1VQ8F

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq8F00
5EO3A 3CCEF 1Q7YH 1QVGF 1CN7A 3I56F 1VQ5F 1W3EX 1QVFF 4C4WC 1DT9A 3VMFB 1VQ9F 1VQ7F 2QEXF 1Q81H 3CCVF 3CCMF 2JNBA 2KTVA 3V7EA 3CG6A 4X3MA 2CZWA 2WALA 3I55F 1VQ6F 1E7KA 3CD6F 3G4SF 3CC4F 2KTUA 5GANK 1YI2F 3O85A 2OHWA 3SIUA 1KC8H 3CC7F 2VGMA 3CCSF 1N8RH 3GYQA 1VQ4F 3CPWF 1GZ0A 3CMEF 2AIFA 4TZZA 1KD1H 3LWRC 1RLGA 3NK6A 3N4ZA 1W42A 3MCAB 3LWOC 3RA6A 3E20B 3CCJF 5G4VC 3AGKA 1VQ8F 1SDSA 1H7MA 1NMUB 3JAMM 3NMUC 5G4UC 1KQSF 5EWRA 5A2QM 3LWPC 2HVYD 1CK2A 4NUTA 1VQPF 3PLAC 1X7PA 3OBWA 3N4YA 4X3LA 3IR9A 1YHQF 1W40A 3LWQC 3HJWC 3LFOA 1Q86H 5DCVA 3CCRF 3NVKE 4LCKA 1YITF 3E1YA 3J7AR 2OTJF 1K9MH 5GAPK 1PXWA 3ON1A 3CCUF 1T0KB 3JCMM 1K73H 3WXMB 1YIJF 3HAXD 3J81M 2LBWA 3CC2F 2ALEA 1YJNF 1X7OA 3PAFA 2BO1A 2VGNA 3LWVC 5FJ4C 5FLXM 5GINC 3CCLF 1RA4A 2QA4F 5GIPC 3OBYA 2OZBA 1GO0A 1XBIA 2FC3A 2I6DA 2LBXA 3SIVA 5IT9M 1IPAA 1NJIH 1Q82H 2KG4A 3NK7A 3CMAF 5GIOC 1VQNF 1W2BF 2OTLF 3OW2F 1VQLF 1YJ9F 1M1KH 1ZWZA 2QI2A 4BW0B 1VQOF 3G71F 1GO1A 1VQMF 3VI6A 1X52A 3CXCF 3NVIB 1W41A 3J80M 3RA5A 1JJ2F 1YJWF 1M90H 1K8AH 3G6EF 3FFMA 3V7QA 4BY9D 3CPQA 3CCQF 1S72F 1VQKF
chains in the Genus database with same CATH superfamily
5EO3A 4I50A 2HQSC 1VQ5F 1W3EX 3RYCA 1DT9A 3VMFB 4O4JB 1VQ9F 3K2XA 1W57A 2UYNA 5J2TB 1JFFB 3CCMF 2JNBA 1TUBA 2RHLA 1UI9A 4X3MA 2AMTA 2R751 1UFYA 1VQ6F 3CD6F 3RYFA 3WGLA 5ITZB 3G4SF 5GANK 4TUYA 3O85A 1FNJA 5JCOC 1W5FA 4ZI7B 2N48A 5JH7A 3WGJA 4X1KB 2DT4A 3GYQA 1VQ4F 3CPWF 3GTZA 4TZZA 1KD1H 3VO8A 2BTUA 5CA0A 3WGMA 1RLGA 5LYJB 2RHHA 1W5AA 4B5CA 3LWOC 3FD6A 3S0WA 1SDSA 4O4LB 5LA6A 4BT7A 3E22B 3VOBA 1CK2A 4NUTA 1QAHA 1VQPF 2P6YA 1IV1A 1X7PA 5EZYB 3OBWA 2I6RA 5JCOA 2LCAA 3IR9A 1YHQF 3JASB 2IQQA 1Q86H 5LP6B 1PXWA 3WJQA 1JD1A 3WGNA 1K73H 2GLZA 3RYFB 3K12A 1IV4A 3WPXA 2UYKA 4BVQA 5IYZB 2VGNA 4TV8A 3LWVC 3VIUA 4EI8A 2QA4F 2FC3A 1W55A 2G9IA 1U40A 4TV9B 2ZODA 4ZOLB 1GX1A 5EYPA 4X1YA 5IT9M 1NJIH 4O2BB 5MN6A 4C8EA 4B62A 3WJRA 1VQNF 4G4ZA 3HKBB 4G4XA 4ZHYB 5EZYA 1YJ9F 2ZVYA 1ZWZA 3KE1A 3VOAA 1M1KH 4BW0B 2R6R1 5FNVA 1FSZA 3IEWA 2Z1TA 1DBFA 4LNUA 4DXDA 3LMEA 3CYPB 3I3FA 4EB6A 2PMPA 2W8BC 3JVHA 4X1YB 5LOVA 5JVDA 1Z5VA 3JATA 3MDOA 5JQGA 3J80M 5MN5A 3KHNA 3JARA 4ZHQB 1TVKB 2AIZP 1OFUA 3FFMA 3V7QA 4DRXA 5HY1A 3RYIA 3IMPA 3CCQF 2HRYA 3ESJA 4XCQA 1VQKF 2ZVZA 3M84A 3TD3A 1Q7YH 5HXUA 4TUYB 1J7HA 1QVFF 4TV9A 4ZOLA 5MN4A 2RHJA 4YJ2A 4X1KA 5HP8A 1JFFA 2GZLA 3CCVF 4I55B 4BVSA 3CG6A 2Q1YA 1ODEA 5ITZA 3I55F 3HKEA 3N2KB 4C81A 1RQ2A 2Z1FA 3HKDB 3HKCA 4ZK7A 5KMGB 3RYIB 2H8CA 4DRXB 4I4TA 4O2AA 3QTYA 4EI9A 3D54A 2QTPA 1FNKA 2DYYA 5EB0A 5GONB 3M4SA 3JASA 3T80A 3MBMA 5LYJA 1U43A 5JVDB 1W42A 4PWTA 3MCAB 4HNAB 5LXTA 5G4VC 3AGKA 3TD4A 5CA1A 3N2GA 3JAKA 5EWRA 5A2QM 3S0HA 1H47A 3F0FA 4X3LA 3JALB 3LWQC 4ZHVA 4IIJA 4C8IA 5DCVA 5EIBD 1YITF 5BMVB 3S0YA 3E1YA 2OTJF 3LDTA 2IG8A 3CCUF 4BT2A 3JCMM 1VQVA 3VYSC 3WXMB 1YIJF 3KJKA 5HWEA 3ZP4A 2CHSA 3HKEB 4BT5A 3D00A 3L7QA 1X7OA 3PAFA 1TUBB 4YJ3A 4I4TB 4O2AB 4ERHA 3WJPA 1SZQA 1IV2A 1RA4A 5J2UA 5GIPC 3F6MA 3K14A 4YJ2B 1GO0A 3RYCB 3SIVA 5LP6C 3I7TA 2YXZA 5IJ9B 5J2TA 3QUWA 4X20B 3N2GB 4F6RA 4G4VA 3S03A 4O4HB 3OW2F 4ZHWA 5LOVB 2RHOA 5HY0A 4IHJA 3G71F 1VQMF 3VI6A 2GVIA 3OONA 3E22A 4LNUB 3ZP7A 2CHTA 2VAWA 2UZHA 2HS4A 5IJ0A 3C9TA 3CXCF 5JQGB 2FGYA 1COMA 2CSLA 1FFXA 2RB9A 1RLUA 3VTIC 5EIBC 4F6RB 4I55A 4KWEA 4FFBB 5EYPB 1VHAA 4ZI7A 1CN7A 1QVGF 4C8GA 3P4EA 2MQEA 1U3PA 2HX0A 1U3LA 4X20A 2QEXF 5IJ9A 5LP6A 3V7EA 2B33A 1SA0B 2WALA 4ZHQA 3N2KA 4YJ3B 3RYHA 2HS0A 1E7KA 4U3JB 3GHZA 4WBNB 5J2UB 2OHWA 3BYQA 1VK3A 3VYUC 3CCSF 3V4DA 1KNJA 4X1IA 3DC2A 3QHDA 3CMEF 2K1SA 5KX5B 3LWRC 3JALA 3D01A 1IV3A 3V3TA 5LA6B 4BVTA 5BMVA 3ZOPA 3RA6A 3E20B 3CCJF 1VQ8F 3JAKB 2EWCA 4NQ3A 1NMUB 3JAMM 5G4UC 1KQSF 3LWPC 2HS3A 5KMGA 3PLAC 1YGYA 2IAFA 3UT5A 1W40A 3HJWC 3LFOA 1XRGA 3R0PA 2KGWA 5GONA 3CCRF 3NVKE 3J7AR 2HP0A 5CB4A 1K9MH 1OAPA 2BTOA 4TV8B 3ON1A 3HKDA 1T0KB 4WBNA 3P0ZA 5KX5A 3J81M 2Z1UA 3ELCA 5EB1B 2V9YA 5EAZA 5FJ4C 4RHAA 3CCLF 4O4JA 3OBYA 4IIJB 1PF5A 1JY8A 3FPIA 1Z5WA 4EI7A 4E6EA 5B8FA 2ZF8A 5IJ0B 5GIOC 3CMAF 2HP0B 3U0OA 4O4LA 5AVMA 4O4IB 1VQLF 5HXZA 3UT5B 1KNKA 1W5EA 3RE3A 2Z1EA 2CW4A 3CB2A 1X25A 3JARB 3F0EA 4O2BA 2Z01A 4HNAA 3NVIB 1W41A 3RA5A 3Q8HA 1M90H 5CA1B 1ONIA 3WPWA 2F9ZC 4BY9D 3WGKA 2VXYA 3MQWA 2HRUA 3CPQA 2L26A 3CCEF 3ZO8A 3I56F 4C4WC 1NQ3A 1VQ7F 1W5BA 2UYNB 5HY4A 2ZOVA 4B46A 3F0DA 1Q81H 2KTVA 3C9SA 2CZWA 3P10A 4G88A 2CVLA 2ZAUA 4U39A 4U3JA 3CC4F 2KTUA 1VH8A 1YI2F 3SIUA 1KC8H 4G4WA 3CC7F 2VGMA 1N8RH 3EORA 2PHNA 2VAPA 1GZ0A 2AIFA 2Q1XA 1W581 3NK6A 3IKEA 3N4ZA 3JATB 4EB6B 5HY2A 3TD5A 2H6LA 4O4IA 1JN1A 3IEQA 1H7MA 5JH7B 1YQNA 3NMUC 1FFXB 1QU9A 2HVYD 5LXTB 3HKCB 3K0TA 3C8LA 2H8EA 5CA0B 3JAWA 4IHJB 3N4YA 4LCKA 4G4YA 1CLIA 3VCZA 4BT6A 3F0GA 1R1MA 4BT3A 3DDNA 3KIZA 3M1XA 5GAPK 4BVRA 3S06A 3CYQA 4NWOB 3HAXD 2LBWA 3VYTC 3CC2F 2ALEA 4O4HA 3ERNA 2UYPA 4BT4A 3HKBA 3S02A 4X1IB 1YJNF 2BO1A 3B6NA 1SA0A 4FFBA 5FLXM 4C82A 1T0AA 1XHOA 5GINC 1TVKA 3MCQA 2OZBA 1XBIA 4R40B 2I6DA 4I50B 2OTMA 2LBXA 1IPAA 1Q8RA 5CB4B 1Q82H 2KG4A 3NK7A 4B45A 3C9RA 2YYEA 2CWJA 5IYZA 5C8YB 5HP7A 1QD9A 3LYBA 1W2BF 3KJJA 2OTLF 3FBAA 3JAWB 1H48A 2QI2A 3C9UA 1VQOF 3HWUA 1GO1A 2HP3A 2VAMA 2UYJA 3IKFA 1RQ7A 2NMUA 4M8IA 5FNVB 1X52A 4RQOA 1JJ2F 1YJWF 2LBTA 3RYHB 1K8AH 3G6EF 1XV2A 2BTQB 3FD5A 5C8YA 3HTNA 1S72F 1W59A
chains in the Genus database with same CATH topology
5EO3A 3CCEF 1Q7YH 1QVGF 5HXUA 1CN7A 3I56F 1VQ5F 1W3EX 1QVFF 4C4WC 1DT9A 3VMFB 1VQ9F 1VQ7F 2QEXF 5HY4A 1Q81H 3CCVF 3CCMF 2JNBA 2KTVA 3V7EA 4BVSA 3CG6A 4X3MA 2CZWA 2WALA 3I55F 1VQ6F 1E7KA 3CD6F 3G4SF 3CC4F 2KTUA 5GANK 1YI2F 3O85A 2OHWA 3SIUA 1KC8H 3CC7F 2VGMA 3CCSF 1N8RH 3GYQA 4EI9A 1VQ4F 3CPWF 1GZ0A 3CMEF 2AIFA 4TZZA 1KD1H 3LWRC 1RLGA 3NK6A 3N4ZA 5HY2A 1W42A 3V3TA 4BVTA 3MCAB 3LWOC 3RA6A 3E20B 3CCJF 5G4VC 3AGKA 1VQ8F 1SDSA 1H7MA 4NQ3A 1NMUB 3JAMM 3NMUC 5G4UC 1KQSF 5EWRA 5A2QM 3LWPC 2HVYD 1CK2A 4NUTA 1VQPF 3PLAC 1X7PA 3OBWA 3N4YA 4X3LA 3IR9A 1YHQF 1W40A 3LWQC 3HJWC 3LFOA 1Q86H 5DCVA 3CCRF 3NVKE 4LCKA 1YITF 3E1YA 3J7AR 2OTJF 1K9MH 5GAPK 4BVRA 1PXWA 3ON1A 3CCUF 1T0KB 3JCMM 1K73H 3WXMB 1YIJF 2GLZA 5HWEA 3HAXD 3J81M 2LBWA 3CC2F 2ALEA 3D00A 1YJNF 1X7OA 3PAFA 2BO1A 4BVQA 2VGNA 3LWVC 5FJ4C 5FLXM 5GINC 3CCLF 1RA4A 4EI8A 2QA4F 5GIPC 3OBYA 2OZBA 1GO0A 1XBIA 4EI7A 2FC3A 2I6DA 2LBXA 3SIVA 5IT9M 1IPAA 1NJIH 1Q82H 2KG4A 3NK7A 3CMAF 5GIOC 1VQNF 1W2BF 2OTLF 3OW2F 1VQLF 1YJ9F 5HXZA 1ZWZA 2QI2A 1M1KH 4BW0B 1VQOF 5HY0A 3G71F 1GO1A 1VQMF 3VI6A 1X52A 3CXCF 2FGYA 3NVIB 1W41A 3J80M 3RA5A 1JJ2F 1YJWF 1M90H 1K8AH 3G6EF 2F9ZC 3FFMA 3V7QA 5HY1A 4BY9D 3CPQA 3CCQF 1S72F 4XCQA 1VQKF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EO3 A;  3CCE F;  1Q7Y H;  1QVG F;  1CN7 A;  3I56 F;  1VQ5 F;  1W3E X;  1QVF F;  4C4W C;  1DT9 A;  3VMF B;  1VQ9 F;  1VQ7 F;  2QEX F;  1Q81 H;  3CCV F;  3CCM F;  2JNB A;  2KTV A;  3V7E A;  3CG6 A;  4X3M A;  2CZW A;  2WAL A;  3I55 F;  1VQ6 F;  1E7K A;  3CD6 F;  3G4S F;  3CC4 F;  2KTU A;  5GAN K;  1YI2 F;  3O85 A;  2OHW A;  3SIU A;  1KC8 H;  3CC7 F;  2VGM A;  3CCS F;  1N8R H;  3GYQ A;  1VQ4 F;  3CPW F;  1GZ0 A;  3CME F;  2AIF A;  4TZZ A;  1KD1 H;  3LWR C;  1RLG A;  3NK6 A;  3N4Z A;  1W42 A;  3MCA B;  3LWO C;  3RA6 A;  3E20 B;  3CCJ F;  5G4V C;  3AGK A;  1VQ8 F;  1SDS A;  1H7M A;  1NMU B;  3JAM M;  3NMU C;  5G4U C;  1KQS F;  5EWR A;  5A2Q M;  3LWP C;  2HVY D;  1CK2 A;  4NUT A;  1VQP F;  3PLA C;  1X7P A;  3OBW A;  3N4Y A;  4X3L A;  3IR9 A;  1YHQ F;  1W40 A;  3LWQ C;  3HJW C;  3LFO A;  1Q86 H;  5DCV A;  3CCR F;  3NVK E;  4LCK A;  1YIT F;  3E1Y A;  3J7A R;  2OTJ F;  1K9M H;  5GAP K;  1PXW A;  3ON1 A;  3CCU F;  1T0K B;  3JCM M;  1K73 H;  3WXM B;  1YIJ F;  3HAX D;  3J81 M;  2LBW A;  3CC2 F;  2ALE A;  1YJN F;  1X7O A;  3PAF A;  2BO1 A;  2VGN A;  3LWV C;  5FJ4 C;  5FLX M;  5GIN C;  3CCL F;  1RA4 A;  2QA4 F;  5GIP C;  3OBY A;  2OZB A;  1GO0 A;  1XBI A;  2FC3 A;  2I6D A;  2LBX A;  3SIV A;  5IT9 M;  1IPA A;  1NJI H;  1Q82 H;  2KG4 A;  3NK7 A;  3CMA F;  5GIO C;  1VQN F;  1W2B F;  2OTL F;  3OW2 F;  1VQL F;  1YJ9 F;  1M1K H;  1ZWZ A;  2QI2 A;  4BW0 B;  1VQO F;  3G71 F;  1GO1 A;  1VQM F;  3VI6 A;  1X52 A;  3CXC F;  3NVI B;  1W41 A;  3J80 M;  3RA5 A;  1JJ2 F;  1YJW F;  1M90 H;  1K8A H;  3G6E F;  3FFM A;  3V7Q A;  4BY9 D;  3CPQ A;  3CCQ F;  1S72 F;  1VQK F; 
#chains in the Genus database with same CATH topology
 5EO3 A;  4I50 A;  2HQS C;  1VQ5 F;  1W3E X;  3RYC A;  1DT9 A;  3VMF B;  4O4J B;  1VQ9 F;  3K2X A;  1W57 A;  2UYN A;  5J2T B;  1JFF B;  3CCM F;  2JNB A;  1TUB A;  2RHL A;  1UI9 A;  4X3M A;  2AMT A;  2R75 1;  1UFY A;  1VQ6 F;  3CD6 F;  3RYF A;  3WGL A;  5ITZ B;  3G4S F;  5GAN K;  4TUY A;  3O85 A;  1FNJ A;  5JCO C;  1W5F A;  4ZI7 B;  2N48 A;  5JH7 A;  3WGJ A;  4X1K B;  2DT4 A;  3GYQ A;  1VQ4 F;  3CPW F;  3GTZ A;  4TZZ A;  1KD1 H;  3VO8 A;  2BTU A;  5CA0 A;  3WGM A;  1RLG A;  5LYJ B;  2RHH A;  1W5A A;  4B5C A;  3LWO C;  3FD6 A;  3S0W A;  1SDS A;  4O4L B;  5LA6 A;  4BT7 A;  3E22 B;  3VOB A;  1CK2 A;  4NUT A;  1QAH A;  1VQP F;  2P6Y A;  1IV1 A;  1X7P A;  5EZY B;  3OBW A;  2I6R A;  5JCO A;  2LCA A;  3IR9 A;  1YHQ F;  3JAS B;  2IQQ A;  1Q86 H;  5LP6 B;  1PXW A;  3WJQ A;  1JD1 A;  3WGN A;  1K73 H;  2GLZ A;  3RYF B;  3K12 A;  1IV4 A;  3WPX A;  2UYK A;  4BVQ A;  5IYZ B;  2VGN A;  4TV8 A;  3LWV C;  3VIU A;  4EI8 A;  2QA4 F;  2FC3 A;  1W55 A;  2G9I A;  1U40 A;  4TV9 B;  2ZOD A;  4ZOL B;  1GX1 A;  5EYP A;  4X1Y A;  5IT9 M;  1NJI H;  4O2B B;  5MN6 A;  4C8E A;  4B62 A;  3WJR A;  1VQN F;  4G4Z A;  3HKB B;  4G4X A;  4ZHY B;  5EZY A;  1YJ9 F;  2ZVY A;  1ZWZ A;  3KE1 A;  3VOA A;  1M1K H;  4BW0 B;  2R6R 1;  5FNV A;  1FSZ A;  3IEW A;  2Z1T A;  1DBF A;  4LNU A;  4DXD A;  3LME A;  3CYP B;  3I3F A;  4EB6 A;  2PMP A;  2W8B C;  3JVH A;  4X1Y B;  5LOV A;  5JVD A;  1Z5V A;  3JAT A;  3MDO A;  5JQG A;  3J80 M;  5MN5 A;  3KHN A;  3JAR A;  4ZHQ B;  1TVK B;  2AIZ P;  1OFU A;  3FFM A;  3V7Q A;  4DRX A;  5HY1 A;  3RYI A;  3IMP A;  3CCQ F;  2HRY A;  3ESJ A;  4XCQ A;  1VQK F;  2ZVZ A;  3M84 A;  3TD3 A;  1Q7Y H;  5HXU A;  4TUY B;  1J7H A;  1QVF F;  4TV9 A;  4ZOL A;  5MN4 A;  2RHJ A;  4YJ2 A;  4X1K A;  5HP8 A;  1JFF A;  2GZL A;  3CCV F;  4I55 B;  4BVS A;  3CG6 A;  2Q1Y A;  1ODE A;  5ITZ A;  3I55 F;  3HKE A;  3N2K B;  4C81 A;  1RQ2 A;  2Z1F A;  3HKD B;  3HKC A;  4ZK7 A;  5KMG B;  3RYI B;  2H8C A;  4DRX B;  4I4T A;  4O2A A;  3QTY A;  4EI9 A;  3D54 A;  2QTP A;  1FNK A;  2DYY A;  5EB0 A;  5GON B;  3M4S A;  3JAS A;  3T80 A;  3MBM A;  5LYJ A;  1U43 A;  5JVD B;  1W42 A;  4PWT A;  3MCA B;  4HNA B;  5LXT A;  5G4V C;  3AGK A;  3TD4 A;  5CA1 A;  3N2G A;  3JAK A;  5EWR A;  5A2Q M;  3S0H A;  1H47 A;  3F0F A;  4X3L A;  3JAL B;  3LWQ C;  4ZHV A;  4IIJ A;  4C8I A;  5DCV A;  5EIB D;  1YIT F;  5BMV B;  3S0Y A;  3E1Y A;  2OTJ F;  3LDT A;  2IG8 A;  3CCU F;  4BT2 A;  3JCM M;  1VQV A;  3VYS C;  3WXM B;  1YIJ F;  3KJK A;  5HWE A;  3ZP4 A;  2CHS A;  3HKE B;  4BT5 A;  3D00 A;  3L7Q A;  1X7O A;  3PAF A;  1TUB B;  4YJ3 A;  4I4T B;  4O2A B;  4ERH A;  3WJP A;  1SZQ A;  1IV2 A;  1RA4 A;  5J2U A;  5GIP C;  3F6M A;  3K14 A;  4YJ2 B;  1GO0 A;  3RYC B;  3SIV A;  5LP6 C;  3I7T A;  2YXZ A;  5IJ9 B;  5J2T A;  3QUW A;  4X20 B;  3N2G B;  4F6R A;  4G4V A;  3S03 A;  4O4H B;  3OW2 F;  4ZHW A;  5LOV B;  2RHO A;  5HY0 A;  4IHJ A;  3G71 F;  1VQM F;  3VI6 A;  2GVI A;  3OON A;  3E22 A;  4LNU B;  3ZP7 A;  2CHT A;  2VAW A;  2UZH A;  2HS4 A;  5IJ0 A;  3C9T A;  3CXC F;  5JQG B;  2FGY A;  1COM A;  2CSL A;  1FFX A;  2RB9 A;  1RLU A;  3VTI C;  5EIB C;  4F6R B;  4I55 A;  4KWE A;  4FFB B;  5EYP B;  1VHA A;  4ZI7 A;  1CN7 A;  1QVG F;  4C8G A;  3P4E A;  2MQE A;  1U3P A;  2HX0 A;  1U3L A;  4X20 A;  2QEX F;  5IJ9 A;  5LP6 A;  3V7E A;  2B33 A;  1SA0 B;  2WAL A;  4ZHQ A;  3N2K A;  4YJ3 B;  3RYH A;  2HS0 A;  1E7K A;  4U3J B;  3GHZ A;  4WBN B;  5J2U B;  2OHW A;  3BYQ A;  1VK3 A;  3VYU C;  3CCS F;  3V4D A;  1KNJ A;  4X1I A;  3DC2 A;  3QHD A;  3CME F;  2K1S A;  5KX5 B;  3LWR C;  3JAL A;  3D01 A;  1IV3 A;  3V3T A;  5LA6 B;  4BVT A;  5BMV A;  3ZOP A;  3RA6 A;  3E20 B;  3CCJ F;  1VQ8 F;  3JAK B;  2EWC A;  4NQ3 A;  1NMU B;  3JAM M;  5G4U C;  1KQS F;  3LWP C;  2HS3 A;  5KMG A;  3PLA C;  1YGY A;  2IAF A;  3UT5 A;  1W40 A;  3HJW C;  3LFO A;  1XRG A;  3R0P A;  2KGW A;  5GON A;  3CCR F;  3NVK E;  3J7A R;  2HP0 A;  5CB4 A;  1K9M H;  1OAP A;  2BTO A;  4TV8 B;  3ON1 A;  3HKD A;  1T0K B;  4WBN A;  3P0Z A;  5KX5 A;  3J81 M;  2Z1U A;  3ELC A;  5EB1 B;  2V9Y A;  5EAZ A;  5FJ4 C;  4RHA A;  3CCL F;  4O4J A;  3OBY A;  4IIJ B;  1PF5 A;  1JY8 A;  3FPI A;  1Z5W A;  4EI7 A;  4E6E A;  5B8F A;  2ZF8 A;  5IJ0 B;  5GIO C;  3CMA F;  2HP0 B;  3U0O A;  4O4L A;  5AVM A;  4O4I B;  1VQL F;  5HXZ A;  3UT5 B;  1KNK A;  1W5E A;  3RE3 A;  2Z1E A;  2CW4 A;  3CB2 A;  1X25 A;  3JAR B;  3F0E A;  4O2B A;  2Z01 A;  4HNA A;  3NVI B;  1W41 A;  3RA5 A;  3Q8H A;  1M90 H;  5CA1 B;  1ONI A;  3WPW A;  2F9Z C;  4BY9 D;  3WGK A;  2VXY A;  3MQW A;  2HRU A;  3CPQ A;  2L26 A;  3CCE F;  3ZO8 A;  3I56 F;  4C4W C;  1NQ3 A;  1VQ7 F;  1W5B A;  2UYN B;  5HY4 A;  2ZOV A;  4B46 A;  3F0D A;  1Q81 H;  2KTV A;  3C9S A;  2CZW A;  3P10 A;  4G88 A;  2CVL A;  2ZAU A;  4U39 A;  4U3J A;  3CC4 F;  2KTU A;  1VH8 A;  1YI2 F;  3SIU A;  1KC8 H;  4G4W A;  3CC7 F;  2VGM A;  1N8R H;  3EOR A;  2PHN A;  2VAP A;  1GZ0 A;  2AIF A;  2Q1X A;  1W58 1;  3NK6 A;  3IKE A;  3N4Z A;  3JAT B;  4EB6 B;  5HY2 A;  3TD5 A;  2H6L A;  4O4I A;  1JN1 A;  3IEQ A;  1H7M A;  5JH7 B;  1YQN A;  3NMU C;  1FFX B;  1QU9 A;  2HVY D;  5LXT B;  3HKC B;  3K0T A;  3C8L A;  2H8E A;  5CA0 B;  3JAW A;  4IHJ B;  3N4Y A;  4LCK A;  4G4Y A;  1CLI A;  3VCZ A;  4BT6 A;  3F0G A;  1R1M A;  4BT3 A;  3DDN A;  3KIZ A;  3M1X A;  5GAP K;  4BVR A;  3S06 A;  3CYQ A;  4NWO B;  3HAX D;  2LBW A;  3VYT C;  3CC2 F;  2ALE A;  4O4H A;  3ERN A;  2UYP A;  4BT4 A;  3HKB A;  3S02 A;  4X1I B;  1YJN F;  2BO1 A;  3B6N A;  1SA0 A;  4FFB A;  5FLX M;  4C82 A;  1T0A A;  1XHO A;  5GIN C;  1TVK A;  3MCQ A;  2OZB A;  1XBI A;  4R40 B;  2I6D A;  4I50 B;  2OTM A;  2LBX A;  1IPA A;  1Q8R A;  5CB4 B;  1Q82 H;  2KG4 A;  3NK7 A;  4B45 A;  3C9R A;  2YYE A;  2CWJ A;  5IYZ A;  5C8Y B;  5HP7 A;  1QD9 A;  3LYB A;  1W2B F;  3KJJ A;  2OTL F;  3FBA A;  3JAW B;  1H48 A;  2QI2 A;  3C9U A;  1VQO F;  3HWU A;  1GO1 A;  2HP3 A;  2VAM A;  2UYJ A;  3IKF A;  1RQ7 A;  2NMU A;  4M8I A;  5FNV B;  1X52 A;  4RQO A;  1JJ2 F;  1YJW F;  2LBT A;  3RYH B;  1K8A H;  3G6E F;  1XV2 A;  2BTQ B;  3FD5 A;  5C8Y A;  3HTN A;  1S72 F;  1W59 A; 
#chains in the Genus database with same CATH homology
 5EO3 A;  3CCE F;  1Q7Y H;  1QVG F;  5HXU A;  1CN7 A;  3I56 F;  1VQ5 F;  1W3E X;  1QVF F;  4C4W C;  1DT9 A;  3VMF B;  1VQ9 F;  1VQ7 F;  2QEX F;  5HY4 A;  1Q81 H;  3CCV F;  3CCM F;  2JNB A;  2KTV A;  3V7E A;  4BVS A;  3CG6 A;  4X3M A;  2CZW A;  2WAL A;  3I55 F;  1VQ6 F;  1E7K A;  3CD6 F;  3G4S F;  3CC4 F;  2KTU A;  5GAN K;  1YI2 F;  3O85 A;  2OHW A;  3SIU A;  1KC8 H;  3CC7 F;  2VGM A;  3CCS F;  1N8R H;  3GYQ A;  4EI9 A;  1VQ4 F;  3CPW F;  1GZ0 A;  3CME F;  2AIF A;  4TZZ A;  1KD1 H;  3LWR C;  1RLG A;  3NK6 A;  3N4Z A;  5HY2 A;  1W42 A;  3V3T A;  4BVT A;  3MCA B;  3LWO C;  3RA6 A;  3E20 B;  3CCJ F;  5G4V C;  3AGK A;  1VQ8 F;  1SDS A;  1H7M A;  4NQ3 A;  1NMU B;  3JAM M;  3NMU C;  5G4U C;  1KQS F;  5EWR A;  5A2Q M;  3LWP C;  2HVY D;  1CK2 A;  4NUT A;  1VQP F;  3PLA C;  1X7P A;  3OBW A;  3N4Y A;  4X3L A;  3IR9 A;  1YHQ F;  1W40 A;  3LWQ C;  3HJW C;  3LFO A;  1Q86 H;  5DCV A;  3CCR F;  3NVK E;  4LCK A;  1YIT F;  3E1Y A;  3J7A R;  2OTJ F;  1K9M H;  5GAP K;  4BVR A;  1PXW A;  3ON1 A;  3CCU F;  1T0K B;  3JCM M;  1K73 H;  3WXM B;  1YIJ F;  2GLZ A;  5HWE A;  3HAX D;  3J81 M;  2LBW A;  3CC2 F;  2ALE A;  3D00 A;  1YJN F;  1X7O A;  3PAF A;  2BO1 A;  4BVQ A;  2VGN A;  3LWV C;  5FJ4 C;  5FLX M;  5GIN C;  3CCL F;  1RA4 A;  4EI8 A;  2QA4 F;  5GIP C;  3OBY A;  2OZB A;  1GO0 A;  1XBI A;  4EI7 A;  2FC3 A;  2I6D A;  2LBX A;  3SIV A;  5IT9 M;  1IPA A;  1NJI H;  1Q82 H;  2KG4 A;  3NK7 A;  3CMA F;  5GIO C;  1VQN F;  1W2B F;  2OTL F;  3OW2 F;  1VQL F;  1YJ9 F;  5HXZ A;  1ZWZ A;  2QI2 A;  1M1K H;  4BW0 B;  1VQO F;  5HY0 A;  3G71 F;  1GO1 A;  1VQM F;  3VI6 A;  1X52 A;  3CXC F;  2FGY A;  3NVI B;  1W41 A;  3J80 M;  3RA5 A;  1JJ2 F;  1YJW F;  1M90 H;  1K8A H;  3G6E F;  2F9Z C;  3FFM A;  3V7Q A;  5HY1 A;  4BY9 D;  3CPQ A;  3CCQ F;  1S72 F;  4XCQ A;  1VQK F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...