2OTMA

Crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
MNTPESRLVAAGLELPEVAAALGNYEPYSIVGSQLMTSGQFPYLQGKLLYQGQLGADYTVSEGYAACRLATLNAIAQLKQACGELSRIKQIYRLEGVLNVHQSCIEHPKALDGASDLLLEIFGEAGRHSRMIWTNPVMPLNSLCLVYLFAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_717567.1) from Shewanella oneidensis at 1.85 A resolution
rcsb
source organism Shewanella oneidensis
total genus 45
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14588 YjgF_endoribonc YjgF/chorismate_mutase-like, putative endoribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2otmA00
3K12A 1NQ3A 1J7HA 3QUWA 1PF5A 2B33A 2CVLA 2CWJA 3D01A 3ZO8A 3ZP7A 1UI9A 1QD9A 3GTZA 1ONIA 5HP8A 3L7QA 1UFYA 3M4SA 3ZP4A 1FNJA 1X25A 2CSLA 3KJJA 2EWCA 3ZOPA 2CHSA 2CHTA 3R0PA 1JD1A 2UYJA 1XRGA 2DYYA 3K0TA 4ZK7A 2CW4A 3I3FA 3I7TA 1ODEA 2UYKA 2UYPA 3LMEA 3VCZA 3KJKA 3LYBA 3V4DA 1QU9A 5HP7A 2OTMA 3M1XA 1DBFA 2UYNB 1FNKA 3MQWA 2UYNA 4NWOB 1XHOA 2IG8A 1COMA 1QAHA
chains in the Genus database with same CATH superfamily
3DDNA 4O2AB 1Q7YH 5LA6B 1KD1H 2G9IA 3F0DA 4ZHWA 2Z1EA 5CB4A 1VQ5F 5HXZA 3B6NA 1U43A 3CCUF 4G4XA 3HKBB 2V9YA 1TUBB 5GANK 1CN7A 3CB2A 1K9MH 5IYZA 4ZI7B 5FNVA 2I6DA 4TUYA 2H8EA 4EB6B 4NQ3A 1CK2A 1IPAA 2LCAA 4C81A 3FBAA 4O4LA 4I4TA 5C8YA 3E22B 3NK7A 1Q81H 3NVIB 1FFXA 3RYCA 2BTOA 3HJWC 2ZVYA 3CXCF 2ZVZA 1VQ7F 2UYJA 3JAWB 3HKEB 2N48A 3S0HA 5KX5A 5LXTA 1W5BA 1YI2F 5KMGA 4WBNA 5JCOA 5EIBC 4TV9B 2AIZP 2LBWA 3G71F 3K14A 3V4DA 3CG6A 4TV8A 4X20B 2BTUA 1VQKF 3CCMF 4BY9D 1Q8RA 1GX1A 3HKCB 3J7AR 5EYPA 2FGYA 3S06A 4I55B 5J2TA 1QVFF 5DCVA 1W581 3CC7F 1RLUA 1W5EA 4O4HB 2DYYA 3OBWA 3RYHA 3QHDA 5EAZA 3TD4A 5JH7B 3I56F 2UYKA 2HQSC 3E20B 3P4EA 4F6RB 4U3JB 1OFUA 5JVDB 3VIUA 4ZOLB 3VI6A 1RA4A 3MCAB 3F0FA 5HXUA 2P6YA 5IJ0B 5IT9M 2KTUA 3OONA 1U3LA 5G4VC 4YJ2B 3LDTA 4R40B 3EORA 5MN6A 3ON1A 1OAPA 3M4SA 1JFFA 1VQ9F 4IIJA 4DXDA 3ZOPA 2ZOVA 2R6R1 3NK6A 1W42A 3JATA 4BT3A 1T0KB 1XBIA 2OTLF 2UYPA 1VQNF 3J81M 3VTIC 3WPXA 1VQLF 5GONA 1X7PA 3P10A 4DRXA 4G4WA 3JAMM 3V7QA 3F0EA 1IV3A 1QAHA 1VQPF 1E7KA 5J2UB 1SZQA 1W5AA 3K12A 4IHJA 1Q82H 4O2AA 1T0AA 3S0WA 2L26A 2RHHA 5LYJB 5GIPC 3CYPB 3T80A 1X25A 5LA6A 4I50B 2CHTA 3N2KB 3CD6F 2VAPA 1H47A 3C9RA 3WGJA 3HKBA 4B46A 3DC2A 1S72F 3VOBA 3FFMA 3KE1A 3KJKA 3LWVC 1U40A 3CC2F 4ZI7A 5HY1A 3RYIB 3WXMB 4BVQA 1N8RH 2RB9A 4EB6A 1VQVA 2B33A 1UI9A 5LP6C 3HKDB 5HP8A 2Z1FA 1TVKB 3IEWA 3JVHA 2VAMA 3JARB 1VQMF 3CCEF 1JD1A 3GHZA 5JQGB 2RHJA 3JAWA 3VYUC 3HKEA 2HRYA 2HS3A 3MBMA 5ITZA 4FFBB 5EZYA 3NVKE 4B45A 1JY8A 3M84A 1YQNA 5BMVB 4TV9A 3WJRA 5GINC 3LWRC 5CA1B 3WJQA 1SA0B 2VGMA 1H7MA 4X20A 1X52A 4KWEA 2WALA 3N4ZA 2CVLA 5HY4A 3ZO8A 3HKCA 3CMEF 3JAKB 3L7QA 1GO0A 4XCQA 4I55A 4O4IA 1VQ6F 1XV2A 3HWUA 3LWPC 2ZAUA 3C9SA 3K0TA 2QI2A 4O4HA 1W55A 3JALA 4X1YB 3I7TA 3F6MA 3O85A 3N4YA 3V7EA 5JH7A 1VH8A 1W3EX 1W57A 2Z01A 3CYQA 3OW2F 1QU9A 3CCQF 4F6RA 5LP6B 2UYNB 4U3JA 4ZHYB 1X7OA 1VK3A 2VAWA 3PAFA 5JCOC 2GLZA 5JVDA 2ALEA 3C9TA 5IJ0A 3V3TA 1KNJA 2CWJA 3D01A 1W2BF 5CA0A 4BT4A 4YJ2A 1M90H 1W5FA 4B5CA 3WGNA 3UT5B 3CCRF 2CSLA 3BYQA 3C8LA 1Z5VA 3P0ZA 2YYEA 3ESJA 3MDOA 3HAXD 3S03A 1W40A 3E1YA 5LOVB 1VQ8F 2AIFA 3IKEA 1KC8H 2LBXA 1GO1A 1VHAA 1KNKA 3M1XA 4BVSA 4O2BA 2H8CA 3CPQA 3CPWF 3LWOC 1IV2A 3CCJF 3CC4F 5C8YB 4I4TB 3QUWA 4YJ3B 5J2UA 5EWRA 1FFXB 1GZ0A 4BT6A 2RHOA 1Z5WA 3ZP4A 5LYJA 2Q1XA 4BT2A 5KX5B 3JCMM 2OHWA 5IJ9B 5KMGB 3RA6A 3N2KA 2IQQA 2PMPA 1K8AH 3VYSC 1IV4A 3VCZA 4C4WC 3WGMA 2Z1TA 5HY0A 1RQ2A 1COMA 4NUTA 3ELCA 2HP3A 1YHQF 5EYPB 3Q8HA 4O4JB 1H48A 3IR9A 1JN1A 3NMUC 3HKDA 1FNJA 4X1KB 2H6LA 4EI8A 3AGKA 3SIVA 3JARA 2KGWA 5MN4A 3MCQA 5HWEA 5JQGA 3RYFB 2HS0A 2UZHA 4FFBA 1TUBA 5HP7A 5BMVA 3MQWA 1XHOA 1DT9A 3QTYA 1SA0A 1NQ3A 3JASB 1J7HA 4G88A 3LWQC 1Q86H 4PWTA 4BT7A 1KQSF 1ONIA 5HY2A 3E22A 2LBTA 3JAKA 2BTQB 3JATB 1RQ7A 3KJJA 4ZHQB 2W8BC 3IKFA 3HTNA 1XRGA 3N2GB 3CCVF 4HNAB 4C82A 4X1IB 5GONB 3IEQA 4X1YA 1YITF 3LYBA 1CLIA 2KG4A 3RA5A 3LFOA 5LP6A 2UYNA 4X3LA 1K73H 2QTPA 4LNUB 3KHNA 3S0YA 1VQOF 1RLGA 2HRUA 1IV1A 2IAFA 3C9UA 3TD5A 3IMPA 2DT4A 3S02A 3D00A 2R751 3UT5A 2CHSA 3R0PA 3PLAC 2VXYA 3I55F 1JJ2F 3ERNA 5LOVA 2HP0B 4RQOA 1NJIH 2Z1UA 3VO8A 2GZLA 4M8IA 3CCLF 1PXWA 3K2XA 4ZOLA 3J80M 2YXZA 4YJ3A 1W41A 3WGLA 3ZP7A 3GTZA 4RHAA 5CB4B 4B62A 3CMAF 3FPIA 3SIUA 3RE3A 4BW0B 5ITZB 5EZYB 2RHLA 2HX0A 3FD5A 5IJ9A 3G6EF 5IYZB 1YJWF 1YJNF 5FNVB 3KIZA 4EI7A 1ZWZA 4TUYB 1DBFA 1YJ9F 2OTJF 2FC3A 3G4SF 4O4LB 1PF5A 4O4JA 4BVRA 4C8EA 3RYCB 2OZBA 4O4IB 2MQEA 4BVTA 2HVYD 2BO1A 4C8IA 4X1KA 5GIOC 2AMTA 5LXTB 3JALB 4I50A 5EIBD 3WJPA 4E6EA 4WBNB 2CZWA 3RYFA 2VGNA 4TV8B 1FNKA 3VMFB 1QVGF 3CCSF 3FD6A 3RYIA 5B8FA 3WGKA 5CA0B 5GAPK 3JASA 5MN5A 1QD9A 2I6RA 3U0OA 3VOAA 4G4ZA 5J2TB 1U3PA 2QA4F 1TVKA 2JNBA 4ZHQA 1W59A 3RYHB 5A2QM 1SDSA 5FJ4C 2PHNA 3I3FA 3N2GA 2ZF8A 4HNAA 1ODEA 1YIJF 4O2BB 2Q1YA 2F9ZC 2KTVA 4X1IA 1M1KH 4LCKA 4BT5A 3F0GA 4EI9A 2QEXF 5CA1A 3OBYA 4LNUA 3GYQA 2ZODA 1YGYA 5AVMA 4ERHA 1JFFB 5FLXM 5G4UC 1UFYA 4IIJB 4U39A 4ZHVA 5EB0A 2EWCA 2NMUA 4TZZA 1VQ4F 4ZK7A 1NMUB 2HS4A 4G4YA 2CW4A 2K1SA 5EO3A 3VYTC 3TD3A 3LMEA 4C8GA 2HP0A 5EB1B 2OTMA 4X3MA 2GVIA 4DRXB 3D54A 1FSZA 3WPWA 4NWOB 1R1MA 4IHJB 2IG8A 4G4VA
chains in the Genus database with same CATH topology
3K12A 1NQ3A 1J7HA 3QUWA 1PF5A 2B33A 2CVLA 2CWJA 3D01A 3ZO8A 3ZP7A 1UI9A 1QD9A 3GTZA 1ONIA 5HP8A 3L7QA 1UFYA 3M4SA 3ZP4A 1FNJA 1X25A 2CSLA 3KJJA 2EWCA 3ZOPA 2CHSA 2CHTA 3R0PA 1JD1A 2UYJA 1XRGA 2DYYA 3K0TA 4ZK7A 2CW4A 3I3FA 3I7TA 1ODEA 2UYKA 2UYPA 3LMEA 3VCZA 3KJKA 3LYBA 3V4DA 1QU9A 5HP7A 2OTMA 3M1XA 1DBFA 2UYNB 1FNKA 3MQWA 2UYNA 4NWOB 1XHOA 2IG8A 1COMA 1QAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K12 A;  1NQ3 A;  1J7H A;  3QUW A;  1PF5 A;  2B33 A;  2CVL A;  2CWJ A;  3D01 A;  3ZO8 A;  3ZP7 A;  1UI9 A;  1QD9 A;  3GTZ A;  1ONI A;  5HP8 A;  3L7Q A;  1UFY A;  3M4S A;  3ZP4 A;  1FNJ A;  1X25 A;  2CSL A;  3KJJ A;  2EWC A;  3ZOP A;  2CHS A;  2CHT A;  3R0P A;  1JD1 A;  2UYJ A;  1XRG A;  2DYY A;  3K0T A;  4ZK7 A;  2CW4 A;  3I3F A;  3I7T A;  1ODE A;  2UYK A;  2UYP A;  3LME A;  3VCZ A;  3KJK A;  3LYB A;  3V4D A;  1QU9 A;  5HP7 A;  2OTM A;  3M1X A;  1DBF A;  2UYN B;  1FNK A;  3MQW A;  2UYN A;  4NWO B;  1XHO A;  2IG8 A;  1COM A;  1QAH A; 
#chains in the Genus database with same CATH topology
 3DDN A;  4O2A B;  1Q7Y H;  5LA6 B;  1KD1 H;  2G9I A;  3F0D A;  4ZHW A;  2Z1E A;  5CB4 A;  1VQ5 F;  5HXZ A;  3B6N A;  1U43 A;  3CCU F;  4G4X A;  3HKB B;  2V9Y A;  1TUB B;  5GAN K;  1CN7 A;  3CB2 A;  1K9M H;  5IYZ A;  4ZI7 B;  5FNV A;  2I6D A;  4TUY A;  2H8E A;  4EB6 B;  4NQ3 A;  1CK2 A;  1IPA A;  2LCA A;  4C81 A;  3FBA A;  4O4L A;  4I4T A;  5C8Y A;  3E22 B;  3NK7 A;  1Q81 H;  3NVI B;  1FFX A;  3RYC A;  2BTO A;  3HJW C;  2ZVY A;  3CXC F;  2ZVZ A;  1VQ7 F;  2UYJ A;  3JAW B;  3HKE B;  2N48 A;  3S0H A;  5KX5 A;  5LXT A;  1W5B A;  1YI2 F;  5KMG A;  4WBN A;  5JCO A;  5EIB C;  4TV9 B;  2AIZ P;  2LBW A;  3G71 F;  3K14 A;  3V4D A;  3CG6 A;  4TV8 A;  4X20 B;  2BTU A;  1VQK F;  3CCM F;  4BY9 D;  1Q8R A;  1GX1 A;  3HKC B;  3J7A R;  5EYP A;  2FGY A;  3S06 A;  4I55 B;  5J2T A;  1QVF F;  5DCV A;  1W58 1;  3CC7 F;  1RLU A;  1W5E A;  4O4H B;  2DYY A;  3OBW A;  3RYH A;  3QHD A;  5EAZ A;  3TD4 A;  5JH7 B;  3I56 F;  2UYK A;  2HQS C;  3E20 B;  3P4E A;  4F6R B;  4U3J B;  1OFU A;  5JVD B;  3VIU A;  4ZOL B;  3VI6 A;  1RA4 A;  3MCA B;  3F0F A;  5HXU A;  2P6Y A;  5IJ0 B;  5IT9 M;  2KTU A;  3OON A;  1U3L A;  5G4V C;  4YJ2 B;  3LDT A;  4R40 B;  3EOR A;  5MN6 A;  3ON1 A;  1OAP A;  3M4S A;  1JFF A;  1VQ9 F;  4IIJ A;  4DXD A;  3ZOP A;  2ZOV A;  2R6R 1;  3NK6 A;  1W42 A;  3JAT A;  4BT3 A;  1T0K B;  1XBI A;  2OTL F;  2UYP A;  1VQN F;  3J81 M;  3VTI C;  3WPX A;  1VQL F;  5GON A;  1X7P A;  3P10 A;  4DRX A;  4G4W A;  3JAM M;  3V7Q A;  3F0E A;  1IV3 A;  1QAH A;  1VQP F;  1E7K A;  5J2U B;  1SZQ A;  1W5A A;  3K12 A;  4IHJ A;  1Q82 H;  4O2A A;  1T0A A;  3S0W A;  2L26 A;  2RHH A;  5LYJ B;  5GIP C;  3CYP B;  3T80 A;  1X25 A;  5LA6 A;  4I50 B;  2CHT A;  3N2K B;  3CD6 F;  2VAP A;  1H47 A;  3C9R A;  3WGJ A;  3HKB A;  4B46 A;  3DC2 A;  1S72 F;  3VOB A;  3FFM A;  3KE1 A;  3KJK A;  3LWV C;  1U40 A;  3CC2 F;  4ZI7 A;  5HY1 A;  3RYI B;  3WXM B;  4BVQ A;  1N8R H;  2RB9 A;  4EB6 A;  1VQV A;  2B33 A;  1UI9 A;  5LP6 C;  3HKD B;  5HP8 A;  2Z1F A;  1TVK B;  3IEW A;  3JVH A;  2VAM A;  3JAR B;  1VQM F;  3CCE F;  1JD1 A;  3GHZ A;  5JQG B;  2RHJ A;  3JAW A;  3VYU C;  3HKE A;  2HRY A;  2HS3 A;  3MBM A;  5ITZ A;  4FFB B;  5EZY A;  3NVK E;  4B45 A;  1JY8 A;  3M84 A;  1YQN A;  5BMV B;  4TV9 A;  3WJR A;  5GIN C;  3LWR C;  5CA1 B;  3WJQ A;  1SA0 B;  2VGM A;  1H7M A;  4X20 A;  1X52 A;  4KWE A;  2WAL A;  3N4Z A;  2CVL A;  5HY4 A;  3ZO8 A;  3HKC A;  3CME F;  3JAK B;  3L7Q A;  1GO0 A;  4XCQ A;  4I55 A;  4O4I A;  1VQ6 F;  1XV2 A;  3HWU A;  3LWP C;  2ZAU A;  3C9S A;  3K0T A;  2QI2 A;  4O4H A;  1W55 A;  3JAL A;  4X1Y B;  3I7T A;  3F6M A;  3O85 A;  3N4Y A;  3V7E A;  5JH7 A;  1VH8 A;  1W3E X;  1W57 A;  2Z01 A;  3CYQ A;  3OW2 F;  1QU9 A;  3CCQ F;  4F6R A;  5LP6 B;  2UYN B;  4U3J A;  4ZHY B;  1X7O A;  1VK3 A;  2VAW A;  3PAF A;  5JCO C;  2GLZ A;  5JVD A;  2ALE A;  3C9T A;  5IJ0 A;  3V3T A;  1KNJ A;  2CWJ A;  3D01 A;  1W2B F;  5CA0 A;  4BT4 A;  4YJ2 A;  1M90 H;  1W5F A;  4B5C A;  3WGN A;  3UT5 B;  3CCR F;  2CSL A;  3BYQ A;  3C8L A;  1Z5V A;  3P0Z A;  2YYE A;  3ESJ A;  3MDO A;  3HAX D;  3S03 A;  1W40 A;  3E1Y A;  5LOV B;  1VQ8 F;  2AIF A;  3IKE A;  1KC8 H;  2LBX A;  1GO1 A;  1VHA A;  1KNK A;  3M1X A;  4BVS A;  4O2B A;  2H8C A;  3CPQ A;  3CPW F;  3LWO C;  1IV2 A;  3CCJ F;  3CC4 F;  5C8Y B;  4I4T B;  3QUW A;  4YJ3 B;  5J2U A;  5EWR A;  1FFX B;  1GZ0 A;  4BT6 A;  2RHO A;  1Z5W A;  3ZP4 A;  5LYJ A;  2Q1X A;  4BT2 A;  5KX5 B;  3JCM M;  2OHW A;  5IJ9 B;  5KMG B;  3RA6 A;  3N2K A;  2IQQ A;  2PMP A;  1K8A H;  3VYS C;  1IV4 A;  3VCZ A;  4C4W C;  3WGM A;  2Z1T A;  5HY0 A;  1RQ2 A;  1COM A;  4NUT A;  3ELC A;  2HP3 A;  1YHQ F;  5EYP B;  3Q8H A;  4O4J B;  1H48 A;  3IR9 A;  1JN1 A;  3NMU C;  3HKD A;  1FNJ A;  4X1K B;  2H6L A;  4EI8 A;  3AGK A;  3SIV A;  3JAR A;  2KGW A;  5MN4 A;  3MCQ A;  5HWE A;  5JQG A;  3RYF B;  2HS0 A;  2UZH A;  4FFB A;  1TUB A;  5HP7 A;  5BMV A;  3MQW A;  1XHO A;  1DT9 A;  3QTY A;  1SA0 A;  1NQ3 A;  3JAS B;  1J7H A;  4G88 A;  3LWQ C;  1Q86 H;  4PWT A;  4BT7 A;  1KQS F;  1ONI A;  5HY2 A;  3E22 A;  2LBT A;  3JAK A;  2BTQ B;  3JAT B;  1RQ7 A;  3KJJ A;  4ZHQ B;  2W8B C;  3IKF A;  3HTN A;  1XRG A;  3N2G B;  3CCV F;  4HNA B;  4C82 A;  4X1I B;  5GON B;  3IEQ A;  4X1Y A;  1YIT F;  3LYB A;  1CLI A;  2KG4 A;  3RA5 A;  3LFO A;  5LP6 A;  2UYN A;  4X3L A;  1K73 H;  2QTP A;  4LNU B;  3KHN A;  3S0Y A;  1VQO F;  1RLG A;  2HRU A;  1IV1 A;  2IAF A;  3C9U A;  3TD5 A;  3IMP A;  2DT4 A;  3S02 A;  3D00 A;  2R75 1;  3UT5 A;  2CHS A;  3R0P A;  3PLA C;  2VXY A;  3I55 F;  1JJ2 F;  3ERN A;  5LOV A;  2HP0 B;  4RQO A;  1NJI H;  2Z1U A;  3VO8 A;  2GZL A;  4M8I A;  3CCL F;  1PXW A;  3K2X A;  4ZOL A;  3J80 M;  2YXZ A;  4YJ3 A;  1W41 A;  3WGL A;  3ZP7 A;  3GTZ A;  4RHA A;  5CB4 B;  4B62 A;  3CMA F;  3FPI A;  3SIU A;  3RE3 A;  4BW0 B;  5ITZ B;  5EZY B;  2RHL A;  2HX0 A;  3FD5 A;  5IJ9 A;  3G6E F;  5IYZ B;  1YJW F;  1YJN F;  5FNV B;  3KIZ A;  4EI7 A;  1ZWZ A;  4TUY B;  1DBF A;  1YJ9 F;  2OTJ F;  2FC3 A;  3G4S F;  4O4L B;  1PF5 A;  4O4J A;  4BVR A;  4C8E A;  3RYC B;  2OZB A;  4O4I B;  2MQE A;  4BVT A;  2HVY D;  2BO1 A;  4C8I A;  4X1K A;  5GIO C;  2AMT A;  5LXT B;  3JAL B;  4I50 A;  5EIB D;  3WJP A;  4E6E A;  4WBN B;  2CZW A;  3RYF A;  2VGN A;  4TV8 B;  1FNK A;  3VMF B;  1QVG F;  3CCS F;  3FD6 A;  3RYI A;  5B8F A;  3WGK A;  5CA0 B;  5GAP K;  3JAS A;  5MN5 A;  1QD9 A;  2I6R A;  3U0O A;  3VOA A;  4G4Z A;  5J2T B;  1U3P A;  2QA4 F;  1TVK A;  2JNB A;  4ZHQ A;  1W59 A;  3RYH B;  5A2Q M;  1SDS A;  5FJ4 C;  2PHN A;  3I3F A;  3N2G A;  2ZF8 A;  4HNA A;  1ODE A;  1YIJ F;  4O2B B;  2Q1Y A;  2F9Z C;  2KTV A;  4X1I A;  1M1K H;  4LCK A;  4BT5 A;  3F0G A;  4EI9 A;  2QEX F;  5CA1 A;  3OBY A;  4LNU A;  3GYQ A;  2ZOD A;  1YGY A;  5AVM A;  4ERH A;  1JFF B;  5FLX M;  5G4U C;  1UFY A;  4IIJ B;  4U39 A;  4ZHV A;  5EB0 A;  2EWC A;  2NMU A;  4TZZ A;  1VQ4 F;  4ZK7 A;  1NMU B;  2HS4 A;  4G4Y A;  2CW4 A;  2K1S A;  5EO3 A;  3VYT C;  3TD3 A;  3LME A;  4C8G A;  2HP0 A;  5EB1 B;  2OTM A;  4X3M A;  2GVI A;  4DRX B;  3D54 A;  1FSZ A;  3WPW A;  4NWO B;  1R1M A;  4IHJ B;  2IG8 A;  4G4V A; 
#chains in the Genus database with same CATH homology
 3K12 A;  1NQ3 A;  1J7H A;  3QUW A;  1PF5 A;  2B33 A;  2CVL A;  2CWJ A;  3D01 A;  3ZO8 A;  3ZP7 A;  1UI9 A;  1QD9 A;  3GTZ A;  1ONI A;  5HP8 A;  3L7Q A;  1UFY A;  3M4S A;  3ZP4 A;  1FNJ A;  1X25 A;  2CSL A;  3KJJ A;  2EWC A;  3ZOP A;  2CHS A;  2CHT A;  3R0P A;  1JD1 A;  2UYJ A;  1XRG A;  2DYY A;  3K0T A;  4ZK7 A;  2CW4 A;  3I3F A;  3I7T A;  1ODE A;  2UYK A;  2UYP A;  3LME A;  3VCZ A;  3KJK A;  3LYB A;  3V4D A;  1QU9 A;  5HP7 A;  2OTM A;  3M1X A;  1DBF A;  2UYN B;  1FNK A;  3MQW A;  2UYN A;  4NWO B;  1XHO A;  2IG8 A;  1COM A;  1QAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...