1VQ8F

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq8F00
1M1KH 1YI2F 1IPAA 5EO3A 1RA4A 3LWRC 1GZ0A 3NK6A 3I55F 3LWVC 3NK7A 3LWPC 2KG4A 3V7EA 5GIPC 3CG6A 3SIVA 1Q86H 1M90H 1E7KA 1VQ6F 3G6EF 3IR9A 1VQ7F 1Q82H 3VMFB 1YIJF 1KD1H 3NMUC 3CCVF 2VGNA 1VQ9F 5A2QM 1YJ9F 1X52A 4LCKA 1NMUB 1CN7A 4BW0B 3LWQC 3CC4F 3E20B 3FFMA 3PAFA 3WXMB 1W41A 3OBWA 3J7AR 1Q81H 5GINC 5FJ4C 3SIUA 3JCMM 2JNBA 3CCRF 3CCEF 1Q7YH 3CPQA 2OZBA 5DCVA 3N4YA 2OTLF 1YHQF 5FLXM 2HVYD 1YJNF 1VQLF 1X7PA 1KQSF 3ON1A 3CCQF 2ALEA 5GAPK 2AIFA 2KTVA 1T0KB 1JJ2F 5EWRA 2WALA 1YITF 4BY9D 3CC2F 3HAXD 1VQ8F 1X7OA 3NVIB 1SDSA 4C4WC 3LFOA 3NVKE 1W42A 1YJWF 1GO0A 2QI2A 1VQPF 3HJWC 3JAMM 3MCAB 1QVFF 1VQMF 3CCLF 1K9MH 3E1YA 4NUTA 1XBIA 1NJIH 5GANK 3RA6A 1W3EX 1W2BF 3N4ZA 1CK2A 5GIOC 1ZWZA 1K8AH 3V7QA 4TZZA 1GO1A 3OW2F 3CCUF 1W40A 1K73H 1DT9A 1S72F 5G4VC 2I6DA 1VQNF 3LWOC 3J81M 2QA4F 3RA5A 3VI6A 3OBYA 1VQ4F 3CC7F 4X3LA 1H7MA 1VQ5F 1VQOF 1RLGA 3I56F 3CCJF 3AGKA 3J80M 4X3MA 1QVGF 2OHWA 3O85A 2FC3A 3CPWF 2OTJF 3G4SF 1PXWA 3CCSF 5IT9M 3GYQA 3CCMF 3CXCF 3CMAF 1KC8H 2QEXF 2LBWA 3CD6F 3G71F 3PLAC 2BO1A 2CZWA 3CMEF 2VGMA 1N8RH 1VQKF 2LBXA 2KTUA 5G4UC
chains in the Genus database with same CATH superfamily
3S06A 1M1KH 3JASB 3L7QA 3LWRC 2HRUA 3I55F 3ERNA 3LDTA 4EB6B 5JH7A 3JAKA 2KG4A 3SIVA 5EYPA 3JAWB 2BTQB 3HWUA 5HWEA 5KX5A 2ZODA 1E7KA 1VQ7F 3WPWA 4X1IA 3NMUC 4BVSA 4BVTA 1OFUA 2IG8A 1X52A 4C8EA 3HKBB 3HKCB 3N2GB 4F6RA 2EWCA 5JCOA 1QD9A 1CN7A 3LWQC 1ONIA 3RYFA 3VOBA 3FFMA 5HXZA 3D01A 3D54A 3WGMA 3WGNA 2IAFA 3OBWA 3F6MA 3WXMB 2YXZA 4ERHA 5MN6A 3J7AR 1R1MA 2JNBA 3CCRF 5DCVA 3CPQA 2OZBA 2W8BC 4G88A 1XHOA 3HTNA 1X7PA 3ON1A 2ZAUA 1RQ2A 2LCAA 2ALEA 1U43A 5GAPK 4LNUA 3KHNA 2UYKA 4IHJB 1T0KB 3C9TA 5EWRA 3WJPA 3WGLA 3C8LA 3ZP7A 4BY9D 3HAXD 4C82A 3MBMA 4TV9A 4X1YB 1SDSA 2HS0A 3LFOA 4YJ2A 1FFXB 5CB4B 4EB6A 1W42A 2HS4A 2QI2A 3F0GA 2HP0A 3JAMM 3MCAB 3JATB 5J2TA 1PF5A 3E22B 1U3PA 5GONB 3KJJA 1W2BF 1COMA 1CK2A 3RE3A 2KGWA 3M4SA 3RYCB 4O2BB 2HP0B 4B45A 3OW2F 3VCZA 3CCUF 1W40A 1DT9A 2IQQA 5BMVB 3C9UA 2MQEA 3OBYA 2CHTA 3VI6A 4DRXA 1U40A 5JVDA 3RYIA 3ELCA 3AGKA 3CYPB 3QTYA 3HKEA 5LXTB 3WPXA 2V9YA 1JFFB 3RYHB 5CA0B 1IV4A 3S02A 2Z1TA 3S0WA 5JH7B 5LA6A 5IT9M 3GYQA 4ZK7A 3G71F 2L26A 1SA0A 4TUYB 5ITZB 2VGMA 4NQ3A 2CW4A 4BT3A 4WBNB 5IYZA 1IPAA 2Q1YA 2CHSA 2UYNA 3VTIC 2F9ZC 4BVRA 3CG6A 1X25A 1VQ6F 3IR9A 1Q82H 5ITZA 1YIJF 5HP7A 1KD1H 3UT5A 2VGNA 3JALA 1YJ9F 4LCKA 4FFBA 1ODEA 3OONA 4ZHWA 3K0TA 4BW0B 2Z01A 4DRXB 2R6R1 4ZOLB 5CB4A 1W57A 3VO8A 1YGYA 5FJ4C 2H8CA 3CCEF 2K1SA 3UT5B 3N4YA 4NWOB 1VH8A 4U3JB 5FLXM 1XV2A 1KQSF 2CWJA 3K2XA 3CCQF 3K14A 3RYCA 4TUYA 1JJ2F 1DBFA 4WBNA 5GONA 2QTPA 1FNKA 1YITF 2ZF8A 4X1KB 5LP6A 1QAHA 5MN4A 1GO0A 1YJWF 2HRYA 1SZQA 1IV1A 3JAWA 3HKCA 1NQ3A 3N2GA 3U0OA 1VQPF 4YJ3B 1QVFF 2B33A 2UZHA 2GVIA 4X1IB 1VQMF 3N2KB 3HKEB 3ZP4A 3R0PA 4NUTA 5LXTA 1XBIA 1TUBB 1JFFA 5EB1B 2HX0A 3ZO8A 5LOVA 2CVLA 5LP6B 3TD4A 3C9RA 3C9SA 5GIOC 3JASA 1ZWZA 5JCOC 1GO1A 2BTOA 5EIBC 3FD5A 4YJ3A 1W581 2DYYA 2VAWA 3I3FA 3FD6A 5J2UA 4IIJA 3LWOC 3J81M 2UYNB 4X3LA 4DXDA 2ZVZA 2DT4A 4PWTA 1VQOF 1IV3A 4G4VA 4U39A 5IYZB 3KE1A 3M84A 2OHWA 3S0HA 4G4WA 3CPWF 3B6NA 3KJKA 5EZYA 4ZHVA 2GLZA 3P10A 5J2UB 2RHHA 3CCMF 1KC8H 3CMAF 3E22A 2LBWA 4O4IB 5HY0A 1RLUA 2AIZP 5HY1A 1TVKA 3IKFA 3FBAA 1N8RH 1Z5WA 4ZHQA 3JALB 1T0AA 4I50B 1YI2F 3F0FA 1H48A 5J2TB 5HP8A 2UYPA 4XCQA 1GZ0A 3NK6A 4LNUB 3K12A 5JQGA 2UYJA 4X20B 5CA1A 2Q1XA 3V7EA 5FNVB 1RQ7A 2PMPA 1Q86H 1M90H 3VOAA 4C8GA 5BMVA 3JARA 4G4ZA 4O2AB 3CCVF 4G4XA 3S0YA 3V3TA 5LYJA 1FSZA 1NMUB 3JATA 4BT7A 3HKDA 1OAPA 3PAFA 2ZVYA 4I55A 1W41A 1Q81H 3SIUA 4G4YA 1JN1A 3JCMM 4O2AA 1FNJA 1SA0B 3GTZA 2FGYA 2OTLF 1YHQF 2Z1EA 5CA0A 5B8FA 1VQLF 4EI8A 4RHAA 3LYBA 2AIFA 2KTVA 3N2KA 2HS3A 2PHNA 3RYIB 5LOVB 3CC2F 1YQNA 3WGJA 1VQ8F 1X7OA 3NVIB 2Z1UA 3VYTC 4O4HA 2CSLA 1Z5VA 2NMUA 2HQSC 5JVDB 2G9IA 4C81A 3HJWC 1J7HA 4O4LB 2LBTA 4M8IA 1K9MH 4B62A 3E1YA 5HY4A 1NJIH 5KMGA 5GANK 3RA6A 5EZYB 1VQVA 1H47A 4HNAB 1W59A 5KX5B 4TZZA 4I55B 3LMEA 3VYSC 2VXYA 4O4LA 3IEWA 3HKBA 4X1YA 1S72F 5G4VC 1VQNF 4YJ2B 2QA4F 3RA5A 4B5CA 3D00A 5IJ0A 1H7MA 4X20A 2VAMA 5IJ9A 1RLGA 1VK3A 1IV2A 4FFBB 5FNVA 3I56F 3CCJF 4BT2A 3J80M 4X3MA 1FFXA 1QVGF 3O85A 4BT5A 1Q8RA 1UI9A 3G4SF 4ZI7A 5JQGB 2GZLA 5CA1B 2H6LA 2P6YA 3CCSF 4BT6A 1QU9A 3CD6F 3MQWA 3QHDA 3IKEA 3T80A 3PLAC 1XRGA 3P0ZA 2CZWA 3CMEF 1UFYA 1VQKF 2LBXA 2KTUA 5EB0A 5EO3A 1RA4A 4O2BA 2AMTA 3LWVC 2I6RA 3NK7A 3LWPC 5GIPC 2RHLA 3ESJA 3WJRA 3WJQA 4HNAA 3G6EF 3GHZA 3VMFB 3RYHA 5AVMA 1U3LA 1JD1A 1W5FA 5A2QM 1VQ9F 2RHJA 3P4EA 3I7TA 3CB2A 4IIJB 3DDNA 3CC4F 3E20B 5IJ0B 2YYEA 4O4HB 3KIZA 4O4JB 3S03A 5IJ9B 5GINC 3FPIA 3QUWA 4B46A 5C8YA 1Q7YH 1TVKB 4EI7A 4C8IA 1W5AA 2HVYD 5EAZA 1YJNF 3TD5A 1TUBA 2H8EA 2HP3A 4O4IA 2RB9A 3RYFB 5LP6C 5EIBD 4ZHYB 3F0EA 4BT4A 4F6RB 2WALA 5KMGB 5LA6B 3MDOA 5MN5A 5C8YB 4RQOA 4C4WC 1W55A 3NVKE 3MCQA 2N48A 3VYUC 3ZOPA 3IMPA 3V4DA 1GX1A 3CCLF 4IHJA 4ZOLA 4TV8A 3JAKB 4ZI7B 3CYQA 1W3EX 4ZHQB 1W5BA 3IEQA 3N4ZA 4I50A 4R40B 4TV9B 4KWEA 2BTUA 3V7QA 1K8AH 4O4JA 1VHAA 2Z1FA 1K73H 4I4TA 3VIUA 3F0DA 4BVQA 2I6DA 4TV8B 3EORA 2R751 2RHOA 1VQ4F 5HY2A 3CC7F 1VQ5F 3DC2A 1KNJA 3WGKA 3TD3A 5LYJB 3M1XA 3JVHA 4X1KA 1KNKA 2FC3A 3JARB 2OTJF 3HKDB 1PXWA 4I4TB 5HXUA 4EI9A 1CLIA 3Q8HA 5EYPB 2VAPA 3CXCF 2QEXF 3BYQA 1W5EA 2BO1A 1JY8A 4E6EA 2ZOVA 2OTMA 4U3JA 5G4UC
chains in the Genus database with same CATH topology
1M1KH 1YI2F 1IPAA 5EO3A 4XCQA 1RA4A 3LWRC 1GZ0A 3NK6A 3LWVC 3I55F 2F9ZC 3NK7A 3LWPC 4BVRA 2KG4A 3V7EA 5GIPC 3CG6A 3SIVA 1Q86H 1M90H 5HWEA 1E7KA 1VQ6F 3G6EF 3IR9A 1VQ7F 1Q82H 3VMFB 1YIJF 1KD1H 3NMUC 3CCVF 4BVSA 2VGNA 4BVTA 1VQ9F 5A2QM 1YJ9F 1X52A 3V3TA 4LCKA 1NMUB 1CN7A 4BW0B 3LWQC 3CC4F 3E20B 3FFMA 3PAFA 5HXZA 3WXMB 1W41A 3OBWA 3J7AR 1Q81H 5GINC 5FJ4C 3SIUA 3JCMM 2JNBA 3CCRF 3CCEF 1Q7YH 3CPQA 2OZBA 5DCVA 3N4YA 2FGYA 2OTLF 4EI7A 1YHQF 5FLXM 2HVYD 1YJNF 1VQLF 1X7PA 4EI8A 1KQSF 3ON1A 3CCQF 2ALEA 5GAPK 2AIFA 2KTVA 1T0KB 1JJ2F 5EWRA 2WALA 1YITF 4BY9D 3CC2F 3HAXD 1VQ8F 1X7OA 3NVIB 1SDSA 4C4WC 3LFOA 3NVKE 1W42A 1YJWF 1GO0A 2QI2A 1VQPF 3HJWC 3JAMM 3MCAB 1QVFF 1VQMF 3CCLF 1K9MH 3E1YA 4NUTA 5HY4A 1XBIA 1NJIH 5GANK 3RA6A 1W3EX 1W2BF 3N4ZA 1CK2A 5GIOC 1ZWZA 1K8AH 3V7QA 4TZZA 1GO1A 3OW2F 3CCUF 1W40A 1K73H 1DT9A 4BVQA 1S72F 5G4VC 2I6DA 1VQNF 3LWOC 3J81M 2QA4F 3RA5A 3VI6A 3OBYA 5HY2A 3D00A 4X3LA 1VQ4F 3CC7F 1H7MA 1VQ5F 1VQOF 1RLGA 3I56F 3CCJF 3AGKA 3J80M 4X3MA 1QVGF 2OHWA 3O85A 2FC3A 3CPWF 2OTJF 3G4SF 1PXWA 5HXUA 2GLZA 4EI9A 3CCSF 5IT9M 3GYQA 3CCMF 3CXCF 3CMAF 1KC8H 2QEXF 2LBWA 3CD6F 5HY0A 3G71F 3PLAC 2BO1A 5HY1A 2CZWA 3CMEF 2VGMA 1N8RH 4NQ3A 1VQKF 2LBXA 2KTUA 5G4UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K H;  1YI2 F;  1IPA A;  5EO3 A;  1RA4 A;  3LWR C;  1GZ0 A;  3NK6 A;  3I55 F;  3LWV C;  3NK7 A;  3LWP C;  2KG4 A;  3V7E A;  5GIP C;  3CG6 A;  3SIV A;  1Q86 H;  1M90 H;  1E7K A;  1VQ6 F;  3G6E F;  3IR9 A;  1VQ7 F;  1Q82 H;  3VMF B;  1YIJ F;  1KD1 H;  3NMU C;  3CCV F;  2VGN A;  1VQ9 F;  5A2Q M;  1YJ9 F;  1X52 A;  4LCK A;  1NMU B;  1CN7 A;  4BW0 B;  3LWQ C;  3CC4 F;  3E20 B;  3FFM A;  3PAF A;  3WXM B;  1W41 A;  3OBW A;  3J7A R;  1Q81 H;  5GIN C;  5FJ4 C;  3SIU A;  3JCM M;  2JNB A;  3CCR F;  3CCE F;  1Q7Y H;  3CPQ A;  2OZB A;  5DCV A;  3N4Y A;  2OTL F;  1YHQ F;  5FLX M;  2HVY D;  1YJN F;  1VQL F;  1X7P A;  1KQS F;  3ON1 A;  3CCQ F;  2ALE A;  5GAP K;  2AIF A;  2KTV A;  1T0K B;  1JJ2 F;  5EWR A;  2WAL A;  1YIT F;  4BY9 D;  3CC2 F;  3HAX D;  1VQ8 F;  1X7O A;  3NVI B;  1SDS A;  4C4W C;  3LFO A;  3NVK E;  1W42 A;  1YJW F;  1GO0 A;  2QI2 A;  1VQP F;  3HJW C;  3JAM M;  3MCA B;  1QVF F;  1VQM F;  3CCL F;  1K9M H;  3E1Y A;  4NUT A;  1XBI A;  1NJI H;  5GAN K;  3RA6 A;  1W3E X;  1W2B F;  3N4Z A;  1CK2 A;  5GIO C;  1ZWZ A;  1K8A H;  3V7Q A;  4TZZ A;  1GO1 A;  3OW2 F;  3CCU F;  1W40 A;  1K73 H;  1DT9 A;  1S72 F;  5G4V C;  2I6D A;  1VQN F;  3LWO C;  3J81 M;  2QA4 F;  3RA5 A;  3VI6 A;  3OBY A;  1VQ4 F;  3CC7 F;  4X3L A;  1H7M A;  1VQ5 F;  1VQO F;  1RLG A;  3I56 F;  3CCJ F;  3AGK A;  3J80 M;  4X3M A;  1QVG F;  2OHW A;  3O85 A;  2FC3 A;  3CPW F;  2OTJ F;  3G4S F;  1PXW A;  3CCS F;  5IT9 M;  3GYQ A;  3CCM F;  3CXC F;  3CMA F;  1KC8 H;  2QEX F;  2LBW A;  3CD6 F;  3G71 F;  3PLA C;  2BO1 A;  2CZW A;  3CME F;  2VGM A;  1N8R H;  1VQK F;  2LBX A;  2KTU A;  5G4U C; 
#chains in the Genus database with same CATH topology
 3S06 A;  1M1K H;  3JAS B;  3L7Q A;  3LWR C;  2HRU A;  3I55 F;  3ERN A;  3LDT A;  4EB6 B;  5JH7 A;  3JAK A;  2KG4 A;  3SIV A;  5EYP A;  3JAW B;  2BTQ B;  3HWU A;  5HWE A;  5KX5 A;  2ZOD A;  1E7K A;  1VQ7 F;  3WPW A;  4X1I A;  3NMU C;  4BVS A;  4BVT A;  1OFU A;  2IG8 A;  1X52 A;  4C8E A;  3HKB B;  3HKC B;  3N2G B;  4F6R A;  2EWC A;  5JCO A;  1QD9 A;  1CN7 A;  3LWQ C;  1ONI A;  3RYF A;  3VOB A;  3FFM A;  5HXZ A;  3D01 A;  3D54 A;  3WGM A;  3WGN A;  2IAF A;  3OBW A;  3F6M A;  3WXM B;  2YXZ A;  4ERH A;  5MN6 A;  3J7A R;  1R1M A;  2JNB A;  3CCR F;  5DCV A;  3CPQ A;  2OZB A;  2W8B C;  4G88 A;  1XHO A;  3HTN A;  1X7P A;  3ON1 A;  2ZAU A;  1RQ2 A;  2LCA A;  2ALE A;  1U43 A;  5GAP K;  4LNU A;  3KHN A;  2UYK A;  4IHJ B;  1T0K B;  3C9T A;  5EWR A;  3WJP A;  3WGL A;  3C8L A;  3ZP7 A;  4BY9 D;  3HAX D;  4C82 A;  3MBM A;  4TV9 A;  4X1Y B;  1SDS A;  2HS0 A;  3LFO A;  4YJ2 A;  1FFX B;  5CB4 B;  4EB6 A;  1W42 A;  2HS4 A;  2QI2 A;  3F0G A;  2HP0 A;  3JAM M;  3MCA B;  3JAT B;  5J2T A;  1PF5 A;  3E22 B;  1U3P A;  5GON B;  3KJJ A;  1W2B F;  1COM A;  1CK2 A;  3RE3 A;  2KGW A;  3M4S A;  3RYC B;  4O2B B;  2HP0 B;  4B45 A;  3OW2 F;  3VCZ A;  3CCU F;  1W40 A;  1DT9 A;  2IQQ A;  5BMV B;  3C9U A;  2MQE A;  3OBY A;  2CHT A;  3VI6 A;  4DRX A;  1U40 A;  5JVD A;  3RYI A;  3ELC A;  3AGK A;  3CYP B;  3QTY A;  3HKE A;  5LXT B;  3WPX A;  2V9Y A;  1JFF B;  3RYH B;  5CA0 B;  1IV4 A;  3S02 A;  2Z1T A;  3S0W A;  5JH7 B;  5LA6 A;  5IT9 M;  3GYQ A;  4ZK7 A;  3G71 F;  2L26 A;  1SA0 A;  4TUY B;  5ITZ B;  2VGM A;  4NQ3 A;  2CW4 A;  4BT3 A;  4WBN B;  5IYZ A;  1IPA A;  2Q1Y A;  2CHS A;  2UYN A;  3VTI C;  2F9Z C;  4BVR A;  3CG6 A;  1X25 A;  1VQ6 F;  3IR9 A;  1Q82 H;  5ITZ A;  1YIJ F;  5HP7 A;  1KD1 H;  3UT5 A;  2VGN A;  3JAL A;  1YJ9 F;  4LCK A;  4FFB A;  1ODE A;  3OON A;  4ZHW A;  3K0T A;  4BW0 B;  2Z01 A;  4DRX B;  2R6R 1;  4ZOL B;  5CB4 A;  1W57 A;  3VO8 A;  1YGY A;  5FJ4 C;  2H8C A;  3CCE F;  2K1S A;  3UT5 B;  3N4Y A;  4NWO B;  1VH8 A;  4U3J B;  5FLX M;  1XV2 A;  1KQS F;  2CWJ A;  3K2X A;  3CCQ F;  3K14 A;  3RYC A;  4TUY A;  1JJ2 F;  1DBF A;  4WBN A;  5GON A;  2QTP A;  1FNK A;  1YIT F;  2ZF8 A;  4X1K B;  5LP6 A;  1QAH A;  5MN4 A;  1GO0 A;  1YJW F;  2HRY A;  1SZQ A;  1IV1 A;  3JAW A;  3HKC A;  1NQ3 A;  3N2G A;  3U0O A;  1VQP F;  4YJ3 B;  1QVF F;  2B33 A;  2UZH A;  2GVI A;  4X1I B;  1VQM F;  3N2K B;  3HKE B;  3ZP4 A;  3R0P A;  4NUT A;  5LXT A;  1XBI A;  1TUB B;  1JFF A;  5EB1 B;  2HX0 A;  3ZO8 A;  5LOV A;  2CVL A;  5LP6 B;  3TD4 A;  3C9R A;  3C9S A;  5GIO C;  3JAS A;  1ZWZ A;  5JCO C;  1GO1 A;  2BTO A;  5EIB C;  3FD5 A;  4YJ3 A;  1W58 1;  2DYY A;  2VAW A;  3I3F A;  3FD6 A;  5J2U A;  4IIJ A;  3LWO C;  3J81 M;  2UYN B;  4X3L A;  4DXD A;  2ZVZ A;  2DT4 A;  4PWT A;  1VQO F;  1IV3 A;  4G4V A;  4U39 A;  5IYZ B;  3KE1 A;  3M84 A;  2OHW A;  3S0H A;  4G4W A;  3CPW F;  3B6N A;  3KJK A;  5EZY A;  4ZHV A;  2GLZ A;  3P10 A;  5J2U B;  2RHH A;  3CCM F;  1KC8 H;  3CMA F;  3E22 A;  2LBW A;  4O4I B;  5HY0 A;  1RLU A;  2AIZ P;  5HY1 A;  1TVK A;  3IKF A;  3FBA A;  1N8R H;  1Z5W A;  4ZHQ A;  3JAL B;  1T0A A;  4I50 B;  1YI2 F;  3F0F A;  1H48 A;  5J2T B;  5HP8 A;  2UYP A;  4XCQ A;  1GZ0 A;  3NK6 A;  4LNU B;  3K12 A;  5JQG A;  2UYJ A;  4X20 B;  5CA1 A;  2Q1X A;  3V7E A;  5FNV B;  1RQ7 A;  2PMP A;  1Q86 H;  1M90 H;  3VOA A;  4C8G A;  5BMV A;  3JAR A;  4G4Z A;  4O2A B;  3CCV F;  4G4X A;  3S0Y A;  3V3T A;  5LYJ A;  1FSZ A;  1NMU B;  3JAT A;  4BT7 A;  3HKD A;  1OAP A;  3PAF A;  2ZVY A;  4I55 A;  1W41 A;  1Q81 H;  3SIU A;  4G4Y A;  1JN1 A;  3JCM M;  4O2A A;  1FNJ A;  1SA0 B;  3GTZ A;  2FGY A;  2OTL F;  1YHQ F;  2Z1E A;  5CA0 A;  5B8F A;  1VQL F;  4EI8 A;  4RHA A;  3LYB A;  2AIF A;  2KTV A;  3N2K A;  2HS3 A;  2PHN A;  3RYI B;  5LOV B;  3CC2 F;  1YQN A;  3WGJ A;  1VQ8 F;  1X7O A;  3NVI B;  2Z1U A;  3VYT C;  4O4H A;  2CSL A;  1Z5V A;  2NMU A;  2HQS C;  5JVD B;  2G9I A;  4C81 A;  3HJW C;  1J7H A;  4O4L B;  2LBT A;  4M8I A;  1K9M H;  4B62 A;  3E1Y A;  5HY4 A;  1NJI H;  5KMG A;  5GAN K;  3RA6 A;  5EZY B;  1VQV A;  1H47 A;  4HNA B;  1W59 A;  5KX5 B;  4TZZ A;  4I55 B;  3LME A;  3VYS C;  2VXY A;  4O4L A;  3IEW A;  3HKB A;  4X1Y A;  1S72 F;  5G4V C;  1VQN F;  4YJ2 B;  2QA4 F;  3RA5 A;  4B5C A;  3D00 A;  5IJ0 A;  1H7M A;  4X20 A;  2VAM A;  5IJ9 A;  1RLG A;  1VK3 A;  1IV2 A;  4FFB B;  5FNV A;  3I56 F;  3CCJ F;  4BT2 A;  3J80 M;  4X3M A;  1FFX A;  1QVG F;  3O85 A;  4BT5 A;  1Q8R A;  1UI9 A;  3G4S F;  4ZI7 A;  5JQG B;  2GZL A;  5CA1 B;  2H6L A;  2P6Y A;  3CCS F;  4BT6 A;  1QU9 A;  3CD6 F;  3MQW A;  3QHD A;  3IKE A;  3T80 A;  3PLA C;  1XRG A;  3P0Z A;  2CZW A;  3CME F;  1UFY A;  1VQK F;  2LBX A;  2KTU A;  5EB0 A;  5EO3 A;  1RA4 A;  4O2B A;  2AMT A;  3LWV C;  2I6R A;  3NK7 A;  3LWP C;  5GIP C;  2RHL A;  3ESJ A;  3WJR A;  3WJQ A;  4HNA A;  3G6E F;  3GHZ A;  3VMF B;  3RYH A;  5AVM A;  1U3L A;  1JD1 A;  1W5F A;  5A2Q M;  1VQ9 F;  2RHJ A;  3P4E A;  3I7T A;  3CB2 A;  4IIJ B;  3DDN A;  3CC4 F;  3E20 B;  5IJ0 B;  2YYE A;  4O4H B;  3KIZ A;  4O4J B;  3S03 A;  5IJ9 B;  5GIN C;  3FPI A;  3QUW A;  4B46 A;  5C8Y A;  1Q7Y H;  1TVK B;  4EI7 A;  4C8I A;  1W5A A;  2HVY D;  5EAZ A;  1YJN F;  3TD5 A;  1TUB A;  2H8E A;  2HP3 A;  4O4I A;  2RB9 A;  3RYF B;  5LP6 C;  5EIB D;  4ZHY B;  3F0E A;  4BT4 A;  4F6R B;  2WAL A;  5KMG B;  5LA6 B;  3MDO A;  5MN5 A;  5C8Y B;  4RQO A;  4C4W C;  1W55 A;  3NVK E;  3MCQ A;  2N48 A;  3VYU C;  3ZOP A;  3IMP A;  3V4D A;  1GX1 A;  3CCL F;  4IHJ A;  4ZOL A;  4TV8 A;  3JAK B;  4ZI7 B;  3CYQ A;  1W3E X;  4ZHQ B;  1W5B A;  3IEQ A;  3N4Z A;  4I50 A;  4R40 B;  4TV9 B;  4KWE A;  2BTU A;  3V7Q A;  1K8A H;  4O4J A;  1VHA A;  2Z1F A;  1K73 H;  4I4T A;  3VIU A;  3F0D A;  4BVQ A;  2I6D A;  4TV8 B;  3EOR A;  2R75 1;  2RHO A;  1VQ4 F;  5HY2 A;  3CC7 F;  1VQ5 F;  3DC2 A;  1KNJ A;  3WGK A;  3TD3 A;  5LYJ B;  3M1X A;  3JVH A;  4X1K A;  1KNK A;  2FC3 A;  3JAR B;  2OTJ F;  3HKD B;  1PXW A;  4I4T B;  5HXU A;  4EI9 A;  1CLI A;  3Q8H A;  5EYP B;  2VAP A;  3CXC F;  2QEX F;  3BYQ A;  1W5E A;  2BO1 A;  1JY8 A;  4E6E A;  2ZOV A;  2OTM A;  4U3J A;  5G4U C; 
#chains in the Genus database with same CATH homology
 1M1K H;  1YI2 F;  1IPA A;  5EO3 A;  4XCQ A;  1RA4 A;  3LWR C;  1GZ0 A;  3NK6 A;  3LWV C;  3I55 F;  2F9Z C;  3NK7 A;  3LWP C;  4BVR A;  2KG4 A;  3V7E A;  5GIP C;  3CG6 A;  3SIV A;  1Q86 H;  1M90 H;  5HWE A;  1E7K A;  1VQ6 F;  3G6E F;  3IR9 A;  1VQ7 F;  1Q82 H;  3VMF B;  1YIJ F;  1KD1 H;  3NMU C;  3CCV F;  4BVS A;  2VGN A;  4BVT A;  1VQ9 F;  5A2Q M;  1YJ9 F;  1X52 A;  3V3T A;  4LCK A;  1NMU B;  1CN7 A;  4BW0 B;  3LWQ C;  3CC4 F;  3E20 B;  3FFM A;  3PAF A;  5HXZ A;  3WXM B;  1W41 A;  3OBW A;  3J7A R;  1Q81 H;  5GIN C;  5FJ4 C;  3SIU A;  3JCM M;  2JNB A;  3CCR F;  3CCE F;  1Q7Y H;  3CPQ A;  2OZB A;  5DCV A;  3N4Y A;  2FGY A;  2OTL F;  4EI7 A;  1YHQ F;  5FLX M;  2HVY D;  1YJN F;  1VQL F;  1X7P A;  4EI8 A;  1KQS F;  3ON1 A;  3CCQ F;  2ALE A;  5GAP K;  2AIF A;  2KTV A;  1T0K B;  1JJ2 F;  5EWR A;  2WAL A;  1YIT F;  4BY9 D;  3CC2 F;  3HAX D;  1VQ8 F;  1X7O A;  3NVI B;  1SDS A;  4C4W C;  3LFO A;  3NVK E;  1W42 A;  1YJW F;  1GO0 A;  2QI2 A;  1VQP F;  3HJW C;  3JAM M;  3MCA B;  1QVF F;  1VQM F;  3CCL F;  1K9M H;  3E1Y A;  4NUT A;  5HY4 A;  1XBI A;  1NJI H;  5GAN K;  3RA6 A;  1W3E X;  1W2B F;  3N4Z A;  1CK2 A;  5GIO C;  1ZWZ A;  1K8A H;  3V7Q A;  4TZZ A;  1GO1 A;  3OW2 F;  3CCU F;  1W40 A;  1K73 H;  1DT9 A;  4BVQ A;  1S72 F;  5G4V C;  2I6D A;  1VQN F;  3LWO C;  3J81 M;  2QA4 F;  3RA5 A;  3VI6 A;  3OBY A;  5HY2 A;  3D00 A;  4X3L A;  1VQ4 F;  3CC7 F;  1H7M A;  1VQ5 F;  1VQO F;  1RLG A;  3I56 F;  3CCJ F;  3AGK A;  3J80 M;  4X3M A;  1QVG F;  2OHW A;  3O85 A;  2FC3 A;  3CPW F;  2OTJ F;  3G4S F;  1PXW A;  5HXU A;  2GLZ A;  4EI9 A;  3CCS F;  5IT9 M;  3GYQ A;  3CCM F;  3CXC F;  3CMA F;  1KC8 H;  2QEX F;  2LBW A;  3CD6 F;  5HY0 A;  3G71 F;  3PLA C;  2BO1 A;  5HY1 A;  2CZW A;  3CME F;  2VGM A;  1N8R H;  4NQ3 A;  1VQK F;  2LBX A;  2KTU A;  5G4U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...