3WPWA

Structure of pombc5, a periplasmic fragment of pomb from vibrio
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
SQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGIVRVSGHTDNRPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords PomB
publication title Conformational change in the periplasmic region of the flagellar stator coupled with the assembly around the rotor
pubmed doi rcsb
source organism Vibrio alginolyticus
total genus 48
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3wpwA00
2AIZP 3IMPA 2MQEA 3S0HA 3S0WA 3KHNA 4B62A 4ZHWA 4G4VA 4R40B 3WPXA 2L26A 3LDTA 5EB0A 3S0YA 4ZHVA 3TD5A 1R1MA 2KGWA 2ZVYA 4B5CA 2W8BC 5EB1B 5EAZA 2LBTA 3CYPB 4G4ZA 2K1SA 3OONA 4PWTA 3S02A 3CYQA 4G4XA 2HQSC 2ZVZA 3WPWA 3S03A 4G4YA 3TD4A 2ZF8A 4ZHYB 3S06A 3TD3A 4G4WA 4RHAA 2LCAA 4G88A 4ERHA 2ZOVA 2N48A 1OAPA
chains in the Genus database with same CATH superfamily
2FGYA 3S0HA 2WALA 1W55A 5LXTB 4TV9A 3F0GA 5AVMA 3S0YA 3L7QA 1CK2A 2UYJA 1JY8A 2BTQB 2HRUA 3RA6A 5IJ0A 1FFXA 4G4XA 4O2AB 4XCQA 2ZVZA 5J2UA 3S03A 1E7KA 5GONA 3NMUC 4F6RB 3LFOA 3F0DA 2R6R1 3TD3A 1GX1A 3JAMM 2LBXA 4YJ2B 5CA1B 5IT9M 3HJWC 1UFYA 2VXYA 3LWPC 3S0WA 2CHTA 1KD1H 1M1KH 1SA0A 3D00A 1VQOF 1IV2A 2OTMA 1XBIA 4BVSA 4EI8A 1XHOA 1VH8A 3DC2A 5CB4B 4NQ3A 2P6YA 3VTIC 5B8FA 5JQGA 1TVKB 3WPWA 1GO0A 3RYCB 5G4VC 1KQSF 1U40A 1VK3A 2IG8A 2ZODA 2G9IA 3K2XA 1W2BF 3KIZA 1Q81H 3VMFB 3F0EA 5JH7B 5C8YB 3IMPA 3G6EF 3ON1A 1XRGA 3KHNA 2IAFA 3F0FA 2DT4A 3C9UA 3GHZA 5IJ9B 3EORA 1NJIH 4R40B 5GAPK 4U3JA 1COMA 5J2TB 1X25A 1PXWA 3CD6F 3QTYA 1JFFA 3HKEA 3JAWA 2LBWA 3GYQA 3R0PA 3VYSC 2IQQA 3ELCA 3K12A 2BTOA 3IEQA 3AGKA 2HP3A 3E22A 2VAPA 4TV8B 1H7MA 1IV1A 1TUBA 2UYKA 5LA6B 2UYNB 3B6NA 5IYZA 3N4ZA 3WGNA 3HKBB 3LWOC 4O2AA 1YQNA 3J7AR 2QA4F 3UT5B 4ZOLB 5DCVA 3CMEF 1VQ9F 4DRXB 1ODEA 3GTZA 4TUYB 4X1KB 2QI2A 1VQNF 3SIVA 2DYYA 4EI7A 4X3MA 2PHNA 1KC8H 3C9TA 4ZI7B 3J80M 3CCVF 1U43A 4O4JA 3CCRF 3MCQA 4IHJB 3N2GA 3MDOA 4HNAA 3E20B 3WPXA 4BVRA 4NUTA 1IV4A 3CG6A 4ZHVA 3N2KB 1IPAA 3FPIA 2ZVYA 3CCEF 3JALB 5EZYA 4B45A 1W5BA 1RQ2A 3IKFA 5EYPB 3CYQA 5KX5B 3K0TA 2AIFA 3CPQA 1H48A 3U0OA 3ESJA 5LOVA 2CZWA 4G88A 5ITZB 2FC3A 3C9SA 5BMVB 2N48A 2VAMA 4BT4A 1K8AH 1VQ6F 1Z5WA 3P4EA 3JATA 4EB6B 5KMGB 1SDSA 4I50A 3HKDA 1YIJF 2RHJA 1FNJA 1M90H 3CCUF 1QU9A 2OTJF 3JVHA 4ZHQB 5LP6B 5HP7A 4G4ZA 3JAKA 1W5FA 3WGLA 2UYPA 3C8LA 3VIUA 3VOAA 3D01A 5FJ4C 3C9RA 3OBYA 4BW0B 5HY1A 2ZF8A 5LA6A 4BT6A 1W59A 4O2BA 3MBMA 2NMUA 3ZOPA 4ERHA 4I55B 2YYEA 5HXUA 3NK6A 2AMTA 1YJWF 5FLXM 1X7PA 2H6LA 2OHWA 4FFBB 3UT5A 2HVYD 1CN7A 5MN4A 5CA0A 3RYIA 3PLAC 3CCLF 3VI6A 4KWEA 5GIPC 5FNVB 1ZWZA 2HRYA 4BT2A 1ONIA 2KG4A 1N8RH 4LNUA 2CVLA 2HS4A 5EO3A 4EI9A 3RYHA 4X20B 4C8EA 3QHDA 4X1IA 2VGNA 3V3TA 3G71F 3T80A 3KJKA 1T0KB 5EYPA 1JJ2F 5KX5A 3RA5A 3M84A 2HS3A 5JVDB 3WGJA 1VQPF 3RYFB 1JN1A 3MCAB 3HAXD 2GZLA 5LYJB 4RQOA 3WXMB 4M8IA 3CCMF 2RHLA 4O4IB 1YGYA 5BMVA 1NMUB 4BVQA 3WJRA 1RLGA 3V7QA 3DDNA 5GINC 5LXTA 1W5EA 4O4HB 3P0ZA 4X1YB 2MQEA 4BY9D 3BYQA 5EIBD 1Q86H 4ZHWA 4YJ3B 3JASB 2OTLF 2KGWA 4B5CA 1Z5VA 4TV9B 2PMPA 4BVTA 4F6RA 2RHOA 4YJ2A 3FD5A 5CA1A 4ZHYB 5IJ0B 4NWOB 1FNKA 2Z01A 3LWVC 1VHAA 4I4TB 2HS0A 2H8CA 5G4UC 3OW2F 5CB4A 3MQWA 2L26A 4E6EA 2QEXF 1TVKA 1SA0B 3KE1A 1Q8RA 4O4LB 3D54A 1QD9A 3RYCA 3FBAA 2Q1YA 3WGMA 1GZ0A 4U39A 3K14A 3V7EA 3KJJA 4BT7A 5JQGB 3CCJF 5JH7A 5C8YA 3CC7F 2GVIA 1DT9A 5LP6C 5IJ9A 3CC2F 4C8GA 2RB9A 3LWQC 2ZAUA 3I7TA 4B46A 2KTUA 5HWEA 5JVDA 4BT5A 4G4VA 2HP0B 3WGKA 1W41A 5J2TA 2Z1FA 2W8BC 5EB1B 1NQ3A 3HTNA 3CXCF 1J7HA 3M1XA 2Z1UA 4U3JB 2K1SA 3VYTC 4C81A 4ZK7A 4TV8A 3TD4A 3I55F 3CCSF 3G4SF 2UYNA 1JFFB 1W42A 3HKEB 2CWJA 3JAWB 4G4WA 4RHAA 3WJQA 1RA4A 1YJ9F 3QUWA 3E22B 5EWRA 4C82A 3HKBA 1TUBB 4WBNB 1X7OA 5HP8A 1W581 1YI2F 4BT3A 3VOBA 1KNJA 1XV2A 4ZOLA 1SZQA 2CW4A 3TD5A 5IYZB 2VGMA 1T0AA 2Z1TA 1Q7YH 4DRXA 1VQ7F 5HY2A 4TUYA 3Q8HA 4X1KA 3HKCB 4I4TA 1K73H 2HQSC 5MN6A 3CB2A 4ZI7A 5JCOC 1RQ7A 3SIUA 3CC4F 1W57A 2LCAA 4IHJA 2UZHA 1QAHA 2RHHA 3O85A 2BO1A 3JARB 3N2KA 1W3EX 3VYUC 1K9MH 3JALA 4O4LA 3LDTA 1OFUA 2BTUA 4O4JB 3HWUA 3CMAF 3N2GB 2LBTA 4HNAB 2EWCA 4C8IA 3OONA 1QVFF 3LMEA 5EZYB 1UI9A 5A2QM 4LCKA 5ITZA 2ALEA 4IIJB 5GANK 2KTVA 2YXZA 2V9YA 1S72F 2HP0A 3LWRC 5KMGA 4EB6A 3M4SA 5MN5A 1VQ5F 1YHQF 5LOVB 1PF5A 2AIZP 3N4YA 1VQVA 4B62A 4ZHQA 5LP6A 1W5AA 3WJPA 1RLUA 2B33A 2CSLA 5HY4A 1YITF 1YJNF 1KNKA 1U3PA 3JATB 5EIBC 3VCZA 3IKEA 1H47A 4I50B 1W40A 3HKDB 3S02A 5HXZA 3NK7A 1CLIA 3CPWF 3ZO8A 3ZP4A 5GIOC 4G4YA 3JAKB 4I55A 3ERNA 3IR9A 4WBNA 1FFXB 2VAWA 1U3LA 4X3LA 5J2UB 5HY0A 5GONB 2ZOVA 4O2BB 4FFBA 1OAPA 1GO1A 1FSZA 4C4WC 1VQ8F 1DBFA 3PAFA 3IEWA 3FFMA 5EB0A 3OBWA 1R1MA 5FNVA 3HKCA 4TZZA 3CYPB 3F6MA 3FD6A 5CA0B 2H8EA 3RYIB 3J81M 3V4DA 3JCMM 1QVGF 1JD1A 3VO8A 4X20A 3JARA 2JNBA 2Q1XA 3RE3A 3S06A 1VQLF 4DXDA 2GLZA 5JCOA 3ZP7A 4LNUB 3LYBA 3I56F 2OZBA 3RYHB 3I3FA 1X52A 2R751 4X1IB 3RYFA 2I6RA 3CCQF 1Q82H 5EAZA 3E1YA 5LYJA 1VQ4F 3NVIB 2HX0A 4O4IA 4IIJA 4PWTA 1IV3A 2QTPA 4O4HA 2Z1EA 1VQMF 1VQKF 2I6DA 3P10A 2F9ZC 4X1YA 3NVKE 4YJ3A 3JASA 2CHSA
chains in the Genus database with same CATH topology
2AIZP 3IMPA 2MQEA 3S0HA 3S0WA 3KHNA 4B62A 4ZHWA 4G4VA 4R40B 3WPXA 2L26A 3LDTA 5EB0A 3S0YA 4ZHVA 3TD5A 1R1MA 2KGWA 2ZVYA 4B5CA 2W8BC 5EB1B 5EAZA 2LBTA 3CYPB 4G4ZA 2K1SA 3OONA 4PWTA 3S02A 3CYQA 4G4XA 2HQSC 2ZVZA 3WPWA 3S03A 4G4YA 3TD4A 2ZF8A 4ZHYB 3S06A 3TD3A 4G4WA 4RHAA 2LCAA 4G88A 4ERHA 2ZOVA 2N48A 1OAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIZ P;  3IMP A;  2MQE A;  3S0H A;  3S0W A;  3KHN A;  4B62 A;  4ZHW A;  4G4V A;  4R40 B;  3WPX A;  2L26 A;  3LDT A;  5EB0 A;  3S0Y A;  4ZHV A;  3TD5 A;  1R1M A;  2KGW A;  2ZVY A;  4B5C A;  2W8B C;  5EB1 B;  5EAZ A;  2LBT A;  3CYP B;  4G4Z A;  2K1S A;  3OON A;  4PWT A;  3S02 A;  3CYQ A;  4G4X A;  2HQS C;  2ZVZ A;  3WPW A;  3S03 A;  4G4Y A;  3TD4 A;  2ZF8 A;  4ZHY B;  3S06 A;  3TD3 A;  4G4W A;  4RHA A;  2LCA A;  4G88 A;  4ERH A;  2ZOV A;  2N48 A;  1OAP A; 
#chains in the Genus database with same CATH topology
 2FGY A;  3S0H A;  2WAL A;  1W55 A;  5LXT B;  4TV9 A;  3F0G A;  5AVM A;  3S0Y A;  3L7Q A;  1CK2 A;  2UYJ A;  1JY8 A;  2BTQ B;  2HRU A;  3RA6 A;  5IJ0 A;  1FFX A;  4G4X A;  4O2A B;  4XCQ A;  2ZVZ A;  5J2U A;  3S03 A;  1E7K A;  5GON A;  3NMU C;  4F6R B;  3LFO A;  3F0D A;  2R6R 1;  3TD3 A;  1GX1 A;  3JAM M;  2LBX A;  4YJ2 B;  5CA1 B;  5IT9 M;  3HJW C;  1UFY A;  2VXY A;  3LWP C;  3S0W A;  2CHT A;  1KD1 H;  1M1K H;  1SA0 A;  3D00 A;  1VQO F;  1IV2 A;  2OTM A;  1XBI A;  4BVS A;  4EI8 A;  1XHO A;  1VH8 A;  3DC2 A;  5CB4 B;  4NQ3 A;  2P6Y A;  3VTI C;  5B8F A;  5JQG A;  1TVK B;  3WPW A;  1GO0 A;  3RYC B;  5G4V C;  1KQS F;  1U40 A;  1VK3 A;  2IG8 A;  2ZOD A;  2G9I A;  3K2X A;  1W2B F;  3KIZ A;  1Q81 H;  3VMF B;  3F0E A;  5JH7 B;  5C8Y B;  3IMP A;  3G6E F;  3ON1 A;  1XRG A;  3KHN A;  2IAF A;  3F0F A;  2DT4 A;  3C9U A;  3GHZ A;  5IJ9 B;  3EOR A;  1NJI H;  4R40 B;  5GAP K;  4U3J A;  1COM A;  5J2T B;  1X25 A;  1PXW A;  3CD6 F;  3QTY A;  1JFF A;  3HKE A;  3JAW A;  2LBW A;  3GYQ A;  3R0P A;  3VYS C;  2IQQ A;  3ELC A;  3K12 A;  2BTO A;  3IEQ A;  3AGK A;  2HP3 A;  3E22 A;  2VAP A;  4TV8 B;  1H7M A;  1IV1 A;  1TUB A;  2UYK A;  5LA6 B;  2UYN B;  3B6N A;  5IYZ A;  3N4Z A;  3WGN A;  3HKB B;  3LWO C;  4O2A A;  1YQN A;  3J7A R;  2QA4 F;  3UT5 B;  4ZOL B;  5DCV A;  3CME F;  1VQ9 F;  4DRX B;  1ODE A;  3GTZ A;  4TUY B;  4X1K B;  2QI2 A;  1VQN F;  3SIV A;  2DYY A;  4EI7 A;  4X3M A;  2PHN A;  1KC8 H;  3C9T A;  4ZI7 B;  3J80 M;  3CCV F;  1U43 A;  4O4J A;  3CCR F;  3MCQ A;  4IHJ B;  3N2G A;  3MDO A;  4HNA A;  3E20 B;  3WPX A;  4BVR A;  4NUT A;  1IV4 A;  3CG6 A;  4ZHV A;  3N2K B;  1IPA A;  3FPI A;  2ZVY A;  3CCE F;  3JAL B;  5EZY A;  4B45 A;  1W5B A;  1RQ2 A;  3IKF A;  5EYP B;  3CYQ A;  5KX5 B;  3K0T A;  2AIF A;  3CPQ A;  1H48 A;  3U0O A;  3ESJ A;  5LOV A;  2CZW A;  4G88 A;  5ITZ B;  2FC3 A;  3C9S A;  5BMV B;  2N48 A;  2VAM A;  4BT4 A;  1K8A H;  1VQ6 F;  1Z5W A;  3P4E A;  3JAT A;  4EB6 B;  5KMG B;  1SDS A;  4I50 A;  3HKD A;  1YIJ F;  2RHJ A;  1FNJ A;  1M90 H;  3CCU F;  1QU9 A;  2OTJ F;  3JVH A;  4ZHQ B;  5LP6 B;  5HP7 A;  4G4Z A;  3JAK A;  1W5F A;  3WGL A;  2UYP A;  3C8L A;  3VIU A;  3VOA A;  3D01 A;  5FJ4 C;  3C9R A;  3OBY A;  4BW0 B;  5HY1 A;  2ZF8 A;  5LA6 A;  4BT6 A;  1W59 A;  4O2B A;  3MBM A;  2NMU A;  3ZOP A;  4ERH A;  4I55 B;  2YYE A;  5HXU A;  3NK6 A;  2AMT A;  1YJW F;  5FLX M;  1X7P A;  2H6L A;  2OHW A;  4FFB B;  3UT5 A;  2HVY D;  1CN7 A;  5MN4 A;  5CA0 A;  3RYI A;  3PLA C;  3CCL F;  3VI6 A;  4KWE A;  5GIP C;  5FNV B;  1ZWZ A;  2HRY A;  4BT2 A;  1ONI A;  2KG4 A;  1N8R H;  4LNU A;  2CVL A;  2HS4 A;  5EO3 A;  4EI9 A;  3RYH A;  4X20 B;  4C8E A;  3QHD A;  4X1I A;  2VGN A;  3V3T A;  3G71 F;  3T80 A;  3KJK A;  1T0K B;  5EYP A;  1JJ2 F;  5KX5 A;  3RA5 A;  3M84 A;  2HS3 A;  5JVD B;  3WGJ A;  1VQP F;  3RYF B;  1JN1 A;  3MCA B;  3HAX D;  2GZL A;  5LYJ B;  4RQO A;  3WXM B;  4M8I A;  3CCM F;  2RHL A;  4O4I B;  1YGY A;  5BMV A;  1NMU B;  4BVQ A;  3WJR A;  1RLG A;  3V7Q A;  3DDN A;  5GIN C;  5LXT A;  1W5E A;  4O4H B;  3P0Z A;  4X1Y B;  2MQE A;  4BY9 D;  3BYQ A;  5EIB D;  1Q86 H;  4ZHW A;  4YJ3 B;  3JAS B;  2OTL F;  2KGW A;  4B5C A;  1Z5V A;  4TV9 B;  2PMP A;  4BVT A;  4F6R A;  2RHO A;  4YJ2 A;  3FD5 A;  5CA1 A;  4ZHY B;  5IJ0 B;  4NWO B;  1FNK A;  2Z01 A;  3LWV C;  1VHA A;  4I4T B;  2HS0 A;  2H8C A;  5G4U C;  3OW2 F;  5CB4 A;  3MQW A;  2L26 A;  4E6E A;  2QEX F;  1TVK A;  1SA0 B;  3KE1 A;  1Q8R A;  4O4L B;  3D54 A;  1QD9 A;  3RYC A;  3FBA A;  2Q1Y A;  3WGM A;  1GZ0 A;  4U39 A;  3K14 A;  3V7E A;  3KJJ A;  4BT7 A;  5JQG B;  3CCJ F;  5JH7 A;  5C8Y A;  3CC7 F;  2GVI A;  1DT9 A;  5LP6 C;  5IJ9 A;  3CC2 F;  4C8G A;  2RB9 A;  3LWQ C;  2ZAU A;  3I7T A;  4B46 A;  2KTU A;  5HWE A;  5JVD A;  4BT5 A;  4G4V A;  2HP0 B;  3WGK A;  1W41 A;  5J2T A;  2Z1F A;  2W8B C;  5EB1 B;  1NQ3 A;  3HTN A;  3CXC F;  1J7H A;  3M1X A;  2Z1U A;  4U3J B;  2K1S A;  3VYT C;  4C81 A;  4ZK7 A;  4TV8 A;  3TD4 A;  3I55 F;  3CCS F;  3G4S F;  2UYN A;  1JFF B;  1W42 A;  3HKE B;  2CWJ A;  3JAW B;  4G4W A;  4RHA A;  3WJQ A;  1RA4 A;  1YJ9 F;  3QUW A;  3E22 B;  5EWR A;  4C82 A;  3HKB A;  1TUB B;  4WBN B;  1X7O A;  5HP8 A;  1W58 1;  1YI2 F;  4BT3 A;  3VOB A;  1KNJ A;  1XV2 A;  4ZOL A;  1SZQ A;  2CW4 A;  3TD5 A;  5IYZ B;  2VGM A;  1T0A A;  2Z1T A;  1Q7Y H;  4DRX A;  1VQ7 F;  5HY2 A;  4TUY A;  3Q8H A;  4X1K A;  3HKC B;  4I4T A;  1K73 H;  2HQS C;  5MN6 A;  3CB2 A;  4ZI7 A;  5JCO C;  1RQ7 A;  3SIU A;  3CC4 F;  1W57 A;  2LCA A;  4IHJ A;  2UZH A;  1QAH A;  2RHH A;  3O85 A;  2BO1 A;  3JAR B;  3N2K A;  1W3E X;  3VYU C;  1K9M H;  3JAL A;  4O4L A;  3LDT A;  1OFU A;  2BTU A;  4O4J B;  3HWU A;  3CMA F;  3N2G B;  2LBT A;  4HNA B;  2EWC A;  4C8I A;  3OON A;  1QVF F;  3LME A;  5EZY B;  1UI9 A;  5A2Q M;  4LCK A;  5ITZ A;  2ALE A;  4IIJ B;  5GAN K;  2KTV A;  2YXZ A;  2V9Y A;  1S72 F;  2HP0 A;  3LWR C;  5KMG A;  4EB6 A;  3M4S A;  5MN5 A;  1VQ5 F;  1YHQ F;  5LOV B;  1PF5 A;  2AIZ P;  3N4Y A;  1VQV A;  4B62 A;  4ZHQ A;  5LP6 A;  1W5A A;  3WJP A;  1RLU A;  2B33 A;  2CSL A;  5HY4 A;  1YIT F;  1YJN F;  1KNK A;  1U3P A;  3JAT B;  5EIB C;  3VCZ A;  3IKE A;  1H47 A;  4I50 B;  1W40 A;  3HKD B;  3S02 A;  5HXZ A;  3NK7 A;  1CLI A;  3CPW F;  3ZO8 A;  3ZP4 A;  5GIO C;  4G4Y A;  3JAK B;  4I55 A;  3ERN A;  3IR9 A;  4WBN A;  1FFX B;  2VAW A;  1U3L A;  4X3L A;  5J2U B;  5HY0 A;  5GON B;  2ZOV A;  4O2B B;  4FFB A;  1OAP A;  1GO1 A;  1FSZ A;  4C4W C;  1VQ8 F;  1DBF A;  3PAF A;  3IEW A;  3FFM A;  5EB0 A;  3OBW A;  1R1M A;  5FNV A;  3HKC A;  4TZZ A;  3CYP B;  3F6M A;  3FD6 A;  5CA0 B;  2H8E A;  3RYI B;  3J81 M;  3V4D A;  3JCM M;  1QVG F;  1JD1 A;  3VO8 A;  4X20 A;  3JAR A;  2JNB A;  2Q1X A;  3RE3 A;  3S06 A;  1VQL F;  4DXD A;  2GLZ A;  5JCO A;  3ZP7 A;  4LNU B;  3LYB A;  3I56 F;  2OZB A;  3RYH B;  3I3F A;  1X52 A;  2R75 1;  4X1I B;  3RYF A;  2I6R A;  3CCQ F;  1Q82 H;  5EAZ A;  3E1Y A;  5LYJ A;  1VQ4 F;  3NVI B;  2HX0 A;  4O4I A;  4IIJ A;  4PWT A;  1IV3 A;  2QTP A;  4O4H A;  2Z1E A;  1VQM F;  1VQK F;  2I6D A;  3P10 A;  2F9Z C;  4X1Y A;  3NVK E;  4YJ3 A;  3JAS A;  2CHS A; 
#chains in the Genus database with same CATH homology
 2AIZ P;  3IMP A;  2MQE A;  3S0H A;  3S0W A;  3KHN A;  4B62 A;  4ZHW A;  4G4V A;  4R40 B;  3WPX A;  2L26 A;  3LDT A;  5EB0 A;  3S0Y A;  4ZHV A;  3TD5 A;  1R1M A;  2KGW A;  2ZVY A;  4B5C A;  2W8B C;  5EB1 B;  5EAZ A;  2LBT A;  3CYP B;  4G4Z A;  2K1S A;  3OON A;  4PWT A;  3S02 A;  3CYQ A;  4G4X A;  2HQS C;  2ZVZ A;  3WPW A;  3S03 A;  4G4Y A;  3TD4 A;  2ZF8 A;  4ZHY B;  3S06 A;  3TD3 A;  4G4W A;  4RHA A;  2LCA A;  4G88 A;  4ERH A;  2ZOV A;  2N48 A;  1OAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...