3WPWA

Structure of pombc5, a periplasmic fragment of pomb from vibrio
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
SQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGIVRVSGHTDNRPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational change in the periplasmic region of the flagellar stator coupled with the assembly around the rotor
pubmed doi rcsb
source organism Vibrio alginolyticus
molecule tags Membrane protein
molecule keywords PomB
total genus 48
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3wpwA00
2W8BC 4PWTA 3S0YA 2ZF8A 4B62A 4ZHWA 2N48A 3LDTA 2ZVYA 3WPWA 2AIZP 1OAPA 2MQEA 3S0WA 2ZVZA 5EAZA 2LBTA 3KHNA 3TD3A 5EB1B 4ZHVA 3IMPA 3TD4A 4G4XA 4RHAA 2ZOVA 4B5CA 3TD5A 3S03A 4ERHA 4G4YA 4G4ZA 3WPXA 5EB0A 3S0HA 2L26A 4R40B 4G88A 3CYQA 4ZHYB 3CYPB 3S02A 2LCAA 3OONA 4G4VA 2KGWA 3S06A 1R1MA 4G4WA 2HQSC 2K1SA
chains in the Genus database with same CATH superfamily
1YJ9F 3F0EA 4I55A 2UYNB 1OAPA 3F0FA 5MN5A 3N2KA 2ZVZA 4TUYA 3RYIB 2B33A 3TD4A 1W40A 2CVLA 4IHJB 1QD9A 1W5BA 1RA4A 5GIOC 3AGKA 4B45A 3N2KB 2OTJF 3C8LA 1W41A 1X7OA 3G6EF 2L26A 2HX0A 2ZODA 2KG4A 4EB6A 3DC2A 3RYHB 3VOBA 1GX1A 1RLGA 3LWOC 1K8AH 2RHOA 3UT5A 1FSZA 5FNVA 1XHOA 3CCUF 3IKFA 4WBNA 3WGJA 3J80M 2WALA 3HKBA 4ZI7A 3JAWB 5MN4A 4ZOLA 2LBTA 3LWVC 2CHSA 3C9UA 3UT5B 5IT9M 5EIBD 2CW4A 3HTNA 2FGYA 5KMGA 2VAPA 3M84A 4ERHA 2UYJA 4F6RA 3V7QA 4G88A 3WGKA 1VH8A 1VQ4F 1T0AA 2YXZA 5EYPB 3CCLF 1JN1A 3OONA 3JCMM 3QUWA 4G4WA 4NWOB 2F9ZC 4TV8A 2BO1A 4FFBB 3M1XA 3ERNA 3FBAA 3QHDA 2ZVYA 3K0TA 3V3TA 3G4SF 4LCKA 3CXCF 4O4JA 1YQNA 1DT9A 3KHNA 5HWEA 3I3FA 4RHAA 2RHHA 3FPIA 2RB9A 1KNJA 2HS3A 1YI2F 3JARA 1VQ5F 4C81A 1UFYA 5CB4B 1M90H 2HS4A 5EYPA 1W3EX 2CWJA 3FD5A 5J2TB 4TV9A 3NMUC 5JQGB 1VQ9F 3WPWA 4YJ3A 5EAZA 1CN7A 3R0PA 4O4IA 3JAKB 5HY2A 4O4JB 2ZOVA 4BT4A 3CMAF 3N2GB 2DT4A 1ZWZA 4HNAA 5FNVB 1Q86H 5EO3A 5JH7B 2DYYA 3S02A 4O4IB 3CCJF 3CMEF 3CCSF 3MCAB 4I50A 3RA6A 2BTQB 3VMFB 3S0YA 2ZAUA 5JH7A 1VQPF 3E22A 4X3MA 3RYCA 1KNKA 4X1YB 3ZP7A 3CG6A 3IMPA 3O85A 4U3JB 1OFUA 3J7AR 3VYTC 5JCOC 3RYFA 2Z01A 5LOVA 2R751 3WGLA 3M4SA 2ALEA 2QA4F 5CA1A 3CCVF 1KD1H 4DXDA 1VK3A 1XBIA 1ODEA 5CA0A 3PAFA 3RYFB 3VCZA 4B46A 4YJ2B 2GLZA 4U3JA 2HVYD 2UYPA 2G9IA 3LDTA 3JASB 1FFXA 2FC3A 3CCMF 3ZP4A 1VQKF 4O2AA 4E6EA 3HKDB 2LBWA 3ON1A 2V9YA 1KQSF 2RHJA 1QVGF 3MCQA 5LA6B 1TUBA 2IAFA 5EZYB 5JQGA 2Q1YA 1COMA 3NK6A 1YJWF 2UZHA 3DDNA 3HWUA 3CD6F 2LCAA 1W5EA 2HP3A 4BT7A 1QAHA 4G4VA 2Z1FA 4X1IA 3ZOPA 3D54A 1JFFA 4C8IA 4BT2A 1XV2A 5GONA 5G4VC 5JVDA 3LMEA 3GYQA 2IG8A 2OHWA 3OBYA 4X20A 3B6NA 5JCOA 3CC4F 5JVDB 5GONB 1ONIA 5ITZA 4R40B 3F0DA 5IYZB 3RYIA 3VIUA 4C82A 5G4UC 5HXZA 4X1YA 3HKCA 2GZLA 5LYJB 4EI7A 3LYBA 1CK2A 4XCQA 3JALA 3IEQA 2UYKA 3JVHA 5C8YA 2HRYA 5GIPC 2HS0A 3U0OA 2MQEA 2BTOA 5EWRA 3C9RA 3TD3A 1GO0A 2PHNA 3MQWA 5LOVB 1NQ3A 5KX5B 3HKCB 5LYJA 1U3LA 3I56F 3V7EA 4U39A 4WBNB 5FJ4C 1Z5VA 5HP7A 3E22B 3KIZA 3K14A 4O4LA 4NQ3A 2KTUA 2RHLA 5J2UB 2QEXF 2KGWA 1U43A 3S06A 3CCQF 5GINC 5EZYA 4PWTA 3D00A 4B62A 2OZBA 3GHZA 1W42A 1W55A 3WGNA 4KWEA 3VYSC 4O4LB 3HKBB 4ZI7B 5IJ0B 1FNJA 2VGNA 3WXMB 2H8CA 4BVTA 3IR9A 4YJ2A 4G4ZA 3G71F 1GO1A 4O4HB 1DBFA 5LP6B 2NMUA 3E20B 2IQQA 3CYPB 2H6LA 5KMGB 1Q7YH 3RA5A 2HP0B 3KJJA 1NMUB 1M1KH 5AVMA 1H7MA 3ZO8A 5DCVA 3RYCB 4BY9D 1RQ2A 3P10A 5EB1B 3OBWA 4BW0B 4B5CA 1PXWA 3RYHA 1SA0B 3EORA 5LP6C 4BVQA 4C8EA 2VXYA 2Z1UA 4BT5A 4O2BA 4EI8A 1Q82H 3CYQA 1TVKA 4EI9A 5BMVA 3S0HA 1X52A 2K1SA 3JARB 5A2QM 1RQ7A 4IIJB 5KX5A 1IV2A 2Z1TA 5BMVB 5HY1A 4C8GA 3KE1A 3PLAC 2HRUA 3NVKE 2LBXA 2VAMA 3I7TA 3L7QA 3WJRA 1GZ0A 1IV4A 1U3PA 3FD6A 4F6RB 2YYEA 5J2UA 2I6DA 1JJ2F 3WPXA 4I4TA 4FFBA 2GVIA 2QI2A 4M8IA 2OTLF 4BVSA 1K73H 1R1MA 2HQSC 3BYQA 3LFOA 3HKEA 3CPQA 3J81M 1W57A 2CSLA 4NUTA 2AIZP 3ELCA 5LA6A 3CPWF 3F6MA 3HAXD 5C8YB 1S72F 4ZHVA 5LP6A 4G4XA 5LXTB 3VTIC 3FFMA 3ESJA 3S03A 3N4YA 3N4ZA 3QTYA 4X1IB 3VI6A 5HXUA 4BVRA 5ITZB 5EIBC 4O2BB 1SDSA 1U40A 1UI9A 3Q8HA 3IEWA 3C9TA 5CA1B 3SIVA 3JALB 1VQOF 3WJQA 3OW2F 1YHQF 2H8EA 1W5FA 1VQ8F 4C4WC 1VQ6F 5IJ0A 2HP0A 5HP8A 1RLUA 4TZZA 4BT3A 3NK7A 2UYNA 2AMTA 1Z5WA 2I6RA 2KTVA 4LNUA 4O4HA 4EB6B 1IPAA 5B8FA 1T0KB 3F0GA 3MDOA 3CC2F 3WGMA 1YJNF 3RE3A 4ZHQA 1QU9A 5J2TA 1K9MH 2CZWA 4HNAB 2P6YA 2ZF8A 4ZOLB 3LWQC 1NJIH 1VQMF 3JAWA 5FLXM 3VOAA 5MN6A 4X3LA 4ZK7A 1CLIA 2EWCA 1TVKB 5HY4A 3CB2A 1FNKA 4DRXA 1H48A 2Q1XA 3E1YA 4I55B 3JAKA 1W59A 3JAMM 4X20B 3WJPA 4YJ3B 3C9SA 3VO8A 1E7KA 5EB0A 4RQOA 2OTMA 3LWPC 3JATB 3NVIB 3CCRF 1VQ7F 3LWRC 3P4EA 1W5AA 3K12A 4O2AB 1VQLF 4IHJA 3D01A 5IYZA 3JASA 4IIJA 5LXTA 3IKEA 3CC7F 4X1KB 1W2BF 3S0WA 1Q8RA 1N8RH 5IJ9A 1H47A 4I50B 5GANK 1TUBB 1KC8H 3GTZA 2VAWA 1Q81H 1IV1A 3HKEB 3SIUA 4G4YA 2VGMA 1IV3A 4X1KA 2JNBA 5CB4A 3K2XA 3HJWC 4ZHYB 4I4TB 1JFFB 1J7HA 2Z1EA 3JATA 1X25A 4BT6A 2PMPA 2W8BC 4ZHWA 5CA0B 2N48A 1XRGA 1SA0A 1YGYA 4LNUB 5IJ9B 3KJKA 1VHAA 1JY8A 1W581 1QVFF 1PF5A 2CHTA 3P0ZA 4TV8B 4TV9B 1JD1A 2R6R1 3HKDA 3T80A 4DRXB 3TD5A 5HY0A 3I55F 3CCEF 1FFXB 2AIFA 1YITF 3N2GA 3MBMA 1VQVA 3V4DA 4ZHQB 2BTUA 3VYUC 2QTPA 5GAPK 4TUYB 1X7PA 1VQNF 1SZQA 1YIJF
chains in the Genus database with same CATH topology
2W8BC 4PWTA 3S0YA 2ZF8A 4B62A 4ZHWA 2N48A 3LDTA 2ZVYA 3WPWA 2AIZP 1OAPA 2MQEA 3S0WA 2ZVZA 5EAZA 2LBTA 3KHNA 3TD3A 5EB1B 4ZHVA 3IMPA 3TD4A 4G4XA 4RHAA 2ZOVA 4B5CA 3TD5A 3S03A 4ERHA 4G4YA 4G4ZA 3WPXA 5EB0A 3S0HA 2L26A 4R40B 4G88A 3CYQA 4ZHYB 3CYPB 3S02A 2LCAA 3OONA 4G4VA 2KGWA 3S06A 1R1MA 4G4WA 2HQSC 2K1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8B C;  4PWT A;  3S0Y A;  2ZF8 A;  4B62 A;  4ZHW A;  2N48 A;  3LDT A;  2ZVY A;  3WPW A;  2AIZ P;  1OAP A;  2MQE A;  3S0W A;  2ZVZ A;  5EAZ A;  2LBT A;  3KHN A;  3TD3 A;  5EB1 B;  4ZHV A;  3IMP A;  3TD4 A;  4G4X A;  4RHA A;  2ZOV A;  4B5C A;  3TD5 A;  3S03 A;  4ERH A;  4G4Y A;  4G4Z A;  3WPX A;  5EB0 A;  3S0H A;  2L26 A;  4R40 B;  4G88 A;  3CYQ A;  4ZHY B;  3CYP B;  3S02 A;  2LCA A;  3OON A;  4G4V A;  2KGW A;  3S06 A;  1R1M A;  4G4W A;  2HQS C;  2K1S A; 
#chains in the Genus database with same CATH topology
 1YJ9 F;  3F0E A;  4I55 A;  2UYN B;  1OAP A;  3F0F A;  5MN5 A;  3N2K A;  2ZVZ A;  4TUY A;  3RYI B;  2B33 A;  3TD4 A;  1W40 A;  2CVL A;  4IHJ B;  1QD9 A;  1W5B A;  1RA4 A;  5GIO C;  3AGK A;  4B45 A;  3N2K B;  2OTJ F;  3C8L A;  1W41 A;  1X7O A;  3G6E F;  2L26 A;  2HX0 A;  2ZOD A;  2KG4 A;  4EB6 A;  3DC2 A;  3RYH B;  3VOB A;  1GX1 A;  1RLG A;  3LWO C;  1K8A H;  2RHO A;  3UT5 A;  1FSZ A;  5FNV A;  1XHO A;  3CCU F;  3IKF A;  4WBN A;  3WGJ A;  3J80 M;  2WAL A;  3HKB A;  4ZI7 A;  3JAW B;  5MN4 A;  4ZOL A;  2LBT A;  3LWV C;  2CHS A;  3C9U A;  3UT5 B;  5IT9 M;  5EIB D;  2CW4 A;  3HTN A;  2FGY A;  5KMG A;  2VAP A;  3M84 A;  4ERH A;  2UYJ A;  4F6R A;  3V7Q A;  4G88 A;  3WGK A;  1VH8 A;  1VQ4 F;  1T0A A;  2YXZ A;  5EYP B;  3CCL F;  1JN1 A;  3OON A;  3JCM M;  3QUW A;  4G4W A;  4NWO B;  2F9Z C;  4TV8 A;  2BO1 A;  4FFB B;  3M1X A;  3ERN A;  3FBA A;  3QHD A;  2ZVY A;  3K0T A;  3V3T A;  3G4S F;  4LCK A;  3CXC F;  4O4J A;  1YQN A;  1DT9 A;  3KHN A;  5HWE A;  3I3F A;  4RHA A;  2RHH A;  3FPI A;  2RB9 A;  1KNJ A;  2HS3 A;  1YI2 F;  3JAR A;  1VQ5 F;  4C81 A;  1UFY A;  5CB4 B;  1M90 H;  2HS4 A;  5EYP A;  1W3E X;  2CWJ A;  3FD5 A;  5J2T B;  4TV9 A;  3NMU C;  5JQG B;  1VQ9 F;  3WPW A;  4YJ3 A;  5EAZ A;  1CN7 A;  3R0P A;  4O4I A;  3JAK B;  5HY2 A;  4O4J B;  2ZOV A;  4BT4 A;  3CMA F;  3N2G B;  2DT4 A;  1ZWZ A;  4HNA A;  5FNV B;  1Q86 H;  5EO3 A;  5JH7 B;  2DYY A;  3S02 A;  4O4I B;  3CCJ F;  3CME F;  3CCS F;  3MCA B;  4I50 A;  3RA6 A;  2BTQ B;  3VMF B;  3S0Y A;  2ZAU A;  5JH7 A;  1VQP F;  3E22 A;  4X3M A;  3RYC A;  1KNK A;  4X1Y B;  3ZP7 A;  3CG6 A;  3IMP A;  3O85 A;  4U3J B;  1OFU A;  3J7A R;  3VYT C;  5JCO C;  3RYF A;  2Z01 A;  5LOV A;  2R75 1;  3WGL A;  3M4S A;  2ALE A;  2QA4 F;  5CA1 A;  3CCV F;  1KD1 H;  4DXD A;  1VK3 A;  1XBI A;  1ODE A;  5CA0 A;  3PAF A;  3RYF B;  3VCZ A;  4B46 A;  4YJ2 B;  2GLZ A;  4U3J A;  2HVY D;  2UYP A;  2G9I A;  3LDT A;  3JAS B;  1FFX A;  2FC3 A;  3CCM F;  3ZP4 A;  1VQK F;  4O2A A;  4E6E A;  3HKD B;  2LBW A;  3ON1 A;  2V9Y A;  1KQS F;  2RHJ A;  1QVG F;  3MCQ A;  5LA6 B;  1TUB A;  2IAF A;  5EZY B;  5JQG A;  2Q1Y A;  1COM A;  3NK6 A;  1YJW F;  2UZH A;  3DDN A;  3HWU A;  3CD6 F;  2LCA A;  1W5E A;  2HP3 A;  4BT7 A;  1QAH A;  4G4V A;  2Z1F A;  4X1I A;  3ZOP A;  3D54 A;  1JFF A;  4C8I A;  4BT2 A;  1XV2 A;  5GON A;  5G4V C;  5JVD A;  3LME A;  3GYQ A;  2IG8 A;  2OHW A;  3OBY A;  4X20 A;  3B6N A;  5JCO A;  3CC4 F;  5JVD B;  5GON B;  1ONI A;  5ITZ A;  4R40 B;  3F0D A;  5IYZ B;  3RYI A;  3VIU A;  4C82 A;  5G4U C;  5HXZ A;  4X1Y A;  3HKC A;  2GZL A;  5LYJ B;  4EI7 A;  3LYB A;  1CK2 A;  4XCQ A;  3JAL A;  3IEQ A;  2UYK A;  3JVH A;  5C8Y A;  2HRY A;  5GIP C;  2HS0 A;  3U0O A;  2MQE A;  2BTO A;  5EWR A;  3C9R A;  3TD3 A;  1GO0 A;  2PHN A;  3MQW A;  5LOV B;  1NQ3 A;  5KX5 B;  3HKC B;  5LYJ A;  1U3L A;  3I56 F;  3V7E A;  4U39 A;  4WBN B;  5FJ4 C;  1Z5V A;  5HP7 A;  3E22 B;  3KIZ A;  3K14 A;  4O4L A;  4NQ3 A;  2KTU A;  2RHL A;  5J2U B;  2QEX F;  2KGW A;  1U43 A;  3S06 A;  3CCQ F;  5GIN C;  5EZY A;  4PWT A;  3D00 A;  4B62 A;  2OZB A;  3GHZ A;  1W42 A;  1W55 A;  3WGN A;  4KWE A;  3VYS C;  4O4L B;  3HKB B;  4ZI7 B;  5IJ0 B;  1FNJ A;  2VGN A;  3WXM B;  2H8C A;  4BVT A;  3IR9 A;  4YJ2 A;  4G4Z A;  3G71 F;  1GO1 A;  4O4H B;  1DBF A;  5LP6 B;  2NMU A;  3E20 B;  2IQQ A;  3CYP B;  2H6L A;  5KMG B;  1Q7Y H;  3RA5 A;  2HP0 B;  3KJJ A;  1NMU B;  1M1K H;  5AVM A;  1H7M A;  3ZO8 A;  5DCV A;  3RYC B;  4BY9 D;  1RQ2 A;  3P10 A;  5EB1 B;  3OBW A;  4BW0 B;  4B5C A;  1PXW A;  3RYH A;  1SA0 B;  3EOR A;  5LP6 C;  4BVQ A;  4C8E A;  2VXY A;  2Z1U A;  4BT5 A;  4O2B A;  4EI8 A;  1Q82 H;  3CYQ A;  1TVK A;  4EI9 A;  5BMV A;  3S0H A;  1X52 A;  2K1S A;  3JAR B;  5A2Q M;  1RQ7 A;  4IIJ B;  5KX5 A;  1IV2 A;  2Z1T A;  5BMV B;  5HY1 A;  4C8G A;  3KE1 A;  3PLA C;  2HRU A;  3NVK E;  2LBX A;  2VAM A;  3I7T A;  3L7Q A;  3WJR A;  1GZ0 A;  1IV4 A;  1U3P A;  3FD6 A;  4F6R B;  2YYE A;  5J2U A;  2I6D A;  1JJ2 F;  3WPX A;  4I4T A;  4FFB A;  2GVI A;  2QI2 A;  4M8I A;  2OTL F;  4BVS A;  1K73 H;  1R1M A;  2HQS C;  3BYQ A;  3LFO A;  3HKE A;  3CPQ A;  3J81 M;  1W57 A;  2CSL A;  4NUT A;  2AIZ P;  3ELC A;  5LA6 A;  3CPW F;  3F6M A;  3HAX D;  5C8Y B;  1S72 F;  4ZHV A;  5LP6 A;  4G4X A;  5LXT B;  3VTI C;  3FFM A;  3ESJ A;  3S03 A;  3N4Y A;  3N4Z A;  3QTY A;  4X1I B;  3VI6 A;  5HXU A;  4BVR A;  5ITZ B;  5EIB C;  4O2B B;  1SDS A;  1U40 A;  1UI9 A;  3Q8H A;  3IEW A;  3C9T A;  5CA1 B;  3SIV A;  3JAL B;  1VQO F;  3WJQ A;  3OW2 F;  1YHQ F;  2H8E A;  1W5F A;  1VQ8 F;  4C4W C;  1VQ6 F;  5IJ0 A;  2HP0 A;  5HP8 A;  1RLU A;  4TZZ A;  4BT3 A;  3NK7 A;  2UYN A;  2AMT A;  1Z5W A;  2I6R A;  2KTV A;  4LNU A;  4O4H A;  4EB6 B;  1IPA A;  5B8F A;  1T0K B;  3F0G A;  3MDO A;  3CC2 F;  3WGM A;  1YJN F;  3RE3 A;  4ZHQ A;  1QU9 A;  5J2T A;  1K9M H;  2CZW A;  4HNA B;  2P6Y A;  2ZF8 A;  4ZOL B;  3LWQ C;  1NJI H;  1VQM F;  3JAW A;  5FLX M;  3VOA A;  5MN6 A;  4X3L A;  4ZK7 A;  1CLI A;  2EWC A;  1TVK B;  5HY4 A;  3CB2 A;  1FNK A;  4DRX A;  1H48 A;  2Q1X A;  3E1Y A;  4I55 B;  3JAK A;  1W59 A;  3JAM M;  4X20 B;  3WJP A;  4YJ3 B;  3C9S A;  3VO8 A;  1E7K A;  5EB0 A;  4RQO A;  2OTM A;  3LWP C;  3JAT B;  3NVI B;  3CCR F;  1VQ7 F;  3LWR C;  3P4E A;  1W5A A;  3K12 A;  4O2A B;  1VQL F;  4IHJ A;  3D01 A;  5IYZ A;  3JAS A;  4IIJ A;  5LXT A;  3IKE A;  3CC7 F;  4X1K B;  1W2B F;  3S0W A;  1Q8R A;  1N8R H;  5IJ9 A;  1H47 A;  4I50 B;  5GAN K;  1TUB B;  1KC8 H;  3GTZ A;  2VAW A;  1Q81 H;  1IV1 A;  3HKE B;  3SIU A;  4G4Y A;  2VGM A;  1IV3 A;  4X1K A;  2JNB A;  5CB4 A;  3K2X A;  3HJW C;  4ZHY B;  4I4T B;  1JFF B;  1J7H A;  2Z1E A;  3JAT A;  1X25 A;  4BT6 A;  2PMP A;  2W8B C;  4ZHW A;  5CA0 B;  2N48 A;  1XRG A;  1SA0 A;  1YGY A;  4LNU B;  5IJ9 B;  3KJK A;  1VHA A;  1JY8 A;  1W58 1;  1QVF F;  1PF5 A;  2CHT A;  3P0Z A;  4TV8 B;  4TV9 B;  1JD1 A;  2R6R 1;  3HKD A;  3T80 A;  4DRX B;  3TD5 A;  5HY0 A;  3I55 F;  3CCE F;  1FFX B;  2AIF A;  1YIT F;  3N2G A;  3MBM A;  1VQV A;  3V4D A;  4ZHQ B;  2BTU A;  3VYU C;  2QTP A;  5GAP K;  4TUY B;  1X7P A;  1VQN F;  1SZQ A;  1YIJ F; 
#chains in the Genus database with same CATH homology
 2W8B C;  4PWT A;  3S0Y A;  2ZF8 A;  4B62 A;  4ZHW A;  2N48 A;  3LDT A;  2ZVY A;  3WPW A;  2AIZ P;  1OAP A;  2MQE A;  3S0W A;  2ZVZ A;  5EAZ A;  2LBT A;  3KHN A;  3TD3 A;  5EB1 B;  4ZHV A;  3IMP A;  3TD4 A;  4G4X A;  4RHA A;  2ZOV A;  4B5C A;  3TD5 A;  3S03 A;  4ERH A;  4G4Y A;  4G4Z A;  3WPX A;  5EB0 A;  3S0H A;  2L26 A;  4R40 B;  4G88 A;  3CYQ A;  4ZHY B;  3CYP B;  3S02 A;  2LCA A;  3OON A;  4G4V A;  2KGW A;  3S06 A;  1R1M A;  4G4W A;  2HQS C;  2K1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...