2HP0B

Crystal structure of iminodisuccinate epimerase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
447
structure length
445
Chain Sequence
b'HMFTTKLAEKVVSAWKAKISQPALKAAQDGVIDTVAAALGGVTEHSVQVALKYVAATGGSGDSKLWGVNQRSNMFDAAFVNGMAAHAIDFDDSFPVMRGHPSSSLVPAIFAVGEHVGANGHNCLKSYVLGIEVVATLGRAVGKGHYLAGWHPTSTLGVFGATTAAALLLGADEEQLRNAWGIAASNSCGIIKNFGTMTKPMHTGSAARNGVLSAWLSMQSFTGCQTVFDDAEGILAMYGAQPGPELFNAMQKFGTPWAIIAPGLYKKSWPSYANHKPLAGLFAIMKEHGLTGQDISHVDVGFLPGVEKPLLYMDPRTEEAKFSIEANIGAALLDGEVSLASFEIEHLDRPAMRAAMKKVTRFDMPSETTFSGTTGYTDIVVHTADGKIERRIEATPGSLEDPMDDAHLERKFKDCTAWMPFGESGLLFDRLRSLTADQGIKTVQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IDS-epimerase
publication title Three-dimensional Structure of Iminodisuccinate Epimerase Defines the Fold of the MmgE/PrpD Protein Family.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 155
structure length 445
sequence length 447
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03972 MmgE_PrpD MmgE/PrpD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4100.10 Mainly Alpha Orthogonal Bundle 2-methylcitrate dehydratase PrpD 2-methylcitrate dehydratase PrpD 2hp0B01
3.30.1330.120 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-methylcitrate dehydratase PrpD 2hp0B02
2HP0A 2HP0B 2HP3A 1SZQA
chains in the Genus database with same CATH superfamily
1E7KA 3S06A 3LDTA 3LMEA 1VQ8F 5EIBC 1U43A 3UT5B 3TD3A 3WGLA 5JH7B 5LP6C 3JAWB 4FFBB 4PWTA 2FGYA 2CHTA 2ZVYA 4BT6A 3TD5A 4TV9B 1W5FA 4BT3A 1M90H 1Q7YH 2IAFA 3ZO8A 3JARB 4IIJB 3WPXA 3IMPA 3N2KA 4HNAB 2KG4A 4BT7A 5EAZA 1VQ4F 4O4IB 1Q86H 3VOAA 3CG6A 3D01A 4G4XA 2OZBA 5LYJA 5LOVA 4I4TB 1W59A 4HNAA 3N4YA 4TUYB 1K9MH 3O85A 3DDNA 3NVIB 1OFUA 3RYFB 5IJ0B 5HXZA 1YITF 4X1KB 3MCAB 3SIUA 2HS0A 3JALA 3JVHA 3HKEB 5FNVB 1UFYA 1GO1A 2Q1XA 3CCJF 1YI2F 2UYKA 4B46A 4O4HA 5FJ4C 4G4VA 1VQ6F 4F6RB 2CSLA 4E6EA 1N8RH 2H8CA 3S0WA 3I55F 2OTJF 2HRYA 1YJWF 3D00A 3DC2A 3JAKA 3VYUC 2HP3A 1Q81H 2CWJA 3FD6A 3CC4F 1VQNF 5J2UB 3TD4A 2ZF8A 1XBIA 1X7OA 1W5AA 5JVDA 1KD1H 5A2QM 5JQGA 1YGYA 5J2TB 1YHQF 5FLXM 2VGMA 3MDOA 4RQOA 1W42A 2Z1EA 2ZAUA 3P10A 4YJ3B 5ITZB 2AIFA 3VO8A 3VYTC 5LXTB 2G9IA 3C9RA 4C8EA 3KHNA 3FD5A 2AIZP 5J2TA 3E22B 4I50A 1DBFA 2UZHA 2VGNA 1VQPF 1COMA 5HY2A 4U3JB 3QTYA 3ESJA 1W581 1GZ0A 4X1IA 2IQQA 2BTOA 1X7PA 2R751 2ZODA 2Z01A 3RYHA 5HY0A 4LNUA 4ERHA 2H6LA 4IHJB 2QI2A 4BVQA 2QTPA 1XV2A 4O4JA 5DCVA 3C9TA 3QUWA 3LWPC 3IKFA 4DRXA 4O4LB 2Z1UA 4C8IA 3J80M 4RHAA 1Q82H 4IHJA 5AVMA 5CA0A 4ZHQB 1YIJF 1NMUB 3MBMA 3RYIB 3PLAC 1YJNF 3F0GA 2QA4F 1VQMF 1T0AA 2VAMA 3K14A 2ZVZA 3F0EA 4ZI7A 3HKDB 4O2BA 3RE3A 2WALA 4C82A 4TV8B 3ERNA 3L7QA 1JD1A 3WXMB 5GINC 3C9UA 3G4SF 1IV1A 3CYQA 3OBYA 3ON1A 1CN7A 5LP6A 3CCMF 1NQ3A 3IKEA 3RA5A 5HP7A 1J7HA 5GANK 3MQWA 2HS3A 5EO3A 1IV4A 1VH8A 1VQKF 1RA4A 4XCQA 3CCUF 3N2KB 3HAXD 3E20B 3Q8HA 3WGMA 3CYPB 4C4WC 1W5BA 1SDSA 5IJ9A 2P6YA 5LYJB 1H7MA 3WJQA 5LOVB 1CK2A 3MCQA 3M84A 1H47A 4WBNA 3KJJA 3GHZA 3C8LA 3WGJA 1PXWA 3JALB 3CD6F 2DYYA 3WPWA 2RB9A 4O4HB 2CZWA 3JCMM 4X3LA 3CCQF 3I3FA 2FC3A 3S0HA 4ZHYB 5JCOC 4BVSA 3BYQA 1Z5VA 1TUBA 4BY9D 1TVKA 2IG8A 3JAKB 3SIVA 1IPAA 3V7QA 1FNKA 2ZOVA 3CCEF 2ALEA 3B6NA 3N2GA 5IT9M 5JVDB 2LCAA 5HY4A 1RLGA 4NUTA 4EB6A 4BW0B 1RQ7A 2RHLA 1T0KB 3CPQA 3K0TA 3NVKE 4NQ3A 5JQGB 2L26A 3GYQA 2RHHA 2YXZA 3S0YA 3G6EF 2NMUA 1XRGA 3VTIC 4I50B 5EIBD 3OBWA 5MN6A 4YJ2A 3ZP4A 3NK7A 1W5EA 3ZOPA 3G71F 5KMGA 4EI9A 4X1IB 2LBXA 4U39A 5GIPC 1QU9A 3T80A 1U40A 3FPIA 4M8IA 5HWEA 3QHDA 3RYHB 3HWUA 2GLZA 4LNUB 3C9SA 4O4JB 4DRXB 3JATA 5EB1B 2UYNB 3VOBA 3NK6A 2UYJA 2CHSA 3KJKA 5LA6A 3VYSC 5CA0B 1VQVA 3LYBA 2VXYA 2OTMA 3VIUA 3HTNA 1JFFB 1R1MA 3M4SA 2UYNA 2Q1YA 5EZYB 1W41A 1FSZA 5GONA 1QAHA 3U0OA 1W57A 4ZI7B 4O2BB 3PAFA 3ZP7A 3FBAA 1JFFA 5EZYA 2F9ZC 3S02A 5EYPA 3LFOA 3CC7F 2KTVA 3CC2F 3R0PA 3CCSF 3J7AR 4B5CA 1VQ7F 5GAPK 4EI8A 1ODEA 2CVLA 4X1YA 2I6DA 2YYEA 3JAMM 4ZOLB 5LP6B 5HP8A 2HRUA 1W2BF 5KX5A 1U3LA 1S72F 4I55A 3K2XA 4ZOLA 2AMTA 5IYZA 3KE1A 1JJ2F 5CB4A 5EB0A 5IJ9B 1W3EX 1VQOF 1GO0A 4C81A 3CMAF 2OHWA 1SZQA 1YQNA 4X20A 3LWVC 4WBNB 3LWQC 1NJIH 2BTUA 4O2AA 1RLUA 1DT9A 3D54A 1H48A 2Z1FA 3N4ZA 3HKBA 2LBTA 1VQLF 3P0ZA 1SA0A 2DT4A 2K1SA 3M1XA 1X25A 1KC8H 2I6RA 3JASA 4C8GA 5CA1A 1KNJA 1Q8RA 3HKCA 5JCOA 1VK3A 1TUBB 1IV2A 3F0FA 1TVKB 4R40B 3E1YA 3VMFB 3UT5A 2VAWA 5JH7A 3AGKA 2OTLF 3JAWA 3N2GB 4FFBA 1CLIA 1ZWZA 2HX0A 4ZK7A 2Z1TA 3FFMA 4G4ZA 4BT5A 4EB6B 3VCZA 4TV9A 3CCVF 2N48A 2RHJA 5HXUA 3JARA 4IIJA 2W8BC 5GIOC 3CCLF 1VHAA 2MQEA 4O4IA 3GTZA 4G4WA 3CPWF 1YJ9F 2UYPA 2V9YA 4I4TA 3RA6A 1QD9A 4KWEA 4EI7A 1W55A 3WJPA 4TUYA 3RYFA 4YJ2B 5IJ0A 3I56F 1K73H 2KGWA 2VAPA 4X1KA 5KMGB 4G4YA 3IEQA 2R6R1 4B45A 4BT2A 3HKEA 5FNVA 1FNJA 2GVIA 3F6MA 2H8EA 3ELCA 5EWRA 1RQ2A 2GZLA 1ONIA 1VQ5F 3K12A 4F6RA 4LCKA 1OAPA 5MN5A 3J81M 3CB2A 3JATB 2CW4A 5LA6B 3S03A 1UI9A 3LWRC 3IR9A 3I7TA 1K8AH 4X3MA 5J2UA 2HVYD 5G4UC 3OONA 4BT4A 3V3TA 4DXDA 2BTQB 3LWOC 1W40A 5GONB 4TZZA 3VI6A 2EWCA 1GX1A 3KIZA 3HJWC 1FFXB 4YJ3A 2HQSC 5ITZA 4ZHVA 5EYPB 5LXTA 4BVRA 1M1KH 1U3PA 2KTUA 3F0DA 4X1YB 3E22A 1FFXA 4BVTA 3RYCB 1QVFF 5KX5B 4NWOB 2QEXF 5MN4A 2B33A 1IV3A 2PHNA 4U3JA 1PF5A 4I55B 1QVGF 3V7EA 1KNKA 3WGKA 3P4EA 2BO1A 5BMVB 3RYCA 5IYZB 3WJRA 5CB4B 2PMPA 4B62A 3IEWA 3NMUC 2RHOA 3CCRF 5G4VC 4X20B 5BMVA 1KQSF 1VQ9F 3EORA 2HP0B 4O4LA 4O2AB 1XHOA 3CXCF 3CMEF 3HKBB 2LBWA 4ZHQA 3OW2F 3RYIA 1SA0B 5C8YB 1JY8A 1Z5WA 5HY1A 2HS4A 5B8FA 2HP0A 2JNBA 4G88A 3JASB 5CA1B 3WGNA 1X52A 3HKCB 3HKDA 3V4DA 5C8YA 4ZHWA 1JN1A 4TV8A
chains in the Genus database with same CATH topology
2HP0A 2HP0B 2HP3A 1SZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP0 A;  2HP0 B;  2HP3 A;  1SZQ A; 
#chains in the Genus database with same CATH topology
 1E7K A;  3S06 A;  3LDT A;  3LME A;  1VQ8 F;  5EIB C;  1U43 A;  3UT5 B;  3TD3 A;  3WGL A;  5JH7 B;  5LP6 C;  3JAW B;  4FFB B;  4PWT A;  2FGY A;  2CHT A;  2ZVY A;  4BT6 A;  3TD5 A;  4TV9 B;  1W5F A;  4BT3 A;  1M90 H;  1Q7Y H;  2IAF A;  3ZO8 A;  3JAR B;  4IIJ B;  3WPX A;  3IMP A;  3N2K A;  4HNA B;  2KG4 A;  4BT7 A;  5EAZ A;  1VQ4 F;  4O4I B;  1Q86 H;  3VOA A;  3CG6 A;  3D01 A;  4G4X A;  2OZB A;  5LYJ A;  5LOV A;  4I4T B;  1W59 A;  4HNA A;  3N4Y A;  4TUY B;  1K9M H;  3O85 A;  3DDN A;  3NVI B;  1OFU A;  3RYF B;  5IJ0 B;  5HXZ A;  1YIT F;  4X1K B;  3MCA B;  3SIU A;  2HS0 A;  3JAL A;  3JVH A;  3HKE B;  5FNV B;  1UFY A;  1GO1 A;  2Q1X A;  3CCJ F;  1YI2 F;  2UYK A;  4B46 A;  4O4H A;  5FJ4 C;  4G4V A;  1VQ6 F;  4F6R B;  2CSL A;  4E6E A;  1N8R H;  2H8C A;  3S0W A;  3I55 F;  2OTJ F;  2HRY A;  1YJW F;  3D00 A;  3DC2 A;  3JAK A;  3VYU C;  2HP3 A;  1Q81 H;  2CWJ A;  3FD6 A;  3CC4 F;  1VQN F;  5J2U B;  3TD4 A;  2ZF8 A;  1XBI A;  1X7O A;  1W5A A;  5JVD A;  1KD1 H;  5A2Q M;  5JQG A;  1YGY A;  5J2T B;  1YHQ F;  5FLX M;  2VGM A;  3MDO A;  4RQO A;  1W42 A;  2Z1E A;  2ZAU A;  3P10 A;  4YJ3 B;  5ITZ B;  2AIF A;  3VO8 A;  3VYT C;  5LXT B;  2G9I A;  3C9R A;  4C8E A;  3KHN A;  3FD5 A;  2AIZ P;  5J2T A;  3E22 B;  4I50 A;  1DBF A;  2UZH A;  2VGN A;  1VQP F;  1COM A;  5HY2 A;  4U3J B;  3QTY A;  3ESJ A;  1W58 1;  1GZ0 A;  4X1I A;  2IQQ A;  2BTO A;  1X7P A;  2R75 1;  2ZOD A;  2Z01 A;  3RYH A;  5HY0 A;  4LNU A;  4ERH A;  2H6L A;  4IHJ B;  2QI2 A;  4BVQ A;  2QTP A;  1XV2 A;  4O4J A;  5DCV A;  3C9T A;  3QUW A;  3LWP C;  3IKF A;  4DRX A;  4O4L B;  2Z1U A;  4C8I A;  3J80 M;  4RHA A;  1Q82 H;  4IHJ A;  5AVM A;  5CA0 A;  4ZHQ B;  1YIJ F;  1NMU B;  3MBM A;  3RYI B;  3PLA C;  1YJN F;  3F0G A;  2QA4 F;  1VQM F;  1T0A A;  2VAM A;  3K14 A;  2ZVZ A;  3F0E A;  4ZI7 A;  3HKD B;  4O2B A;  3RE3 A;  2WAL A;  4C82 A;  4TV8 B;  3ERN A;  3L7Q A;  1JD1 A;  3WXM B;  5GIN C;  3C9U A;  3G4S F;  1IV1 A;  3CYQ A;  3OBY A;  3ON1 A;  1CN7 A;  5LP6 A;  3CCM F;  1NQ3 A;  3IKE A;  3RA5 A;  5HP7 A;  1J7H A;  5GAN K;  3MQW A;  2HS3 A;  5EO3 A;  1IV4 A;  1VH8 A;  1VQK F;  1RA4 A;  4XCQ A;  3CCU F;  3N2K B;  3HAX D;  3E20 B;  3Q8H A;  3WGM A;  3CYP B;  4C4W C;  1W5B A;  1SDS A;  5IJ9 A;  2P6Y A;  5LYJ B;  1H7M A;  3WJQ A;  5LOV B;  1CK2 A;  3MCQ A;  3M84 A;  1H47 A;  4WBN A;  3KJJ A;  3GHZ A;  3C8L A;  3WGJ A;  1PXW A;  3JAL B;  3CD6 F;  2DYY A;  3WPW A;  2RB9 A;  4O4H B;  2CZW A;  3JCM M;  4X3L A;  3CCQ F;  3I3F A;  2FC3 A;  3S0H A;  4ZHY B;  5JCO C;  4BVS A;  3BYQ A;  1Z5V A;  1TUB A;  4BY9 D;  1TVK A;  2IG8 A;  3JAK B;  3SIV A;  1IPA A;  3V7Q A;  1FNK A;  2ZOV A;  3CCE F;  2ALE A;  3B6N A;  3N2G A;  5IT9 M;  5JVD B;  2LCA A;  5HY4 A;  1RLG A;  4NUT A;  4EB6 A;  4BW0 B;  1RQ7 A;  2RHL A;  1T0K B;  3CPQ A;  3K0T A;  3NVK E;  4NQ3 A;  5JQG B;  2L26 A;  3GYQ A;  2RHH A;  2YXZ A;  3S0Y A;  3G6E F;  2NMU A;  1XRG A;  3VTI C;  4I50 B;  5EIB D;  3OBW A;  5MN6 A;  4YJ2 A;  3ZP4 A;  3NK7 A;  1W5E A;  3ZOP A;  3G71 F;  5KMG A;  4EI9 A;  4X1I B;  2LBX A;  4U39 A;  5GIP C;  1QU9 A;  3T80 A;  1U40 A;  3FPI A;  4M8I A;  5HWE A;  3QHD A;  3RYH B;  3HWU A;  2GLZ A;  4LNU B;  3C9S A;  4O4J B;  4DRX B;  3JAT A;  5EB1 B;  2UYN B;  3VOB A;  3NK6 A;  2UYJ A;  2CHS A;  3KJK A;  5LA6 A;  3VYS C;  5CA0 B;  1VQV A;  3LYB A;  2VXY A;  2OTM A;  3VIU A;  3HTN A;  1JFF B;  1R1M A;  3M4S A;  2UYN A;  2Q1Y A;  5EZY B;  1W41 A;  1FSZ A;  5GON A;  1QAH A;  3U0O A;  1W57 A;  4ZI7 B;  4O2B B;  3PAF A;  3ZP7 A;  3FBA A;  1JFF A;  5EZY A;  2F9Z C;  3S02 A;  5EYP A;  3LFO A;  3CC7 F;  2KTV A;  3CC2 F;  3R0P A;  3CCS F;  3J7A R;  4B5C A;  1VQ7 F;  5GAP K;  4EI8 A;  1ODE A;  2CVL A;  4X1Y A;  2I6D A;  2YYE A;  3JAM M;  4ZOL B;  5LP6 B;  5HP8 A;  2HRU A;  1W2B F;  5KX5 A;  1U3L A;  1S72 F;  4I55 A;  3K2X A;  4ZOL A;  2AMT A;  5IYZ A;  3KE1 A;  1JJ2 F;  5CB4 A;  5EB0 A;  5IJ9 B;  1W3E X;  1VQO F;  1GO0 A;  4C81 A;  3CMA F;  2OHW A;  1SZQ A;  1YQN A;  4X20 A;  3LWV C;  4WBN B;  3LWQ C;  1NJI H;  2BTU A;  4O2A A;  1RLU A;  1DT9 A;  3D54 A;  1H48 A;  2Z1F A;  3N4Z A;  3HKB A;  2LBT A;  1VQL F;  3P0Z A;  1SA0 A;  2DT4 A;  2K1S A;  3M1X A;  1X25 A;  1KC8 H;  2I6R A;  3JAS A;  4C8G A;  5CA1 A;  1KNJ A;  1Q8R A;  3HKC A;  5JCO A;  1VK3 A;  1TUB B;  1IV2 A;  3F0F A;  1TVK B;  4R40 B;  3E1Y A;  3VMF B;  3UT5 A;  2VAW A;  5JH7 A;  3AGK A;  2OTL F;  3JAW A;  3N2G B;  4FFB A;  1CLI A;  1ZWZ A;  2HX0 A;  4ZK7 A;  2Z1T A;  3FFM A;  4G4Z A;  4BT5 A;  4EB6 B;  3VCZ A;  4TV9 A;  3CCV F;  2N48 A;  2RHJ A;  5HXU A;  3JAR A;  4IIJ A;  2W8B C;  5GIO C;  3CCL F;  1VHA A;  2MQE A;  4O4I A;  3GTZ A;  4G4W A;  3CPW F;  1YJ9 F;  2UYP A;  2V9Y A;  4I4T A;  3RA6 A;  1QD9 A;  4KWE A;  4EI7 A;  1W55 A;  3WJP A;  4TUY A;  3RYF A;  4YJ2 B;  5IJ0 A;  3I56 F;  1K73 H;  2KGW A;  2VAP A;  4X1K A;  5KMG B;  4G4Y A;  3IEQ A;  2R6R 1;  4B45 A;  4BT2 A;  3HKE A;  5FNV A;  1FNJ A;  2GVI A;  3F6M A;  2H8E A;  3ELC A;  5EWR A;  1RQ2 A;  2GZL A;  1ONI A;  1VQ5 F;  3K12 A;  4F6R A;  4LCK A;  1OAP A;  5MN5 A;  3J81 M;  3CB2 A;  3JAT B;  2CW4 A;  5LA6 B;  3S03 A;  1UI9 A;  3LWR C;  3IR9 A;  3I7T A;  1K8A H;  4X3M A;  5J2U A;  2HVY D;  5G4U C;  3OON A;  4BT4 A;  3V3T A;  4DXD A;  2BTQ B;  3LWO C;  1W40 A;  5GON B;  4TZZ A;  3VI6 A;  2EWC A;  1GX1 A;  3KIZ A;  3HJW C;  1FFX B;  4YJ3 A;  2HQS C;  5ITZ A;  4ZHV A;  5EYP B;  5LXT A;  4BVR A;  1M1K H;  1U3P A;  2KTU A;  3F0D A;  4X1Y B;  3E22 A;  1FFX A;  4BVT A;  3RYC B;  1QVF F;  5KX5 B;  4NWO B;  2QEX F;  5MN4 A;  2B33 A;  1IV3 A;  2PHN A;  4U3J A;  1PF5 A;  4I55 B;  1QVG F;  3V7E A;  1KNK A;  3WGK A;  3P4E A;  2BO1 A;  5BMV B;  3RYC A;  5IYZ B;  3WJR A;  5CB4 B;  2PMP A;  4B62 A;  3IEW A;  3NMU C;  2RHO A;  3CCR F;  5G4V C;  4X20 B;  5BMV A;  1KQS F;  1VQ9 F;  3EOR A;  2HP0 B;  4O4L A;  4O2A B;  1XHO A;  3CXC F;  3CME F;  3HKB B;  2LBW A;  4ZHQ A;  3OW2 F;  3RYI A;  1SA0 B;  5C8Y B;  1JY8 A;  1Z5W A;  5HY1 A;  2HS4 A;  5B8F A;  2HP0 A;  2JNB A;  4G88 A;  3JAS B;  5CA1 B;  3WGN A;  1X52 A;  3HKC B;  3HKD A;  3V4D A;  5C8Y A;  4ZHW A;  1JN1 A;  4TV8 A; 
#chains in the Genus database with same CATH homology
 2HP0 A;  2HP0 B;  2HP3 A;  1SZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...