3WPWA

Structure of pombc5, a periplasmic fragment of pomb from vibrio
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
b'SQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGIVRVSGHTDNRPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PomB
molecule tags Membrane protein
source organism Vibrio alginolyticus
publication title Conformational change in the periplasmic region of the flagellar stator coupled with the assembly around the rotor
pubmed doi rcsb
total genus 48
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3wpwA00
2LCAA 2ZVYA 3S0HA 5EB0A 1OAPA 4RHAA 4ERHA 3OONA 3CYQA 4R40B 3S06A 2KGWA 2L26A 3CYPB 3WPXA 4ZHVA 4G4VA 3S02A 4B5CA 3S03A 3S0YA 4G4ZA 2N48A 4G88A 2LBTA 2MQEA 1R1MA 3KHNA 2HQSC 4G4XA 3TD5A 5EAZA 2W8BC 4ZHYB 4PWTA 2ZF8A 3S0WA 3LDTA 4G4WA 3TD4A 4ZHWA 3WPWA 4G4YA 4B62A 3IMPA 2K1SA 2ZVZA 5EB1B 2ZOVA 3TD3A 2AIZP
chains in the Genus database with same CATH superfamily
2RHHA 2ZAUA 1KNJA 3RYCB 3JAWA 2QEXF 2HP3A 1KD1H 3LYBA 1S72F 2LBXA 4WBNA 3ON1A 3FBAA 4TV8B 4NUTA 2LBTA 5CA1B 3LWVC 1DT9A 2GLZA 3HKEB 4EB6B 3VO8A 4ZHYB 3TD4A 1J7HA 2GVIA 5FJ4C 4O4LB 1TUBA 1W55A 4I50A 2HP0A 3AGKA 4F6RA 5EZYA 2ALEA 5GAPK 3VCZA 4DRXA 5GINC 3VTIC 1ZWZA 1KQSF 3NVKE 1TVKB 1W5BA 3F0DA 3V7QA 2IAFA 3PLAC 1R1MA 1Q82H 4G4XA 4ZK7A 1YJNF 4LCKA 1YI2F 3D01A 3IR9A 2YYEA 3F0EA 2UYNB 4HNAB 3HKCA 5ITZB 1SZQA 5J2UB 3C8LA 5GIOC 3LFOA 3G6EF 5IT9M 2FGYA 4X1KA 5CB4A 3FD6A 4O4LA 2BTUA 5EYPB 5MN5A 1W59A 3MQWA 4G4ZA 4ZI7B 1T0AA 3HJWC 5BMVA 4BVSA 4X1YA 3F0GA 3LWRC 4B46A 4O4IB 3CCVF 2CW4A 2Q1XA 3VIUA 4KWEA 3JAMM 1W581 1VQKF 3CPQA 4IIJB 4WBNB 2VAWA 3CPWF 2LCAA 2UYPA 4I4TA 4ZOLB 4BVQA 2Z1TA 5A2QM 5IJ0B 1VQNF 3DDNA 3M1XA 3GTZA 5EZYB 5LP6C 3C9UA 3T80A 1W57A 2CHSA 2PHNA 2UZHA 4DXDA 4X20A 3CCJF 1TUBB 3FFMA 1W40A 5ITZA 5HP7A 1RQ7A 2HRYA 4F6RB 1PF5A 4O4HB 3VOBA 1NMUB 4ZHWA 4B62A 1M1KH 3K0TA 1IPAA 3N2GA 4X3MA 2AIZP 1OFUA 2I6RA 5FNVA 4YJ2A 1QVFF 3KJJA 3VOAA 2G9IA 4TUYA 1VQ5F 2HVYD 3OONA 4EI7A 5BMVB 4U39A 3I56F 3N2KB 3HKDB 4X1IB 3ERNA 3G71F 3CB2A 4BVTA 5GANK 1QVGF 3IKEA 2UYKA 2IG8A 5J2UA 1K73H 2BTQB 5HXUA 4G4WA 3UT5A 2HS4A 3K14A 3RE3A 3IMPA 5G4VC 2K1SA 4LNUB 1JD1A 3RYIB 4O4JA 4XCQA 5IYZB 1X7OA 4BW0B 3V3TA 4X3LA 1VQ8F 4I55B 4IIJA 2QA4F 2HS0A 3RYFA 4YJ2B 5FNVB 3QTYA 1RQ2A 4TUYB 3MDOA 3JAWB 3JATB 2VGNA 3TD5A 1U3PA 1YIJF 5JVDB 1VQ7F 3J80M 3JVHA 1IV4A 3WJQA 5MN4A 5IJ0A 4IHJA 4TV9B 3LWPC 3S0HA 3CCMF 4BT7A 3DC2A 3ESJA 4M8IA 5HWEA 1PXWA 2VGMA 2FC3A 2KGWA 2L26A 3HKEA 3JARB 3CMEF 5LYJA 3I55F 5DCVA 2N48A 1UI9A 3SIVA 3WGNA 3J81M 4EI8A 1FNKA 3LWQC 2CHTA 5HY2A 3S0WA 3RYCA 3GYQA 4DRXB 3F6MA 4I55A 1VK3A 3JALB 1VQOF 3Q8HA 5J2TB 1Z5VA 1JFFA 4RHAA 5JVDA 3M84A 3UT5B 5EWRA 5GONA 4HNAA 3S06A 3NK7A 3HWUA 2KTVA 3CYPB 4IHJB 3RYIA 3V4DA 2OZBA 3L7QA 2Z1EA 2DT4A 3OBWA 1W2BF 2YXZA 3KIZA 3WXMB 4BT6A 5EAZA 3RYHB 3IEWA 5KMGB 1KNKA 2V9YA 3MCQA 4X1YB 4NQ3A 4O4IA 1VQMF 3WGKA 3G4SF 2RHOA 2HX0A 1X52A 3RYFB 1KC8H 2ZVYA 5LOVA 1GZ0A 5C8YA 2Z1UA 3VMFB 4R40B 4BT3A 3WJRA 1CLIA 1K9MH 4TV9A 4EI9A 5LP6B 1XRGA 1RLGA 3S0YA 1W5EA 3FD5A 1FNJA 2CWJA 2Z1FA 3CC4F 3KE1A 1XV2A 1DBFA 2JNBA 4X1KB 4C8GA 1NQ3A 2AMTA 4ZOLA 3TD3A 5HY0A 2F9ZC 3E20B 5JH7A 5IJ9B 3WGMA 5KMGA 1JY8A 4O2AB 2HRUA 4U3JA 3N2GB 2DYYA 4B5CA 1E7KA 3CD6F 3HTNA 1T0KB 1SA0A 2MQEA 2R6R1 1VQ9F 5AVMA 3KHNA 3E22A 3CCSF 2Q1YA 3JASA 4PWTA 4I4TB 4TZZA 3OW2F 1VQLF 4ZHQA 2CZWA 3N2KA 1ODEA 3K2XA 1COMA 4X1IA 4TV8A 4YJ3A 4BT2A 3VI6A 2CVLA 3NVIB 3GHZA 5IYZA 5EO3A 2B33A 3E1YA 3S03A 3V7EA 4U3JB 2OHWA 3OBYA 2KG4A 2R751 1Q8RA 3I7TA 3C9TA 3VYUC 1YQNA 1IV3A 4RQOA 3K12A 1GO0A 1SA0B 2CSLA 3C9SA 1YITF 5LXTA 2WALA 3I3FA 2ZOVA 2RB9A 3LWOC 5LP6A 3U0OA 3WJPA 3P0ZA 1Q86H 1Q7YH 2AIFA 1FSZA 3RA6A 2EWCA 4I50B 3LMEA 2VAMA 4G4VA 2VAPA 3CMAF 3ELCA 3RA5A 4O2AA 3CC7F 2IQQA 2QI2A 1W5AA 1QAHA 4BT4A 3N4YA 3ZO8A 5HXZA 3VYSC 3HKBB 5JH7B 1IV1A 3CCQF 4ZI7A 5FLXM 1XBIA 1JN1A 3M4SA 3ZP4A 1NJIH 3CC2F 1M90H 1TVKA 1OAPA 4E6EA 2UYJA 1VQ6F 1XHOA 2NMUA 1W42A 3JAKA 3CYQA 3EORA 3CG6A 3JALA 5B8FA 3CCRF 3F0FA 3HKCB 3IKFA 1QD9A 1Z5WA 2H6LA 5J2TA 1JFFB 3B6NA 4G88A 1W41A 3CXCF 1CK2A 4FFBA 5EIBD 4C4WC 3SIUA 5JQGB 2W8BC 1YHQF 1FFXA 5KX5A 1YJWF 1VHAA 1N8RH 5LA6B 1W5FA 3WPWA 3FPIA 5HY4A 4BT5A 3IEQA 3BYQA 4C81A 2RHLA 1VQ4F 1U43A 3JARA 3MCAB 3RYHA 3CCEF 5LYJB 1VH8A 3WGJA 4ERHA 3HAXD 5LXTB 4X20B 1X25A 3P4EA 2OTMA 1CN7A 3KJKA 1IV2A 4O4HA 1ONIA 5GONB 3N4ZA 3HKDA 2HQSC 5HY1A 2LBWA 1RA4A 5LOVB 1GX1A 2PMPA 3LDTA 3ZP7A 4BVRA 1H47A 4FFBB 1U3LA 2BO1A 3HKBA 2H8EA 1X7PA 4EB6A 5JQGA 3QHDA 1UFYA 2I6DA 1Q81H 4LNUA 2RHJA 4NWOB 2BTOA 2GZLA 3C9RA 2KTUA 5CA0A 1VQVA 1U40A 3MBMA 1YJ9F 1H7MA 4O2BA 5GIPC 3O85A 1W3EX 2HP0B 2H8CA 3QUWA 2ZF8A 1H48A 5C8YB 1GO1A 3JAKB 3PAFA 3CCUF 2ZVZA 3JCMM 1YGYA 3WGLA 1SDSA 3NMUC 5JCOA 5EB0A 1FFXB 3D54A 5EIBC 5HP8A 5KX5B 5LA6A 1RLUA 3P10A 3JATA 4BY9D 5CA1A 2UYNA 4ZHQB 4O4JB 3WPXA 4ZHVA 5IJ9A 3S02A 4YJ3B 3D00A 3VYTC 3ZOPA 3JASB 4C8EA 5MN6A 5JCOC 1VQPF 2VXYA 2Z01A 3CCLF 1JJ2F 2ZODA 5EYPA 4B45A 2QTPA 2HS3A 4C8IA 2OTLF 2OTJF 5G4UC 1K8AH 3R0PA 5CA0B 5CB4B 4G4YA 4O2BB 4C82A 1QU9A 3E22B 3J7AR 2P6YA 5EB1B 3NK6A
chains in the Genus database with same CATH topology
2LCAA 2ZVYA 3S0HA 5EB0A 1OAPA 4RHAA 4ERHA 3OONA 3CYQA 4R40B 3S06A 2KGWA 2L26A 3CYPB 3WPXA 4ZHVA 4G4VA 3S02A 4B5CA 3S03A 3S0YA 4G4ZA 2N48A 4G88A 2LBTA 2MQEA 1R1MA 3KHNA 2HQSC 4G4XA 3TD5A 5EAZA 2W8BC 4ZHYB 4PWTA 2ZF8A 3S0WA 3LDTA 4G4WA 3TD4A 4ZHWA 3WPWA 4G4YA 4B62A 3IMPA 2K1SA 2ZVZA 5EB1B 2ZOVA 3TD3A 2AIZP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCA A;  2ZVY A;  3S0H A;  5EB0 A;  1OAP A;  4RHA A;  4ERH A;  3OON A;  3CYQ A;  4R40 B;  3S06 A;  2KGW A;  2L26 A;  3CYP B;  3WPX A;  4ZHV A;  4G4V A;  3S02 A;  4B5C A;  3S03 A;  3S0Y A;  4G4Z A;  2N48 A;  4G88 A;  2LBT A;  2MQE A;  1R1M A;  3KHN A;  2HQS C;  4G4X A;  3TD5 A;  5EAZ A;  2W8B C;  4ZHY B;  4PWT A;  2ZF8 A;  3S0W A;  3LDT A;  4G4W A;  3TD4 A;  4ZHW A;  3WPW A;  4G4Y A;  4B62 A;  3IMP A;  2K1S A;  2ZVZ A;  5EB1 B;  2ZOV A;  3TD3 A;  2AIZ P; 
#chains in the Genus database with same CATH topology
 2RHH A;  2ZAU A;  1KNJ A;  3RYC B;  3JAW A;  2QEX F;  2HP3 A;  1KD1 H;  3LYB A;  1S72 F;  2LBX A;  4WBN A;  3ON1 A;  3FBA A;  4TV8 B;  4NUT A;  2LBT A;  5CA1 B;  3LWV C;  1DT9 A;  2GLZ A;  3HKE B;  4EB6 B;  3VO8 A;  4ZHY B;  3TD4 A;  1J7H A;  2GVI A;  5FJ4 C;  4O4L B;  1TUB A;  1W55 A;  4I50 A;  2HP0 A;  3AGK A;  4F6R A;  5EZY A;  2ALE A;  5GAP K;  3VCZ A;  4DRX A;  5GIN C;  3VTI C;  1ZWZ A;  1KQS F;  3NVK E;  1TVK B;  1W5B A;  3F0D A;  3V7Q A;  2IAF A;  3PLA C;  1R1M A;  1Q82 H;  4G4X A;  4ZK7 A;  1YJN F;  4LCK A;  1YI2 F;  3D01 A;  3IR9 A;  2YYE A;  3F0E A;  2UYN B;  4HNA B;  3HKC A;  5ITZ B;  1SZQ A;  5J2U B;  3C8L A;  5GIO C;  3LFO A;  3G6E F;  5IT9 M;  2FGY A;  4X1K A;  5CB4 A;  3FD6 A;  4O4L A;  2BTU A;  5EYP B;  5MN5 A;  1W59 A;  3MQW A;  4G4Z A;  4ZI7 B;  1T0A A;  3HJW C;  5BMV A;  4BVS A;  4X1Y A;  3F0G A;  3LWR C;  4B46 A;  4O4I B;  3CCV F;  2CW4 A;  2Q1X A;  3VIU A;  4KWE A;  3JAM M;  1W58 1;  1VQK F;  3CPQ A;  4IIJ B;  4WBN B;  2VAW A;  3CPW F;  2LCA A;  2UYP A;  4I4T A;  4ZOL B;  4BVQ A;  2Z1T A;  5A2Q M;  5IJ0 B;  1VQN F;  3DDN A;  3M1X A;  3GTZ A;  5EZY B;  5LP6 C;  3C9U A;  3T80 A;  1W57 A;  2CHS A;  2PHN A;  2UZH A;  4DXD A;  4X20 A;  3CCJ F;  1TUB B;  3FFM A;  1W40 A;  5ITZ A;  5HP7 A;  1RQ7 A;  2HRY A;  4F6R B;  1PF5 A;  4O4H B;  3VOB A;  1NMU B;  4ZHW A;  4B62 A;  1M1K H;  3K0T A;  1IPA A;  3N2G A;  4X3M A;  2AIZ P;  1OFU A;  2I6R A;  5FNV A;  4YJ2 A;  1QVF F;  3KJJ A;  3VOA A;  2G9I A;  4TUY A;  1VQ5 F;  2HVY D;  3OON A;  4EI7 A;  5BMV B;  4U39 A;  3I56 F;  3N2K B;  3HKD B;  4X1I B;  3ERN A;  3G71 F;  3CB2 A;  4BVT A;  5GAN K;  1QVG F;  3IKE A;  2UYK A;  2IG8 A;  5J2U A;  1K73 H;  2BTQ B;  5HXU A;  4G4W A;  3UT5 A;  2HS4 A;  3K14 A;  3RE3 A;  3IMP A;  5G4V C;  2K1S A;  4LNU B;  1JD1 A;  3RYI B;  4O4J A;  4XCQ A;  5IYZ B;  1X7O A;  4BW0 B;  3V3T A;  4X3L A;  1VQ8 F;  4I55 B;  4IIJ A;  2QA4 F;  2HS0 A;  3RYF A;  4YJ2 B;  5FNV B;  3QTY A;  1RQ2 A;  4TUY B;  3MDO A;  3JAW B;  3JAT B;  2VGN A;  3TD5 A;  1U3P A;  1YIJ F;  5JVD B;  1VQ7 F;  3J80 M;  3JVH A;  1IV4 A;  3WJQ A;  5MN4 A;  5IJ0 A;  4IHJ A;  4TV9 B;  3LWP C;  3S0H A;  3CCM F;  4BT7 A;  3DC2 A;  3ESJ A;  4M8I A;  5HWE A;  1PXW A;  2VGM A;  2FC3 A;  2KGW A;  2L26 A;  3HKE A;  3JAR B;  3CME F;  5LYJ A;  3I55 F;  5DCV A;  2N48 A;  1UI9 A;  3SIV A;  3WGN A;  3J81 M;  4EI8 A;  1FNK A;  3LWQ C;  2CHT A;  5HY2 A;  3S0W A;  3RYC A;  3GYQ A;  4DRX B;  3F6M A;  4I55 A;  1VK3 A;  3JAL B;  1VQO F;  3Q8H A;  5J2T B;  1Z5V A;  1JFF A;  4RHA A;  5JVD A;  3M84 A;  3UT5 B;  5EWR A;  5GON A;  4HNA A;  3S06 A;  3NK7 A;  3HWU A;  2KTV A;  3CYP B;  4IHJ B;  3RYI A;  3V4D A;  2OZB A;  3L7Q A;  2Z1E A;  2DT4 A;  3OBW A;  1W2B F;  2YXZ A;  3KIZ A;  3WXM B;  4BT6 A;  5EAZ A;  3RYH B;  3IEW A;  5KMG B;  1KNK A;  2V9Y A;  3MCQ A;  4X1Y B;  4NQ3 A;  4O4I A;  1VQM F;  3WGK A;  3G4S F;  2RHO A;  2HX0 A;  1X52 A;  3RYF B;  1KC8 H;  2ZVY A;  5LOV A;  1GZ0 A;  5C8Y A;  2Z1U A;  3VMF B;  4R40 B;  4BT3 A;  3WJR A;  1CLI A;  1K9M H;  4TV9 A;  4EI9 A;  5LP6 B;  1XRG A;  1RLG A;  3S0Y A;  1W5E A;  3FD5 A;  1FNJ A;  2CWJ A;  2Z1F A;  3CC4 F;  3KE1 A;  1XV2 A;  1DBF A;  2JNB A;  4X1K B;  4C8G A;  1NQ3 A;  2AMT A;  4ZOL A;  3TD3 A;  5HY0 A;  2F9Z C;  3E20 B;  5JH7 A;  5IJ9 B;  3WGM A;  5KMG A;  1JY8 A;  4O2A B;  2HRU A;  4U3J A;  3N2G B;  2DYY A;  4B5C A;  1E7K A;  3CD6 F;  3HTN A;  1T0K B;  1SA0 A;  2MQE A;  2R6R 1;  1VQ9 F;  5AVM A;  3KHN A;  3E22 A;  3CCS F;  2Q1Y A;  3JAS A;  4PWT A;  4I4T B;  4TZZ A;  3OW2 F;  1VQL F;  4ZHQ A;  2CZW A;  3N2K A;  1ODE A;  3K2X A;  1COM A;  4X1I A;  4TV8 A;  4YJ3 A;  4BT2 A;  3VI6 A;  2CVL A;  3NVI B;  3GHZ A;  5IYZ A;  5EO3 A;  2B33 A;  3E1Y A;  3S03 A;  3V7E A;  4U3J B;  2OHW A;  3OBY A;  2KG4 A;  2R75 1;  1Q8R A;  3I7T A;  3C9T A;  3VYU C;  1YQN A;  1IV3 A;  4RQO A;  3K12 A;  1GO0 A;  1SA0 B;  2CSL A;  3C9S A;  1YIT F;  5LXT A;  2WAL A;  3I3F A;  2ZOV A;  2RB9 A;  3LWO C;  5LP6 A;  3U0O A;  3WJP A;  3P0Z A;  1Q86 H;  1Q7Y H;  2AIF A;  1FSZ A;  3RA6 A;  2EWC A;  4I50 B;  3LME A;  2VAM A;  4G4V A;  2VAP A;  3CMA F;  3ELC A;  3RA5 A;  4O2A A;  3CC7 F;  2IQQ A;  2QI2 A;  1W5A A;  1QAH A;  4BT4 A;  3N4Y A;  3ZO8 A;  5HXZ A;  3VYS C;  3HKB B;  5JH7 B;  1IV1 A;  3CCQ F;  4ZI7 A;  5FLX M;  1XBI A;  1JN1 A;  3M4S A;  3ZP4 A;  1NJI H;  3CC2 F;  1M90 H;  1TVK A;  1OAP A;  4E6E A;  2UYJ A;  1VQ6 F;  1XHO A;  2NMU A;  1W42 A;  3JAK A;  3CYQ A;  3EOR A;  3CG6 A;  3JAL A;  5B8F A;  3CCR F;  3F0F A;  3HKC B;  3IKF A;  1QD9 A;  1Z5W A;  2H6L A;  5J2T A;  1JFF B;  3B6N A;  4G88 A;  1W41 A;  3CXC F;  1CK2 A;  4FFB A;  5EIB D;  4C4W C;  3SIU A;  5JQG B;  2W8B C;  1YHQ F;  1FFX A;  5KX5 A;  1YJW F;  1VHA A;  1N8R H;  5LA6 B;  1W5F A;  3WPW A;  3FPI A;  5HY4 A;  4BT5 A;  3IEQ A;  3BYQ A;  4C81 A;  2RHL A;  1VQ4 F;  1U43 A;  3JAR A;  3MCA B;  3RYH A;  3CCE F;  5LYJ B;  1VH8 A;  3WGJ A;  4ERH A;  3HAX D;  5LXT B;  4X20 B;  1X25 A;  3P4E A;  2OTM A;  1CN7 A;  3KJK A;  1IV2 A;  4O4H A;  1ONI A;  5GON B;  3N4Z A;  3HKD A;  2HQS C;  5HY1 A;  2LBW A;  1RA4 A;  5LOV B;  1GX1 A;  2PMP A;  3LDT A;  3ZP7 A;  4BVR A;  1H47 A;  4FFB B;  1U3L A;  2BO1 A;  3HKB A;  2H8E A;  1X7P A;  4EB6 A;  5JQG A;  3QHD A;  1UFY A;  2I6D A;  1Q81 H;  4LNU A;  2RHJ A;  4NWO B;  2BTO A;  2GZL A;  3C9R A;  2KTU A;  5CA0 A;  1VQV A;  1U40 A;  3MBM A;  1YJ9 F;  1H7M A;  4O2B A;  5GIP C;  3O85 A;  1W3E X;  2HP0 B;  2H8C A;  3QUW A;  2ZF8 A;  1H48 A;  5C8Y B;  1GO1 A;  3JAK B;  3PAF A;  3CCU F;  2ZVZ A;  3JCM M;  1YGY A;  3WGL A;  1SDS A;  3NMU C;  5JCO A;  5EB0 A;  1FFX B;  3D54 A;  5EIB C;  5HP8 A;  5KX5 B;  5LA6 A;  1RLU A;  3P10 A;  3JAT A;  4BY9 D;  5CA1 A;  2UYN A;  4ZHQ B;  4O4J B;  3WPX A;  4ZHV A;  5IJ9 A;  3S02 A;  4YJ3 B;  3D00 A;  3VYT C;  3ZOP A;  3JAS B;  4C8E A;  5MN6 A;  5JCO C;  1VQP F;  2VXY A;  2Z01 A;  3CCL F;  1JJ2 F;  2ZOD A;  5EYP A;  4B45 A;  2QTP A;  2HS3 A;  4C8I A;  2OTL F;  2OTJ F;  5G4U C;  1K8A H;  3R0P A;  5CA0 B;  5CB4 B;  4G4Y A;  4O2B B;  4C82 A;  1QU9 A;  3E22 B;  3J7A R;  2P6Y A;  5EB1 B;  3NK6 A; 
#chains in the Genus database with same CATH homology
 2LCA A;  2ZVY A;  3S0H A;  5EB0 A;  1OAP A;  4RHA A;  4ERH A;  3OON A;  3CYQ A;  4R40 B;  3S06 A;  2KGW A;  2L26 A;  3CYP B;  3WPX A;  4ZHV A;  4G4V A;  3S02 A;  4B5C A;  3S03 A;  3S0Y A;  4G4Z A;  2N48 A;  4G88 A;  2LBT A;  2MQE A;  1R1M A;  3KHN A;  2HQS C;  4G4X A;  3TD5 A;  5EAZ A;  2W8B C;  4ZHY B;  4PWT A;  2ZF8 A;  3S0W A;  3LDT A;  4G4W A;  3TD4 A;  4ZHW A;  3WPW A;  4G4Y A;  4B62 A;  3IMP A;  2K1S A;  2ZVZ A;  5EB1 B;  2ZOV A;  3TD3 A;  2AIZ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...