD1A 3MQWA 1FNKA 3QUWA 3ZO8A 4NWOB 2CHTA 3L7QA 1XRGA 2CHSA 3LMEA 3K12A 1QAHA 2UYPA 3ZP7A 3GTZA 3VCZA 2UYNB 3D01A 1QU9A 3KJKA 3M4SA 1J7HA 3I3FA 3K0TA 1ODEA 2CVLA
chains in the Genus database with same CATH superfamily
2QTPA 1VQKF 3CC2F 4I4TB 2JNBA 5KMGA 1T0AA 3TD4A 3OBWA 1IV1A 2AIFA 5EWRA 5IJ0B 4IHJB 2R751 4O4HB 3VMFB 2DT4A 2R6R1 1RA4A 3L7QA 5CA0B 2CHSA 2UYPA 3ON1A 3VTIC 5CB4A 1VQVA 2V9YA 4WBNB 2KTVA 3S0YA 3C9UA 2OTLF 1TVKB 5MN5A 3CCJF 1GO0A 3V4DA 5CA1A 5FLXM 3ELCA 1SA0B 3R0PA 4IIJA 1VQMF 4TUYB 1Q82H 2FGYA 1CLIA 1E7KA 2GLZA 1H47A 3S0HA 2VAPA 3VI6A 3DC2A 1FSZA 2CW4A 3MQWA 3WGKA 4M8IA 1Z5WA 1VQPF 5IJ9A 3JAWB 2YXZA 4LNUB 3JASA 3V7QA 1CK2A 1W5AA 1XBIA 1W55A 3JALB 1W59A 5FNVA 2NMUA 5LP6A 1PXWA 4C8GA 5LA6A 1KNKA 4U39A 4X1YA 2N48A 5IJ0A 3WJQA 3IEQA 5EYPB 3U0OA 5C8YA 3VOBA 3N2GB 5MN4A 3WXMB 2CWJA 4ZOLB 5EZYB 3RA6A 1Z5VA 3DDNA 3J81M 3VIUA 4B46A 3GYQA 3UT5B 1CN7A 3I7TA 5ITZA 4NUTA 3LWPC 4C82A 3LMEA 4X1KB 3IR9A 1TUBB 4O4LA 3RYCA 3PLAC 2Z1FA 3T80A 1QU9A 3KJKA 2HX0A 3CPWF 1VQ9F 2FC3A 2VAWA 5JH7B 5GAPK 5KX5A 2UYJA 1SZQA 1VQ5F 5BMVA 3IKFA 1VQLF 1FFXA 4TV9A 3RYFB 1W41A 5JQGA 3CC7F 1NQ3A 5JVDB 3MBMA 1Q81H 2RHOA 3VOAA 4X3LA 3CG6A 3ERNA 3MDOA 4YJ3A 3RYHB 2ZAUA 4YJ2B 1YITF 2BTOA 1VQ6F 1OAPA 3O85A 2AMTA 4B5CA 3RA5A 4DRXA 2OHWA 5IT9M 4RQOA 1YJNF 3J80M 5LXTB 3M1XA 4O4IB 1RLGA 1RQ2A 3C9TA 3HWUA 4C8IA 4BT2A 1M1KH 3NMUC 1YJWF 2LCAA 3HKBA 4X1KA 2Z1TA 1W581 3CB2A 2LBTA 2VXYA 4F6RB 1K9MH 2HVYD 3I56F 5J2TB 3WPXA 5FJ4C 3HKEA 3JARB 3I55F 1VQ4F 2HS0A 3G71F 3KHNA 5LOVB 4I50B 5GINC 3CCMF 2Q1XA 5JCOC 3K0TA 4G4WA 1K8AH 3SIUA 4BVRA 2BTQB 1ZWZA 4BW0B 3NVIB 2H6LA 5EAZA 3JCMM 3N2KB 4BT3A 4ZK7A 5CB4B 1OFUA 3TD3A 1UI9A 3IEWA 3TD5A 2I6RA 2Z01A 3WGLA 2UZHA 3WJRA 5CA1B 2H8EA 4O4JA 1VH8A 3CCQF 3CCVF 1IPAA 3BYQA 5JCOA 4ZHQA 2MQEA 1YI2F 3G4SF 5IJ9B 2HRYA 4KWEA 4HNAA 2HP3A 5HXUA 2ZVZA 2WALA 3E22B 4E6EA 4I55B 4ERHA 2HRUA 3M84A 1U40A 1QAHA 4O2AA 2CZWA 3HKCB 3S0WA 1KQSF 5IYZB 3RE3A 1ODEA 2P6YA 3JAWA 4LNUA 4EI9A 4RHAA 3F0GA 3JALA 5GIOC 1X25A 3IKEA 4EB6A 3UT5A 2ZODA 1FNJA 1PF5A 3LFOA 3C8LA 4G4VA 3LWOC 2RHJA 3JAKA 1IV3A 2VAMA 3QUWA 2HP0A 3SIVA 3G6EF 1XRGA 3RYIA 3K12A 3GTZA 2PHNA 2BO1A 4I4TA 5KMGB 3CCEF 1YGYA 4NQ3A 5ITZB 3VO8A 3ZP4A 3S06A 3P4EA 1KNJA 4G4XA 1RQ7A 3RYCB 4C4WC 4BVQA 1YJ9F 4TV8B 2UYKA 2OZBA 4PWTA 2EWCA 3LWVC 5LYJA 3VYUC 4O2AB 5BMVB 1JD1A 1FFXB 4WBNA 3CC4F 3F6MA 3RYFA 2Z1UA 4DRXB 3AGKA 3CYQA 5LP6C 3CCSF 3VCZA 1JFFA 3N4ZA 2OTJF 2W8BC 2Q1YA 3I3FA 4IIJB 3WJPA 2QA4F 2K1SA 3FBAA 2IQQA 3S03A 4YJ2A 4ZHVA 2DYYA 3F0EA 3JATA 4O2BB 1U3LA 1ONIA 1VHAA 3OBYA 2HP0B 4FFBA 5B8FA 2CSLA 3NVKE 2BTUA 1VQ8F 1R1MA 3JARA 3JVHA 1XHOA 1DBFA 2L26A 1QVGF 4I50A 3Q8HA 3EORA 4X1YB 2GVIA 3QTYA 3LDTA 4B45A 5C8YB 3FD5A 3F0DA 4F6RA 1YIJF 3OONA 4X1IB 4R40B 3JASB 3J7AR 3E1YA 3GHZA 5FNVB 2ZOVA 2LBWA 3CMEF 5GONB 3LYBA 1JN1A 2QI2A 1GZ0A 1T0KB 1IV4A 5J2UA 5EYPA 2F9ZC 1JFFB 1Q8RA 1GX1A 2UYNA 3MCAB 3N2GA 1KD1H 3K14A 4NWOB 2RHHA 4O4JB 1H7MA 1W2BF 1VQNF 4G4YA 3JATB 4X20B 3V3TA 4O2BA 3IMPA 5EB1B 2H8CA 3B6NA 3S02A 2VGMA 5GANK 5JQGB 3CCUF 1Q86H 1H48A 2HQSC 5EIBC 4O4HA 4I55A 3WPWA 5DCVA 4U3JB 3HKDA 1W42A 5JH7A 4TZZA 5CA0A 4YJ3B 1W5BA 3KIZA 1UFYA 4B62A 1NJIH 2IG8A 3HKCA 5G4UC 3FPIA 1TVKA 1M90H 5JVDA 4HNAB 1SDSA 4ZHWA 3C9SA 4BVTA 4O4IA 5AVMA 4ZI7B 1J7HA 5GONA 2KG4A 2CVLA 3P0ZA 3RYHA 2OTMA 3K2XA 3VYSC 1QD9A 4G88A 5J2UB 3HTNA 2VGNA 1JJ2F 2ALEA 2B33A 1VQOF 1W3EX 3NK6A 2HS4A 1DT9A 3FD6A 5LXTA 5HY2A 1YHQF 5EIBD 4BT7A 4BT5A 4EB6B 1W57A 3CPQA 5LOVA 5LA6B 5LP6B 2CHTA 4C81A 1N8RH 4XCQA 3ZP7A 5HY4A 2KTUA 2QEXF 4U3JA 3D54A 1W5EA 5HXZA 5J2TA 5GIPC 5HY1A 4TV8A 2PMPA 1COMA 2KGWA 2I6DA 4BVSA 4EI7A 3ZOPA 1X7PA 3KJJA 3OW2F 5HP8A 1VQ7F 1VK3A 2IAFA 2ZVYA 3ZO8A 1FNKA 2ZF8A 3ESJA 4ZI7A 4ZOLA 5EZYA 4ZHYB 3N2KA 3D00A 3CCLF 3JAMM 4BY9D 3KE1A 4C8EA 2HS3A 5LYJB 3MCQA 1X52A 3WGNA 3M4SA 1XV2A 4FFBB 4TV9B 3P10A 3CCRF 2Z1EA 1TUBA 1YQNA 3NK7A 4O4LB 1K73H 3E22A 3HAXD 2YYEA 1W5FA 1W40A 3CD6F 1QVFF 5HP7A 3LWQC 5KX5B 5HY0A 1U43A 3PAFA 4ZHQB 1GO1A 4BT4A 5EO3A 3WGMA 4X3MA 1U3PA 4IHJA 1Q7YH 5A2QM 3D01A 3HJWC 1S72F 2AIZP 1NMUB 3JAKB 1JY8A 4EI8A 4LCKA 3VYTC 5HWEA 3QHDA 3F0FA 3LWRC 3V7EA 3N4YA 5IYZA 2RB9A 4X1IA 3RYIB 3FFMA 4G4ZA 2GZLA 2G9IA 3HKEB 3C9RA 3CXCF 2LBXA 3CYPB 1SA0A 4X20A 5MN6A 5EB0A 3WGJA 1KC8H 4TUYA 4DXDA 3HKBB 4BT6A 3CMAF 3E20B 2UYNB 1X7OA 2RHLA 1IV2A 5G4VC 1RLUA 3HKDB
chains in the Genus database with same CATH topology
2OTMA 1QD9A 2UYJA 3M1XA 1X25A 2DYYA 2B33A 3V4DA 1ONIA 3R0PA 1COMA 3LYBA 1FNJA 1PF5A 2CWJA 2CSLA 3ZOPA 5HP7A 3KJJA 4ZK7A 1NQ3A 2UYKA 2EWCA 5HP8A 3ZP4A 1UFYA 1XHOA 1DBFA 2IG8A 2CW4A 1UI9A 2UYNA 3I7TA 1JD1A 3MQWA 1FNKA 3QUWA 3ZO8A 4NWOB 2CHTA 3L7QA 1XRGA 2CHSA 3LMEA 3K12A 1QAHA 2UYPA 3ZP7A 3GTZA 3VCZA 2UYNB 3D01A 1QU9A 3KJKA 3M4SA 1J7HA 3I3FA 3K0TA 1ODEA 2CVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTM A;  1QD9 A;  2UYJ A;  3M1X A;  1X25 A;  2DYY A;  2B33 A;  3V4D A;  1ONI A;  3R0P A;  1COM A;  3LYB A;  1FNJ A;  1PF5 A;  2CWJ A;  2CSL A;  3ZOP A;  5HP7 A;  3KJJ A;  4ZK7 A;  1NQ3 A;  2UYK A;  2EWC A;  5HP8 A;  3ZP4 A;  1UFY A;  1XHO A;  1DBF A;  2IG8 A;  2CW4 A;  1UI9 A;  2UYN A;  3I7T A;  1JD1 A;  3MQW A;  1FNK A;  3QUW A;  3ZO8 A;  4NWO B;  2CHT A;  3L7Q A;  1XRG A;  2CHS A;  3LME A;  3K12 A;  1QAH A;  2UYP A;  3ZP7 A;  3GTZ A;  3VCZ A;  2UYN B;  3D01 A;  1QU9 A;  3KJK A;  3M4S A;  1J7H A;  3I3F A;  3K0T A;  1ODE A;  2CVL A; 
#chains in the Genus database with same CATH topology
 2QTP A;  1VQK F;  3CC2 F;  4I4T B;  2JNB A;  5KMG A;  1T0A A;  3TD4 A;  3OBW A;  1IV1 A;  2AIF A;  5EWR A;  5IJ0 B;  4IHJ B;  2R75 1;  4O4H B;  3VMF B;  2DT4 A;  2R6R 1;  1RA4 A;  3L7Q A;  5CA0 B;  2CHS A;  2UYP A;  3ON1 A;  3VTI C;  5CB4 A;  1VQV A;  2V9Y A;  4WBN B;  2KTV A;  3S0Y A;  3C9U A;  2OTL F;  1TVK B;  5MN5 A;  3CCJ F;  1GO0 A;  3V4D A;  5CA1 A;  5FLX M;  3ELC A;  1SA0 B;  3R0P A;  4IIJ A;  1VQM F;  4TUY B;  1Q82 H;  2FGY A;  1CLI A;  1E7K A;  2GLZ A;  1H47 A;  3S0H A;  2VAP A;  3VI6 A;  3DC2 A;  1FSZ A;  2CW4 A;  3MQW A;  3WGK A;  4M8I A;  1Z5W A;  1VQP F;  5IJ9 A;  3JAW B;  2YXZ A;  4LNU B;  3JAS A;  3V7Q A;  1CK2 A;  1W5A A;  1XBI A;  1W55 A;  3JAL B;  1W59 A;  5FNV A;  2NMU A;  5LP6 A;  1PXW A;  4C8G A;  5LA6 A;  1KNK A;  4U39 A;  4X1Y A;  2N48 A;  5IJ0 A;  3WJQ A;  3IEQ A;  5EYP B;  3U0O A;  5C8Y A;  3VOB A;  3N2G B;  5MN4 A;  3WXM B;  2CWJ A;  4ZOL B;  5EZY B;  3RA6 A;  1Z5V A;  3DDN A;  3J81 M;  3VIU A;  4B46 A;  3GYQ A;  3UT5 B;  1CN7 A;  3I7T A;  5ITZ A;  4NUT A;  3LWP C;  4C82 A;  3LME A;  4X1K B;  3IR9 A;  1TUB B;  4O4L A;  3RYC A;  3PLA C;  2Z1F A;  3T80 A;  1QU9 A;  3KJK A;  2HX0 A;  3CPW F;  1VQ9 F;  2FC3 A;  2VAW A;  5JH7 B;  5GAP K;  5KX5 A;  2UYJ A;  1SZQ A;  1VQ5 F;  5BMV A;  3IKF A;  1VQL F;  1FFX A;  4TV9 A;  3RYF B;  1W41 A;  5JQG A;  3CC7 F;  1NQ3 A;  5JVD B;  3MBM A;  1Q81 H;  2RHO A;  3VOA A;  4X3L A;  3CG6 A;  3ERN A;  3MDO A;  4YJ3 A;  3RYH B;  2ZAU A;  4YJ2 B;  1YIT F;  2BTO A;  1VQ6 F;  1OAP A;  3O85 A;  2AMT A;  4B5C A;  3RA5 A;  4DRX A;  2OHW A;  5IT9 M;  4RQO A;  1YJN F;  3J80 M;  5LXT B;  3M1X A;  4O4I B;  1RLG A;  1RQ2 A;  3C9T A;  3HWU A;  4C8I A;  4BT2 A;  1M1K H;  3NMU C;  1YJW F;  2LCA A;  3HKB A;  4X1K A;  2Z1T A;  1W58 1;  3CB2 A;  2LBT A;  2VXY A;  4F6R B;  1K9M H;  2HVY D;  3I56 F;  5J2T B;  3WPX A;  5FJ4 C;  3HKE A;  3JAR B;  3I55 F;  1VQ4 F;  2HS0 A;  3G71 F;  3KHN A;  5LOV B;  4I50 B;  5GIN C;  3CCM F;  2Q1X A;  5JCO C;  3K0T A;  4G4W A;  1K8A H;  3SIU A;  4BVR A;  2BTQ B;  1ZWZ A;  4BW0 B;  3NVI B;  2H6L A;  5EAZ A;  3JCM M;  3N2K B;  4BT3 A;  4ZK7 A;  5CB4 B;  1OFU A;  3TD3 A;  1UI9 A;  3IEW A;  3TD5 A;  2I6R A;  2Z01 A;  3WGL A;  2UZH A;  3WJR A;  5CA1 B;  2H8E A;  4O4J A;  1VH8 A;  3CCQ F;  3CCV F;  1IPA A;  3BYQ A;  5JCO A;  4ZHQ A;  2MQE A;  1YI2 F;  3G4S F;  5IJ9 B;  2HRY A;  4KWE A;  4HNA A;  2HP3 A;  5HXU A;  2ZVZ A;  2WAL A;  3E22 B;  4E6E A;  4I55 B;  4ERH A;  2HRU A;  3M84 A;  1U40 A;  1QAH A;  4O2A A;  2CZW A;  3HKC B;  3S0W A;  1KQS F;  5IYZ B;  3RE3 A;  1ODE A;  2P6Y A;  3JAW A;  4LNU A;  4EI9 A;  4RHA A;  3F0G A;  3JAL A;  5GIO C;  1X25 A;  3IKE A;  4EB6 A;  3UT5 A;  2ZOD A;  1FNJ A;  1PF5 A;  3LFO A;  3C8L A;  4G4V A;  3LWO C;  2RHJ A;  3JAK A;  1IV3 A;  2VAM A;  3QUW A;  2HP0 A;  3SIV A;  3G6E F;  1XRG A;  3RYI A;  3K12 A;  3GTZ A;  2PHN A;  2BO1 A;  4I4T A;  5KMG B;  3CCE F;  1YGY A;  4NQ3 A;  5ITZ B;  3VO8 A;  3ZP4 A;  3S06 A;  3P4E A;  1KNJ A;  4G4X A;  1RQ7 A;  3RYC B;  4C4W C;  4BVQ A;  1YJ9 F;  4TV8 B;  2UYK A;  2OZB A;  4PWT A;  2EWC A;  3LWV C;  5LYJ A;  3VYU C;  4O2A B;  5BMV B;  1JD1 A;  1FFX B;  4WBN A;  3CC4 F;  3F6M A;  3RYF A;  2Z1U A;  4DRX B;  3AGK A;  3CYQ A;  5LP6 C;  3CCS F;  3VCZ A;  1JFF A;  3N4Z A;  2OTJ F;  2W8B C;  2Q1Y A;  3I3F A;  4IIJ B;  3WJP A;  2QA4 F;  2K1S A;  3FBA A;  2IQQ A;  3S03 A;  4YJ2 A;  4ZHV A;  2DYY A;  3F0E A;  3JAT A;  4O2B B;  1U3L A;  1ONI A;  1VHA A;  3OBY A;  2HP0 B;  4FFB A;  5B8F A;  2CSL A;  3NVK E;  2BTU A;  1VQ8 F;  1R1M A;  3JAR A;  3JVH A;  1XHO A;  1DBF A;  2L26 A;  1QVG F;  4I50 A;  3Q8H A;  3EOR A;  4X1Y B;  2GVI A;  3QTY A;  3LDT A;  4B45 A;  5C8Y B;  3FD5 A;  3F0D A;  4F6R A;  1YIJ F;  3OON A;  4X1I B;  4R40 B;  3JAS B;  3J7A R;  3E1Y A;  3GHZ A;  5FNV B;  2ZOV A;  2LBW A;  3CME F;  5GON B;  3LYB A;  1JN1 A;  2QI2 A;  1GZ0 A;  1T0K B;  1IV4 A;  5J2U A;  5EYP A;  2F9Z C;  1JFF B;  1Q8R A;  1GX1 A;  2UYN A;  3MCA B;  3N2G A;  1KD1 H;  3K14 A;  4NWO B;  2RHH A;  4O4J B;  1H7M A;  1W2B F;  1VQN F;  4G4Y A;  3JAT B;  4X20 B;  3V3T A;  4O2B A;  3IMP A;  5EB1 B;  2H8C A;  3B6N A;  3S02 A;  2VGM A;  5GAN K;  5JQG B;  3CCU F;  1Q86 H;  1H48 A;  2HQS C;  5EIB C;  4O4H A;  4I55 A;  3WPW A;  5DCV A;  4U3J B;  3HKD A;  1W42 A;  5JH7 A;  4TZZ A;  5CA0 A;  4YJ3 B;  1W5B A;  3KIZ A;  1UFY A;  4B62 A;  1NJI H;  2IG8 A;  3HKC A;  5G4U C;  3FPI A;  1TVK A;  1M90 H;  5JVD A;  4HNA B;  1SDS A;  4ZHW A;  3C9S A;  4BVT A;  4O4I A;  5AVM A;  4ZI7 B;  1J7H A;  5GON A;  2KG4 A;  2CVL A;  3P0Z A;  3RYH A;  2OTM A;  3K2X A;  3VYS C;  1QD9 A;  4G88 A;  5J2U B;  3HTN A;  2VGN A;  1JJ2 F;  2ALE A;  2B33 A;  1VQO F;  1W3E X;  3NK6 A;  2HS4 A;  1DT9 A;  3FD6 A;  5LXT A;  5HY2 A;  1YHQ F;  5EIB D;  4BT7 A;  4BT5 A;  4EB6 B;  1W57 A;  3CPQ A;  5LOV A;  5LA6 B;  5LP6 B;  2CHT A;  4C81 A;  1N8R H;  4XCQ A;  3ZP7 A;  5HY4 A;  2KTU A;  2QEX F;  4U3J A;  3D54 A;  1W5E A;  5HXZ A;  5J2T A;  5GIP C;  5HY1 A;  4TV8 A;  2PMP A;  1COM A;  2KGW A;  2I6D A;  4BVS A;  4EI7 A;  3ZOP A;  1X7P A;  3KJJ A;  3OW2 F;  5HP8 A;  1VQ7 F;  1VK3 A;  2IAF A;  2ZVY A;  3ZO8 A;  1FNK A;  2ZF8 A;  3ESJ A;  4ZI7 A;  4ZOL A;  5EZY A;  4ZHY B;  3N2K A;  3D00 A;  3CCL F;  3JAM M;  4BY9 D;  3KE1 A;  4C8E A;  2HS3 A;  5LYJ B;  3MCQ A;  1X52 A;  3WGN A;  3M4S A;  1XV2 A;  4FFB B;  4TV9 B;  3P10 A;  3CCR F;  2Z1E A;  1TUB A;  1YQN A;  3NK7 A;  4O4L B;  1K73 H;  3E22 A;  3HAX D;  2YYE A;  1W5F A;  1W40 A;  3CD6 F;  1QVF F;  5HP7 A;  3LWQ C;  5KX5 B;  5HY0 A;  1U43 A;  3PAF A;  4ZHQ B;  1GO1 A;  4BT4 A;  5EO3 A;  3WGM A;  4X3M A;  1U3P A;  4IHJ A;  1Q7Y H;  5A2Q M;  3D01 A;  3HJW C;  1S72 F;  2AIZ P;  1NMU B;  3JAK B;  1JY8 A;  4EI8 A;  4LCK A;  3VYT C;  5HWE A;  3QHD A;  3F0F A;  3LWR C;  3V7E A;  3N4Y A;  5IYZ A;  2RB9 A;  4X1I A;  3RYI B;  3FFM A;  4G4Z A;  2GZL A;  2G9I A;  3HKE B;  3C9R A;  3CXC F;  2LBX A;  3CYP B;  1SA0 A;  4X20 A;  5MN6 A;  5EB0 A;  3WGJ A;  1KC8 H;  4TUY A;  4DXD A;  3HKB B;  4BT6 A;  3CMA F;  3E20 B;  2UYN B;  1X7O A;  2RHL A;  1IV2 A;  5G4V C;  1RLU A;  3HKD B; 
#chains in the Genus database with same CATH homology
 2OTM A;  1QD9 A;  2UYJ A;  3M1X A;  1X25 A;  2DYY A;  2B33 A;  3V4D A;  1ONI A;  3R0P A;  1COM A;  3LYB A;  1FNJ A;  1PF5 A;  2CWJ A;  2CSL A;  3ZOP A;  5HP7 A;  3KJJ A;  4ZK7 A;  1NQ3 A;  2UYK A;  2EWC A;  5HP8 A;  3ZP4 A;  1UFY A;  1XHO A;  1DBF A;  2IG8 A;  2CW4 A;  1UI9 A;  2UYN A;  3I7T A;  1JD1 A;  3MQW A;  1FNK A;  3QUW A;  3ZO8 A;  4NWO B;  2CHT A;  3L7Q A;  1XRG A;  2CHS A;  3LME A;  3K12 A;  1QAH A;  2UYP A;  3ZP7 A;  3GTZ A;  3VCZ A;  2UYN B;  3D01 A;  1QU9 A;  3KJK A;  3M4S A;  1J7H A;  3I3F A;  3K0T A;  1ODE A;  2CVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...