2OTMA

Crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
MNTPESRLVAAGLELPEVAAALGNYEPYSIVGSQLMTSGQFPYLQGKLLYQGQLGADYTVSEGYAACRLATLNAIAQLKQACGELSRIKQIYRLEGVLNVHQSCIEHPKALDGASDLLLEIFGEAGRHSRMIWTNPVMPLNSLCLVYLFAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_717567.1) from Shewanella oneidensis at 1.85 A resolution
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
total genus 45
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2otmA00
1J7HA 1QAHA 2IG8A 3ZO8A 1JD1A 1QD9A 1UFYA 2UYNA 2UYPA 1X25A 3K12A 3QUWA 2UYJA 3R0PA 2CHSA 4ZK7A 3ZOPA 1UI9A 3LYBA 5HP8A 2CHTA 3GTZA 5HP7A 2EWCA 1ODEA 3K0TA 3D01A 2UYKA 2CVLA 2CWJA 1XHOA 2UYNB 3KJKA 3L7QA 3M1XA 3M4SA 1FNKA 2OTMA 1XRGA 3MQWA 1DBFA 2DYYA 3KJJA 3LMEA 1COMA 1QU9A 3ZP7A 3I7TA 2CW4A 3V4DA 1FNJA 1NQ3A 2CSLA 3ZP4A 3VCZA 1PF5A 2B33A 4NWOB 1ONIA 3I3FA
chains in the Genus database with same CATH superfamily
4HNAA 3WGKA 2OZBA 3MBMA 3K12A 4YJ2B 5EZYB 3HKBA 4FFBA 5IJ9B 4IIJA 5GANK 1VQKF 1JFFA 3HWUA 3RE3A 4O4HA 5HP7A 3UT5A 5JVDA 4BT6A 3G71F 1M90H 3FPIA 4ZI7A 1SA0A 1IV3A 3VO8A 1COMA 4X20B 3HKDB 4ZHQA 2JNBA 1H48A 2VAMA 4TZZA 1KD1H 3ZP4A 3P4EA 5EIBC 4BT2A 3QHDA 3VTIC 4LCKA 1W59A 3BYQA 1Q82H 1YGYA 3VYSC 1JD1A 3CCUF 3NK7A 3LWRC 5HY0A 4ZK7A 2YXZA 4EI9A 2FGYA 4BT5A 4O4IA 2EWCA 1KNKA 4HNAB 3NVIB 4I55A 3MDOA 1W57A 3JCMM 2UYKA 3E22A 5J2UA 1M1KH 4I4TB 1RLGA 3WXMB 4ZOLA 4FFBB 5KMGA 1DBFA 1YJNF 3OBYA 1X52A 3S03A 4B46A 2RB9A 1FNJA 3E20B 2Z1EA 5JVDB 3UT5B 4C4WC 3V3TA 2VAPA 4BVSA 4C8IA 2R6R1 2ZVYA 5IYZB 5CB4A 5EWRA 3RYCA 2I6RA 1IPAA 1VQ7F 1SA0B 5LP6C 5DCVA 4ZHQB 3HAXD 3VIUA 3JALB 1YIJF 1Q7YH 2GLZA 1GZ0A 1FFXB 2UYNB 3JAKB 1VQPF 3IR9A 5CA0A 2OTMA 3MQWA 4YJ3A 2RHHA 5JH7A 3J81M 3IKFA 3CMAF 4O4IB 1W5EA 2VGNA 5GONA 1U43A 2B33A 4TV8B 5J2UB 1J7HA 2QEXF 2CZWA 3ZO8A 4C82A 5KMGB 4BVTA 5LOVB 2BO1A 3R0PA 2F9ZC 3LWOC 3N2GA 3LWPC 1U40A 4O2AB 5HY4A 1ODEA 1PXWA 3K0TA 3CCEF 5CB4B 1JJ2F 4X1IB 5BMVA 4F6RA 1FSZA 4BT3A 4G88A 1H47A 1K73H 4X3MA 5EZYA 3WGJA 5IJ9A 1NQ3A 2ALEA 4G4YA 3S0HA 1VQNF 2Z1UA 1XBIA 2AIFA 5HWEA 4E6EA 5G4UC 4B5CA 3IKEA 1VQ5F 4NUTA 4TV9B 5GONB 3VOAA 3WPWA 2AIZP 1VQ6F 1SZQA 3MCAB 2ZODA 3RYHB 2CVLA 4ERHA 5LXTB 1W2BF 1NJIH 3F0FA 5AVMA 2UZHA 3LMEA 4X1YA 3N2KB 3VCZA 3TD3A 3CYQA 1ONIA 3N4YA 5MN4A 1VH8A 2HS4A 3FBAA 3GYQA 1QAHA 4F6RB 3VYTC 4ZHVA 4EB6B 2LBTA 3ELCA 4I4TA 1VQ8F 1YITF 1Z5VA 2HVYD 2BTUA 2ZF8A 4PWTA 4DRXB 3WGLA 5HXUA 3SIVA 5IYZA 1VQLF 2DYYA 4C8EA 1QVFF 2H8EA 4TUYB 4X3LA 3LWVC 5FJ4C 2H6LA 5LP6A 3VI6A 1YQNA 3JALA 3ON1A 3JARB 3HKEB 2PHNA 1Z5WA 4LNUB 3U0OA 3LFOA 1FFXA 2UYNA 3JAKA 4G4WA 1X25A 2KGWA 3QUWA 2UYJA 4X1YB 3FD5A 3ZOPA 4BVQA 1YJWF 4O4LA 3CXCF 3DDNA 3WGMA 1ZWZA 3D01A 1CK2A 3IEQA 5EYPB 3HTNA 1RQ2A 4TV8A 3WJQA 1W40A 2GZLA 1VK3A 3CB2A 4IHJB 4G4VA 5LOVA 3AGKA 1GX1A 5JCOA 3JASB 1PF5A 4O2AA 3F0GA 2QI2A 5CA1B 3OW2F 3DC2A 3KHNA 4X1IA 3G6EF 1Q86H 1IV1A 2BTQB 3TD4A 5EB0A 5LP6B 3CCQF 1T0KB 3RYIB 2N48A 3M4SA 3T80A 1W5FA 4EI7A 1FNKA 4O4JB 3S02A 3HJWC 3K2XA 1VQMF 3D00A 4O4LB 2CSLA 3C8LA 5LYJB 3C9RA 4TV9A 4NWOB 5GAPK 5JQGB 3WPXA 1IV2A 3RYHA 1QD9A 5LXTA 3J80M 3CCRF 1GO1A 2Z01A 4ZHWA 3LWQC 2KTUA 3F0DA 3N2KA 5EO3A 1S72F 3F6MA 1W581 1VQ4F 2K1SA 3NMUC 3NK6A 4WBNB 4EB6A 5J2TB 5KX5B 3P0ZA 3ESJA 3FFMA 1JY8A 4R40B 4NQ3A 2QA4F 3RYFA 2PMPA 3VOBA 2R751 3HKCB 2IAFA 4DRXA 3GHZA 2HP3A 3RA5A 1U3LA 2GVIA 2UYPA 1RLUA 1W5BA 2VAWA 2HP0B 5B8FA 4G4XA 2CHTA 2I6DA 2OTLF 3S06A 4TUYA 3CCJF 3OBWA 5MN5A 3KIZA 5EIBD 3WJPA 3EORA 3C9SA 3HKEA 3JARA 3J7AR 3O85A 4LNUA 3K14A 4I50B 3QTYA 4BT7A 3V4DA 3L7QA 2WALA 1U3PA 1YHQF 3E1YA 1YJ9F 4BY9D 2ZOVA 5HY2A 5EYPA 1X7PA 1KNJA 1TUBB 1NMUB 2G9IA 4X1KA 5GINC 1UI9A 4IHJA 1QVGF 3CPQA 5HY1A 3FD6A 3RYFB 1SDSA 5HXZA 1W5AA 2P6YA 3C9TA 3TD5A 5ITZB 3D54A 3JASA 4KWEA 5CA1A 2HS0A 3VYUC 3KJJA 5IT9M 1Q8RA 3G4SF 5G4VC 2Z1FA 1OFUA 4U3JB 1X7OA 5FNVA 1XV2A 3RYIA 4XCQA 2DT4A 3CCLF 4O4JA 1W3EX 3LYBA 1TVKA 1VQOF 3N4ZA 1VQVA 3CC4F 3ERNA 5LYJA 3WGNA 3JVHA 1XHOA 2LBWA 5C8YB 1W42A 5JQGA 1CN7A 1XRGA 3S0YA 2LBXA 4X1KB 2HQSC 5LA6B 5GIOC 4ZHYB 3F0EA 3I55F 3SIUA 1RQ7A 3CC7F 2Z1TA 2LCAA 1IV4A 5IJ0B 1N8RH 3CPWF 3C9UA 2KG4A 2CHSA 4EI8A 3JATB 5HP8A 2IQQA 4WBNA 5J2TA 5KX5A 3CC2F 1W55A 3CCMF 1KQSF 2VGMA 5FNVB 3CYPB 1Q81H 2HRYA 2FC3A 3HKCA 3VMFB 3HKBB 2ZVZA 4G4ZA 4IIJB 1JFFB 4C8GA 3JAWA 2MQEA 3CD6F 1TVKB 2KTVA 4O4HB 5EAZA 3ZP7A 2CW4A 2BTOA 2HP0A 5A2QM 4ZI7B 4M8IA 4RHAA 1GO0A 3CCVF 1UFYA 2OTJF 3RA6A 4B45A 2V9YA 3GTZA 4I50A 4O2BA 1W41A 1JN1A 2L26A 5MN6A 1R1MA 5EB1B 2RHLA 1VHAA 1QU9A 3CMEF 3PLAC 1CLIA 1TUBA 4I55B 2RHOA 1RA4A 3E22B 4C81A 2H8CA 3I3FA 1KC8H 2OHWA 4ZOLB 5JCOC 1DT9A 5ITZA 3B6NA 3LDTA 2W8BC 3V7QA 3JAWB 2YYEA 2QTPA 2Q1XA 1T0AA 2Q1YA 1K9MH 3RYCB 2VXYA 4U3JA 2AMTA 3KJKA 3CG6A 2ZAUA 1YI2F 3IEWA 3NVKE 3IMPA 2HS3A 1K8AH 2HX0A 4B62A 4YJ2A 4O2BB 2HRUA 3S0WA 3JAMM 4DXDA 5CA0B 3M84A 1VQ9F 2IG8A 2RHJA 3PAFA 4YJ3B 5JH7B 5C8YA 4U39A 1H7MA 4RQOA 3Q8HA 4X20A 3HKDA 5GIPC 3V7EA 3WJRA 4BVRA 5LA6A 3P10A 1E7KA 3OONA 2CWJA 3M1XA 5FLXM 3N2GB 3MCQA 5IJ0A 3I56F 3CCSF 2NMUA 3I7TA 3JATA 3KE1A 4BW0B 4BT4A 5BMVB 1OAPA
chains in the Genus database with same CATH topology
1J7HA 1QAHA 2IG8A 3ZO8A 1JD1A 1QD9A 1UFYA 2UYNA 2UYPA 1X25A 3K12A 3QUWA 2UYJA 3R0PA 2CHSA 4ZK7A 3ZOPA 1UI9A 3LYBA 5HP8A 2CHTA 3GTZA 5HP7A 2EWCA 1ODEA 3K0TA 3D01A 2UYKA 2CVLA 2CWJA 1XHOA 2UYNB 3KJKA 3L7QA 3M1XA 3M4SA 1FNKA 2OTMA 1XRGA 3MQWA 1DBFA 2DYYA 3KJJA 3LMEA 1COMA 1QU9A 3ZP7A 3I7TA 2CW4A 3V4DA 1FNJA 1NQ3A 2CSLA 3ZP4A 3VCZA 1PF5A 2B33A 4NWOB 1ONIA 3I3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7H A;  1QAH A;  2IG8 A;  3ZO8 A;  1JD1 A;  1QD9 A;  1UFY A;  2UYN A;  2UYP A;  1X25 A;  3K12 A;  3QUW A;  2UYJ A;  3R0P A;  2CHS A;  4ZK7 A;  3ZOP A;  1UI9 A;  3LYB A;  5HP8 A;  2CHT A;  3GTZ A;  5HP7 A;  2EWC A;  1ODE A;  3K0T A;  3D01 A;  2UYK A;  2CVL A;  2CWJ A;  1XHO A;  2UYN B;  3KJK A;  3L7Q A;  3M1X A;  3M4S A;  1FNK A;  2OTM A;  1XRG A;  3MQW A;  1DBF A;  2DYY A;  3KJJ A;  3LME A;  1COM A;  1QU9 A;  3ZP7 A;  3I7T A;  2CW4 A;  3V4D A;  1FNJ A;  1NQ3 A;  2CSL A;  3ZP4 A;  3VCZ A;  1PF5 A;  2B33 A;  4NWO B;  1ONI A;  3I3F A; 
#chains in the Genus database with same CATH topology
 4HNA A;  3WGK A;  2OZB A;  3MBM A;  3K12 A;  4YJ2 B;  5EZY B;  3HKB A;  4FFB A;  5IJ9 B;  4IIJ A;  5GAN K;  1VQK F;  1JFF A;  3HWU A;  3RE3 A;  4O4H A;  5HP7 A;  3UT5 A;  5JVD A;  4BT6 A;  3G71 F;  1M90 H;  3FPI A;  4ZI7 A;  1SA0 A;  1IV3 A;  3VO8 A;  1COM A;  4X20 B;  3HKD B;  4ZHQ A;  2JNB A;  1H48 A;  2VAM A;  4TZZ A;  1KD1 H;  3ZP4 A;  3P4E A;  5EIB C;  4BT2 A;  3QHD A;  3VTI C;  4LCK A;  1W59 A;  3BYQ A;  1Q82 H;  1YGY A;  3VYS C;  1JD1 A;  3CCU F;  3NK7 A;  3LWR C;  5HY0 A;  4ZK7 A;  2YXZ A;  4EI9 A;  2FGY A;  4BT5 A;  4O4I A;  2EWC A;  1KNK A;  4HNA B;  3NVI B;  4I55 A;  3MDO A;  1W57 A;  3JCM M;  2UYK A;  3E22 A;  5J2U A;  1M1K H;  4I4T B;  1RLG A;  3WXM B;  4ZOL A;  4FFB B;  5KMG A;  1DBF A;  1YJN F;  3OBY A;  1X52 A;  3S03 A;  4B46 A;  2RB9 A;  1FNJ A;  3E20 B;  2Z1E A;  5JVD B;  3UT5 B;  4C4W C;  3V3T A;  2VAP A;  4BVS A;  4C8I A;  2R6R 1;  2ZVY A;  5IYZ B;  5CB4 A;  5EWR A;  3RYC A;  2I6R A;  1IPA A;  1VQ7 F;  1SA0 B;  5LP6 C;  5DCV A;  4ZHQ B;  3HAX D;  3VIU A;  3JAL B;  1YIJ F;  1Q7Y H;  2GLZ A;  1GZ0 A;  1FFX B;  2UYN B;  3JAK B;  1VQP F;  3IR9 A;  5CA0 A;  2OTM A;  3MQW A;  4YJ3 A;  2RHH A;  5JH7 A;  3J81 M;  3IKF A;  3CMA F;  4O4I B;  1W5E A;  2VGN A;  5GON A;  1U43 A;  2B33 A;  4TV8 B;  5J2U B;  1J7H A;  2QEX F;  2CZW A;  3ZO8 A;  4C82 A;  5KMG B;  4BVT A;  5LOV B;  2BO1 A;  3R0P A;  2F9Z C;  3LWO C;  3N2G A;  3LWP C;  1U40 A;  4O2A B;  5HY4 A;  1ODE A;  1PXW A;  3K0T A;  3CCE F;  5CB4 B;  1JJ2 F;  4X1I B;  5BMV A;  4F6R A;  1FSZ A;  4BT3 A;  4G88 A;  1H47 A;  1K73 H;  4X3M A;  5EZY A;  3WGJ A;  5IJ9 A;  1NQ3 A;  2ALE A;  4G4Y A;  3S0H A;  1VQN F;  2Z1U A;  1XBI A;  2AIF A;  5HWE A;  4E6E A;  5G4U C;  4B5C A;  3IKE A;  1VQ5 F;  4NUT A;  4TV9 B;  5GON B;  3VOA A;  3WPW A;  2AIZ P;  1VQ6 F;  1SZQ A;  3MCA B;  2ZOD A;  3RYH B;  2CVL A;  4ERH A;  5LXT B;  1W2B F;  1NJI H;  3F0F A;  5AVM A;  2UZH A;  3LME A;  4X1Y A;  3N2K B;  3VCZ A;  3TD3 A;  3CYQ A;  1ONI A;  3N4Y A;  5MN4 A;  1VH8 A;  2HS4 A;  3FBA A;  3GYQ A;  1QAH A;  4F6R B;  3VYT C;  4ZHV A;  4EB6 B;  2LBT A;  3ELC A;  4I4T A;  1VQ8 F;  1YIT F;  1Z5V A;  2HVY D;  2BTU A;  2ZF8 A;  4PWT A;  4DRX B;  3WGL A;  5HXU A;  3SIV A;  5IYZ A;  1VQL F;  2DYY A;  4C8E A;  1QVF F;  2H8E A;  4TUY B;  4X3L A;  3LWV C;  5FJ4 C;  2H6L A;  5LP6 A;  3VI6 A;  1YQN A;  3JAL A;  3ON1 A;  3JAR B;  3HKE B;  2PHN A;  1Z5W A;  4LNU B;  3U0O A;  3LFO A;  1FFX A;  2UYN A;  3JAK A;  4G4W A;  1X25 A;  2KGW A;  3QUW A;  2UYJ A;  4X1Y B;  3FD5 A;  3ZOP A;  4BVQ A;  1YJW F;  4O4L A;  3CXC F;  3DDN A;  3WGM A;  1ZWZ A;  3D01 A;  1CK2 A;  3IEQ A;  5EYP B;  3HTN A;  1RQ2 A;  4TV8 A;  3WJQ A;  1W40 A;  2GZL A;  1VK3 A;  3CB2 A;  4IHJ B;  4G4V A;  5LOV A;  3AGK A;  1GX1 A;  5JCO A;  3JAS B;  1PF5 A;  4O2A A;  3F0G A;  2QI2 A;  5CA1 B;  3OW2 F;  3DC2 A;  3KHN A;  4X1I A;  3G6E F;  1Q86 H;  1IV1 A;  2BTQ B;  3TD4 A;  5EB0 A;  5LP6 B;  3CCQ F;  1T0K B;  3RYI B;  2N48 A;  3M4S A;  3T80 A;  1W5F A;  4EI7 A;  1FNK A;  4O4J B;  3S02 A;  3HJW C;  3K2X A;  1VQM F;  3D00 A;  4O4L B;  2CSL A;  3C8L A;  5LYJ B;  3C9R A;  4TV9 A;  4NWO B;  5GAP K;  5JQG B;  3WPX A;  1IV2 A;  3RYH A;  1QD9 A;  5LXT A;  3J80 M;  3CCR F;  1GO1 A;  2Z01 A;  4ZHW A;  3LWQ C;  2KTU A;  3F0D A;  3N2K A;  5EO3 A;  1S72 F;  3F6M A;  1W58 1;  1VQ4 F;  2K1S A;  3NMU C;  3NK6 A;  4WBN B;  4EB6 A;  5J2T B;  5KX5 B;  3P0Z A;  3ESJ A;  3FFM A;  1JY8 A;  4R40 B;  4NQ3 A;  2QA4 F;  3RYF A;  2PMP A;  3VOB A;  2R75 1;  3HKC B;  2IAF A;  4DRX A;  3GHZ A;  2HP3 A;  3RA5 A;  1U3L A;  2GVI A;  2UYP A;  1RLU A;  1W5B A;  2VAW A;  2HP0 B;  5B8F A;  4G4X A;  2CHT A;  2I6D A;  2OTL F;  3S06 A;  4TUY A;  3CCJ F;  3OBW A;  5MN5 A;  3KIZ A;  5EIB D;  3WJP A;  3EOR A;  3C9S A;  3HKE A;  3JAR A;  3J7A R;  3O85 A;  4LNU A;  3K14 A;  4I50 B;  3QTY A;  4BT7 A;  3V4D A;  3L7Q A;  2WAL A;  1U3P A;  1YHQ F;  3E1Y A;  1YJ9 F;  4BY9 D;  2ZOV A;  5HY2 A;  5EYP A;  1X7P A;  1KNJ A;  1TUB B;  1NMU B;  2G9I A;  4X1K A;  5GIN C;  1UI9 A;  4IHJ A;  1QVG F;  3CPQ A;  5HY1 A;  3FD6 A;  3RYF B;  1SDS A;  5HXZ A;  1W5A A;  2P6Y A;  3C9T A;  3TD5 A;  5ITZ B;  3D54 A;  3JAS A;  4KWE A;  5CA1 A;  2HS0 A;  3VYU C;  3KJJ A;  5IT9 M;  1Q8R A;  3G4S F;  5G4V C;  2Z1F A;  1OFU A;  4U3J B;  1X7O A;  5FNV A;  1XV2 A;  3RYI A;  4XCQ A;  2DT4 A;  3CCL F;  4O4J A;  1W3E X;  3LYB A;  1TVK A;  1VQO F;  3N4Z A;  1VQV A;  3CC4 F;  3ERN A;  5LYJ A;  3WGN A;  3JVH A;  1XHO A;  2LBW A;  5C8Y B;  1W42 A;  5JQG A;  1CN7 A;  1XRG A;  3S0Y A;  2LBX A;  4X1K B;  2HQS C;  5LA6 B;  5GIO C;  4ZHY B;  3F0E A;  3I55 F;  3SIU A;  1RQ7 A;  3CC7 F;  2Z1T A;  2LCA A;  1IV4 A;  5IJ0 B;  1N8R H;  3CPW F;  3C9U A;  2KG4 A;  2CHS A;  4EI8 A;  3JAT B;  5HP8 A;  2IQQ A;  4WBN A;  5J2T A;  5KX5 A;  3CC2 F;  1W55 A;  3CCM F;  1KQS F;  2VGM A;  5FNV B;  3CYP B;  1Q81 H;  2HRY A;  2FC3 A;  3HKC A;  3VMF B;  3HKB B;  2ZVZ A;  4G4Z A;  4IIJ B;  1JFF B;  4C8G A;  3JAW A;  2MQE A;  3CD6 F;  1TVK B;  2KTV A;  4O4H B;  5EAZ A;  3ZP7 A;  2CW4 A;  2BTO A;  2HP0 A;  5A2Q M;  4ZI7 B;  4M8I A;  4RHA A;  1GO0 A;  3CCV F;  1UFY A;  2OTJ F;  3RA6 A;  4B45 A;  2V9Y A;  3GTZ A;  4I50 A;  4O2B A;  1W41 A;  1JN1 A;  2L26 A;  5MN6 A;  1R1M A;  5EB1 B;  2RHL A;  1VHA A;  1QU9 A;  3CME F;  3PLA C;  1CLI A;  1TUB A;  4I55 B;  2RHO A;  1RA4 A;  3E22 B;  4C81 A;  2H8C A;  3I3F A;  1KC8 H;  2OHW A;  4ZOL B;  5JCO C;  1DT9 A;  5ITZ A;  3B6N A;  3LDT A;  2W8B C;  3V7Q A;  3JAW B;  2YYE A;  2QTP A;  2Q1X A;  1T0A A;  2Q1Y A;  1K9M H;  3RYC B;  2VXY A;  4U3J A;  2AMT A;  3KJK A;  3CG6 A;  2ZAU A;  1YI2 F;  3IEW A;  3NVK E;  3IMP A;  2HS3 A;  1K8A H;  2HX0 A;  4B62 A;  4YJ2 A;  4O2B B;  2HRU A;  3S0W A;  3JAM M;  4DXD A;  5CA0 B;  3M84 A;  1VQ9 F;  2IG8 A;  2RHJ A;  3PAF A;  4YJ3 B;  5JH7 B;  5C8Y A;  4U39 A;  1H7M A;  4RQO A;  3Q8H A;  4X20 A;  3HKD A;  5GIP C;  3V7E A;  3WJR A;  4BVR A;  5LA6 A;  3P10 A;  1E7K A;  3OON A;  2CWJ A;  3M1X A;  5FLX M;  3N2G B;  3MCQ A;  5IJ0 A;  3I56 F;  3CCS F;  2NMU A;  3I7T A;  3JAT A;  3KE1 A;  4BW0 B;  4BT4 A;  5BMV B;  1OAP A; 
#chains in the Genus database with same CATH homology
 1J7H A;  1QAH A;  2IG8 A;  3ZO8 A;  1JD1 A;  1QD9 A;  1UFY A;  2UYN A;  2UYP A;  1X25 A;  3K12 A;  3QUW A;  2UYJ A;  3R0P A;  2CHS A;  4ZK7 A;  3ZOP A;  1UI9 A;  3LYB A;  5HP8 A;  2CHT A;  3GTZ A;  5HP7 A;  2EWC A;  1ODE A;  3K0T A;  3D01 A;  2UYK A;  2CVL A;  2CWJ A;  1XHO A;  2UYN B;  3KJK A;  3L7Q A;  3M1X A;  3M4S A;  1FNK A;  2OTM A;  1XRG A;  3MQW A;  1DBF A;  2DYY A;  3KJJ A;  3LME A;  1COM A;  1QU9 A;  3ZP7 A;  3I7T A;  2CW4 A;  3V4D A;  1FNJ A;  1NQ3 A;  2CSL A;  3ZP4 A;  3VCZ A;  1PF5 A;  2B33 A;  4NWO B;  1ONI A;  3I3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...