3WPWA

Structure of pombc5, a periplasmic fragment of pomb from vibrio
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
SQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGIVRVSGHTDNRPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational change in the periplasmic region of the flagellar stator coupled with the assembly around the rotor
pubmed doi rcsb
source organism Vibrio alginolyticus
molecule tags Membrane protein
molecule keywords PomB
total genus 48
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3wpwA00
4G88A 3TD3A 3KHNA 3CYQA 5EB0A 3S03A 2MQEA 3CYPB 4RHAA 2LCAA 3S06A 3S0WA 4B62A 4G4YA 2HQSC 2ZOVA 4ZHWA 3S0YA 1OAPA 4G4WA 3LDTA 3WPWA 4G4XA 1R1MA 4R40B 4ERHA 2ZVYA 2K1SA 2N48A 2ZVZA 5EB1B 4ZHVA 4PWTA 4ZHYB 3TD5A 2ZF8A 4B5CA 2KGWA 2AIZP 2LBTA 3TD4A 3WPXA 3IMPA 3S0HA 2L26A 5EAZA 4G4VA 4G4ZA 3OONA 2W8BC 3S02A
chains in the Genus database with same CATH superfamily
1H7MA 5LP6B 3KE1A 3E20B 2Q1XA 3FBAA 4IIJA 4ZI7B 1JY8A 3M1XA 1YJ9F 3NVKE 2ZOVA 2HRUA 5CA1A 1W2BF 1IV4A 3WGNA 5GONA 5IYZB 1KNJA 5HY0A 1VQ4F 4BT6A 1K73H 3V4DA 4EI9A 3JASB 2LBTA 4TV8A 4LNUB 4BT7A 5EIBC 4BY9D 5JCOA 2VXYA 3HAXD 1CN7A 1W581 1UI9A 3C9RA 2H8CA 4B45A 4WBNA 2P6YA 2R6R1 4G4YA 3S0YA 3KJJA 4EB6B 1Q82H 4O4JB 2NMUA 3WPWA 3LWVC 4X20B 4G4XA 4EB6A 2DYYA 2VAMA 1X7PA 3G71F 4PWTA 4WBNB 1RLUA 5IJ9A 4I55A 3N2GA 3HKBB 4TUYB 3CCLF 4ZOLB 3EORA 1VQNF 3JCMM 5HXZA 3ZOPA 1DT9A 5GINC 2Z1FA 2HS0A 1VQLF 2BTUA 3OONA 1PF5A 3JARB 3GHZA 4ZHQA 1TVKA 3DC2A 3IKFA 3VIUA 3G6EF 3NVIB 1W55A 3VO8A 3KIZA 3LWRC 1YI2F 1VQ9F 3K14A 3I3FA 1TUBB 2N48A 3LWPC 4IIJB 4ZI7A 3J80M 1QU9A 1U3LA 3WGLA 1W5EA 2GVIA 1K8AH 4M8IA 1XRGA 1Z5WA 1CK2A 2HS3A 5HP7A 1GX1A 1K9MH 4C8EA 3LFOA 5IT9M 5GAPK 3HKEA 2MQEA 3MCQA 3VYUC 3QHDA 4X3MA 1JFFB 3RYIB 1YQNA 3F0EA 5LXTB 1VK3A 4DRXA 3Q8HA 5IJ0A 5JH7B 3VTIC 1Q8RA 5C8YA 3CD6F 2UYJA 4F6RB 2KTVA 5EO3A 3N2KB 4BVQA 1JJ2F 5EZYB 4O2AB 3M84A 3KHNA 3CYQA 5ITZB 3S06A 2UYNB 5KX5A 4NQ3A 3ELCA 5CA0A 1R1MA 2YXZA 3G4SF 4R40B 3LMEA 1W5BA 4O4LA 3L7QA 3ZP4A 4ZHQB 3WGJA 2Z1TA 3QTYA 2G9IA 5ITZA 4IHJB 3N2GB 2QA4F 4YJ2B 3K12A 2HVYD 5IJ9B 1KQSF 4O4HB 5LOVB 2PMPA 4G4ZA 3LWOC 1KC8H 3CMAF 3JAKA 5CB4B 3JVHA 3VCZA 1NJIH 4O4IB 2Z1EA 3OBYA 5LP6A 4RHAA 2LCAA 4X1KB 2WALA 3KJKA 3V7QA 1YIJF 1T0AA 5MN4A 4O4IA 3JATA 3JALA 5JH7A 5AVMA 1SA0A 2BTOA 5LOVA 5EYPB 5B8FA 2KG4A 2HX0A 2CVLA 5HY4A 3M4SA 3UT5B 4ZHYB 3CCUF 1Q81H 3N4YA 1JFFA 2RB9A 2OZBA 1YHQF 5LA6B 2GLZA 3JALB 2I6DA 5HXUA 5HWEA 1VQ7F 5EAZA 1E7KA 1XBIA 3E1YA 4G4VA 4I4TB 1VQKF 4XCQA 3RE3A 5G4VC 3J7AR 3AGKA 1RLGA 2RHOA 3JASA 2VAWA 3FFMA 2HP0A 2VAPA 3IKEA 1QVGF 4B62A 3ZO8A 3VYTC 4O2BA 1RA4A 3OW2F 5EZYA 1XHOA 2DT4A 3NMUC 4BT3A 3CCVF 3VYSC 3SIUA 4FFBA 3CPWF 1JD1A 3WPXA 5CA0B 1VQPF 1VH8A 2Z1UA 3IR9A 2OTJF 3GYQA 3JARA 3CPQA 5LA6A 3CB2A 1KD1H 3F0FA 3E22B 4TUYA 1X25A 3HKBA 3WJPA 1Q86H 3P0ZA 2OTLF 3GTZA 3ZP7A 3HKDB 4HNAB 1W42A 5J2UA 1VQMF 2HP3A 4BT2A 5FLXM 3ESJA 1YJWF 1U3PA 3MQWA 2AIZP 2CSLA 1XV2A 3S0HA 3HTNA 4IHJA 4BT5A 3NK7A 5BMVA 3LWQC 3WJRA 3F6MA 3R0PA 5FNVA 3MCAB 1RQ2A 2CHTA 1DBFA 2VGNA 4LNUA 5J2TB 5FNVB 3CG6A 3LDTA 4ZK7A 1W40A 3P10A 1FSZA 4LCKA 4FFBB 2ZVZA 4BW0B 1U40A 3TD5A 5GIOC 4E6EA 5J2UB 4O2BB 1X52A 2QEXF 5JQGA 1J7HA 3V7EA 4BVRA 2H8EA 3ON1A 1FFXB 3U0OA 5C8YB 2UYKA 3K2XA 3D54A 1Z5VA 5EIBD 4DXDA 3TD3A 3SIVA 5EB0A 3WXMB 1IPAA 1ODEA 5LYJA 3BYQA 3S0WA 2HQSC 3V3TA 5KMGB 5JVDA 4I55B 2K1SA 3CCMF 4ZHVA 1GZ0A 2FC3A 2ZODA 1SDSA 2JNBA 1VHAA 2UYPA 3OBWA 3TD4A 3O85A 4O4HA 2AIFA 4HNAA 1VQ5F 3PAFA 1T0KB 4C4WC 3CYPB 3I7TA 5LP6C 1FNKA 3N4ZA 4EI8A 5HY1A 4YJ2A 1OAPA 1COMA 2Z01A 4X1YA 3WGMA 2UYNA 3MBMA 1X7OA 3CCRF 5J2TA 1RQ7A 2YYEA 5CA1B 1UFYA 2OTMA 5BMVB 3VMFB 4TZZA 1W5FA 3RYCA 1GO1A 4X1YB 4BT4A 3CC4F 4I50B 3S02A 3UT5A 1U43A 2HP0B 3MDOA 1SA0B 5A2QM 3RYFB 4YJ3B 3T80A 1Q7YH 4X20A 3JAKB 3DDNA 3N2KA 5EWRA 5CB4A 4O4JA 1QD9A 5IJ0B 1FFXA 4DRXB 3WGKA 4F6RA 4I4TA 4KWEA 3F0DA 4I50A 1FNJA 2F9ZC 2FGYA 3RYCB 1IV2A 3C9TA 4B46A 3RYFA 2ZF8A 4B5CA 2KGWA 5HY2A 2BO1A 5HP8A 1OFUA 2CWJA 3D00A 5JVDB 2BTQB 4U39A 2CW4A 5KMGA 4EI7A 4X1KA 3CMEF 4X3LA 4O4LB 3J81M 1M1KH 2V9YA 4TV9A 2UZHA 2CHSA 2I6RA 4BVTA 3NK6A 2QI2A 3CXCF 4O2AA 1TVKB 3RA5A 3WJQA 3JAMM 2IAFA 1VQ8F 4TV9B 3VOBA 1W41A 1N8RH 2IQQA 1GO0A 1W59A 4C82A 2L26A 1YJNF 2VGMA 5KX5B 1H48A 2HRYA 4X1IB 1IV1A 4RQOA 5LXTA 5GANK 1VQ6F 3RYHA 1VQVA 2R751 3HWUA 4ZHWA 3HJWC 3JAWB 1QVFF 2KTUA 1VQOF 1S72F 5MN5A 3VOAA 3HKEB 2ZVYA 2HS4A 3HKDA 4C8IA 3CC7F 5LYJB 5JQGB 1YITF 2QTPA 1ONIA 1PXWA 1TUBA 1W5AA 3IEWA 4YJ3A 1ZWZA 3IMPA 3JAWA 5DCVA 5JCOC 3RYHB 1W57A 3CC2F 1IV3A 1SZQA 3D01A 3RYIA 4G88A 3K0TA 2ZAUA 1H47A 1KNKA 3S03A 1NMUB 3CCSF 5G4UC 3I55F 3B6NA 3VI6A 4G4WA 1YGYA 5FJ4C 2PHNA 3C9UA 3I56F 5GONB 5IYZA 5MN6A 3C8LA 2RHLA 2H6LA 3HKCB 4NWOB 2RHJA 3P4EA 4ZOLA 3CCEF 2OHWA 1NQ3A 3QUWA 2LBXA 2Q1YA 2W8BC 3FD5A 4U3JA 3RA6A 3CCQF 2AMTA 4C81A 3E22A 2RHHA 3FD6A 3PLAC 1QAHA 3CCJF 4NUTA 4C8GA 1W3EX 5EYPA 2CZWA 3F0GA 4ERHA 4TV8B 4X1IA 5EB1B 1M90H 4U3JB 1CLIA 1JN1A 3FPIA 3ERNA 3IEQA 3C9SA 2GZLA 2IG8A 2LBWA 2ALEA 2B33A 3HKCA 3JATB 4BVSA 3LYBA 5GIPC 2EWCA
chains in the Genus database with same CATH topology
4G88A 3TD3A 3KHNA 3CYQA 5EB0A 3S03A 2MQEA 3CYPB 4RHAA 2LCAA 3S06A 3S0WA 4B62A 4G4YA 2HQSC 2ZOVA 4ZHWA 3S0YA 1OAPA 4G4WA 3LDTA 3WPWA 4G4XA 1R1MA 4R40B 4ERHA 2ZVYA 2K1SA 2N48A 2ZVZA 5EB1B 4ZHVA 4PWTA 4ZHYB 3TD5A 2ZF8A 4B5CA 2KGWA 2AIZP 2LBTA 3TD4A 3WPXA 3IMPA 3S0HA 2L26A 5EAZA 4G4VA 4G4ZA 3OONA 2W8BC 3S02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G88 A;  3TD3 A;  3KHN A;  3CYQ A;  5EB0 A;  3S03 A;  2MQE A;  3CYP B;  4RHA A;  2LCA A;  3S06 A;  3S0W A;  4B62 A;  4G4Y A;  2HQS C;  2ZOV A;  4ZHW A;  3S0Y A;  1OAP A;  4G4W A;  3LDT A;  3WPW A;  4G4X A;  1R1M A;  4R40 B;  4ERH A;  2ZVY A;  2K1S A;  2N48 A;  2ZVZ A;  5EB1 B;  4ZHV A;  4PWT A;  4ZHY B;  3TD5 A;  2ZF8 A;  4B5C A;  2KGW A;  2AIZ P;  2LBT A;  3TD4 A;  3WPX A;  3IMP A;  3S0H A;  2L26 A;  5EAZ A;  4G4V A;  4G4Z A;  3OON A;  2W8B C;  3S02 A; 
#chains in the Genus database with same CATH topology
 1H7M A;  5LP6 B;  3KE1 A;  3E20 B;  2Q1X A;  3FBA A;  4IIJ A;  4ZI7 B;  1JY8 A;  3M1X A;  1YJ9 F;  3NVK E;  2ZOV A;  2HRU A;  5CA1 A;  1W2B F;  1IV4 A;  3WGN A;  5GON A;  5IYZ B;  1KNJ A;  5HY0 A;  1VQ4 F;  4BT6 A;  1K73 H;  3V4D A;  4EI9 A;  3JAS B;  2LBT A;  4TV8 A;  4LNU B;  4BT7 A;  5EIB C;  4BY9 D;  5JCO A;  2VXY A;  3HAX D;  1CN7 A;  1W58 1;  1UI9 A;  3C9R A;  2H8C A;  4B45 A;  4WBN A;  2P6Y A;  2R6R 1;  4G4Y A;  3S0Y A;  3KJJ A;  4EB6 B;  1Q82 H;  4O4J B;  2NMU A;  3WPW A;  3LWV C;  4X20 B;  4G4X A;  4EB6 A;  2DYY A;  2VAM A;  1X7P A;  3G71 F;  4PWT A;  4WBN B;  1RLU A;  5IJ9 A;  4I55 A;  3N2G A;  3HKB B;  4TUY B;  3CCL F;  4ZOL B;  3EOR A;  1VQN F;  3JCM M;  5HXZ A;  3ZOP A;  1DT9 A;  5GIN C;  2Z1F A;  2HS0 A;  1VQL F;  2BTU A;  3OON A;  1PF5 A;  3JAR B;  3GHZ A;  4ZHQ A;  1TVK A;  3DC2 A;  3IKF A;  3VIU A;  3G6E F;  3NVI B;  1W55 A;  3VO8 A;  3KIZ A;  3LWR C;  1YI2 F;  1VQ9 F;  3K14 A;  3I3F A;  1TUB B;  2N48 A;  3LWP C;  4IIJ B;  4ZI7 A;  3J80 M;  1QU9 A;  1U3L A;  3WGL A;  1W5E A;  2GVI A;  1K8A H;  4M8I A;  1XRG A;  1Z5W A;  1CK2 A;  2HS3 A;  5HP7 A;  1GX1 A;  1K9M H;  4C8E A;  3LFO A;  5IT9 M;  5GAP K;  3HKE A;  2MQE A;  3MCQ A;  3VYU C;  3QHD A;  4X3M A;  1JFF B;  3RYI B;  1YQN A;  3F0E A;  5LXT B;  1VK3 A;  4DRX A;  3Q8H A;  5IJ0 A;  5JH7 B;  3VTI C;  1Q8R A;  5C8Y A;  3CD6 F;  2UYJ A;  4F6R B;  2KTV A;  5EO3 A;  3N2K B;  4BVQ A;  1JJ2 F;  5EZY B;  4O2A B;  3M84 A;  3KHN A;  3CYQ A;  5ITZ B;  3S06 A;  2UYN B;  5KX5 A;  4NQ3 A;  3ELC A;  5CA0 A;  1R1M A;  2YXZ A;  3G4S F;  4R40 B;  3LME A;  1W5B A;  4O4L A;  3L7Q A;  3ZP4 A;  4ZHQ B;  3WGJ A;  2Z1T A;  3QTY A;  2G9I A;  5ITZ A;  4IHJ B;  3N2G B;  2QA4 F;  4YJ2 B;  3K12 A;  2HVY D;  5IJ9 B;  1KQS F;  4O4H B;  5LOV B;  2PMP A;  4G4Z A;  3LWO C;  1KC8 H;  3CMA F;  3JAK A;  5CB4 B;  3JVH A;  3VCZ A;  1NJI H;  4O4I B;  2Z1E A;  3OBY A;  5LP6 A;  4RHA A;  2LCA A;  4X1K B;  2WAL A;  3KJK A;  3V7Q A;  1YIJ F;  1T0A A;  5MN4 A;  4O4I A;  3JAT A;  3JAL A;  5JH7 A;  5AVM A;  1SA0 A;  2BTO A;  5LOV A;  5EYP B;  5B8F A;  2KG4 A;  2HX0 A;  2CVL A;  5HY4 A;  3M4S A;  3UT5 B;  4ZHY B;  3CCU F;  1Q81 H;  3N4Y A;  1JFF A;  2RB9 A;  2OZB A;  1YHQ F;  5LA6 B;  2GLZ A;  3JAL B;  2I6D A;  5HXU A;  5HWE A;  1VQ7 F;  5EAZ A;  1E7K A;  1XBI A;  3E1Y A;  4G4V A;  4I4T B;  1VQK F;  4XCQ A;  3RE3 A;  5G4V C;  3J7A R;  3AGK A;  1RLG A;  2RHO A;  3JAS A;  2VAW A;  3FFM A;  2HP0 A;  2VAP A;  3IKE A;  1QVG F;  4B62 A;  3ZO8 A;  3VYT C;  4O2B A;  1RA4 A;  3OW2 F;  5EZY A;  1XHO A;  2DT4 A;  3NMU C;  4BT3 A;  3CCV F;  3VYS C;  3SIU A;  4FFB A;  3CPW F;  1JD1 A;  3WPX A;  5CA0 B;  1VQP F;  1VH8 A;  2Z1U A;  3IR9 A;  2OTJ F;  3GYQ A;  3JAR A;  3CPQ A;  5LA6 A;  3CB2 A;  1KD1 H;  3F0F A;  3E22 B;  4TUY A;  1X25 A;  3HKB A;  3WJP A;  1Q86 H;  3P0Z A;  2OTL F;  3GTZ A;  3ZP7 A;  3HKD B;  4HNA B;  1W42 A;  5J2U A;  1VQM F;  2HP3 A;  4BT2 A;  5FLX M;  3ESJ A;  1YJW F;  1U3P A;  3MQW A;  2AIZ P;  2CSL A;  1XV2 A;  3S0H A;  3HTN A;  4IHJ A;  4BT5 A;  3NK7 A;  5BMV A;  3LWQ C;  3WJR A;  3F6M A;  3R0P A;  5FNV A;  3MCA B;  1RQ2 A;  2CHT A;  1DBF A;  2VGN A;  4LNU A;  5J2T B;  5FNV B;  3CG6 A;  3LDT A;  4ZK7 A;  1W40 A;  3P10 A;  1FSZ A;  4LCK A;  4FFB B;  2ZVZ A;  4BW0 B;  1U40 A;  3TD5 A;  5GIO C;  4E6E A;  5J2U B;  4O2B B;  1X52 A;  2QEX F;  5JQG A;  1J7H A;  3V7E A;  4BVR A;  2H8E A;  3ON1 A;  1FFX B;  3U0O A;  5C8Y B;  2UYK A;  3K2X A;  3D54 A;  1Z5V A;  5EIB D;  4DXD A;  3TD3 A;  3SIV A;  5EB0 A;  3WXM B;  1IPA A;  1ODE A;  5LYJ A;  3BYQ A;  3S0W A;  2HQS C;  3V3T A;  5KMG B;  5JVD A;  4I55 B;  2K1S A;  3CCM F;  4ZHV A;  1GZ0 A;  2FC3 A;  2ZOD A;  1SDS A;  2JNB A;  1VHA A;  2UYP A;  3OBW A;  3TD4 A;  3O85 A;  4O4H A;  2AIF A;  4HNA A;  1VQ5 F;  3PAF A;  1T0K B;  4C4W C;  3CYP B;  3I7T A;  5LP6 C;  1FNK A;  3N4Z A;  4EI8 A;  5HY1 A;  4YJ2 A;  1OAP A;  1COM A;  2Z01 A;  4X1Y A;  3WGM A;  2UYN A;  3MBM A;  1X7O A;  3CCR F;  5J2T A;  1RQ7 A;  2YYE A;  5CA1 B;  1UFY A;  2OTM A;  5BMV B;  3VMF B;  4TZZ A;  1W5F A;  3RYC A;  1GO1 A;  4X1Y B;  4BT4 A;  3CC4 F;  4I50 B;  3S02 A;  3UT5 A;  1U43 A;  2HP0 B;  3MDO A;  1SA0 B;  5A2Q M;  3RYF B;  4YJ3 B;  3T80 A;  1Q7Y H;  4X20 A;  3JAK B;  3DDN A;  3N2K A;  5EWR A;  5CB4 A;  4O4J A;  1QD9 A;  5IJ0 B;  1FFX A;  4DRX B;  3WGK A;  4F6R A;  4I4T A;  4KWE A;  3F0D A;  4I50 A;  1FNJ A;  2F9Z C;  2FGY A;  3RYC B;  1IV2 A;  3C9T A;  4B46 A;  3RYF A;  2ZF8 A;  4B5C A;  2KGW A;  5HY2 A;  2BO1 A;  5HP8 A;  1OFU A;  2CWJ A;  3D00 A;  5JVD B;  2BTQ B;  4U39 A;  2CW4 A;  5KMG A;  4EI7 A;  4X1K A;  3CME F;  4X3L A;  4O4L B;  3J81 M;  1M1K H;  2V9Y A;  4TV9 A;  2UZH A;  2CHS A;  2I6R A;  4BVT A;  3NK6 A;  2QI2 A;  3CXC F;  4O2A A;  1TVK B;  3RA5 A;  3WJQ A;  3JAM M;  2IAF A;  1VQ8 F;  4TV9 B;  3VOB A;  1W41 A;  1N8R H;  2IQQ A;  1GO0 A;  1W59 A;  4C82 A;  2L26 A;  1YJN F;  2VGM A;  5KX5 B;  1H48 A;  2HRY A;  4X1I B;  1IV1 A;  4RQO A;  5LXT A;  5GAN K;  1VQ6 F;  3RYH A;  1VQV A;  2R75 1;  3HWU A;  4ZHW A;  3HJW C;  3JAW B;  1QVF F;  2KTU A;  1VQO F;  1S72 F;  5MN5 A;  3VOA A;  3HKE B;  2ZVY A;  2HS4 A;  3HKD A;  4C8I A;  3CC7 F;  5LYJ B;  5JQG B;  1YIT F;  2QTP A;  1ONI A;  1PXW A;  1TUB A;  1W5A A;  3IEW A;  4YJ3 A;  1ZWZ A;  3IMP A;  3JAW A;  5DCV A;  5JCO C;  3RYH B;  1W57 A;  3CC2 F;  1IV3 A;  1SZQ A;  3D01 A;  3RYI A;  4G88 A;  3K0T A;  2ZAU A;  1H47 A;  1KNK A;  3S03 A;  1NMU B;  3CCS F;  5G4U C;  3I55 F;  3B6N A;  3VI6 A;  4G4W A;  1YGY A;  5FJ4 C;  2PHN A;  3C9U A;  3I56 F;  5GON B;  5IYZ A;  5MN6 A;  3C8L A;  2RHL A;  2H6L A;  3HKC B;  4NWO B;  2RHJ A;  3P4E A;  4ZOL A;  3CCE F;  2OHW A;  1NQ3 A;  3QUW A;  2LBX A;  2Q1Y A;  2W8B C;  3FD5 A;  4U3J A;  3RA6 A;  3CCQ F;  2AMT A;  4C81 A;  3E22 A;  2RHH A;  3FD6 A;  3PLA C;  1QAH A;  3CCJ F;  4NUT A;  4C8G A;  1W3E X;  5EYP A;  2CZW A;  3F0G A;  4ERH A;  4TV8 B;  4X1I A;  5EB1 B;  1M90 H;  4U3J B;  1CLI A;  1JN1 A;  3FPI A;  3ERN A;  3IEQ A;  3C9S A;  2GZL A;  2IG8 A;  2LBW A;  2ALE A;  2B33 A;  3HKC A;  3JAT B;  4BVS A;  3LYB A;  5GIP C;  2EWC A; 
#chains in the Genus database with same CATH homology
 4G88 A;  3TD3 A;  3KHN A;  3CYQ A;  5EB0 A;  3S03 A;  2MQE A;  3CYP B;  4RHA A;  2LCA A;  3S06 A;  3S0W A;  4B62 A;  4G4Y A;  2HQS C;  2ZOV A;  4ZHW A;  3S0Y A;  1OAP A;  4G4W A;  3LDT A;  3WPW A;  4G4X A;  1R1M A;  4R40 B;  4ERH A;  2ZVY A;  2K1S A;  2N48 A;  2ZVZ A;  5EB1 B;  4ZHV A;  4PWT A;  4ZHY B;  3TD5 A;  2ZF8 A;  4B5C A;  2KGW A;  2AIZ P;  2LBT A;  3TD4 A;  3WPX A;  3IMP A;  3S0H A;  2L26 A;  5EAZ A;  4G4V A;  4G4Z A;  3OON A;  2W8B C;  3S02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...