3WPWA

Structure of pombc5, a periplasmic fragment of pomb from vibrio
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
SQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGIVRVSGHTDNRPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PomB
publication title Conformational change in the periplasmic region of the flagellar stator coupled with the assembly around the rotor
pubmed doi rcsb
source organism Vibrio alginolyticus
molecule tags Membrane protein
total genus 48
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3wpwA00
2ZOVA 2HQSC 2ZF8A 4RHAA 4G4YA 4G4VA 3S0WA 2LBTA 2AIZP 2MQEA 3LDTA 4ERHA 3IMPA 1R1MA 4G4ZA 2ZVZA 5EAZA 4B5CA 4ZHVA 3OONA 2ZVYA 4G88A 3TD3A 3CYPB 2W8BC 2N48A 2KGWA 2K1SA 5EB0A 3S06A 3S0HA 3TD4A 2LCAA 3S02A 4PWTA 3S03A 4G4XA 3CYQA 3KHNA 4G4WA 1OAPA 5EB1B 3TD5A 4ZHYB 2L26A 4ZHWA 3S0YA 3WPWA 3WPXA 4R40B 4B62A
chains in the Genus database with same CATH superfamily
4RHAA 1YI2F 1IV2A 2AIZP 3MQWA 1COMA 3I55F 5EAZA 5JH7A 1VQ6F 3QUWA 3KE1A 3RE3A 1VQ8F 5A2QM 5HXZA 3CPQA 2HP0B 3N4YA 3PLAC 3OBYA 4IIJB 1U43A 5LYJB 1TUBA 1VQNF 3S0YA 1DBFA 1FNKA 2YXZA 3LMEA 4X1KB 5ITZB 1W59A 4DXDA 2UYNB 1VQOF 1YITF 1H7MA 1PF5A 4X20A 3JATA 5JQGB 4LCKA 4TV8A 1ODEA 3HKBA 3VTIC 4B5CA 1U3LA 4BT6A 2GZLA 3P10A 4O4HB 5HP7A 3JARA 3I3FA 2Z1EA 2GVIA 1VQ4F 4O4JB 3WGMA 1SZQA 3EORA 3M4SA 1PXWA 3VMFB 4C4WC 4O2BB 3NVKE 2ZODA 4C8IA 2VAPA 1W5EA 3WPWA 5BMVB 4ZOLA 3Q8HA 3RYIB 4G4VA 3K2XA 5LOVB 1JN1A 3N2KB 3VO8A 2CZWA 3JASB 2CHTA 4C81A 1YJNF 3F0EA 1YIJF 2Z1UA 3S06A 3J80M 3FFMA 1T0AA 5JVDA 3CC2F 4X1IB 5IJ0A 3JAMM 2H6LA 3JVHA 3WGJA 2QA4F 4YJ3A 4BT5A 4X1YA 5GONA 5JH7B 3VOAA 5GINC 3E22A 1VH8A 4NWOB 5JCOC 4WBNB 2LBTA 4E6EA 1UFYA 3D54A 4RQOA 5GIPC 1TUBB 3LWQC 2FC3A 4M8IA 4G88A 4B45A 4FFBA 2QEXF 2OTLF 3ESJA 3LWOC 3S02A 4G4XA 3G4SF 1VQVA 3GYQA 1VHAA 4ZI7B 4X20B 3JATB 5EB1B 3HKBB 1RLGA 3U0OA 1W57A 1YJ9F 1QD9A 1SA0A 5J2UA 3NMUC 2ALEA 3K12A 1W55A 1YHQF 3B6NA 3JARB 2I6DA 3CC7F 1YQNA 2UZHA 3VYTC 3ERNA 3HJWC 5EIBD 1Q7YH 3RA6A 2HS0A 1KNJA 1H47A 3VCZA 4I50A 1VQ5F 4ZOLB 3AGKA 3BYQA 3JAKB 3IKEA 4NUTA 1XRGA 4HNAB 3LWRC 4ZHWA 5IYZA 3ELCA 4LNUB 4O2AB 1VQPF 3M1XA 3C9TA 5GIOC 3WJPA 5JVDB 2VXYA 1YGYA 5IJ0B 4BVTA 3LWPC 4BVSA 4YJ3B 2WALA 5GONB 3WJQA 5EB0A 3CCRF 1QAHA 3CG6A 1S72F 2R751 3E22B 1FNJA 3HKCA 3S03A 2KG4A 4U39A 3G71F 3F0DA 2VGMA 1GX1A 3E1YA 1X25A 3CPWF 3JCMM 5GANK 4O4LA 4EI9A 1QVGF 5LP6A 4FFBB 3JALA 2NMUA 5G4UC 3ZP4A 3V7QA 1XBIA 2AIFA 2VAWA 1Q8RA 1JFFB 2HS3A 4C8EA 1RQ7A 4I4TA 3RYCA 1Q86H 1SDSA 1IPAA 3F6MA 3GTZA 3C9UA 1SA0B 5J2UB 1UI9A 1QU9A 3ZOPA 3HKDA 4BT2A 5J2TA 5C8YA 5EZYA 3DC2A 1DT9A 3LFOA 1H48A 1KD1H 3F0GA 5HY1A 5KMGA 4BT3A 4G4YA 2Z1TA 5CA0A 2VGNA 5GAPK 2RHOA 4B46A 2GLZA 2ZVZA 3R0PA 2HX0A 2OZBA 5DCVA 5KX5A 3N4ZA 1K73H 1JD1A 2F9ZC 3I7TA 4EI7A 2BTOA 5IYZB 1XHOA 3IEQA 3S0HA 2KGWA 2K1SA 3CCQF 2KTUA 3CMAF 3PAFA 3LWVC 5MN5A 4O4IA 2RB9A 2L26A 3JAWA 3M84A 3CXCF 3WGKA 1OFUA 5FNVA 4DRXA 4KWEA 1N8RH 3FD5A 3L7QA 1RQ2A 2HRYA 3HKCB 1QVFF 4TV9A 4ERHA 5FJ4C 3FD6A 1FSZA 2LBWA 3NVIB 2IQQA 3RYFA 5HXUA 2ZVYA 2DT4A 3D01A 3RYHA 3ZP7A 2PHNA 2CSLA 3KHNA 3HTNA 1X7PA 1IV4A 3FPIA 3JALB 3KJKA 4G4WA 3OW2F 4TV8B 3IKFA 1U40A 2IG8A 2P6YA 2HP0A 3MBMA 4I4TB 3RYCB 2H8CA 4X3MA 2OTMA 3NK6A 1K8AH 2CHSA 4C82A 2EWCA 2IAFA 4BY9D 5IJ9A 3HKDB 1JY8A 4G4ZA 5C8YB 5EZYB 4EB6A 1M1KH 2DYYA 3C8LA 3WJRA 4U3JA 3C9SA 4I55A 5KMGB 5AVMA 4BT4A 5G4VC 5CA0B 3N2GA 3HKEA 4IHJA 1W41A 3CMEF 1M90H 5LA6A 5KX5B 4B62A 5FLXM 3CB2A 2BTUA 2BTQB 3KIZA 3I56F 4TZZA 3MDOA 1K9MH 3VYUC 2RHLA 4F6RA 3HWUA 1W5AA 3K14A 1R1MA 4NQ3A 3D00A 4O4IB 2Q1YA 5MN4A 3JAWB 1W2BF 2CVLA 3O85A 4X1YB 2R6R1 1YJWF 2I6RA 2AMTA 5FNVB 1IV3A 4PWTA 3CYQA 3JASA 1CN7A 2UYKA 1FFXA 4ZHYB 4TV9B 3V4DA 4X3LA 2OTJF 4X1IA 3ON1A 3RYFB 3KJJA 3IR9A 5EYPA 3CCMF 5HY2A 3RYHB 3S0WA 3WGNA 1NJIH 1U3PA 2JNBA 1W5BA 3MCAB 2Z1FA 2MQEA 2QTPA 2LBXA 1TVKA 2QI2A 3WGLA 1W581 2YYEA 1VQMF 4WBNA 5HP8A 3TD4A 3J81M 3VYSC 4YJ2A 5CA1A 1GZ0A 3P0ZA 5HY0A 5IJ9B 1GO0A 1T0KB 4EB6B 3CCVF 5EWRA 2ZOVA 1J7HA 2ZF8A 4ZHQA 4ZI7A 3QTYA 4U3JB 3LYBA 1W42A 4I55B 4I50B 3LDTA 3V3TA 3CC4F 2B33A 1JJ2F 3N2GB 3SIUA 3HKEB 1CK2A 3OONA 3SIVA 3QHDA 3P4EA 5LP6C 4BVQA 3GHZA 1VQ7F 4IHJB 3TD3A 3CYPB 1X7OA 5LA6B 4BVRA 3K0TA 5LXTA 1VK3A 1E7KA 1W3EX 4F6RB 5JCOA 1OAPA 2HS4A 5CB4A 4TUYA 5B8FA 3CD6F 3UT5A 3F0FA 4BT7A 4R40B 4C8GA 3JAKA 1X52A 1ONIA 3E20B 4HNAA 3G6EF 1NQ3A 1FFXB 4LNUA 3CCJF 4O2AA 1KNKA 4O4LB 2W8BC 1IV1A 3VIUA 2Q1XA 1KQSF 2V9YA 5EYPB 1NMUB 5LP6B 3CCUF 2CW4A 2G9IA 5MN6A 2KTVA 5HY4A 1TVKB 1Q82H 2Z01A 1RA4A 2UYPA 3DDNA 2PMPA 4IIJA 4YJ2B 2RHHA 5LYJA 3J7AR 5CA1B 2UYJA 3T80A 1VQKF 1CLIA 2HVYD 1Z5VA 5J2TB 3CCSF 4X1KA 5ITZA 3VOBA 3VI6A 3OBWA 1XV2A 3MCQA 1Z5WA 2CWJA 5EIBC 2BO1A 1KC8H 3HAXD 5EO3A 2UYNA 2N48A 2H8EA 3RA5A 1Q81H 1RLUA 2LCAA 5JQGA 4ZHQB 1W5FA 2RHJA 1JFFA 1VQ9F 3NK7A 4O4HA 4BW0B 5HWEA 5IT9M 1ZWZA 3FBAA 3WPXA 2OHWA 4O4JA 2HQSC 2ZAUA 2FGYA 3V7EA 3CCLF 3CCEF 3ZO8A 5LXTB 4O2BA 4XCQA 3IMPA 4ZHVA 5BMVA 2HRUA 4TUYB 3RYIA 2VAMA 3UT5B 4ZK7A 5CB4B 5LOVA 3C9RA 3N2KA 1GO1A 4DRXB 2HP3A 3WXMB 4EI8A 3TD5A 3IEWA 1VQLF 1W40A
chains in the Genus database with same CATH topology
2ZOVA 2HQSC 2ZF8A 4RHAA 4G4YA 4G4VA 3S0WA 2LBTA 2AIZP 2MQEA 3LDTA 4ERHA 3IMPA 1R1MA 4G4ZA 2ZVZA 5EAZA 4B5CA 4ZHVA 3OONA 2ZVYA 4G88A 3TD3A 3CYPB 2W8BC 2N48A 2KGWA 2K1SA 5EB0A 3S06A 3S0HA 3TD4A 2LCAA 3S02A 4PWTA 3S03A 4G4XA 3CYQA 3KHNA 4G4WA 1OAPA 5EB1B 3TD5A 4ZHYB 2L26A 4ZHWA 3S0YA 3WPWA 3WPXA 4R40B 4B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOV A;  2HQS C;  2ZF8 A;  4RHA A;  4G4Y A;  4G4V A;  3S0W A;  2LBT A;  2AIZ P;  2MQE A;  3LDT A;  4ERH A;  3IMP A;  1R1M A;  4G4Z A;  2ZVZ A;  5EAZ A;  4B5C A;  4ZHV A;  3OON A;  2ZVY A;  4G88 A;  3TD3 A;  3CYP B;  2W8B C;  2N48 A;  2KGW A;  2K1S A;  5EB0 A;  3S06 A;  3S0H A;  3TD4 A;  2LCA A;  3S02 A;  4PWT A;  3S03 A;  4G4X A;  3CYQ A;  3KHN A;  4G4W A;  1OAP A;  5EB1 B;  3TD5 A;  4ZHY B;  2L26 A;  4ZHW A;  3S0Y A;  3WPW A;  3WPX A;  4R40 B;  4B62 A; 
#chains in the Genus database with same CATH topology
 4RHA A;  1YI2 F;  1IV2 A;  2AIZ P;  3MQW A;  1COM A;  3I55 F;  5EAZ A;  5JH7 A;  1VQ6 F;  3QUW A;  3KE1 A;  3RE3 A;  1VQ8 F;  5A2Q M;  5HXZ A;  3CPQ A;  2HP0 B;  3N4Y A;  3PLA C;  3OBY A;  4IIJ B;  1U43 A;  5LYJ B;  1TUB A;  1VQN F;  3S0Y A;  1DBF A;  1FNK A;  2YXZ A;  3LME A;  4X1K B;  5ITZ B;  1W59 A;  4DXD A;  2UYN B;  1VQO F;  1YIT F;  1H7M A;  1PF5 A;  4X20 A;  3JAT A;  5JQG B;  4LCK A;  4TV8 A;  1ODE A;  3HKB A;  3VTI C;  4B5C A;  1U3L A;  4BT6 A;  2GZL A;  3P10 A;  4O4H B;  5HP7 A;  3JAR A;  3I3F A;  2Z1E A;  2GVI A;  1VQ4 F;  4O4J B;  3WGM A;  1SZQ A;  3EOR A;  3M4S A;  1PXW A;  3VMF B;  4C4W C;  4O2B B;  3NVK E;  2ZOD A;  4C8I A;  2VAP A;  1W5E A;  3WPW A;  5BMV B;  4ZOL A;  3Q8H A;  3RYI B;  4G4V A;  3K2X A;  5LOV B;  1JN1 A;  3N2K B;  3VO8 A;  2CZW A;  3JAS B;  2CHT A;  4C81 A;  1YJN F;  3F0E A;  1YIJ F;  2Z1U A;  3S06 A;  3J80 M;  3FFM A;  1T0A A;  5JVD A;  3CC2 F;  4X1I B;  5IJ0 A;  3JAM M;  2H6L A;  3JVH A;  3WGJ A;  2QA4 F;  4YJ3 A;  4BT5 A;  4X1Y A;  5GON A;  5JH7 B;  3VOA A;  5GIN C;  3E22 A;  1VH8 A;  4NWO B;  5JCO C;  4WBN B;  2LBT A;  4E6E A;  1UFY A;  3D54 A;  4RQO A;  5GIP C;  1TUB B;  3LWQ C;  2FC3 A;  4M8I A;  4G88 A;  4B45 A;  4FFB A;  2QEX F;  2OTL F;  3ESJ A;  3LWO C;  3S02 A;  4G4X A;  3G4S F;  1VQV A;  3GYQ A;  1VHA A;  4ZI7 B;  4X20 B;  3JAT B;  5EB1 B;  3HKB B;  1RLG A;  3U0O A;  1W57 A;  1YJ9 F;  1QD9 A;  1SA0 A;  5J2U A;  3NMU C;  2ALE A;  3K12 A;  1W55 A;  1YHQ F;  3B6N A;  3JAR B;  2I6D A;  3CC7 F;  1YQN A;  2UZH A;  3VYT C;  3ERN A;  3HJW C;  5EIB D;  1Q7Y H;  3RA6 A;  2HS0 A;  1KNJ A;  1H47 A;  3VCZ A;  4I50 A;  1VQ5 F;  4ZOL B;  3AGK A;  3BYQ A;  3JAK B;  3IKE A;  4NUT A;  1XRG A;  4HNA B;  3LWR C;  4ZHW A;  5IYZ A;  3ELC A;  4LNU B;  4O2A B;  1VQP F;  3M1X A;  3C9T A;  5GIO C;  3WJP A;  5JVD B;  2VXY A;  1YGY A;  5IJ0 B;  4BVT A;  3LWP C;  4BVS A;  4YJ3 B;  2WAL A;  5GON B;  3WJQ A;  5EB0 A;  3CCR F;  1QAH A;  3CG6 A;  1S72 F;  2R75 1;  3E22 B;  1FNJ A;  3HKC A;  3S03 A;  2KG4 A;  4U39 A;  3G71 F;  3F0D A;  2VGM A;  1GX1 A;  3E1Y A;  1X25 A;  3CPW F;  3JCM M;  5GAN K;  4O4L A;  4EI9 A;  1QVG F;  5LP6 A;  4FFB B;  3JAL A;  2NMU A;  5G4U C;  3ZP4 A;  3V7Q A;  1XBI A;  2AIF A;  2VAW A;  1Q8R A;  1JFF B;  2HS3 A;  4C8E A;  1RQ7 A;  4I4T A;  3RYC A;  1Q86 H;  1SDS A;  1IPA A;  3F6M A;  3GTZ A;  3C9U A;  1SA0 B;  5J2U B;  1UI9 A;  1QU9 A;  3ZOP A;  3HKD A;  4BT2 A;  5J2T A;  5C8Y A;  5EZY A;  3DC2 A;  1DT9 A;  3LFO A;  1H48 A;  1KD1 H;  3F0G A;  5HY1 A;  5KMG A;  4BT3 A;  4G4Y A;  2Z1T A;  5CA0 A;  2VGN A;  5GAP K;  2RHO A;  4B46 A;  2GLZ A;  2ZVZ A;  3R0P A;  2HX0 A;  2OZB A;  5DCV A;  5KX5 A;  3N4Z A;  1K73 H;  1JD1 A;  2F9Z C;  3I7T A;  4EI7 A;  2BTO A;  5IYZ B;  1XHO A;  3IEQ A;  3S0H A;  2KGW A;  2K1S A;  3CCQ F;  2KTU A;  3CMA F;  3PAF A;  3LWV C;  5MN5 A;  4O4I A;  2RB9 A;  2L26 A;  3JAW A;  3M84 A;  3CXC F;  3WGK A;  1OFU A;  5FNV A;  4DRX A;  4KWE A;  1N8R H;  3FD5 A;  3L7Q A;  1RQ2 A;  2HRY A;  3HKC B;  1QVF F;  4TV9 A;  4ERH A;  5FJ4 C;  3FD6 A;  1FSZ A;  2LBW A;  3NVI B;  2IQQ A;  3RYF A;  5HXU A;  2ZVY A;  2DT4 A;  3D01 A;  3RYH A;  3ZP7 A;  2PHN A;  2CSL A;  3KHN A;  3HTN A;  1X7P A;  1IV4 A;  3FPI A;  3JAL B;  3KJK A;  4G4W A;  3OW2 F;  4TV8 B;  3IKF A;  1U40 A;  2IG8 A;  2P6Y A;  2HP0 A;  3MBM A;  4I4T B;  3RYC B;  2H8C A;  4X3M A;  2OTM A;  3NK6 A;  1K8A H;  2CHS A;  4C82 A;  2EWC A;  2IAF A;  4BY9 D;  5IJ9 A;  3HKD B;  1JY8 A;  4G4Z A;  5C8Y B;  5EZY B;  4EB6 A;  1M1K H;  2DYY A;  3C8L A;  3WJR A;  4U3J A;  3C9S A;  4I55 A;  5KMG B;  5AVM A;  4BT4 A;  5G4V C;  5CA0 B;  3N2G A;  3HKE A;  4IHJ A;  1W41 A;  3CME F;  1M90 H;  5LA6 A;  5KX5 B;  4B62 A;  5FLX M;  3CB2 A;  2BTU A;  2BTQ B;  3KIZ A;  3I56 F;  4TZZ A;  3MDO A;  1K9M H;  3VYU C;  2RHL A;  4F6R A;  3HWU A;  1W5A A;  3K14 A;  1R1M A;  4NQ3 A;  3D00 A;  4O4I B;  2Q1Y A;  5MN4 A;  3JAW B;  1W2B F;  2CVL A;  3O85 A;  4X1Y B;  2R6R 1;  1YJW F;  2I6R A;  2AMT A;  5FNV B;  1IV3 A;  4PWT A;  3CYQ A;  3JAS A;  1CN7 A;  2UYK A;  1FFX A;  4ZHY B;  4TV9 B;  3V4D A;  4X3L A;  2OTJ F;  4X1I A;  3ON1 A;  3RYF B;  3KJJ A;  3IR9 A;  5EYP A;  3CCM F;  5HY2 A;  3RYH B;  3S0W A;  3WGN A;  1NJI H;  1U3P A;  2JNB A;  1W5B A;  3MCA B;  2Z1F A;  2MQE A;  2QTP A;  2LBX A;  1TVK A;  2QI2 A;  3WGL A;  1W58 1;  2YYE A;  1VQM F;  4WBN A;  5HP8 A;  3TD4 A;  3J81 M;  3VYS C;  4YJ2 A;  5CA1 A;  1GZ0 A;  3P0Z A;  5HY0 A;  5IJ9 B;  1GO0 A;  1T0K B;  4EB6 B;  3CCV F;  5EWR A;  2ZOV A;  1J7H A;  2ZF8 A;  4ZHQ A;  4ZI7 A;  3QTY A;  4U3J B;  3LYB A;  1W42 A;  4I55 B;  4I50 B;  3LDT A;  3V3T A;  3CC4 F;  2B33 A;  1JJ2 F;  3N2G B;  3SIU A;  3HKE B;  1CK2 A;  3OON A;  3SIV A;  3QHD A;  3P4E A;  5LP6 C;  4BVQ A;  3GHZ A;  1VQ7 F;  4IHJ B;  3TD3 A;  3CYP B;  1X7O A;  5LA6 B;  4BVR A;  3K0T A;  5LXT A;  1VK3 A;  1E7K A;  1W3E X;  4F6R B;  5JCO A;  1OAP A;  2HS4 A;  5CB4 A;  4TUY A;  5B8F A;  3CD6 F;  3UT5 A;  3F0F A;  4BT7 A;  4R40 B;  4C8G A;  3JAK A;  1X52 A;  1ONI A;  3E20 B;  4HNA A;  3G6E F;  1NQ3 A;  1FFX B;  4LNU A;  3CCJ F;  4O2A A;  1KNK A;  4O4L B;  2W8B C;  1IV1 A;  3VIU A;  2Q1X A;  1KQS F;  2V9Y A;  5EYP B;  1NMU B;  5LP6 B;  3CCU F;  2CW4 A;  2G9I A;  5MN6 A;  2KTV A;  5HY4 A;  1TVK B;  1Q82 H;  2Z01 A;  1RA4 A;  2UYP A;  3DDN A;  2PMP A;  4IIJ A;  4YJ2 B;  2RHH A;  5LYJ A;  3J7A R;  5CA1 B;  2UYJ A;  3T80 A;  1VQK F;  1CLI A;  2HVY D;  1Z5V A;  5J2T B;  3CCS F;  4X1K A;  5ITZ A;  3VOB A;  3VI6 A;  3OBW A;  1XV2 A;  3MCQ A;  1Z5W A;  2CWJ A;  5EIB C;  2BO1 A;  1KC8 H;  3HAX D;  5EO3 A;  2UYN A;  2N48 A;  2H8E A;  3RA5 A;  1Q81 H;  1RLU A;  2LCA A;  5JQG A;  4ZHQ B;  1W5F A;  2RHJ A;  1JFF A;  1VQ9 F;  3NK7 A;  4O4H A;  4BW0 B;  5HWE A;  5IT9 M;  1ZWZ A;  3FBA A;  3WPX A;  2OHW A;  4O4J A;  2HQS C;  2ZAU A;  2FGY A;  3V7E A;  3CCL F;  3CCE F;  3ZO8 A;  5LXT B;  4O2B A;  4XCQ A;  3IMP A;  4ZHV A;  5BMV A;  2HRU A;  4TUY B;  3RYI A;  2VAM A;  3UT5 B;  4ZK7 A;  5CB4 B;  5LOV A;  3C9R A;  3N2K A;  1GO1 A;  4DRX B;  2HP3 A;  3WXM B;  4EI8 A;  3TD5 A;  3IEW A;  1VQL F;  1W40 A; 
#chains in the Genus database with same CATH homology
 2ZOV A;  2HQS C;  2ZF8 A;  4RHA A;  4G4Y A;  4G4V A;  3S0W A;  2LBT A;  2AIZ P;  2MQE A;  3LDT A;  4ERH A;  3IMP A;  1R1M A;  4G4Z A;  2ZVZ A;  5EAZ A;  4B5C A;  4ZHV A;  3OON A;  2ZVY A;  4G88 A;  3TD3 A;  3CYP B;  2W8B C;  2N48 A;  2KGW A;  2K1S A;  5EB0 A;  3S06 A;  3S0H A;  3TD4 A;  2LCA A;  3S02 A;  4PWT A;  3S03 A;  4G4X A;  3CYQ A;  3KHN A;  4G4W A;  1OAP A;  5EB1 B;  3TD5 A;  4ZHY B;  2L26 A;  4ZHW A;  3S0Y A;  3WPW A;  3WPX A;  4R40 B;  4B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...