1VQ8F

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq8F00
2LBWA 2BO1A 3CCQF 5GINC 3CCJF 3E20B 3NK7A 1W2BF 3LWQC 1W42A 2QA4F 4BY9D 3NMUC 1X7OA 1Q82H 1RA4A 3IR9A 2CZWA 5GIOC 2OTLF 1VQ8F 5A2QM 4X3MA 1VQ4F 3LWVC 3LWPC 1IPAA 3LFOA 1YI2F 1KC8H 5IT9M 3NVKE 1YHQF 4BW0B 1Q81H 3J80M 3CXCF 3G6EF 1VQ9F 5DCVA 1VQ5F 3VI6A 5FJ4C 1CK2A 3JCMM 3PAFA 1NMUB 3HJWC 3CD6F 3VMFB 1GO1A 3CC7F 3LWRC 3I55F 1YITF 1PXWA 2JNBA 1X52A 1CN7A 3J7AR 3G71F 2ALEA 3HAXD 1VQ6F 1W3EX 3OBWA 3RA6A 3J81M 1X7PA 1M90H 3CCUF 1GO0A 1Q86H 3WXMB 5EWRA 2KTVA 3V7QA 5GIPC 3OW2F 2OZBA 3CPWF 1T0KB 1QVGF 3V7EA 1N8RH 2OHWA 1H7MA 1W40A 1VQ7F 1E7KA 4LCKA 1YJWF 3GYQA 1VQNF 2QEXF 1KQSF 5GANK 2FC3A 3SIVA 3FFMA 3CCMF 3AGKA 3CMEF 2LBXA 2VGMA 1YJ9F 1K9MH 2AIFA 5G4VC 1NJIH 1JJ2F 4TZZA 1M1KH 1W41A 3CCLF 3N4ZA 2KG4A 3G4SF 1QVFF 3PLAC 3SIUA 3NK6A 1ZWZA 1K8AH 2HVYD 1VQLF 2I6DA 1KD1H 3CG6A 3E1YA 1S72F 3NVIB 3CCEF 1YJNF 3CCRF 2KTUA 1GZ0A 1VQMF 1XBIA 5EO3A 3O85A 2QI2A 1Q7YH 3CPQA 2OTJF 4C4WC 5GAPK 1SDSA 3CC4F 1K73H 3CMAF 5FLXM 3CC2F 1RLGA 2WALA 3CCVF 4X3LA 2VGNA 3N4YA 3ON1A 1VQPF 1DT9A 3LWOC 5G4UC 3OBYA 1VQOF 3MCAB 3I56F 3CCSF 3RA5A 1YIJF 1VQKF 4NUTA 3JAMM
chains in the Genus database with same CATH superfamily
5CA1A 4C82A 5BMVB 1JN1A 3CCJF 1W2BF 2QA4F 2HQSC 2UYJA 1X7OA 1RA4A 5C8YB 2LBTA 5J2UA 4YJ3A 5EB0A 5A2QM 4NQ3A 1W581 2CHSA 3F0FA 1VQ4F 4X1YB 3KHNA 5IYZB 1NQ3A 4KWEA 4O4LA 5IT9M 3KIZA 4B46A 4BVTA 5HY0A 3V4DA 5JH7A 3J80M 1VQ9F 2L26A 4IHJA 5LP6C 5EB1B 2HX0A 5J2TA 1H48A 1JY8A 5FNVA 3VYSC 5IJ0B 1GO1A 3DDNA 2W8BC 2UYPA 4FFBA 5CA0B 3LYBA 3S03A 4BT4A 4ZK7A 4C8EA 1U43A 4ZHQA 2CSLA 4O4JB 5HP7A 5GONB 3RYIB 3M84A 4X1KB 3J81M 4G4WA 4O2AB 2Q1XA 3F0GA 3OW2F 2OZBA 3CPWF 1Z5WA 3FPIA 4LNUA 5EZYA 1N8RH 1QVGF 3B6NA 1H7MA 1W40A 3RYCB 1JD1A 3N2GA 3TD4A 1FSZA 5HY4A 3FFMA 3CCMF 2HS3A 3QHDA 4G4XA 2AIFA 1FNJA 1OAPA 1JJ2F 4TZZA 3QUWA 1W41A 3FBAA 2BTOA 3HKEA 3C9UA 1YGYA 3G4SF 2BTUA 3SIUA 1VQLF 4O4IB 1QU9A 3HKBB 3NVIB 3CCEF 4C81A 2ZAUA 1W5FA 3K2XA 1XBIA 3CB2A 3UT5A 4BT6A 1TUBB 1ONIA 2K1SA 2DYYA 2VAWA 3C8LA 5MN6A 3KJKA 1SA0B 3VOAA 3JASA 3CC4F 3F6MA 5IJ9A 2VGNA 1JFFB 4B45A 5ITZB 2R751 1IV2A 3I56F 2UYKA 1VQKF 3E22A 5LOVA 2BO1A 3CCQF 1W57A 3K14A 4HNAB 4O2BB 3NK7A 3LWQC 3JARA 1XRGA 3VYTC 3IR9A 2CZWA 4EI9A 2HS0A 2IQQA 2OTLF 1W5EA 3LWVC 3LWPC 1TVKA 5LA6A 1RQ7A 2I6RA 3C9RA 5EYPA 1YI2F 5LYJA 3NVKE 4BW0B 2AMTA 2DT4A 4I55B 4G4VA 2GLZA 1VQ5F 3IMPA 3D01A 2N48A 4I4TA 4O4LB 4DRXA 2F9ZC 5B8FA 5HWEA 2UYNA 4BT3A 4U3JB 3CC7F 4IHJB 3LWRC 3I55F 2CVLA 5J2TB 3F0EA 3CYPB 3HKCA 2ZVZA 4BT5A 2EWCA 2CHTA 1CN7A 2BTQB 2HRUA 1W3EX 4X20A 3RYHB 4ZHQB 2ZVYA 3KE1A 3K12A 1M90H 3CCUF 3WXMB 5EWRA 2KTVA 3V7QA 5MN5A 5GIPC 4WBNB 1IV4A 3MCQA 4BT7A 2PHNA 3WGMA 4TUYA 2RHJA 1E7KA 2H8CA 2ZF8A 3ERNA 4ERHA 3GYQA 5EZYB 1VQVA 3N2KB 2FC3A 4EB6A 3LDTA 1XV2A 2GVIA 4I50A 3JALA 1K9MH 4O4HB 3M4SA 1NJIH 3D00A 4C8IA 3FD6A 3EORA 3FD5A 4BT2A 3NK6A 2HVYD 2HRYA 5JVDB 3WGKA 4YJ2A 3HKEB 3WGNA 1KD1H 1KNJA 1YJNF 3HTNA 2CWJA 2P6YA 3CCRF 3QTYA 5JQGA 2KTUA 1GZ0A 1VH8A 3C9TA 3DC2A 4G4YA 2Z1UA 3R0PA 2OTJF 1W5BA 4TV8B 3VO8A 3JATB 3UT5B 2B33A 1K73H 5FLXM 3P10A 3ON1A 4ZHWA 3VOBA 1DT9A 4DXDA 3OBYA 3JASB 1VQOF 3MCAB 3CCSF 1YIJF 2Q1YA 5CA0A 4NUTA 2LBWA 1YQNA 2Z1FA 1COMA 1OFUA 3JAWB 1W42A 4BY9D 3JAKB 3E22B 5KX5A 5LOVB 4ZI7B 5LXTA 4U39A 3F0DA 5KMGB 5EAZA 1VHAA 3GTZA 3M1XA 3ZO8A 3VYUC 4BVSA 2H8EA 1FNKA 3S0HA 3VIUA 2Z1TA 3GHZA 2HS4A 3RYCA 1YHQF 2YYEA 1U3PA 1Q81H 3BYQA 1TVKB 4NWOB 5LA6B 3CXCF 4IIJB 1X25A 4F6RA 1RQ2A 2OTMA 5LYJB 1CK2A 2G9IA 3PAFA 2IG8A 3CD6F 5JCOA 4I4TB 5CA1B 3S0YA 1YITF 1PXWA 1X52A 3Q8HA 3L7QA 3J7AR 3ESJA 2ALEA 4R40B 1FFXA 1VQ6F 3RA6A 4RHAA 3HKCB 1X7PA 5J2UB 1GO0A 4YJ3B 2PMPA 2QTPA 4X20B 2HP0A 1T0KB 1H47A 3WJRA 3WGLA 3OONA 5HXZA 1SZQA 1TUBA 3TD3A 1IV3A 1CLIA 5JH7B 1VQNF 2QEXF 1KQSF 4ZHYB 1RLUA 4X1IA 3IKFA 4TUYB 5GANK 1DBFA 5FNVB 3ZOPA 1T0AA 3CMEF 3MDOA 1IV1A 5HY1A 2VGMA 1YJ9F 3RE3A 3ZP4A 4TV9A 5EIBD 4ZOLA 4EI7A 5G4VC 4FFBB 1M1KH 3P4EA 3CCLF 5CB4A 3N4ZA 3VCZA 2IAFA 3PLAC 1QAHA 3HKDA 3WJQA 3CG6A 1S72F 2VXYA 5LP6A 3TD5A 3RYFA 4LNUB 1VQMF 4YJ2B 4C8GA 5EO3A 3I7TA 3O85A 1Q7YH 1W55A 2UZHA 3ZP7A 5JQGB 3LMEA 3N2GB 4I55A 5GAPK 1SDSA 5AVMA 3WGJA 3CMAF 1U3LA 1RLGA 2WALA 3CCVF 4X3LA 1J7HA 5BMVA 4RQOA 4U3JA 2GZLA 5G4UC 3RA5A 5C8YA 5GINC 3E20B 2RB9A 4G4ZA 3VTIC 3U0OA 3NMUC 1Q82H 3RYHA 5HY2A 4X1YA 1KNKA 5IYZA 3P0ZA 5GIOC 2R6R1 2Z01A 3WJPA 1VQ8F 5KX5B 5LXTB 4X3MA 1UI9A 4WBNA 1IPAA 5MN4A 2HP3A 3LFOA 3WPWA 1KC8H 4BVRA 4G88A 4B5CA 5IJ0A 3G6EF 5DCVA 2KGWA 2YXZA 3VI6A 3N2KA 5IJ9B 3V3TA 5FJ4C 3CYQA 3JCMM 1NMUB 3HJWC 3VMFB 2CW4A 4F6RB 4O4JA 4O4HA 1VK3A 5GONA 2AIZP 2JNBA 2RHOA 3RYIA 4X1KA 3JVHA 1Q8RA 4O2AA 3G71F 3JARB 3K0TA 3HAXD 3OBWA 3IKEA 5JVDA 1Q86H 2VAMA 1FFXB 1GX1A 2FGYA 1W5AA 2H6LA 3V7EA 1R1MA 4BVQA 2OHWA 5EYPB 1W59A 1VQ7F 2HP0B 1PF5A 4LCKA 1YJWF 4TV8A 3S0WA 4ZHVA 3JATA 4DRXB 4PWTA 3SIVA 2UYNB 2Z1EA 3AGKA 3MQWA 3T80A 1QD9A 2LBXA 4B62A 4M8IA 4X1IB 2V9YA 1U40A 4O4IA 2VAPA 4TV9B 3KJJA 1Z5VA 2ZOVA 3HKBA 4ZOLB 3JAWA 2KG4A 1QVFF 3JAKA 1ZWZA 3IEQA 1K8AH 4ZI7A 5JCOC 2I6DA 5KMGA 5CB4B 3E1YA 2MQEA 3HKDB 3D54A 3HWUA 2LCAA 5EIBC 1ODEA 1SA0A 3S02A 2QI2A 3WPXA 5LP6B 3CPQA 3RYFB 1XHOA 1JFFA 1UFYA 5ITZA 4C4WC 2NMUA 3I3FA 2ZODA 4IIJA 2RHLA 4EB6B 5HP8A 5HXUA 3CC2F 1VQPF 3N4YA 3S06A 4E6EA 3MBMA 3ELCA 3IEWA 3JALB 4I50B 4XCQA 4HNAA 4O2BA 3LWOC 4EI8A 3C9SA 2RHHA 3JAMM
chains in the Genus database with same CATH topology
2LBWA 2BO1A 3CCQF 5GINC 3CCJF 3E20B 3NK7A 1W2BF 3LWQC 1W42A 2QA4F 4BY9D 3NMUC 1X7OA 1Q82H 1RA4A 3IR9A 2CZWA 5HY2A 4EI9A 5GIOC 2OTLF 1VQ8F 5A2QM 4NQ3A 4X3MA 1VQ4F 4BVSA 3LWPC 3LWVC 1IPAA 3LFOA 1YI2F 1KC8H 5IT9M 3NVKE 1YHQF 4BW0B 4BVRA 4BVTA 5HY0A 1Q81H 3J80M 2GLZA 3CXCF 3G6EF 1VQ9F 5DCVA 1VQ5F 3VI6A 5HWEA 5FJ4C 3V3TA 2F9ZC 1CK2A 3JCMM 3PAFA 1NMUB 3HJWC 3CD6F 3VMFB 1GO1A 3CC7F 3LWRC 3I55F 1YITF 1PXWA 2JNBA 1X52A 1CN7A 3J7AR 3G71F 2ALEA 3HAXD 1VQ6F 1W3EX 3OBWA 3RA6A 3J81M 1X7PA 1M90H 3CCUF 1GO0A 1Q86H 1RLGA 3WXMB 5EWRA 2KTVA 3V7QA 5GIPC 3OW2F 2OZBA 3CPWF 2FGYA 1T0KB 1QVGF 3V7EA 1N8RH 5HXZA 4BVQA 2OHWA 1H7MA 1W40A 1VQ7F 1E7KA 4LCKA 1YJWF 3GYQA 1VQNF 2QEXF 1KQSF 5HY4A 5GANK 2FC3A 3SIVA 3FFMA 3CCMF 3AGKA 3CMEF 5HY1A 2LBXA 2VGMA 1YJ9F 1K9MH 2AIFA 4EI7A 5G4VC 1NJIH 1JJ2F 4TZZA 3D00A 1M1KH 1W41A 3CCLF 3N4ZA 2KG4A 3G4SF 1QVFF 3PLAC 3SIUA 3NK6A 1ZWZA 1K8AH 2HVYD 1VQLF 2I6DA 1KD1H 3CG6A 3E1YA 1S72F 3NVIB 3CCEF 1YJNF 3CCRF 2KTUA 1GZ0A 1VQMF 1XBIA 5EO3A 3O85A 2QI2A 1Q7YH 3CPQA 2OTJF 4C4WC 5GAPK 1SDSA 3CC4F 1K73H 3CMAF 5FLXM 5HXUA 3CC2F 2WALA 3CCVF 4X3LA 2VGNA 3N4YA 3ON1A 1VQPF 4XCQA 1DT9A 3LWOC 5G4UC 4EI8A 3OBYA 1VQOF 3MCAB 3I56F 3CCSF 3RA5A 1YIJF 1VQKF 4NUTA 3JAMM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBW A;  2BO1 A;  3CCQ F;  5GIN C;  3CCJ F;  3E20 B;  3NK7 A;  1W2B F;  3LWQ C;  1W42 A;  2QA4 F;  4BY9 D;  3NMU C;  1X7O A;  1Q82 H;  1RA4 A;  3IR9 A;  2CZW A;  5GIO C;  2OTL F;  1VQ8 F;  5A2Q M;  4X3M A;  1VQ4 F;  3LWV C;  3LWP C;  1IPA A;  3LFO A;  1YI2 F;  1KC8 H;  5IT9 M;  3NVK E;  1YHQ F;  4BW0 B;  1Q81 H;  3J80 M;  3CXC F;  3G6E F;  1VQ9 F;  5DCV A;  1VQ5 F;  3VI6 A;  5FJ4 C;  1CK2 A;  3JCM M;  3PAF A;  1NMU B;  3HJW C;  3CD6 F;  3VMF B;  1GO1 A;  3CC7 F;  3LWR C;  3I55 F;  1YIT F;  1PXW A;  2JNB A;  1X52 A;  1CN7 A;  3J7A R;  3G71 F;  2ALE A;  3HAX D;  1VQ6 F;  1W3E X;  3OBW A;  3RA6 A;  3J81 M;  1X7P A;  1M90 H;  3CCU F;  1GO0 A;  1Q86 H;  3WXM B;  5EWR A;  2KTV A;  3V7Q A;  5GIP C;  3OW2 F;  2OZB A;  3CPW F;  1T0K B;  1QVG F;  3V7E A;  1N8R H;  2OHW A;  1H7M A;  1W40 A;  1VQ7 F;  1E7K A;  4LCK A;  1YJW F;  3GYQ A;  1VQN F;  2QEX F;  1KQS F;  5GAN K;  2FC3 A;  3SIV A;  3FFM A;  3CCM F;  3AGK A;  3CME F;  2LBX A;  2VGM A;  1YJ9 F;  1K9M H;  2AIF A;  5G4V C;  1NJI H;  1JJ2 F;  4TZZ A;  1M1K H;  1W41 A;  3CCL F;  3N4Z A;  2KG4 A;  3G4S F;  1QVF F;  3PLA C;  3SIU A;  3NK6 A;  1ZWZ A;  1K8A H;  2HVY D;  1VQL F;  2I6D A;  1KD1 H;  3CG6 A;  3E1Y A;  1S72 F;  3NVI B;  3CCE F;  1YJN F;  3CCR F;  2KTU A;  1GZ0 A;  1VQM F;  1XBI A;  5EO3 A;  3O85 A;  2QI2 A;  1Q7Y H;  3CPQ A;  2OTJ F;  4C4W C;  5GAP K;  1SDS A;  3CC4 F;  1K73 H;  3CMA F;  5FLX M;  3CC2 F;  1RLG A;  2WAL A;  3CCV F;  4X3L A;  2VGN A;  3N4Y A;  3ON1 A;  1VQP F;  1DT9 A;  3LWO C;  5G4U C;  3OBY A;  1VQO F;  3MCA B;  3I56 F;  3CCS F;  3RA5 A;  1YIJ F;  1VQK F;  4NUT A;  3JAM M; 
#chains in the Genus database with same CATH topology
 5CA1 A;  4C82 A;  5BMV B;  1JN1 A;  3CCJ F;  1W2B F;  2QA4 F;  2HQS C;  2UYJ A;  1X7O A;  1RA4 A;  5C8Y B;  2LBT A;  5J2U A;  4YJ3 A;  5EB0 A;  5A2Q M;  4NQ3 A;  1W58 1;  2CHS A;  3F0F A;  1VQ4 F;  4X1Y B;  3KHN A;  5IYZ B;  1NQ3 A;  4KWE A;  4O4L A;  5IT9 M;  3KIZ A;  4B46 A;  4BVT A;  5HY0 A;  3V4D A;  5JH7 A;  3J80 M;  1VQ9 F;  2L26 A;  4IHJ A;  5LP6 C;  5EB1 B;  2HX0 A;  5J2T A;  1H48 A;  1JY8 A;  5FNV A;  3VYS C;  5IJ0 B;  1GO1 A;  3DDN A;  2W8B C;  2UYP A;  4FFB A;  5CA0 B;  3LYB A;  3S03 A;  4BT4 A;  4ZK7 A;  4C8E A;  1U43 A;  4ZHQ A;  2CSL A;  4O4J B;  5HP7 A;  5GON B;  3RYI B;  3M84 A;  4X1K B;  3J81 M;  4G4W A;  4O2A B;  2Q1X A;  3F0G A;  3OW2 F;  2OZB A;  3CPW F;  1Z5W A;  3FPI A;  4LNU A;  5EZY A;  1N8R H;  1QVG F;  3B6N A;  1H7M A;  1W40 A;  3RYC B;  1JD1 A;  3N2G A;  3TD4 A;  1FSZ A;  5HY4 A;  3FFM A;  3CCM F;  2HS3 A;  3QHD A;  4G4X A;  2AIF A;  1FNJ A;  1OAP A;  1JJ2 F;  4TZZ A;  3QUW A;  1W41 A;  3FBA A;  2BTO A;  3HKE A;  3C9U A;  1YGY A;  3G4S F;  2BTU A;  3SIU A;  1VQL F;  4O4I B;  1QU9 A;  3HKB B;  3NVI B;  3CCE F;  4C81 A;  2ZAU A;  1W5F A;  3K2X A;  1XBI A;  3CB2 A;  3UT5 A;  4BT6 A;  1TUB B;  1ONI A;  2K1S A;  2DYY A;  2VAW A;  3C8L A;  5MN6 A;  3KJK A;  1SA0 B;  3VOA A;  3JAS A;  3CC4 F;  3F6M A;  5IJ9 A;  2VGN A;  1JFF B;  4B45 A;  5ITZ B;  2R75 1;  1IV2 A;  3I56 F;  2UYK A;  1VQK F;  3E22 A;  5LOV A;  2BO1 A;  3CCQ F;  1W57 A;  3K14 A;  4HNA B;  4O2B B;  3NK7 A;  3LWQ C;  3JAR A;  1XRG A;  3VYT C;  3IR9 A;  2CZW A;  4EI9 A;  2HS0 A;  2IQQ A;  2OTL F;  1W5E A;  3LWV C;  3LWP C;  1TVK A;  5LA6 A;  1RQ7 A;  2I6R A;  3C9R A;  5EYP A;  1YI2 F;  5LYJ A;  3NVK E;  4BW0 B;  2AMT A;  2DT4 A;  4I55 B;  4G4V A;  2GLZ A;  1VQ5 F;  3IMP A;  3D01 A;  2N48 A;  4I4T A;  4O4L B;  4DRX A;  2F9Z C;  5B8F A;  5HWE A;  2UYN A;  4BT3 A;  4U3J B;  3CC7 F;  4IHJ B;  3LWR C;  3I55 F;  2CVL A;  5J2T B;  3F0E A;  3CYP B;  3HKC A;  2ZVZ A;  4BT5 A;  2EWC A;  2CHT A;  1CN7 A;  2BTQ B;  2HRU A;  1W3E X;  4X20 A;  3RYH B;  4ZHQ B;  2ZVY A;  3KE1 A;  3K12 A;  1M90 H;  3CCU F;  3WXM B;  5EWR A;  2KTV A;  3V7Q A;  5MN5 A;  5GIP C;  4WBN B;  1IV4 A;  3MCQ A;  4BT7 A;  2PHN A;  3WGM A;  4TUY A;  2RHJ A;  1E7K A;  2H8C A;  2ZF8 A;  3ERN A;  4ERH A;  3GYQ A;  5EZY B;  1VQV A;  3N2K B;  2FC3 A;  4EB6 A;  3LDT A;  1XV2 A;  2GVI A;  4I50 A;  3JAL A;  1K9M H;  4O4H B;  3M4S A;  1NJI H;  3D00 A;  4C8I A;  3FD6 A;  3EOR A;  3FD5 A;  4BT2 A;  3NK6 A;  2HVY D;  2HRY A;  5JVD B;  3WGK A;  4YJ2 A;  3HKE B;  3WGN A;  1KD1 H;  1KNJ A;  1YJN F;  3HTN A;  2CWJ A;  2P6Y A;  3CCR F;  3QTY A;  5JQG A;  2KTU A;  1GZ0 A;  1VH8 A;  3C9T A;  3DC2 A;  4G4Y A;  2Z1U A;  3R0P A;  2OTJ F;  1W5B A;  4TV8 B;  3VO8 A;  3JAT B;  3UT5 B;  2B33 A;  1K73 H;  5FLX M;  3P10 A;  3ON1 A;  4ZHW A;  3VOB A;  1DT9 A;  4DXD A;  3OBY A;  3JAS B;  1VQO F;  3MCA B;  3CCS F;  1YIJ F;  2Q1Y A;  5CA0 A;  4NUT A;  2LBW A;  1YQN A;  2Z1F A;  1COM A;  1OFU A;  3JAW B;  1W42 A;  4BY9 D;  3JAK B;  3E22 B;  5KX5 A;  5LOV B;  4ZI7 B;  5LXT A;  4U39 A;  3F0D A;  5KMG B;  5EAZ A;  1VHA A;  3GTZ A;  3M1X A;  3ZO8 A;  3VYU C;  4BVS A;  2H8E A;  1FNK A;  3S0H A;  3VIU A;  2Z1T A;  3GHZ A;  2HS4 A;  3RYC A;  1YHQ F;  2YYE A;  1U3P A;  1Q81 H;  3BYQ A;  1TVK B;  4NWO B;  5LA6 B;  3CXC F;  4IIJ B;  1X25 A;  4F6R A;  1RQ2 A;  2OTM A;  5LYJ B;  1CK2 A;  2G9I A;  3PAF A;  2IG8 A;  3CD6 F;  5JCO A;  4I4T B;  5CA1 B;  3S0Y A;  1YIT F;  1PXW A;  1X52 A;  3Q8H A;  3L7Q A;  3J7A R;  3ESJ A;  2ALE A;  4R40 B;  1FFX A;  1VQ6 F;  3RA6 A;  4RHA A;  3HKC B;  1X7P A;  5J2U B;  1GO0 A;  4YJ3 B;  2PMP A;  2QTP A;  4X20 B;  2HP0 A;  1T0K B;  1H47 A;  3WJR A;  3WGL A;  3OON A;  5HXZ A;  1SZQ A;  1TUB A;  3TD3 A;  1IV3 A;  1CLI A;  5JH7 B;  1VQN F;  2QEX F;  1KQS F;  4ZHY B;  1RLU A;  4X1I A;  3IKF A;  4TUY B;  5GAN K;  1DBF A;  5FNV B;  3ZOP A;  1T0A A;  3CME F;  3MDO A;  1IV1 A;  5HY1 A;  2VGM A;  1YJ9 F;  3RE3 A;  3ZP4 A;  4TV9 A;  5EIB D;  4ZOL A;  4EI7 A;  5G4V C;  4FFB B;  1M1K H;  3P4E A;  3CCL F;  5CB4 A;  3N4Z A;  3VCZ A;  2IAF A;  3PLA C;  1QAH A;  3HKD A;  3WJQ A;  3CG6 A;  1S72 F;  2VXY A;  5LP6 A;  3TD5 A;  3RYF A;  4LNU B;  1VQM F;  4YJ2 B;  4C8G A;  5EO3 A;  3I7T A;  3O85 A;  1Q7Y H;  1W55 A;  2UZH A;  3ZP7 A;  5JQG B;  3LME A;  3N2G B;  4I55 A;  5GAP K;  1SDS A;  5AVM A;  3WGJ A;  3CMA F;  1U3L A;  1RLG A;  2WAL A;  3CCV F;  4X3L A;  1J7H A;  5BMV A;  4RQO A;  4U3J A;  2GZL A;  5G4U C;  3RA5 A;  5C8Y A;  5GIN C;  3E20 B;  2RB9 A;  4G4Z A;  3VTI C;  3U0O A;  3NMU C;  1Q82 H;  3RYH A;  5HY2 A;  4X1Y A;  1KNK A;  5IYZ A;  3P0Z A;  5GIO C;  2R6R 1;  2Z01 A;  3WJP A;  1VQ8 F;  5KX5 B;  5LXT B;  4X3M A;  1UI9 A;  4WBN A;  1IPA A;  5MN4 A;  2HP3 A;  3LFO A;  3WPW A;  1KC8 H;  4BVR A;  4G88 A;  4B5C A;  5IJ0 A;  3G6E F;  5DCV A;  2KGW A;  2YXZ A;  3VI6 A;  3N2K A;  5IJ9 B;  3V3T A;  5FJ4 C;  3CYQ A;  3JCM M;  1NMU B;  3HJW C;  3VMF B;  2CW4 A;  4F6R B;  4O4J A;  4O4H A;  1VK3 A;  5GON A;  2AIZ P;  2JNB A;  2RHO A;  3RYI A;  4X1K A;  3JVH A;  1Q8R A;  4O2A A;  3G71 F;  3JAR B;  3K0T A;  3HAX D;  3OBW A;  3IKE A;  5JVD A;  1Q86 H;  2VAM A;  1FFX B;  1GX1 A;  2FGY A;  1W5A A;  2H6L A;  3V7E A;  1R1M A;  4BVQ A;  2OHW A;  5EYP B;  1W59 A;  1VQ7 F;  2HP0 B;  1PF5 A;  4LCK A;  1YJW F;  4TV8 A;  3S0W A;  4ZHV A;  3JAT A;  4DRX B;  4PWT A;  3SIV A;  2UYN B;  2Z1E A;  3AGK A;  3MQW A;  3T80 A;  1QD9 A;  2LBX A;  4B62 A;  4M8I A;  4X1I B;  2V9Y A;  1U40 A;  4O4I A;  2VAP A;  4TV9 B;  3KJJ A;  1Z5V A;  2ZOV A;  3HKB A;  4ZOL B;  3JAW A;  2KG4 A;  1QVF F;  3JAK A;  1ZWZ A;  3IEQ A;  1K8A H;  4ZI7 A;  5JCO C;  2I6D A;  5KMG A;  5CB4 B;  3E1Y A;  2MQE A;  3HKD B;  3D54 A;  3HWU A;  2LCA A;  5EIB C;  1ODE A;  1SA0 A;  3S02 A;  2QI2 A;  3WPX A;  5LP6 B;  3CPQ A;  3RYF B;  1XHO A;  1JFF A;  1UFY A;  5ITZ A;  4C4W C;  2NMU A;  3I3F A;  2ZOD A;  4IIJ A;  2RHL A;  4EB6 B;  5HP8 A;  5HXU A;  3CC2 F;  1VQP F;  3N4Y A;  3S06 A;  4E6E A;  3MBM A;  3ELC A;  3IEW A;  3JAL B;  4I50 B;  4XCQ A;  4HNA A;  4O2B A;  3LWO C;  4EI8 A;  3C9S A;  2RHH A;  3JAM M; 
#chains in the Genus database with same CATH homology
 2LBW A;  2BO1 A;  3CCQ F;  5GIN C;  3CCJ F;  3E20 B;  3NK7 A;  1W2B F;  3LWQ C;  1W42 A;  2QA4 F;  4BY9 D;  3NMU C;  1X7O A;  1Q82 H;  1RA4 A;  3IR9 A;  2CZW A;  5HY2 A;  4EI9 A;  5GIO C;  2OTL F;  1VQ8 F;  5A2Q M;  4NQ3 A;  4X3M A;  1VQ4 F;  4BVS A;  3LWP C;  3LWV C;  1IPA A;  3LFO A;  1YI2 F;  1KC8 H;  5IT9 M;  3NVK E;  1YHQ F;  4BW0 B;  4BVR A;  4BVT A;  5HY0 A;  1Q81 H;  3J80 M;  2GLZ A;  3CXC F;  3G6E F;  1VQ9 F;  5DCV A;  1VQ5 F;  3VI6 A;  5HWE A;  5FJ4 C;  3V3T A;  2F9Z C;  1CK2 A;  3JCM M;  3PAF A;  1NMU B;  3HJW C;  3CD6 F;  3VMF B;  1GO1 A;  3CC7 F;  3LWR C;  3I55 F;  1YIT F;  1PXW A;  2JNB A;  1X52 A;  1CN7 A;  3J7A R;  3G71 F;  2ALE A;  3HAX D;  1VQ6 F;  1W3E X;  3OBW A;  3RA6 A;  3J81 M;  1X7P A;  1M90 H;  3CCU F;  1GO0 A;  1Q86 H;  1RLG A;  3WXM B;  5EWR A;  2KTV A;  3V7Q A;  5GIP C;  3OW2 F;  2OZB A;  3CPW F;  2FGY A;  1T0K B;  1QVG F;  3V7E A;  1N8R H;  5HXZ A;  4BVQ A;  2OHW A;  1H7M A;  1W40 A;  1VQ7 F;  1E7K A;  4LCK A;  1YJW F;  3GYQ A;  1VQN F;  2QEX F;  1KQS F;  5HY4 A;  5GAN K;  2FC3 A;  3SIV A;  3FFM A;  3CCM F;  3AGK A;  3CME F;  5HY1 A;  2LBX A;  2VGM A;  1YJ9 F;  1K9M H;  2AIF A;  4EI7 A;  5G4V C;  1NJI H;  1JJ2 F;  4TZZ A;  3D00 A;  1M1K H;  1W41 A;  3CCL F;  3N4Z A;  2KG4 A;  3G4S F;  1QVF F;  3PLA C;  3SIU A;  3NK6 A;  1ZWZ A;  1K8A H;  2HVY D;  1VQL F;  2I6D A;  1KD1 H;  3CG6 A;  3E1Y A;  1S72 F;  3NVI B;  3CCE F;  1YJN F;  3CCR F;  2KTU A;  1GZ0 A;  1VQM F;  1XBI A;  5EO3 A;  3O85 A;  2QI2 A;  1Q7Y H;  3CPQ A;  2OTJ F;  4C4W C;  5GAP K;  1SDS A;  3CC4 F;  1K73 H;  3CMA F;  5FLX M;  5HXU A;  3CC2 F;  2WAL A;  3CCV F;  4X3L A;  2VGN A;  3N4Y A;  3ON1 A;  1VQP F;  4XCQ A;  1DT9 A;  3LWO C;  5G4U C;  4EI8 A;  3OBY A;  1VQO F;  3MCA B;  3I56 F;  3CCS F;  3RA5 A;  1YIJ F;  1VQK F;  4NUT A;  3JAM M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...