1VQ8F

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq8F00
3LWPC 3CCEF 1QVFF 3CC7F 1YIJF 3VI6A 2FC3A 2QI2A 2QA4F 5G4UC 3CCJF 1IPAA 2OTJF 2KG4A 3SIUA 1RLGA 3LWOC 4C4WC 3G4SF 1X7OA 3MCAB 4X3MA 5EWRA 2QEXF 1W40A 5EO3A 3LWRC 1QVGF 1M1KH 3AGKA 3RA6A 1VQNF 5GIPC 3J81M 3CMAF 1X52A 2BO1A 1CN7A 3E20B 4NUTA 2AIFA 1M90H 3J7AR 5GAPK 1YJWF 1W2BF 1YJNF 3V7EA 3NVIB 1K8AH 1NJIH 1T0KB 3CPWF 2OTLF 1YHQF 1E7KA 3RA5A 3CCQF 3CC4F 3CCMF 3CMEF 3OBWA 5GIOC 3LFOA 4TZZA 3HJWC 3N4YA 1W41A 3CD6F 2VGMA 1VQ7F 3OW2F 1YITF 2LBXA 3WXMB 2LBWA 3NVKE 4LCKA 2JNBA 3GYQA 3NMUC 3LWQC 1N8RH 5A2QM 3ON1A 1PXWA 3NK7A 3JAMM 1KQSF 3G71F 1VQPF 2VGNA 5FLXM 1SDSA 5GANK 1VQKF 1GO1A 4BW0B 1KD1H 3CCUF 3NK6A 3N4ZA 1VQ4F 1XBIA 1VQ9F 3I55F 3LWVC 3V7QA 1CK2A 3CCVF 1W3EX 2OHWA 5G4VC 1VQOF 3VMFB 3J80M 3CCRF 3CCLF 5FJ4C 4X3LA 2ALEA 1Q81H 3IR9A 1JJ2F 2CZWA 1K9MH 5IT9M 5GINC 1YJ9F 2KTVA 3FFMA 1K73H 2I6DA 3OBYA 1ZWZA 3JCMM 1VQ6F 1VQ8F 1RA4A 3CG6A 3CXCF 1X7PA 2HVYD 1S72F 1Q82H 3HAXD 3G6EF 1VQ5F 3CPQA 1H7MA 4BY9D 1GO0A 1NMUB 3PLAC 3CCSF 1GZ0A 1YI2F 1VQMF 2OZBA 1W42A 3O85A 5DCVA 1VQLF 3I56F 1Q86H 3E1YA 3PAFA 3SIVA 2WALA 2KTUA 1Q7YH 1DT9A 1KC8H 3CC2F
chains in the Genus database with same CATH superfamily
4O4LB 3WPWA 3RYCA 3CCEF 1JFFA 2OTMA 3CC7F 3D00A 4C8GA 2FC3A 2NMUA 5LOVB 1TUBA 4YJ2B 5IJ0A 3CCJF 3RYHB 2KG4A 4FFBA 3SIUA 3KJJA 3LWOC 5EB1B 1RLUA 4X20B 3MCAB 4X3MA 5LA6B 2QEXF 2DYYA 2AMTA 4EB6A 3P4EA 1X52A 2BO1A 4TUYA 2AIFA 4G4YA 3J7AR 3V7EA 3NVIB 1K8AH 4ZI7A 1YQNA 2BTUA 3CPWF 2OTLF 1E7KA 4O4HA 3RYCB 1U3PA 3WGNA 3JATA 1W5FA 3HKDB 2UYNB 1TUBB 4E6EA 4X1IA 5JQGA 2VAMA 4G4VA 1W41A 3CD6F 4G4ZA 3RYIA 3I7TA 3JARA 5ITZB 4TV8B 3F0EA 2CSLA 2JNBA 3WGKA 3NMUC 4EB6B 3LWQC 4TV9B 2R6R1 5B8FA 3ON1A 2GZLA 4I55A 3JAMM 3JVHA 1YGYA 2P6YA 1VQPF 4X1YA 2VGNA 3TD3A 1SDSA 4B46A 1GO1A 3MBMA 3C9TA 4O2AB 3CCUF 2PMPA 3MDOA 3FD5A 4F6RB 1W3EX 1COMA 2OHWA 4R40B 3VMFB 2CHSA 4I4TA 4EI8A 2Z01A 4ZOLB 3ZP7A 5EIBC 1XV2A 5IT9M 4B62A 4IIJB 1YJ9F 2KTVA 5BMVA 5AVMA 3OBYA 1RA4A 3S0WA 5HXZA 4DRXB 1Q82H 1SA0A 3WGLA 3IEQA 3HAXD 5LYJA 1U3LA 5CB4B 2DT4A 1H7MA 1VQ5F 1NMUB 1VH8A 3IKFA 2IG8A 5C8YB 4X1KB 3E22B 5CA1A 3O85A 4WBNA 4YJ3A 2L26A 5EB0A 4XCQA 1VQLF 5LP6B 3DDNA 2RB9A 3K0TA 2WALA 2HRUA 3JAWB 4HNAB 3T80A 1KC8H 4G88A 1H47A 3S02A 2N48A 3VI6A 4BT2A 3VOBA 3VCZA 1JD1A 4IHJA 3U0OA 3ZP4A 3JAKB 1IPAA 4C8EA 3JALB 2HX0A 4BT3A 4C4WC 5KMGB 1X7OA 1T0AA 1W40A 4I50B 3LWRC 1QVGF 2HP0B 1M1KH 3RA6A 2EWCA 3ESJA 5J2TB 5GIPC 4WBNB 5LXTA 4YJ3B 5EAZA 1XHOA 2RHHA 5HY0A 3CMAF 5EYPB 2GVIA 4NWOB 5GAPK 1CLIA 3EORA 4ZHQA 1YJWF 1W2BF 1FSZA 3D01A 3RYFB 3IEWA 5GONB 5KX5A 4O4IB 2W8BC 5MN6A 2RHOA 3CMEF 1R1MA 1J7HA 3LFOA 3HJWC 5JH7B 1VQ7F 3K2XA 3OW2F 3C9UA 3M4SA 5EZYA 4U3JB 5MN4A 2Z1EA 4DXDA 3VOAA 5JVDA 1N8RH 1DBFA 1QD9A 3IMPA 1RQ7A 3HKCB 2LCAA 1KQSF 3G71F 4U39A 4LNUA 3S0YA 5FLXM 1W59A 2HS4A 1SZQA 1VQKF 4BW0B 5JCOC 1JN1A 2ZVZA 1JFFB 1XBIA 2UZHA 1X25A 3I55F 3V7QA 1CK2A 2QTPA 5G4VC 5IJ0B 3P10A 1VQOF 3CCLF 5FJ4C 4FFBB 3WGMA 5IYZA 3ZOPA 3R0PA 5HY4A 3S0HA 1W5AA 2CZWA 1U43A 2YYEA 5GINC 1TVKA 4EI7A 3QUWA 4BT7A 3HKEA 1K73H 2I6DA 5EZYB 1ZWZA 3MQWA 5IJ9A 1VQ8F 2R751 1VQ6F 3CXCF 2V9YA 5JVDB 2Q1XA 2ZAUA 4TUYB 3V4DA 4BY9D 3CPQA 1GO0A 3PLAC 2Q1YA 3WJQA 3N2GA 3RE3A 4ZI7B 4ZHVA 2ZODA 4O4HB 1VK3A 1Q86H 3JATB 2ZF8A 2F9ZC 3C8LA 3SIVA 4X1IB 2BTQB 5JQGB 1FFXA 5IYZB 3RYIB 1DT9A 1FNKA 4BT5A 3CC2F 3JARB 1IV4A 3HKBA 3LWPC 1QVFF 1YIJF 2OTJF 4G4XA 4I55B 2B33A 4X1YB 1W5EA 3MCQA 5EWRA 3KHNA 2H6LA 5EO3A 3WPXA 2Z1FA 3AGKA 5CA0A 1VQNF 2YXZA 5HWEA 3F0FA 1KNJA 4KWEA 5FNVA 4I4TB 1Z5VA 5LP6C 2CWJA 3K12A 1YJNF 3N2KA 5BMVB 3M1XA 3RA5A 3V3TA 3CCQF 4O2BA 5GIOC 2UYKA 1SA0B 2PHNA 3N4YA 3JASA 3TD5A 5LYJB 2VGMA 3LMEA 1YITF 4G4WA 4O4JA 2CW4A 3WXMB 2LBWA 3VO8A 2IQQA 3NVKE 1QU9A 1W55A 2ZVYA 5CA1B 3GYQA 5LOVA 4YJ2A 3VIUA 3CYPB 5A2QM 3KJKA 3RYHA 1NQ3A 3NK7A 3VYTC 1RQ2A 3UT5A 3CB2A 5HY2A 4X20A 4C81A 5LA6A 2CVLA 2Z1UA 3NK6A 3N4ZA 1VQ4F 1UI9A 1VQ9F 3LWVC 1OAPA 5HP7A 3CCVF 4BVTA 3S03A 4IHJB 3VTIC 3J80M 3CCRF 1QAHA 2KGWA 3FBAA 5JCOA 2ALEA 3IR9A 3K14A 1JJ2F 1VHAA 2MQEA 4O4JB 3JCMM 1XRGA 3CG6A 2H8CA 1X7PA 5LXTB 3HKDA 3CYQA 2UYNA 4PWTA 5HXUA 1S72F 1GX1A 3G6EF 3QHDA 3ELCA 4ZHQB 3UT5B 3CCSF 5ITZA 4TV8A 3FPIA 1VQMF 1W57A 5KX5B 1W42A 4BVQA 2HS3A 4TV9A 3S06A 3ZO8A 3E1YA 3PAFA 1Z5WA 1H48A 4O2AA 4BT6A 3WJPA 3C9SA 5HP8A 4EI9A 3KIZA 2GLZA 4F6RA 3QTYA 2AIZP 2QI2A 2QA4F 4M8IA 5G4UC 4B45A 3DC2A 1RLGA 3G4SF 4ZOLA 4B5CA 4LNUB 4RHAA 2VXYA 3ERNA 4IIJA 1ONIA 1KNKA 2H8EA 4C82A 3J81M 4DRXA 1CN7A 3E20B 4NUTA 3P0ZA 4ERHA 3VYSC 4BVSA 5CB4A 1M90H 2UYJA 4RQOA 3L7QA 1U40A 1TVKB 3KE1A 5EIBD 1NJIH 1T0KB 5C8YA 3HKEB 4X1KA 3E22A 1ODEA 4BVRA 1YHQF 5IJ9B 3CC4F 2VAWA 5LP6A 3CCMF 1W5BA 3OBWA 4NQ3A 4TZZA 3JAWA 4HNAA 5HY1A 2BTOA 2LBXA 1JY8A 3N2GB 3LDTA 4LCKA 3GHZA 2I6RA 2HP3A 1FNJA 2ZOVA 3C9RA 5J2UA 4ZHWA 1IV1A 3JAKA 3JALA 1PXWA 4ZK7A 3F0GA 3IKEA 3BYQA 1FFXB 5MN5A 5KMGA 5GANK 1OFUA 3F6MA 3WJRA 1VQVA 4I50A 3VYUC 3HKBB 1KD1H 2HP0A 2FGYA 3HTNA 2RHLA 2G9IA 3I3FA 5J2TA 2UYPA 3HWUA 3M84A 2Z1TA 1IV2A 5EYPA 4X3LA 2LBTA 1Q81H 4BT4A 4O4LA 2HQSC 3TD4A 1IV3A 1K9MH 1W581 3RYFA 3GTZA 5GONA 3FFMA 4C8IA 4O4IA 5CA0B 3F0DA 2HRYA 2CHTA 3OONA 2HVYD 5J2UB 2VAPA 5FNVB 1UFYA 2K1SA 3D54A 5JH7A 1GZ0A 3LYBA 1YI2F 4U3JA 3N2KB 2IAFA 2OZBA 3Q8HA 5DCVA 4ZHYB 3I56F 4O2BB 1Q8RA 3WGJA 2HS0A 2RHJA 3HKCA 3B6NA 2KTUA 3FD6A 3JASB 1Q7YH 1PF5A
chains in the Genus database with same CATH topology
4EI9A 3LWPC 3CCEF 1QVFF 3CC7F 3D00A 1YIJF 2GLZA 2FC3A 3VI6A 2QI2A 2QA4F 5G4UC 3CCJF 1IPAA 2OTJF 2KG4A 3SIUA 1RLGA 3LWOC 4C4WC 3G4SF 1X7OA 3MCAB 4X3MA 5EWRA 2QEXF 1W40A 5EO3A 3LWRC 1QVGF 1M1KH 3AGKA 3RA6A 1VQNF 5GIPC 3J81M 3CMAF 5HWEA 1X52A 2BO1A 5HY0A 1CN7A 3E20B 4NUTA 2AIFA 1M90H 4BVSA 5GAPK 3J7AR 1YJWF 1W2BF 1YJNF 3V7EA 3NVIB 1K8AH 1NJIH 1T0KB 3CPWF 2OTLF 4BVRA 1YHQF 1E7KA 3RA5A 3V3TA 3CCQF 3CC4F 3CCMF 3CMEF 3OBWA 5GIOC 4NQ3A 3LFOA 4TZZA 3HJWC 3N4YA 1W41A 3CD6F 2VGMA 1VQ7F 3OW2F 1YITF 5HY1A 2LBXA 3WXMB 2LBWA 3NVKE 4LCKA 2JNBA 3GYQA 3NMUC 3LWQC 1N8RH 5A2QM 3ON1A 1PXWA 3NK7A 3JAMM 1KQSF 5HY2A 3G71F 1VQPF 2VGNA 5FLXM 1SDSA 5GANK 1VQKF 1GO1A 4BW0B 1KD1H 3CCUF 3NK6A 3N4ZA 1VQ4F 2FGYA 1XBIA 1VQ9F 3I55F 3LWVC 3V7QA 1CK2A 3CCVF 4BVTA 1W3EX 2OHWA 5G4VC 1VQOF 3VMFB 3J80M 3CCRF 3CCLF 5FJ4C 4EI8A 4X3LA 2ALEA 5HY4A 3IR9A 1Q81H 1JJ2F 2CZWA 1K9MH 5IT9M 5GINC 4EI7A 1YJ9F 2KTVA 3FFMA 1K73H 2I6DA 3OBYA 1ZWZA 3JCMM 1VQ6F 1VQ8F 1RA4A 3CG6A 3CXCF 1X7PA 5HXZA 2HVYD 5HXUA 1S72F 1Q82H 3HAXD 3G6EF 1VQ5F 3CPQA 1H7MA 4BY9D 1GO0A 1NMUB 3PLAC 3CCSF 1GZ0A 1YI2F 1VQMF 2OZBA 1W42A 3O85A 4BVQA 5DCVA 4XCQA 1VQLF 3I56F 1Q86H 3E1YA 3PAFA 2F9ZC 3SIVA 2WALA 2KTUA 1Q7YH 1DT9A 1KC8H 3CC2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWP C;  3CCE F;  1QVF F;  3CC7 F;  1YIJ F;  3VI6 A;  2FC3 A;  2QI2 A;  2QA4 F;  5G4U C;  3CCJ F;  1IPA A;  2OTJ F;  2KG4 A;  3SIU A;  1RLG A;  3LWO C;  4C4W C;  3G4S F;  1X7O A;  3MCA B;  4X3M A;  5EWR A;  2QEX F;  1W40 A;  5EO3 A;  3LWR C;  1QVG F;  1M1K H;  3AGK A;  3RA6 A;  1VQN F;  5GIP C;  3J81 M;  3CMA F;  1X52 A;  2BO1 A;  1CN7 A;  3E20 B;  4NUT A;  2AIF A;  1M90 H;  3J7A R;  5GAP K;  1YJW F;  1W2B F;  1YJN F;  3V7E A;  3NVI B;  1K8A H;  1NJI H;  1T0K B;  3CPW F;  2OTL F;  1YHQ F;  1E7K A;  3RA5 A;  3CCQ F;  3CC4 F;  3CCM F;  3CME F;  3OBW A;  5GIO C;  3LFO A;  4TZZ A;  3HJW C;  3N4Y A;  1W41 A;  3CD6 F;  2VGM A;  1VQ7 F;  3OW2 F;  1YIT F;  2LBX A;  3WXM B;  2LBW A;  3NVK E;  4LCK A;  2JNB A;  3GYQ A;  3NMU C;  3LWQ C;  1N8R H;  5A2Q M;  3ON1 A;  1PXW A;  3NK7 A;  3JAM M;  1KQS F;  3G71 F;  1VQP F;  2VGN A;  5FLX M;  1SDS A;  5GAN K;  1VQK F;  1GO1 A;  4BW0 B;  1KD1 H;  3CCU F;  3NK6 A;  3N4Z A;  1VQ4 F;  1XBI A;  1VQ9 F;  3I55 F;  3LWV C;  3V7Q A;  1CK2 A;  3CCV F;  1W3E X;  2OHW A;  5G4V C;  1VQO F;  3VMF B;  3J80 M;  3CCR F;  3CCL F;  5FJ4 C;  4X3L A;  2ALE A;  1Q81 H;  3IR9 A;  1JJ2 F;  2CZW A;  1K9M H;  5IT9 M;  5GIN C;  1YJ9 F;  2KTV A;  3FFM A;  1K73 H;  2I6D A;  3OBY A;  1ZWZ A;  3JCM M;  1VQ6 F;  1VQ8 F;  1RA4 A;  3CG6 A;  3CXC F;  1X7P A;  2HVY D;  1S72 F;  1Q82 H;  3HAX D;  3G6E F;  1VQ5 F;  3CPQ A;  1H7M A;  4BY9 D;  1GO0 A;  1NMU B;  3PLA C;  3CCS F;  1GZ0 A;  1YI2 F;  1VQM F;  2OZB A;  1W42 A;  3O85 A;  5DCV A;  1VQL F;  3I56 F;  1Q86 H;  3E1Y A;  3PAF A;  3SIV A;  2WAL A;  2KTU A;  1Q7Y H;  1DT9 A;  1KC8 H;  3CC2 F; 
#chains in the Genus database with same CATH topology
 4O4L B;  3WPW A;  3RYC A;  3CCE F;  1JFF A;  2OTM A;  3CC7 F;  3D00 A;  4C8G A;  2FC3 A;  2NMU A;  5LOV B;  1TUB A;  4YJ2 B;  5IJ0 A;  3CCJ F;  3RYH B;  2KG4 A;  4FFB A;  3SIU A;  3KJJ A;  3LWO C;  5EB1 B;  1RLU A;  4X20 B;  3MCA B;  4X3M A;  5LA6 B;  2QEX F;  2DYY A;  2AMT A;  4EB6 A;  3P4E A;  1X52 A;  2BO1 A;  4TUY A;  2AIF A;  4G4Y A;  3J7A R;  3V7E A;  3NVI B;  1K8A H;  4ZI7 A;  1YQN A;  2BTU A;  3CPW F;  2OTL F;  1E7K A;  4O4H A;  3RYC B;  1U3P A;  3WGN A;  3JAT A;  1W5F A;  3HKD B;  2UYN B;  1TUB B;  4E6E A;  4X1I A;  5JQG A;  2VAM A;  4G4V A;  1W41 A;  3CD6 F;  4G4Z A;  3RYI A;  3I7T A;  3JAR A;  5ITZ B;  4TV8 B;  3F0E A;  2CSL A;  2JNB A;  3WGK A;  3NMU C;  4EB6 B;  3LWQ C;  4TV9 B;  2R6R 1;  5B8F A;  3ON1 A;  2GZL A;  4I55 A;  3JAM M;  3JVH A;  1YGY A;  2P6Y A;  1VQP F;  4X1Y A;  2VGN A;  3TD3 A;  1SDS A;  4B46 A;  1GO1 A;  3MBM A;  3C9T A;  4O2A B;  3CCU F;  2PMP A;  3MDO A;  3FD5 A;  4F6R B;  1W3E X;  1COM A;  2OHW A;  4R40 B;  3VMF B;  2CHS A;  4I4T A;  4EI8 A;  2Z01 A;  4ZOL B;  3ZP7 A;  5EIB C;  1XV2 A;  5IT9 M;  4B62 A;  4IIJ B;  1YJ9 F;  2KTV A;  5BMV A;  5AVM A;  3OBY A;  1RA4 A;  3S0W A;  5HXZ A;  4DRX B;  1Q82 H;  1SA0 A;  3WGL A;  3IEQ A;  3HAX D;  5LYJ A;  1U3L A;  5CB4 B;  2DT4 A;  1H7M A;  1VQ5 F;  1NMU B;  1VH8 A;  3IKF A;  2IG8 A;  5C8Y B;  4X1K B;  3E22 B;  5CA1 A;  3O85 A;  4WBN A;  4YJ3 A;  2L26 A;  5EB0 A;  4XCQ A;  1VQL F;  5LP6 B;  3DDN A;  2RB9 A;  3K0T A;  2WAL A;  2HRU A;  3JAW B;  4HNA B;  3T80 A;  1KC8 H;  4G88 A;  1H47 A;  3S02 A;  2N48 A;  3VI6 A;  4BT2 A;  3VOB A;  3VCZ A;  1JD1 A;  4IHJ A;  3U0O A;  3ZP4 A;  3JAK B;  1IPA A;  4C8E A;  3JAL B;  2HX0 A;  4BT3 A;  4C4W C;  5KMG B;  1X7O A;  1T0A A;  1W40 A;  4I50 B;  3LWR C;  1QVG F;  2HP0 B;  1M1K H;  3RA6 A;  2EWC A;  3ESJ A;  5J2T B;  5GIP C;  4WBN B;  5LXT A;  4YJ3 B;  5EAZ A;  1XHO A;  2RHH A;  5HY0 A;  3CMA F;  5EYP B;  2GVI A;  4NWO B;  5GAP K;  1CLI A;  3EOR A;  4ZHQ A;  1YJW F;  1W2B F;  1FSZ A;  3D01 A;  3RYF B;  3IEW A;  5GON B;  5KX5 A;  4O4I B;  2W8B C;  5MN6 A;  2RHO A;  3CME F;  1R1M A;  1J7H A;  3LFO A;  3HJW C;  5JH7 B;  1VQ7 F;  3K2X A;  3OW2 F;  3C9U A;  3M4S A;  5EZY A;  4U3J B;  5MN4 A;  2Z1E A;  4DXD A;  3VOA A;  5JVD A;  1N8R H;  1DBF A;  1QD9 A;  3IMP A;  1RQ7 A;  3HKC B;  2LCA A;  1KQS F;  3G71 F;  4U39 A;  4LNU A;  3S0Y A;  5FLX M;  1W59 A;  2HS4 A;  1SZQ A;  1VQK F;  4BW0 B;  5JCO C;  1JN1 A;  2ZVZ A;  1JFF B;  1XBI A;  2UZH A;  1X25 A;  3I55 F;  3V7Q A;  1CK2 A;  2QTP A;  5G4V C;  5IJ0 B;  3P10 A;  1VQO F;  3CCL F;  5FJ4 C;  4FFB B;  3WGM A;  5IYZ A;  3ZOP A;  3R0P A;  5HY4 A;  3S0H A;  1W5A A;  2CZW A;  1U43 A;  2YYE A;  5GIN C;  1TVK A;  4EI7 A;  3QUW A;  4BT7 A;  3HKE A;  1K73 H;  2I6D A;  5EZY B;  1ZWZ A;  3MQW A;  5IJ9 A;  1VQ8 F;  2R75 1;  1VQ6 F;  3CXC F;  2V9Y A;  5JVD B;  2Q1X A;  2ZAU A;  4TUY B;  3V4D A;  4BY9 D;  3CPQ A;  1GO0 A;  3PLA C;  2Q1Y A;  3WJQ A;  3N2G A;  3RE3 A;  4ZI7 B;  4ZHV A;  2ZOD A;  4O4H B;  1VK3 A;  1Q86 H;  3JAT B;  2ZF8 A;  2F9Z C;  3C8L A;  3SIV A;  4X1I B;  2BTQ B;  5JQG B;  1FFX A;  5IYZ B;  3RYI B;  1DT9 A;  1FNK A;  4BT5 A;  3CC2 F;  3JAR B;  1IV4 A;  3HKB A;  3LWP C;  1QVF F;  1YIJ F;  2OTJ F;  4G4X A;  4I55 B;  2B33 A;  4X1Y B;  1W5E A;  3MCQ A;  5EWR A;  3KHN A;  2H6L A;  5EO3 A;  3WPX A;  2Z1F A;  3AGK A;  5CA0 A;  1VQN F;  2YXZ A;  5HWE A;  3F0F A;  1KNJ A;  4KWE A;  5FNV A;  4I4T B;  1Z5V A;  5LP6 C;  2CWJ A;  3K12 A;  1YJN F;  3N2K A;  5BMV B;  3M1X A;  3RA5 A;  3V3T A;  3CCQ F;  4O2B A;  5GIO C;  2UYK A;  1SA0 B;  2PHN A;  3N4Y A;  3JAS A;  3TD5 A;  5LYJ B;  2VGM A;  3LME A;  1YIT F;  4G4W A;  4O4J A;  2CW4 A;  3WXM B;  2LBW A;  3VO8 A;  2IQQ A;  3NVK E;  1QU9 A;  1W55 A;  2ZVY A;  5CA1 B;  3GYQ A;  5LOV A;  4YJ2 A;  3VIU A;  3CYP B;  5A2Q M;  3KJK A;  3RYH A;  1NQ3 A;  3NK7 A;  3VYT C;  1RQ2 A;  3UT5 A;  3CB2 A;  5HY2 A;  4X20 A;  4C81 A;  5LA6 A;  2CVL A;  2Z1U A;  3NK6 A;  3N4Z A;  1VQ4 F;  1UI9 A;  1VQ9 F;  3LWV C;  1OAP A;  5HP7 A;  3CCV F;  4BVT A;  3S03 A;  4IHJ B;  3VTI C;  3J80 M;  3CCR F;  1QAH A;  2KGW A;  3FBA A;  5JCO A;  2ALE A;  3IR9 A;  3K14 A;  1JJ2 F;  1VHA A;  2MQE A;  4O4J B;  3JCM M;  1XRG A;  3CG6 A;  2H8C A;  1X7P A;  5LXT B;  3HKD A;  3CYQ A;  2UYN A;  4PWT A;  5HXU A;  1S72 F;  1GX1 A;  3G6E F;  3QHD A;  3ELC A;  4ZHQ B;  3UT5 B;  3CCS F;  5ITZ A;  4TV8 A;  3FPI A;  1VQM F;  1W57 A;  5KX5 B;  1W42 A;  4BVQ A;  2HS3 A;  4TV9 A;  3S06 A;  3ZO8 A;  3E1Y A;  3PAF A;  1Z5W A;  1H48 A;  4O2A A;  4BT6 A;  3WJP A;  3C9S A;  5HP8 A;  4EI9 A;  3KIZ A;  2GLZ A;  4F6R A;  3QTY A;  2AIZ P;  2QI2 A;  2QA4 F;  4M8I A;  5G4U C;  4B45 A;  3DC2 A;  1RLG A;  3G4S F;  4ZOL A;  4B5C A;  4LNU B;  4RHA A;  2VXY A;  3ERN A;  4IIJ A;  1ONI A;  1KNK A;  2H8E A;  4C82 A;  3J81 M;  4DRX A;  1CN7 A;  3E20 B;  4NUT A;  3P0Z A;  4ERH A;  3VYS C;  4BVS A;  5CB4 A;  1M90 H;  2UYJ A;  4RQO A;  3L7Q A;  1U40 A;  1TVK B;  3KE1 A;  5EIB D;  1NJI H;  1T0K B;  5C8Y A;  3HKE B;  4X1K A;  3E22 A;  1ODE A;  4BVR A;  1YHQ F;  5IJ9 B;  3CC4 F;  2VAW A;  5LP6 A;  3CCM F;  1W5B A;  3OBW A;  4NQ3 A;  4TZZ A;  3JAW A;  4HNA A;  5HY1 A;  2BTO A;  2LBX A;  1JY8 A;  3N2G B;  3LDT A;  4LCK A;  3GHZ A;  2I6R A;  2HP3 A;  1FNJ A;  2ZOV A;  3C9R A;  5J2U A;  4ZHW A;  1IV1 A;  3JAK A;  3JAL A;  1PXW A;  4ZK7 A;  3F0G A;  3IKE A;  3BYQ A;  1FFX B;  5MN5 A;  5KMG A;  5GAN K;  1OFU A;  3F6M A;  3WJR A;  1VQV A;  4I50 A;  3VYU C;  3HKB B;  1KD1 H;  2HP0 A;  2FGY A;  3HTN A;  2RHL A;  2G9I A;  3I3F A;  5J2T A;  2UYP A;  3HWU A;  3M84 A;  2Z1T A;  1IV2 A;  5EYP A;  4X3L A;  2LBT A;  1Q81 H;  4BT4 A;  4O4L A;  2HQS C;  3TD4 A;  1IV3 A;  1K9M H;  1W58 1;  3RYF A;  3GTZ A;  5GON A;  3FFM A;  4C8I A;  4O4I A;  5CA0 B;  3F0D A;  2HRY A;  2CHT A;  3OON A;  2HVY D;  5J2U B;  2VAP A;  5FNV B;  1UFY A;  2K1S A;  3D54 A;  5JH7 A;  1GZ0 A;  3LYB A;  1YI2 F;  4U3J A;  3N2K B;  2IAF A;  2OZB A;  3Q8H A;  5DCV A;  4ZHY B;  3I56 F;  4O2B B;  1Q8R A;  3WGJ A;  2HS0 A;  2RHJ A;  3HKC A;  3B6N A;  2KTU A;  3FD6 A;  3JAS B;  1Q7Y H;  1PF5 A; 
#chains in the Genus database with same CATH homology
 4EI9 A;  3LWP C;  3CCE F;  1QVF F;  3CC7 F;  3D00 A;  1YIJ F;  2GLZ A;  2FC3 A;  3VI6 A;  2QI2 A;  2QA4 F;  5G4U C;  3CCJ F;  1IPA A;  2OTJ F;  2KG4 A;  3SIU A;  1RLG A;  3LWO C;  4C4W C;  3G4S F;  1X7O A;  3MCA B;  4X3M A;  5EWR A;  2QEX F;  1W40 A;  5EO3 A;  3LWR C;  1QVG F;  1M1K H;  3AGK A;  3RA6 A;  1VQN F;  5GIP C;  3J81 M;  3CMA F;  5HWE A;  1X52 A;  2BO1 A;  5HY0 A;  1CN7 A;  3E20 B;  4NUT A;  2AIF A;  1M90 H;  4BVS A;  5GAP K;  3J7A R;  1YJW F;  1W2B F;  1YJN F;  3V7E A;  3NVI B;  1K8A H;  1NJI H;  1T0K B;  3CPW F;  2OTL F;  4BVR A;  1YHQ F;  1E7K A;  3RA5 A;  3V3T A;  3CCQ F;  3CC4 F;  3CCM F;  3CME F;  3OBW A;  5GIO C;  4NQ3 A;  3LFO A;  4TZZ A;  3HJW C;  3N4Y A;  1W41 A;  3CD6 F;  2VGM A;  1VQ7 F;  3OW2 F;  1YIT F;  5HY1 A;  2LBX A;  3WXM B;  2LBW A;  3NVK E;  4LCK A;  2JNB A;  3GYQ A;  3NMU C;  3LWQ C;  1N8R H;  5A2Q M;  3ON1 A;  1PXW A;  3NK7 A;  3JAM M;  1KQS F;  5HY2 A;  3G71 F;  1VQP F;  2VGN A;  5FLX M;  1SDS A;  5GAN K;  1VQK F;  1GO1 A;  4BW0 B;  1KD1 H;  3CCU F;  3NK6 A;  3N4Z A;  1VQ4 F;  2FGY A;  1XBI A;  1VQ9 F;  3I55 F;  3LWV C;  3V7Q A;  1CK2 A;  3CCV F;  4BVT A;  1W3E X;  2OHW A;  5G4V C;  1VQO F;  3VMF B;  3J80 M;  3CCR F;  3CCL F;  5FJ4 C;  4EI8 A;  4X3L A;  2ALE A;  5HY4 A;  3IR9 A;  1Q81 H;  1JJ2 F;  2CZW A;  1K9M H;  5IT9 M;  5GIN C;  4EI7 A;  1YJ9 F;  2KTV A;  3FFM A;  1K73 H;  2I6D A;  3OBY A;  1ZWZ A;  3JCM M;  1VQ6 F;  1VQ8 F;  1RA4 A;  3CG6 A;  3CXC F;  1X7P A;  5HXZ A;  2HVY D;  5HXU A;  1S72 F;  1Q82 H;  3HAX D;  3G6E F;  1VQ5 F;  3CPQ A;  1H7M A;  4BY9 D;  1GO0 A;  1NMU B;  3PLA C;  3CCS F;  1GZ0 A;  1YI2 F;  1VQM F;  2OZB A;  1W42 A;  3O85 A;  4BVQ A;  5DCV A;  4XCQ A;  1VQL F;  3I56 F;  1Q86 H;  3E1Y A;  3PAF A;  2F9Z C;  3SIV A;  2WAL A;  2KTU A;  1Q7Y H;  1DT9 A;  1KC8 H;  3CC2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...